1LAMA

Leucine aminopeptidase (unligated)
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
484
structure length
484
Chain Sequence
TKGLVLGIYSKEKEEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LEUCINE AMINOPEPTIDASE
publication title Two-metal ion mechanism of bovine lens leucine aminopeptidase: active site solvent structure and binding mode of L-leucinal, a gem-diolate transition state analogue, by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase (alpha-aminoacylpeptide)
total genus 174
structure length 484
sequence length 484
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 1995-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1lamA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1lamA02
1AMPA 2IJZA 3NFZA 4PPZA 2RB7A 4MCPA 5HXDA 3FH4A 4P45A 1Y7EA 3EJGA 3SIHA 1IGBA 2XEGA 1EE3P 4J5SA 5CB3A 2DX6A 2C6CA 2ABZA 4JLLA 2AFWA 3Q6ZA 4UIBA 3IO1A 2V8HA 4PXEA 5ELYA 3PBEA 5D29A 4JYWA 3NA6A 3V2BA 3SI0A 2PJ4A 3V38A 1KWMA 1ZG9A 4NGRA 4D86A 1TXRA 4F9UA 2PJ3A 4P10A 3KQXA 4ZYQA 1NJRA 4F9VA 1CP6A 3H8FA 4ZY1A 4EMEA 4ZX9A 4J4ZA 3BI1A 2AFMA 1YW6A 4UEFA 1XMBA 3H8EA 2JEWA 3FECA 5J1QA 4MRIA 1XBUA 5FSZA 4LQGA 5CB5A 4ZY0A 2PIYA 3D68A 2BOAA 3NH5A 2AFUA 3PFEA 4ETKA 3ISXA 2WZNA 3B3VA 1Z5RA 3Q71A 5DS0A 3LMSA 3K2KA 2GU2A 4FBEA 2XEIA 2HC9A 3FMCA 2C6PA 1YLOA 3B3CA 3RBUA 2ACFA 4NGQA 3B35A 4MHZA 2PVWA 3S9LA 2JBJA 4PQAA 4WWVA 4JCAA 2PJAA 3FJUA 2PJ7A 4GM5A 3IEHA 2BO9A 2QYVA 1LCPA 2XEJA 4FWUA 4NGTA 3SIGA 1YD9A 2F8HA 2Q51A 4P4EA 3WC6A 2G9DA 3SIJA 1PYTB 2PJBA 4UMLA 2PJ8A 3CPXA 8CPAA 2PJ9A 3NH4A 1GYTA 3IWWA 3JZTA 4DYOA 1TKHA 2BFRA 4JGKA 1ELMP 1XRYA 2POKA 2V8GA 1F57A 2AFOA 4Q7AA 3GB0A 4OC2A 2Q43A 2BCOA 4K3NA 1CPSA 5HVFA 4R6TA 3V7ZA 3KR5A 1R3NA 3IFEA 4MHPA 4A94A 4ETJA 4IHMA 3KASA 2EWBA 2L8RA 4P44A 2IMOA 2FXKA 1OBRA 1Z2LA 3VATA 1TF8A 4PXCA 3FEEA 2ZEFA 2V8VA 4OIWA 1XJOA 3KL9A 5E3BA 3DLJA 2AFCA 4GUAA 3GLJA 4KYBA 3SJFA 3KQZA 3HUVA 1HDQA 4F8ZA 6CPAA 5HVHA 2CIJA 1Y0RA 4OMEA 5D8NA 5IB9A 2AFZA 2O53A 2GLFA 2JBKA 2QJ8A 4UEEA 3BI0A 3GQOA 1Y0YA 2ZEMA 3MN8A 2NSMA 5LRGA 3TX8A 1CBXA 4NJRA 2CTBA 3SI1A 3QNVA 3RZAA 1VGYA 1ZLHA 4P6YA 3EJFA 4BD9A 2AFXA 1BPNA 1YSJA 3SJXA 5FSYA 3KI9A 1HDUA 1PCAA 4A38A 4MCSA 4GVWA 3VH9A 3GPGA 3IC1A 4EFDA 1DTDA 3PB8X 3PB7X 1F2PA 2PJCA 4ONWA 2PRQA 4IK2A 3D66A 4TU0A 4R7MA 4G1PA 3KR4A 4YWYA 3H8GA 1SPVA 2ZEHA 2ZELA 1UWYA 5FSVA 2EK8A 3VFQA 2X47A 3T8WA 1NSAA 2GREA 4P4JA 3B3SA 4ABKA 4WJBA 5FSXA 3IIBA 2OR4A 2ZEDA 3L2NA 2RFHA 3S9MA 3KGQA 4AXVA 3PB6X 4P4FA 1YW4A 3BXMA 1Q7LA 5K8NA 3KZWA 2C1CA 4YU9A 3TC8A 4MMOA 1ZG7A 4P4DA 2CF4A 3D7GA 4IAVA 4PXDA 1YMEA 4TWEA 3B3TA 5FSUA 3D7FA 1VHEA 2PJ5A 2CTCA 3D67A 1LOKA 4MCRA 5CMSA 1ZR5A 3FVLA 2GLJA 4ZX8A 5LYDA 1CX8A 4JZ0A 2QVPA 4RUHA 5K8MA 4X2TA 2HB6A 1VIXA 3K9TA 4OP4A 3SJGA 4NGMA 4K0CA 1ARLA 5THWA 4B6ZA 3PB9X 5CBMA 7CPAA 4A37A 4X3RA 4P4IA 2VL1A 1R43A 4OC0A 4PXBA 3GPQA 5DUSA 3D4UA 4OC3A 1VHOA 4NGPA 4DJLA 5F09A 5HIHA 2I3CA 4JVVA 4IQYA 4TNUA 5I4MA 3EWPA 4ZY2A 5JM6A 3GQEA 4MXUA 1ZR3A 3B2YA 4H2KA 3S9NA 3WC7A 5HOLA 2IQ6A 2FG1A 2ZEOA 4O23A 1LAMA 3GPOA 2WYRA 1LANA 2PE3A 4Z65A 4R76A 2FVGA 4MHYA 1ELLP 2ANPA 2J9AA 3B7IA 3BHXA 1DE4C 4MHNA 1XFOA 3VARA 4NGNA 2Q4ZA 5LRJA 2OOTA 3IJ3A 1FT7A 4MCQA 3D7DA 5LYIA 1AYEA 4OC4A 3PB4X 4ZI6A 3CDXA 5LYLA 1FNOA 5JGFA 1ZLIA 5LRKA 1CP7A 5AILA 1TF9A 3WT4A 2BFQA 1LFWA 2PJ0A 1TKJA 3N5FA 2PCUA 4P4BA 3RAMA 1QQ9A 3IIDA 4NFRA 4NGSA 3CPAA 1H8LA 2ZOFA 3EWQA 1CPXA 4ESSA 2ZEPA 4UIAA 2EK9A 5HVGA 2LGRA 1BAVA 1TKFA 1BLLE 3DGVA 4J5RA 1HEEA 2V8DA 1TXZA 1ZG8A 3KHXA 3WABA 3FEDA 3EKEA 1M4LA 2C6GA 4W9YA 2PJ6A 1HJZA 4UF4A 5JH9A 5LYFA 4OKOA 2FAVA 2PVVA 3JRUA 2PIZA 1QMUA 3PFOA 2EEEA 3EWRA 3FX6A 3PBBA 2XEFA 3ISZA 5K8OA 3WC5A 3SJEA 3D7HA 1Z8LA 2DEAA 4OC1A 3KHZA 3IIFA 3NH8A 3CT9A 3SIIA 5CPAA 2XD7A 1LAPA 3MRUA 4OC5A 2VRIA 3B3WA 1JQGA 4FUUA 3EWOA 2F7VA 4FAIA 2PJ2A 1RTQA 3GUXA 4NJQA 1BPMA 3LWUA 2ZENA 3EW5A 4R8FA 1VHUA 2O4HA 3HLPA 1F2OA 5K8PA 1CG2A 3PRTA 4J5QA 4UEZA 3ETIA 2AFSA 2V77A 4ABLA 3PEIA 3SI2A 3V45A 2PJ1A 1TY8A 4KSIA 2ZEGA 2ZEEA 3I1UA 4OIDA 1IY7A 1ARMA 4EWTA 3FF3A 4GVVA 4A39A 2ZOGA 4DUKA 2NYQA 4CPAA 4X8IA
chains in the Genus database with same CATH superfamily
1AMPA 2IJZA 4KOYA 3R9GA 2PQ8A 3NFZA 2B58A 3RAMA 4PPZA 3FYNA 4AG9A 2RB7A 4CGNA 1ON0A 2Y0MA 4MCPA 4R57A 2RNKA 3C26A 4XPDB 3FH4A 5HXDA 1QSMA 4P45A 1Y7EA 4UFXA 2PC1A 4KOUA 3EJGA 3SIHA 1IGBA 2XEGA 1U6MA 4Q38A 2JZEA 1EE3P 3R96A 4IUSA 3TTHA 4J5SA 5CB3A 2FIAA 2DX6A 1R57A 2C6CA 4UFVA 2ABZA 3R1KA 1Z8TA 4JLLA 1M4IA 2AFWA 3KKWA 4UA3A 3Q6ZA 4UIBA 3IO1A 5HVGA 5F46A 4KVOE 5EC4A 2V8HA 4PXEA 5E96A 1KUVA 2B5GB 2Q0YA 5ELYA 3RO0A 2HQYA 3PBEA 5D29A 4JYWA 1CJWA 4A2ZA 3NA6A 2PRBA 3V2BA 3CXSA 1S7LA 4KOTA 3SI0A 3TO9A 1PUAA 1JWQA 2PJ4A 4MFJA 2ATRA 4UCPA 2QIRA 1IICA 4FD7A 3V38A 4M6IA 1FY7A 2B3UA 2EVNA 4IF5A 1KWMA 3GY9A 1ZG9A 2GIVA 4NXYA 4UBRA 5FVJA 1Y7RA 2AJ6A 2J8RA 2PR8A 4NGRA 2EO8A 4KVME 4D86A 1ZO0A 1TXRA 4K30A 1NMTA 4F9UA 2PJ3A 4P10A 2JEVA 3IU1A 4HNWB 4JWPA 5ISVA 3KQXA 2PDOA 2CNMA 4ZYQA 1NJRA 2ZPAA 4E0AA 1CP6A 2Z0ZA 4F9VA 3H8FA 4ZY1A 3DR6A 4EMEA 2Z3OA 4YRHA 4ZX9A 4J4ZA 1QSRA 3FBUA 1OZPA 4JD6A 2AFMA 3BI1A 1YW6A 4UEFA 1XMBA 3H8EA 2JEWA 3FECA 5J1QA 3QAYA 4EVYA 4MRIA 1YR0A 4QB9A 1XBUA 5FSZA 4LQGA 5CB5A 4ZY0A 2PIYA 3D68A 2Z3NA 2BOAA 3NH5A 4U9ZA 3FIXA 2AFUA 3PFEA 4GS4A 4ETKA 4HPSA 5G1ZA 4R3LA 1V0CA 3ISXA 4R3KA 2WZNA 3B3VA 3S6KA 1Z5RA 2GFQA 3Q71A 5DS0A 3LMSA 3K2KA 2GU2A 4FBEA 2XEIA 4U5YA 4KOXA 1KUYA 2CY2A 2HC9A 2D4OA 3FMCA 2R8VA 1VHSA 3I9SA 4JXQA 2C6PA 4MJ8A 3SHPA 5AG4A 1X10A 1B6BA 1YLOA 3B3CA 4GXHA 3RBUA 2ACFA 1MJBA 1YVKA 3B35A 4NGQA 4MHZA 3LODA 4R9MA 2PVWA 2P6FA 3S9LA 2JBJA 1I12A 2R1IA 3F5BA 4PQAA 2BL1A 4WWVA 4JCAA 1MJ9A 1YK3A 2PJAA 3FJUA 2PJ7A 4GM5A 3IEHA 4KLWA 4QVTA 1IYLA 2BO9A 4LX9A 3CZXA 2Z3KA 4E8OA 2QYVA 3P2HA 4M85A 1LCPA 2XEJA 4FWUA 2QECA 4B5OA 4H6ZA 1QSTA 2Q4YA 4NGTA 4XPDC 3SIGA 3TOAA 2Z10A 5KTDA 1YD9A 2JZFA 2F8HA 3A9LA 2IL4A 4XPKA 2Q51A 4P4EA 4J3GA 4KVXA 5GCNA 4CYPA 2NMTA 3WC6A 4C68A 2JDDA 2B3VA 4BINA 2G9DA 3SIJA 3BJ7A 3DSBA 4KSAA 1WWZA 3RYOA 4B11A 1PYTB 2PJBA 4UMLA 2PJ8A 2Z3PA 3CPXA 4L8AA 8CPAA 1Y9KA 2PJ9A 4PSXA 3NH4A 1GYTA 3IWWA 3JZTA 4DYOA 3TFYA 1YGHA 1TKHA 2BFRA 4JGKA 1ELMP 1XRYA 2POKA 2V8GA 1QSNA 1F57A 2AFOA 3TO7A 4MFQA 4Q7AA 4AVCA 3GB0A 4OC2A 2Q43A 2BCOA 4K3NA 1CPSA 2DPSA 3BLNA 4NSQA 5HVFA 4R6TA 1S5KA 4M6HA 3V7ZA 3KR5A 1CM0A 1R3NA 2VEZA 3IFEA 3LACA 2CXAA 4MHPA 5K8MA 4A94A 4ETJA 4A95A 1Q2YA 4IHMA 3KASA 2ZW5A 1MK4A 4I49A 2EWBA 5EMIA 2L8RA 4KUBA 4P44A 2HUZA 2IMOA 2FXKA 4Q36A 1Z9UA 2WPWA 1OBRA 1Z2LA 2ZW6A 4AVBA 3VATA 1TF8A 3EY5A 4PXCA 3FEEA 4CRZB 2Z11A 2ZEFA 4F0YA 5IV0A 2FIWA 1Z8XA 2V8VA 3DNSA 4LQ6A 1XJOA 2BEIA 2FXFA 3KL9A 4OIWA 4NCZA 5E3BA 3DLJA 4A33A 5KTCA 2AFCA 2WPXA 4GUAA 1RO5A 3JUWA 3JVNA 3GLJA 4KYBA 3SJFA 3KQZA 3HUVA 1GHEA 1HDQA 4OAEA 4A31A 2VI7A 3JTKA 4F8ZA 6CPAA 5HVHA 2CIJA 3H5ZA 3GKRA 1Y0RA 4BMHA 4OMEA 5D8NA 3G3SA 2AFZA 5IB9A 5AGEA 2ARHA 2O53A 5IX3A 2GLFA 4KOSA 2JBKA 2QJ8A 4ZBGA 4UEEA 3BI0A 1RXTA 2AE6A 3GQOA 1Y0YA 2ZEMA 3MN8A 2NSMA 5LRGA 3T90A 3TX8A 1CBXA 1XEBA 4NJRA 2CTBA 3TCVA 3SI1A 4CGOA 4II9A 3QNVA 3RZAA 3D2PA 5AG5A 3FXTA 1VGYA 4NEXA 4KOWA 4AB7A 4XPLA 3TO6A 1ZLHA 4P6YA 4PK3A 2B4BA 3EJFA 4BD9A 2AFXA 2WUUA 4F6AA 3QB8A 1BPNA 1YSJA 4MFPA 5JPHA 3SJXA 2EBJA 5FSYA 3KI9A 1HDUA 4C2XA 1PCAA 4A38A 3K9UA 4MCSA 2P6EA 4GVWA 3VH9A 3GPGA 3VWEA 2JDCA 1A2ZA 4KZTA 2G0BA 3IC1A 4EFDA 1DTDA 1YX0A 4RN7A 4UWIA 3PB8X 4CYNA 3PB7X 1F2PA 2PJCA 1KZFA 4ONWA 2PRQA 4IK2A 4OADA 3S6GA 4CS0B 5AG7A 5HH1A 3D66A 4TU0A 4R7MA 4G1PA 3KR4A 4YWYA 1AUGA 3H8GA 1SPVA 2ZEHA 2ZELA 2KCWA 4MFZA 3V8IA 1UWYA 2R7HA 5FSVA 2EK8A 2B4DA 3UY5A 3VFQA 4CAWA 2X47A 3T8WA 1NSAA 1S60A 4KS9A 3SXNA 2GREA 2FT0A 4P4JA 2Z3LA 3B3SA 2GE3A 4ABKA 3IGRA 4WJBA 4FD5A 4MFLA 5FSXA 1IYKA 3IIBA 2OR4A 2ZEDA 3L2NA 2X7BA 2Z3MA 2RFHA 3S9MA 4ONUA 1Q2DA 3BJ8A 3KGQA 4AXVA 4B5PB 1XF8A 3PB6X 2K5TA 2YNCA 4P4FA 1YW4A 3BXMA 5BWAB 1Q7LA 4UFWA 2YNCC 4QUSA 4QBJA 5K8NA 5KTAA 3EO4A 2CNSA 3KZWA 2C1CA 4MI4A 1YLEA 3N7ZA 4PV6A 4YU9A 5C88A 4CGPA 3TC8A 4MMOA 1ZG7A 2RC4A 3D8PA 3WR7A 2YNEA 2CF4A 3D7GA 4IAVA 4P4DA 4PXDA 1YMEA 4TWEA 1M4GA 3B3TA 4KLVA 5FSUA 2FL4A 1XE4A 4YGOA 2I00A 5F48A 2Q7SA 3D7FA 1VHEA 3CXPA 3FB3A 3NE7A 1YREA 2B4DB 2PJ5A 4LUAA 4B14A 3E0KA 2OZHA 1NE9A 2CTCA 3D67A 2C27A 3EFAA 3SXOA 4Y49B 1LOKA 5H84A 4MCRA 3PZJA 5CMSA 4CAVA 1ZR5A 4ORFA 3FVLA 2PR1A 2GLJA 4UCMA 2GANA 1SQHA 4NF1A 4ZX8A 3FNCA 4MHDA 1CX8A 4JZ0A 5LYDA 2QVPA 2OB0A 4RUHA 4X2TA 2HB6A 4XNHC 1VIXA 3K9TA 4OP4A 4HNYB 3SJGA 4NGMA 2DPTA 4A30A 4K0CA 5G22A 1ARLA 5THWA 4B6ZA 3PB9X 3PP9A 5EBVA 5CBMA 2HV2A 3IWGA 4A37A 1XOVA 2D4PA 4RS2A 4X3RA 2YGWA 2G3AA 4P4IA 2VL1A 1R43A 4OC0A 1QSOA 4PXBA 3GPQA 5DUSA 3D4UA 4OC3A 3IU2A 4B13A 4CYQA 1VHOA 4E2AA 4NGPA 4DJLA 5F09A 5HIHA 2I3CA 4JVVA 4IQYA 4AG7A 3W6XA 1IOIA 1TIQA 4TNUA 3EC4A 4F0XA 1BOBA 1LRZA 2F5IA 3GIUA 4HNXB 3EWPA 5I4MA 4ZY2A 5G20A 5A28A 5JM6A 3GQEA 4MXUA 1ZR3A 3B2YA 4H2KA 5I0CA 3S9NA 4PSWA 3WC7A 2KQVA 3IWEA 4CAEA 5HOLA 2IQ6A 2FG1A 2ZEOA 4A32A 4O23A 1LAMA 3GPOA 2R98A 2WYRA 1LANA 3MGDA 1I1DA 1P0HA 3CXQA 2PE3A 4Z65A 3W91A 4R76A 2CNTA 2Q7BA 4ZGYB 2FVGA 1YVOA 1Y9WA 3RNZA 2I79A 2ZW4A 2VXKA 4MHYA 1ELLP 4BBHA 1YQEA 3ZJ0A 4KORA 2ANPA 2J9AA 1M4DA 3B7IA 4XNHB 4KOVA 4MFKA 3BHXA 2PSWA 4AVAA 2BUEA 1Z4EA 1DE4C 4MHNA 1XFOA 1N71A 3DR8A 4QC6A 5DWNA 3VARA 4NGNA 2W2GA 2Q4ZA 5LRJA 2OOTA 3IJ3A 1FT7A 1IIDA 3G8WA 5J8FA 1S7NA 4MCQA 3D7DA 2OZUA 5LYIA 1AYEA 4B5PA 5F47A 1J4JA 1K4JA 4DNCA 4OC4A 3R9FA 3R95A 3PB4X 4ZI6A 3CDXA 5LYLA 2Q04A 1FNOA 5AG6A 3S6HA 3D2MA 5JGFA 1ZLIA 5LRKA 1CP7A 5AILA 1TF9A 3DDDA 2JZDA 2O28A 3WT4A 2BFQA 3QAHA 1LFWA 2PJ0A 4PK2A 1TKJA 1I21A 2ZW7A 1IU8A 2PCUA 3GYAA 3N5FA 4P4BA 1PU9A 2VBQA 2VZZA 1QQ9A 4M3SA 3IIDA 4NFRA 4NGSA 1XMTA 3F8KA 2DXQA 2P0WA 3NE8A 4X5KA 3CPAA 1H8LA 2ZOFA 3EWQA 1M1DA 2J8MA 1L0CA 3TT2A 4KUAA 1S3ZA 1CPXA 5F49A 1S7FA 4ESSA 3LD2A 2ZEPA 5JQ4A 2YNDA 4UIAA 1IB1E 1M44A 2EK9A 2REEA 2Q4VA 2LGRA 1BAVA 1TKFA 4CGMA 1BLLE 4Y49C 3DGVA 4J5RA 1HEEA 2REFA 2V8DA 4UWJA 5DWMA 1TXZA 4FD6A 2WCTA 1WK4A 5C82A 1ZG8A 3KHXA 3WABA 3TE4A 3W6SA 3FEDA 3EKEA 1M4LA 2C6GA 2Q44A 4H6UA 3TOBA 2J8NA 2WSAA 4C2ZA 4W9YA 2PJ6A 1HJZA 2ZXVA 4MY3A 2FCKA 4UF4A 2QMLA 1P4NA 5IB0A 5JH9A 5LYFA 1B87A 4OKOA 1NSLA 4CRYB 4JJXA 2FAVA 2PVVA 2JLMA 4HKFA 2DF5A 3JRUA 2PIZA 1QMUA 3PFOA 2EEEA 3EWRA 3R9EA 3FX6A 2P6GA 4YFJA 3PBBA 2XEFA 3ISZA 5K8OA 2FE7A 1X12A 3WC5A 3SJEA 3D7HA 4JXRA 4M6GA 4UCNA 1Z8LA 2DEAA 4OC1A 3KHZA 1XIXA 2G3TA 4C7IA 4CAXA 4CYOA 3IIFA 3I3GA 3NH8A 3ZZIA 3CT9A 3SIIA 1BO4A 3VWDA 5CPAA 7CPAA 2XD7A 1KUXA 1LAPA 3MRUA 4OC5A 5H86A 2VRIA 3B3WA 1JQGA 3D3SA 3H4QA 1S7KA 4FUUA 3EWOA 2F7VA 4U9YA 2PJ2A 4FAIA 1Z4RA 4MBUA 2H5MA 1RTQA 3GUXA 4NJQA 1VKCA 5CNPA 1BPMA 5G21A 3LWUA 1IOFA 2ZENA 3P2FA 3EW5A 4L89A 4JLYA 4R8FA 1VHUA 2O4HA 4RI1A 3F0AA 4OLLA 4B12A 3T9YA 4KSFA 3HLPA 1F2OA 4CAFA 5K8PA 4H89A 1CG2A 3OWCA 3FRMA 3PRTA 4C7HA 4J5QA 1Q2CA 3PGPA 4CGLA 4UEZA 3B8GA 3ETIA 2AFSA 2A4NA 2OU2A 2VZYA 2V77A 4FD4A 4ABLA 1MJAA 4B10A 3PEIA 2FS5A 4R87A 2OH1A 3SI2A 2B5GA 2OZGA 3V45A 2PJ1A 1TY8A 2FSRA 2ODFA 5HMNA 4KSIA 2ZEGA 2ZEEA 3I1UA 4C2YA 4OIDA 2VQYA 1IY7A 1ARMA 1Z8WA 2BSWA 2EUIA 4MY0A 4EWTA 5A27A 3FF3A 3EXNA 4GVVA 4A39A 5J8CA 2ZOGA 3S6FA 4DUKA 2NYQA 1UFHA 4CPAA 4X8IA
chains in the Genus database with same CATH topology
1AMPA 2IJZA 3NFZA 4PPZA 2RB7A 4MCPA 5HXDA 3FH4A 4P45A 1Y7EA 3EJGA 3SIHA 1IGBA 2XEGA 1EE3P 4J5SA 5CB3A 2DX6A 2C6CA 2ABZA 4JLLA 2AFWA 3Q6ZA 4UIBA 3IO1A 2V8HA 4PXEA 5ELYA 3PBEA 5D29A 4JYWA 3NA6A 3V2BA 3SI0A 2PJ4A 3V38A 1KWMA 1ZG9A 4NGRA 4D86A 1TXRA 4F9UA 2PJ3A 4P10A 3KQXA 4ZYQA 1NJRA 4F9VA 1CP6A 3H8FA 4ZY1A 4EMEA 4ZX9A 4J4ZA 3BI1A 2AFMA 1YW6A 4UEFA 1XMBA 3H8EA 2JEWA 3FECA 5J1QA 4MRIA 1XBUA 5FSZA 4LQGA 5CB5A 4ZY0A 2PIYA 3D68A 2BOAA 3NH5A 2AFUA 3PFEA 4ETKA 3ISXA 2WZNA 3B3VA 1Z5RA 3Q71A 5DS0A 3LMSA 3K2KA 2GU2A 4FBEA 2XEIA 2HC9A 3FMCA 2C6PA 1YLOA 3B3CA 3RBUA 2ACFA 4NGQA 3B35A 4MHZA 2PVWA 3S9LA 2JBJA 4PQAA 4WWVA 4JCAA 2PJAA 3FJUA 2PJ7A 4GM5A 3IEHA 2BO9A 2QYVA 1LCPA 2XEJA 4FWUA 4NGTA 3SIGA 1YD9A 2F8HA 2Q51A 4P4EA 3WC6A 2G9DA 3SIJA 1PYTB 2PJBA 4UMLA 2PJ8A 3CPXA 8CPAA 2PJ9A 3NH4A 1GYTA 3IWWA 3JZTA 4DYOA 1TKHA 2BFRA 4JGKA 1ELMP 1XRYA 2POKA 2V8GA 1F57A 2AFOA 4Q7AA 3GB0A 4OC2A 2Q43A 2BCOA 4K3NA 1CPSA 5HVFA 4R6TA 3V7ZA 3KR5A 1R3NA 3IFEA 4MHPA 4A94A 4ETJA 4IHMA 3KASA 2EWBA 2L8RA 4P44A 2IMOA 2FXKA 1OBRA 1Z2LA 3VATA 1TF8A 4PXCA 3FEEA 2ZEFA 2V8VA 4OIWA 1XJOA 3KL9A 5E3BA 3DLJA 2AFCA 4GUAA 3GLJA 4KYBA 3SJFA 3KQZA 3HUVA 1HDQA 4F8ZA 6CPAA 5HVHA 2CIJA 1Y0RA 4OMEA 5D8NA 5IB9A 2AFZA 2O53A 2GLFA 2JBKA 2QJ8A 4UEEA 3BI0A 3GQOA 1Y0YA 2ZEMA 3MN8A 2NSMA 5LRGA 3TX8A 1CBXA 4NJRA 2CTBA 3SI1A 3QNVA 3RZAA 1VGYA 1ZLHA 4P6YA 3EJFA 4BD9A 2AFXA 1BPNA 1YSJA 3SJXA 5FSYA 3KI9A 1HDUA 1PCAA 4A38A 4MCSA 4GVWA 3VH9A 3GPGA 3IC1A 4EFDA 1DTDA 3PB8X 3PB7X 1F2PA 2PJCA 4ONWA 2PRQA 4IK2A 3D66A 4TU0A 4R7MA 4G1PA 3KR4A 4YWYA 3H8GA 1SPVA 2ZEHA 2ZELA 1UWYA 5FSVA 2EK8A 3VFQA 2X47A 3T8WA 1NSAA 2GREA 4P4JA 3B3SA 4ABKA 4WJBA 5FSXA 3IIBA 2OR4A 2ZEDA 3L2NA 2RFHA 3S9MA 3KGQA 4AXVA 3PB6X 4P4FA 1YW4A 3BXMA 1Q7LA 5K8NA 3KZWA 2C1CA 4YU9A 3TC8A 4MMOA 1ZG7A 4P4DA 2CF4A 3D7GA 4IAVA 4PXDA 1YMEA 4TWEA 3B3TA 5FSUA 3D7FA 1VHEA 2PJ5A 2CTCA 3D67A 1LOKA 4MCRA 5CMSA 1ZR5A 3FVLA 2GLJA 4ZX8A 5LYDA 1CX8A 4JZ0A 2QVPA 4RUHA 5K8MA 4X2TA 2HB6A 1VIXA 3K9TA 4OP4A 3SJGA 4NGMA 4K0CA 1ARLA 5THWA 4B6ZA 3PB9X 5CBMA 7CPAA 4A37A 4X3RA 4P4IA 2VL1A 1R43A 4OC0A 4PXBA 3GPQA 5DUSA 3D4UA 4OC3A 1VHOA 4NGPA 4DJLA 5F09A 5HIHA 2I3CA 4JVVA 4IQYA 4TNUA 5I4MA 3EWPA 4ZY2A 5JM6A 3GQEA 4MXUA 1ZR3A 3B2YA 4H2KA 3S9NA 3WC7A 5HOLA 2IQ6A 2FG1A 2ZEOA 4O23A 1LAMA 3GPOA 2WYRA 1LANA 2PE3A 4Z65A 4R76A 2FVGA 4MHYA 1ELLP 2ANPA 2J9AA 3B7IA 3BHXA 1DE4C 4MHNA 1XFOA 3VARA 4NGNA 2Q4ZA 5LRJA 2OOTA 3IJ3A 1FT7A 4MCQA 3D7DA 5LYIA 1AYEA 4OC4A 3PB4X 4ZI6A 3CDXA 5LYLA 1FNOA 5JGFA 1ZLIA 5LRKA 1CP7A 5AILA 1TF9A 3WT4A 2BFQA 1LFWA 2PJ0A 1TKJA 3N5FA 2PCUA 4P4BA 3RAMA 1QQ9A 3IIDA 4NFRA 4NGSA 3CPAA 1H8LA 2ZOFA 3EWQA 1CPXA 4ESSA 2ZEPA 4UIAA 2EK9A 5HVGA 2LGRA 1BAVA 1TKFA 1BLLE 3DGVA 4J5RA 1HEEA 2V8DA 1TXZA 1ZG8A 3KHXA 3WABA 3FEDA 3EKEA 1M4LA 2C6GA 4W9YA 2PJ6A 1HJZA 4UF4A 5JH9A 5LYFA 4OKOA 2FAVA 2PVVA 3JRUA 2PIZA 1QMUA 3PFOA 2EEEA 3EWRA 3FX6A 3PBBA 2XEFA 3ISZA 5K8OA 3WC5A 3SJEA 3D7HA 1Z8LA 2DEAA 4OC1A 3KHZA 3IIFA 3NH8A 3CT9A 3SIIA 5CPAA 2XD7A 1LAPA 3MRUA 4OC5A 2VRIA 3B3WA 1JQGA 4FUUA 3EWOA 2F7VA 4FAIA 2PJ2A 1RTQA 3GUXA 4NJQA 1BPMA 3LWUA 2ZENA 3EW5A 4R8FA 1VHUA 2O4HA 3HLPA 1F2OA 5K8PA 1CG2A 3PRTA 4J5QA 4UEZA 3ETIA 2AFSA 2V77A 4ABLA 3PEIA 3SI2A 3V45A 2PJ1A 1TY8A 4KSIA 2ZEGA 2ZEEA 3I1UA 4OIDA 1IY7A 1ARMA 4EWTA 3FF3A 4GVVA 4A39A 2ZOGA 4DUKA 2NYQA 4CPAA 4X8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AMP A;  2IJZ A;  3NFZ A;  4PPZ A;  2RB7 A;  4MCP A;  5HXD A;  3FH4 A;  4P45 A;  1Y7E A;  3EJG A;  3SIH A;  1IGB A;  2XEG A;  1EE3 P;  4J5S A;  5CB3 A;  2DX6 A;  2C6C A;  2ABZ A;  4JLL A;  2AFW A;  3Q6Z A;  4UIB A;  3IO1 A;  2V8H A;  4PXE A;  5ELY A;  3PBE A;  5D29 A;  4JYW A;  3NA6 A;  3V2B A;  3SI0 A;  2PJ4 A;  3V38 A;  1KWM A;  1ZG9 A;  4NGR A;  4D86 A;  1TXR A;  4F9U A;  2PJ3 A;  4P10 A;  3KQX A;  4ZYQ A;  1NJR A;  4F9V A;  1CP6 A;  3H8F A;  4ZY1 A;  4EME A;  4ZX9 A;  4J4Z A;  3BI1 A;  2AFM A;  1YW6 A;  4UEF A;  1XMB A;  3H8E A;  2JEW A;  3FEC A;  5J1Q A;  4MRI A;  1XBU A;  5FSZ A;  4LQG A;  5CB5 A;  4ZY0 A;  2PIY A;  3D68 A;  2BOA A;  3NH5 A;  2AFU A;  3PFE A;  4ETK A;  3ISX A;  2WZN A;  3B3V A;  1Z5R A;  3Q71 A;  5DS0 A;  3LMS A;  3K2K A;  2GU2 A;  4FBE A;  2XEI A;  2HC9 A;  3FMC A;  2C6P A;  1YLO A;  3B3C A;  3RBU A;  2ACF A;  4NGQ A;  3B35 A;  4MHZ A;  2PVW A;  3S9L A;  2JBJ A;  4PQA A;  4WWV A;  4JCA A;  2PJA A;  3FJU A;  2PJ7 A;  4GM5 A;  3IEH A;  2BO9 A;  2QYV A;  1LCP A;  2XEJ A;  4FWU A;  4NGT A;  3SIG A;  1YD9 A;  2F8H A;  2Q51 A;  4P4E A;  3WC6 A;  2G9D A;  3SIJ A;  1PYT B;  2PJB A;  4UML A;  2PJ8 A;  3CPX A;  8CPA A;  2PJ9 A;  3NH4 A;  1GYT A;  3IWW A;  3JZT A;  4DYO A;  1TKH A;  2BFR A;  4JGK A;  1ELM P;  1XRY A;  2POK A;  2V8G A;  1F57 A;  2AFO A;  4Q7A A;  3GB0 A;  4OC2 A;  2Q43 A;  2BCO A;  4K3N A;  1CPS A;  5HVF A;  4R6T A;  3V7Z A;  3KR5 A;  1R3N A;  3IFE A;  4MHP A;  4A94 A;  4ETJ A;  4IHM A;  3KAS A;  2EWB A;  2L8R A;  4P44 A;  2IMO A;  2FXK A;  1OBR A;  1Z2L A;  3VAT A;  1TF8 A;  4PXC A;  3FEE A;  2ZEF A;  2V8V A;  4OIW A;  1XJO A;  3KL9 A;  5E3B A;  3DLJ A;  2AFC A;  4GUA A;  3GLJ A;  4KYB A;  3SJF A;  3KQZ A;  3HUV A;  1HDQ A;  4F8Z A;  6CPA A;  5HVH A;  2CIJ A;  1Y0R A;  4OME A;  5D8N A;  5IB9 A;  2AFZ A;  2O53 A;  2GLF A;  2JBK A;  2QJ8 A;  4UEE A;  3BI0 A;  3GQO A;  1Y0Y A;  2ZEM A;  3MN8 A;  2NSM A;  5LRG A;  3TX8 A;  1CBX A;  4NJR A;  2CTB A;  3SI1 A;  3QNV A;  3RZA A;  1VGY A;  1ZLH A;  4P6Y A;  3EJF A;  4BD9 A;  2AFX A;  1BPN A;  1YSJ A;  3SJX A;  5FSY A;  3KI9 A;  1HDU A;  1PCA A;  4A38 A;  4MCS A;  4GVW A;  3VH9 A;  3GPG A;  3IC1 A;  4EFD A;  1DTD A;  3PB8 X;  3PB7 X;  1F2P A;  2PJC A;  4ONW A;  2PRQ A;  4IK2 A;  3D66 A;  4TU0 A;  4R7M A;  4G1P A;  3KR4 A;  4YWY A;  3H8G A;  1SPV A;  2ZEH A;  2ZEL A;  1UWY A;  5FSV A;  2EK8 A;  3VFQ A;  2X47 A;  3T8W A;  1NSA A;  2GRE A;  4P4J A;  3B3S A;  4ABK A;  4WJB A;  5FSX A;  3IIB A;  2OR4 A;  2ZED A;  3L2N A;  2RFH A;  3S9M A;  3KGQ A;  4AXV A;  3PB6 X;  4P4F A;  1YW4 A;  3BXM A;  1Q7L A;  5K8N A;  3KZW A;  2C1C A;  4YU9 A;  3TC8 A;  4MMO A;  1ZG7 A;  4P4D A;  2CF4 A;  3D7G A;  4IAV A;  4PXD A;  1YME A;  4TWE A;  3B3T A;  5FSU A;  3D7F A;  1VHE A;  2PJ5 A;  2CTC A;  3D67 A;  1LOK A;  4MCR A;  5CMS A;  1ZR5 A;  3FVL A;  2GLJ A;  4ZX8 A;  5LYD A;  1CX8 A;  4JZ0 A;  2QVP A;  4RUH A;  5K8M A;  4X2T A;  2HB6 A;  1VIX A;  3K9T A;  4OP4 A;  3SJG A;  4NGM A;  4K0C A;  1ARL A;  5THW A;  4B6Z A;  3PB9 X;  5CBM A;  7CPA A;  4A37 A;  4X3R A;  4P4I A;  2VL1 A;  1R43 A;  4OC0 A;  4PXB A;  3GPQ A;  5DUS A;  3D4U A;  4OC3 A;  1VHO A;  4NGP A;  4DJL A;  5F09 A;  5HIH A;  2I3C A;  4JVV A;  4IQY A;  4TNU A;  5I4M A;  3EWP A;  4ZY2 A;  5JM6 A;  3GQE A;  4MXU A;  1ZR3 A;  3B2Y A;  4H2K A;  3S9N A;  3WC7 A;  5HOL A;  2IQ6 A;  2FG1 A;  2ZEO A;  4O23 A;  1LAM A;  3GPO A;  2WYR A;  1LAN A;  2PE3 A;  4Z65 A;  4R76 A;  2FVG A;  4MHY A;  1ELL P;  2ANP A;  2J9A A;  3B7I A;  3BHX A;  1DE4 C;  4MHN A;  1XFO A;  3VAR A;  4NGN A;  2Q4Z A;  5LRJ A;  2OOT A;  3IJ3 A;  1FT7 A;  4MCQ A;  3D7D A;  5LYI A;  1AYE A;  4OC4 A;  3PB4 X;  4ZI6 A;  3CDX A;  5LYL A;  1FNO A;  5JGF A;  1ZLI A;  5LRK A;  1CP7 A;  5AIL A;  1TF9 A;  3WT4 A;  2BFQ A;  1LFW A;  2PJ0 A;  1TKJ A;  3N5F A;  2PCU A;  4P4B A;  3RAM A;  1QQ9 A;  3IID A;  4NFR A;  4NGS A;  3CPA A;  1H8L A;  2ZOF A;  3EWQ A;  1CPX A;  4ESS A;  2ZEP A;  4UIA A;  2EK9 A;  5HVG A;  2LGR A;  1BAV A;  1TKF A;  1BLL E;  3DGV A;  4J5R A;  1HEE A;  2V8D A;  1TXZ A;  1ZG8 A;  3KHX A;  3WAB A;  3FED A;  3EKE A;  1M4L A;  2C6G A;  4W9Y A;  2PJ6 A;  1HJZ A;  4UF4 A;  5JH9 A;  5LYF A;  4OKO A;  2FAV A;  2PVV A;  3JRU A;  2PIZ A;  1QMU A;  3PFO A;  2EEE A;  3EWR A;  3FX6 A;  3PBB A;  2XEF A;  3ISZ A;  5K8O A;  3WC5 A;  3SJE A;  3D7H A;  1Z8L A;  2DEA A;  4OC1 A;  3KHZ A;  3IIF A;  3NH8 A;  3CT9 A;  3SII A;  5CPA A;  2XD7 A;  1LAP A;  3MRU A;  4OC5 A;  2VRI A;  3B3W A;  1JQG A;  4FUU A;  3EWO A;  2F7V A;  4FAI A;  2PJ2 A;  1RTQ A;  3GUX A;  4NJQ A;  1BPM A;  3LWU A;  2ZEN A;  3EW5 A;  4R8F A;  1VHU A;  2O4H A;  3HLP A;  1F2O A;  5K8P A;  1CG2 A;  3PRT A;  4J5Q A;  4UEZ A;  3ETI A;  2AFS A;  2V77 A;  4ABL A;  3PEI A;  3SI2 A;  3V45 A;  2PJ1 A;  1TY8 A;  4KSI A;  2ZEG A;  2ZEE A;  3I1U A;  4OID A;  1IY7 A;  1ARM A;  4EWT A;  3FF3 A;  4GVV A;  4A39 A;  2ZOG A;  4DUK A;  2NYQ A;  4CPA A;  4X8I A; 
#chains in the Genus database with same CATH topology
 1AMP A;  2IJZ A;  4KOY A;  3R9G A;  2PQ8 A;  3NFZ A;  2B58 A;  3RAM A;  4PPZ A;  3FYN A;  4AG9 A;  2RB7 A;  4CGN A;  1ON0 A;  2Y0M A;  4MCP A;  4R57 A;  2RNK A;  3C26 A;  4XPD B;  3FH4 A;  5HXD A;  1QSM A;  4P45 A;  1Y7E A;  4UFX A;  2PC1 A;  4KOU A;  3EJG A;  3SIH A;  1IGB A;  2XEG A;  1U6M A;  4Q38 A;  2JZE A;  1EE3 P;  3R96 A;  4IUS A;  3TTH A;  4J5S A;  5CB3 A;  2FIA A;  2DX6 A;  1R57 A;  2C6C A;  4UFV A;  2ABZ A;  3R1K A;  1Z8T A;  4JLL A;  1M4I A;  2AFW A;  3KKW A;  4UA3 A;  3Q6Z A;  4UIB A;  3IO1 A;  5HVG A;  5F46 A;  4KVO E;  5EC4 A;  2V8H A;  4PXE A;  5E96 A;  1KUV A;  2B5G B;  2Q0Y A;  5ELY A;  3RO0 A;  2HQY A;  3PBE A;  5D29 A;  4JYW A;  1CJW A;  4A2Z A;  3NA6 A;  2PRB A;  3V2B A;  3CXS A;  1S7L A;  4KOT A;  3SI0 A;  3TO9 A;  1PUA A;  1JWQ A;  2PJ4 A;  4MFJ A;  2ATR A;  4UCP A;  2QIR A;  1IIC A;  4FD7 A;  3V38 A;  4M6I A;  1FY7 A;  2B3U A;  2EVN A;  4IF5 A;  1KWM A;  3GY9 A;  1ZG9 A;  2GIV A;  4NXY A;  4UBR A;  5FVJ A;  1Y7R A;  2AJ6 A;  2J8R A;  2PR8 A;  4NGR A;  2EO8 A;  4KVM E;  4D86 A;  1ZO0 A;  1TXR A;  4K30 A;  1NMT A;  4F9U A;  2PJ3 A;  4P10 A;  2JEV A;  3IU1 A;  4HNW B;  4JWP A;  5ISV A;  3KQX A;  2PDO A;  2CNM A;  4ZYQ A;  1NJR A;  2ZPA A;  4E0A A;  1CP6 A;  2Z0Z A;  4F9V A;  3H8F A;  4ZY1 A;  3DR6 A;  4EME A;  2Z3O A;  4YRH A;  4ZX9 A;  4J4Z A;  1QSR A;  3FBU A;  1OZP A;  4JD6 A;  2AFM A;  3BI1 A;  1YW6 A;  4UEF A;  1XMB A;  3H8E A;  2JEW A;  3FEC A;  5J1Q A;  3QAY A;  4EVY A;  4MRI A;  1YR0 A;  4QB9 A;  1XBU A;  5FSZ A;  4LQG A;  5CB5 A;  4ZY0 A;  2PIY A;  3D68 A;  2Z3N A;  2BOA A;  3NH5 A;  4U9Z A;  3FIX A;  2AFU A;  3PFE A;  4GS4 A;  4ETK A;  4HPS A;  5G1Z A;  4R3L A;  1V0C A;  3ISX A;  4R3K A;  2WZN A;  3B3V A;  3S6K A;  1Z5R A;  2GFQ A;  3Q71 A;  5DS0 A;  3LMS A;  3K2K A;  2GU2 A;  4FBE A;  2XEI A;  4U5Y A;  4KOX A;  1KUY A;  2CY2 A;  2HC9 A;  2D4O A;  3FMC A;  2R8V A;  1VHS A;  3I9S A;  4JXQ A;  2C6P A;  4MJ8 A;  3SHP A;  5AG4 A;  1X10 A;  1B6B A;  1YLO A;  3B3C A;  4GXH A;  3RBU A;  2ACF A;  1MJB A;  1YVK A;  3B35 A;  4NGQ A;  4MHZ A;  3LOD A;  4R9M A;  2PVW A;  2P6F A;  3S9L A;  2JBJ A;  1I12 A;  2R1I A;  3F5B A;  4PQA A;  2BL1 A;  4WWV A;  4JCA A;  1MJ9 A;  1YK3 A;  2PJA A;  3FJU A;  2PJ7 A;  4GM5 A;  3IEH A;  4KLW A;  4QVT A;  1IYL A;  2BO9 A;  4LX9 A;  3CZX A;  2Z3K A;  4E8O A;  2QYV A;  3P2H A;  4M85 A;  1LCP A;  2XEJ A;  4FWU A;  2QEC A;  4B5O A;  4H6Z A;  1QST A;  2Q4Y A;  4NGT A;  4XPD C;  3SIG A;  3TOA A;  2Z10 A;  5KTD A;  1YD9 A;  2JZF A;  2F8H A;  3A9L A;  2IL4 A;  4XPK A;  2Q51 A;  4P4E A;  4J3G A;  4KVX A;  5GCN A;  4CYP A;  2NMT A;  3WC6 A;  4C68 A;  2JDD A;  2B3V A;  4BIN A;  2G9D A;  3SIJ A;  3BJ7 A;  3DSB A;  4KSA A;  1WWZ A;  3RYO A;  4B11 A;  1PYT B;  2PJB A;  4UML A;  2PJ8 A;  2Z3P A;  3CPX A;  4L8A A;  8CPA A;  1Y9K A;  2PJ9 A;  4PSX A;  3NH4 A;  1GYT A;  3IWW A;  3JZT A;  4DYO A;  3TFY A;  1YGH A;  1TKH A;  2BFR A;  4JGK A;  1ELM P;  1XRY A;  2POK A;  2V8G A;  1QSN A;  1F57 A;  2AFO A;  3TO7 A;  4MFQ A;  4Q7A A;  4AVC A;  3GB0 A;  4OC2 A;  2Q43 A;  2BCO A;  4K3N A;  1CPS A;  2DPS A;  3BLN A;  4NSQ A;  5HVF A;  4R6T A;  1S5K A;  4M6H A;  3V7Z A;  3KR5 A;  1CM0 A;  1R3N A;  2VEZ A;  3IFE A;  3LAC A;  2CXA A;  4MHP A;  5K8M A;  4A94 A;  4ETJ A;  4A95 A;  1Q2Y A;  4IHM A;  3KAS A;  2ZW5 A;  1MK4 A;  4I49 A;  2EWB A;  5EMI A;  2L8R A;  4KUB A;  4P44 A;  2HUZ A;  2IMO A;  2FXK A;  4Q36 A;  1Z9U A;  2WPW A;  1OBR A;  1Z2L A;  2ZW6 A;  4AVB A;  3VAT A;  1TF8 A;  3EY5 A;  4PXC A;  3FEE A;  4CRZ B;  2Z11 A;  2ZEF A;  4F0Y A;  5IV0 A;  2FIW A;  1Z8X A;  2V8V A;  3DNS A;  4LQ6 A;  1XJO A;  2BEI A;  2FXF A;  3KL9 A;  4OIW A;  4NCZ A;  5E3B A;  3DLJ A;  4A33 A;  5KTC A;  2AFC A;  2WPX A;  4GUA A;  1RO5 A;  3JUW A;  3JVN A;  3GLJ A;  4KYB A;  3SJF A;  3KQZ A;  3HUV A;  1GHE A;  1HDQ A;  4OAE A;  4A31 A;  2VI7 A;  3JTK A;  4F8Z A;  6CPA A;  5HVH A;  2CIJ A;  3H5Z A;  3GKR A;  1Y0R A;  4BMH A;  4OME A;  5D8N A;  3G3S A;  2AFZ A;  5IB9 A;  5AGE A;  2ARH A;  2O53 A;  5IX3 A;  2GLF A;  4KOS A;  2JBK A;  2QJ8 A;  4ZBG A;  4UEE A;  3BI0 A;  1RXT A;  2AE6 A;  3GQO A;  1Y0Y A;  2ZEM A;  3MN8 A;  2NSM A;  5LRG A;  3T90 A;  3TX8 A;  1CBX A;  1XEB A;  4NJR A;  2CTB A;  3TCV A;  3SI1 A;  4CGO A;  4II9 A;  3QNV A;  3RZA A;  3D2P A;  5AG5 A;  3FXT A;  1VGY A;  4NEX A;  4KOW A;  4AB7 A;  4XPL A;  3TO6 A;  1ZLH A;  4P6Y A;  4PK3 A;  2B4B A;  3EJF A;  4BD9 A;  2AFX A;  2WUU A;  4F6A A;  3QB8 A;  1BPN A;  1YSJ A;  4MFP A;  5JPH A;  3SJX A;  2EBJ A;  5FSY A;  3KI9 A;  1HDU A;  4C2X A;  1PCA A;  4A38 A;  3K9U A;  4MCS A;  2P6E A;  4GVW A;  3VH9 A;  3GPG A;  3VWE A;  2JDC A;  1A2Z A;  4KZT A;  2G0B A;  3IC1 A;  4EFD A;  1DTD A;  1YX0 A;  4RN7 A;  4UWI A;  3PB8 X;  4CYN A;  3PB7 X;  1F2P A;  2PJC A;  1KZF A;  4ONW A;  2PRQ A;  4IK2 A;  4OAD A;  3S6G A;  4CS0 B;  5AG7 A;  5HH1 A;  3D66 A;  4TU0 A;  4R7M A;  4G1P A;  3KR4 A;  4YWY A;  1AUG A;  3H8G A;  1SPV A;  2ZEH A;  2ZEL A;  2KCW A;  4MFZ A;  3V8I A;  1UWY A;  2R7H A;  5FSV A;  2EK8 A;  2B4D A;  3UY5 A;  3VFQ A;  4CAW A;  2X47 A;  3T8W A;  1NSA A;  1S60 A;  4KS9 A;  3SXN A;  2GRE A;  2FT0 A;  4P4J A;  2Z3L A;  3B3S A;  2GE3 A;  4ABK A;  3IGR A;  4WJB A;  4FD5 A;  4MFL A;  5FSX A;  1IYK A;  3IIB A;  2OR4 A;  2ZED A;  3L2N A;  2X7B A;  2Z3M A;  2RFH A;  3S9M A;  4ONU A;  1Q2D A;  3BJ8 A;  3KGQ A;  4AXV A;  4B5P B;  1XF8 A;  3PB6 X;  2K5T A;  2YNC A;  4P4F A;  1YW4 A;  3BXM A;  5BWA B;  1Q7L A;  4UFW A;  2YNC C;  4QUS A;  4QBJ A;  5K8N A;  5KTA A;  3EO4 A;  2CNS A;  3KZW A;  2C1C A;  4MI4 A;  1YLE A;  3N7Z A;  4PV6 A;  4YU9 A;  5C88 A;  4CGP A;  3TC8 A;  4MMO A;  1ZG7 A;  2RC4 A;  3D8P A;  3WR7 A;  2YNE A;  2CF4 A;  3D7G A;  4IAV A;  4P4D A;  4PXD A;  1YME A;  4TWE A;  1M4G A;  3B3T A;  4KLV A;  5FSU A;  2FL4 A;  1XE4 A;  4YGO A;  2I00 A;  5F48 A;  2Q7S A;  3D7F A;  1VHE A;  3CXP A;  3FB3 A;  3NE7 A;  1YRE A;  2B4D B;  2PJ5 A;  4LUA A;  4B14 A;  3E0K A;  2OZH A;  1NE9 A;  2CTC A;  3D67 A;  2C27 A;  3EFA A;  3SXO A;  4Y49 B;  1LOK A;  5H84 A;  4MCR A;  3PZJ A;  5CMS A;  4CAV A;  1ZR5 A;  4ORF A;  3FVL A;  2PR1 A;  2GLJ A;  4UCM A;  2GAN A;  1SQH A;  4NF1 A;  4ZX8 A;  3FNC A;  4MHD A;  1CX8 A;  4JZ0 A;  5LYD A;  2QVP A;  2OB0 A;  4RUH A;  4X2T A;  2HB6 A;  4XNH C;  1VIX A;  3K9T A;  4OP4 A;  4HNY B;  3SJG A;  4NGM A;  2DPT A;  4A30 A;  4K0C A;  5G22 A;  1ARL A;  5THW A;  4B6Z A;  3PB9 X;  3PP9 A;  5EBV A;  5CBM A;  2HV2 A;  3IWG A;  4A37 A;  1XOV A;  2D4P A;  4RS2 A;  4X3R A;  2YGW A;  2G3A A;  4P4I A;  2VL1 A;  1R43 A;  4OC0 A;  1QSO A;  4PXB A;  3GPQ A;  5DUS A;  3D4U A;  4OC3 A;  3IU2 A;  4B13 A;  4CYQ A;  1VHO A;  4E2A A;  4NGP A;  4DJL A;  5F09 A;  5HIH A;  2I3C A;  4JVV A;  4IQY A;  4AG7 A;  3W6X A;  1IOI A;  1TIQ A;  4TNU A;  3EC4 A;  4F0X A;  1BOB A;  1LRZ A;  2F5I A;  3GIU A;  4HNX B;  3EWP A;  5I4M A;  4ZY2 A;  5G20 A;  5A28 A;  5JM6 A;  3GQE A;  4MXU A;  1ZR3 A;  3B2Y A;  4H2K A;  5I0C A;  3S9N A;  4PSW A;  3WC7 A;  2KQV A;  3IWE A;  4CAE A;  5HOL A;  2IQ6 A;  2FG1 A;  2ZEO A;  4A32 A;  4O23 A;  1LAM A;  3GPO A;  2R98 A;  2WYR A;  1LAN A;  3MGD A;  1I1D A;  1P0H A;  3CXQ A;  2PE3 A;  4Z65 A;  3W91 A;  4R76 A;  2CNT A;  2Q7B A;  4ZGY B;  2FVG A;  1YVO A;  1Y9W A;  3RNZ A;  2I79 A;  2ZW4 A;  2VXK A;  4MHY A;  1ELL P;  4BBH A;  1YQE A;  3ZJ0 A;  4KOR A;  2ANP A;  2J9A A;  1M4D A;  3B7I A;  4XNH B;  4KOV A;  4MFK A;  3BHX A;  2PSW A;  4AVA A;  2BUE A;  1Z4E A;  1DE4 C;  4MHN A;  1XFO A;  1N71 A;  3DR8 A;  4QC6 A;  5DWN A;  3VAR A;  4NGN A;  2W2G A;  2Q4Z A;  5LRJ A;  2OOT A;  3IJ3 A;  1FT7 A;  1IID A;  3G8W A;  5J8F A;  1S7N A;  4MCQ A;  3D7D A;  2OZU A;  5LYI A;  1AYE A;  4B5P A;  5F47 A;  1J4J A;  1K4J A;  4DNC A;  4OC4 A;  3R9F A;  3R95 A;  3PB4 X;  4ZI6 A;  3CDX A;  5LYL A;  2Q04 A;  1FNO A;  5AG6 A;  3S6H A;  3D2M A;  5JGF A;  1ZLI A;  5LRK A;  1CP7 A;  5AIL A;  1TF9 A;  3DDD A;  2JZD A;  2O28 A;  3WT4 A;  2BFQ A;  3QAH A;  1LFW A;  2PJ0 A;  4PK2 A;  1TKJ A;  1I21 A;  2ZW7 A;  1IU8 A;  2PCU A;  3GYA A;  3N5F A;  4P4B A;  1PU9 A;  2VBQ A;  2VZZ A;  1QQ9 A;  4M3S A;  3IID A;  4NFR A;  4NGS A;  1XMT A;  3F8K A;  2DXQ A;  2P0W A;  3NE8 A;  4X5K A;  3CPA A;  1H8L A;  2ZOF A;  3EWQ A;  1M1D A;  2J8M A;  1L0C A;  3TT2 A;  4KUA A;  1S3Z A;  1CPX A;  5F49 A;  1S7F A;  4ESS A;  3LD2 A;  2ZEP A;  5JQ4 A;  2YND A;  4UIA A;  1IB1 E;  1M44 A;  2EK9 A;  2REE A;  2Q4V A;  2LGR A;  1BAV A;  1TKF A;  4CGM A;  1BLL E;  4Y49 C;  3DGV A;  4J5R A;  1HEE A;  2REF A;  2V8D A;  4UWJ A;  5DWM A;  1TXZ A;  4FD6 A;  2WCT A;  1WK4 A;  5C82 A;  1ZG8 A;  3KHX A;  3WAB A;  3TE4 A;  3W6S A;  3FED A;  3EKE A;  1M4L A;  2C6G A;  2Q44 A;  4H6U A;  3TOB A;  2J8N A;  2WSA A;  4C2Z A;  4W9Y A;  2PJ6 A;  1HJZ A;  2ZXV A;  4MY3 A;  2FCK A;  4UF4 A;  2QML A;  1P4N A;  5IB0 A;  5JH9 A;  5LYF A;  1B87 A;  4OKO A;  1NSL A;  4CRY B;  4JJX A;  2FAV A;  2PVV A;  2JLM A;  4HKF A;  2DF5 A;  3JRU A;  2PIZ A;  1QMU A;  3PFO A;  2EEE A;  3EWR A;  3R9E A;  3FX6 A;  2P6G A;  4YFJ A;  3PBB A;  2XEF A;  3ISZ A;  5K8O A;  2FE7 A;  1X12 A;  3WC5 A;  3SJE A;  3D7H A;  4JXR A;  4M6G A;  4UCN A;  1Z8L A;  2DEA A;  4OC1 A;  3KHZ A;  1XIX A;  2G3T A;  4C7I A;  4CAX A;  4CYO A;  3IIF A;  3I3G A;  3NH8 A;  3ZZI A;  3CT9 A;  3SII A;  1BO4 A;  3VWD A;  5CPA A;  7CPA A;  2XD7 A;  1KUX A;  1LAP A;  3MRU A;  4OC5 A;  5H86 A;  2VRI A;  3B3W A;  1JQG A;  3D3S A;  3H4Q A;  1S7K A;  4FUU A;  3EWO A;  2F7V A;  4U9Y A;  2PJ2 A;  4FAI A;  1Z4R A;  4MBU A;  2H5M A;  1RTQ A;  3GUX A;  4NJQ A;  1VKC A;  5CNP A;  1BPM A;  5G21 A;  3LWU A;  1IOF A;  2ZEN A;  3P2F A;  3EW5 A;  4L89 A;  4JLY A;  4R8F A;  1VHU A;  2O4H A;  4RI1 A;  3F0A A;  4OLL A;  4B12 A;  3T9Y A;  4KSF A;  3HLP A;  1F2O A;  4CAF A;  5K8P A;  4H89 A;  1CG2 A;  3OWC A;  3FRM A;  3PRT A;  4C7H A;  4J5Q A;  1Q2C A;  3PGP A;  4CGL A;  4UEZ A;  3B8G A;  3ETI A;  2AFS A;  2A4N A;  2OU2 A;  2VZY A;  2V77 A;  4FD4 A;  4ABL A;  1MJA A;  4B10 A;  3PEI A;  2FS5 A;  4R87 A;  2OH1 A;  3SI2 A;  2B5G A;  2OZG A;  3V45 A;  2PJ1 A;  1TY8 A;  2FSR A;  2ODF A;  5HMN A;  4KSI A;  2ZEG A;  2ZEE A;  3I1U A;  4C2Y A;  4OID A;  2VQY A;  1IY7 A;  1ARM A;  1Z8W A;  2BSW A;  2EUI A;  4MY0 A;  4EWT A;  5A27 A;  3FF3 A;  3EXN A;  4GVV A;  4A39 A;  5J8C A;  2ZOG A;  3S6F A;  4DUK A;  2NYQ A;  1UFH A;  4CPA A;  4X8I A; 
#chains in the Genus database with same CATH homology
 1AMP A;  2IJZ A;  3NFZ A;  4PPZ A;  2RB7 A;  4MCP A;  5HXD A;  3FH4 A;  4P45 A;  1Y7E A;  3EJG A;  3SIH A;  1IGB A;  2XEG A;  1EE3 P;  4J5S A;  5CB3 A;  2DX6 A;  2C6C A;  2ABZ A;  4JLL A;  2AFW A;  3Q6Z A;  4UIB A;  3IO1 A;  2V8H A;  4PXE A;  5ELY A;  3PBE A;  5D29 A;  4JYW A;  3NA6 A;  3V2B A;  3SI0 A;  2PJ4 A;  3V38 A;  1KWM A;  1ZG9 A;  4NGR A;  4D86 A;  1TXR A;  4F9U A;  2PJ3 A;  4P10 A;  3KQX A;  4ZYQ A;  1NJR A;  4F9V A;  1CP6 A;  3H8F A;  4ZY1 A;  4EME A;  4ZX9 A;  4J4Z A;  3BI1 A;  2AFM A;  1YW6 A;  4UEF A;  1XMB A;  3H8E A;  2JEW A;  3FEC A;  5J1Q A;  4MRI A;  1XBU A;  5FSZ A;  4LQG A;  5CB5 A;  4ZY0 A;  2PIY A;  3D68 A;  2BOA A;  3NH5 A;  2AFU A;  3PFE A;  4ETK A;  3ISX A;  2WZN A;  3B3V A;  1Z5R A;  3Q71 A;  5DS0 A;  3LMS A;  3K2K A;  2GU2 A;  4FBE A;  2XEI A;  2HC9 A;  3FMC A;  2C6P A;  1YLO A;  3B3C A;  3RBU A;  2ACF A;  4NGQ A;  3B35 A;  4MHZ A;  2PVW A;  3S9L A;  2JBJ A;  4PQA A;  4WWV A;  4JCA A;  2PJA A;  3FJU A;  2PJ7 A;  4GM5 A;  3IEH A;  2BO9 A;  2QYV A;  1LCP A;  2XEJ A;  4FWU A;  4NGT A;  3SIG A;  1YD9 A;  2F8H A;  2Q51 A;  4P4E A;  3WC6 A;  2G9D A;  3SIJ A;  1PYT B;  2PJB A;  4UML A;  2PJ8 A;  3CPX A;  8CPA A;  2PJ9 A;  3NH4 A;  1GYT A;  3IWW A;  3JZT A;  4DYO A;  1TKH A;  2BFR A;  4JGK A;  1ELM P;  1XRY A;  2POK A;  2V8G A;  1F57 A;  2AFO A;  4Q7A A;  3GB0 A;  4OC2 A;  2Q43 A;  2BCO A;  4K3N A;  1CPS A;  5HVF A;  4R6T A;  3V7Z A;  3KR5 A;  1R3N A;  3IFE A;  4MHP A;  4A94 A;  4ETJ A;  4IHM A;  3KAS A;  2EWB A;  2L8R A;  4P44 A;  2IMO A;  2FXK A;  1OBR A;  1Z2L A;  3VAT A;  1TF8 A;  4PXC A;  3FEE A;  2ZEF A;  2V8V A;  4OIW A;  1XJO A;  3KL9 A;  5E3B A;  3DLJ A;  2AFC A;  4GUA A;  3GLJ A;  4KYB A;  3SJF A;  3KQZ A;  3HUV A;  1HDQ A;  4F8Z A;  6CPA A;  5HVH A;  2CIJ A;  1Y0R A;  4OME A;  5D8N A;  5IB9 A;  2AFZ A;  2O53 A;  2GLF A;  2JBK A;  2QJ8 A;  4UEE A;  3BI0 A;  3GQO A;  1Y0Y A;  2ZEM A;  3MN8 A;  2NSM A;  5LRG A;  3TX8 A;  1CBX A;  4NJR A;  2CTB A;  3SI1 A;  3QNV A;  3RZA A;  1VGY A;  1ZLH A;  4P6Y A;  3EJF A;  4BD9 A;  2AFX A;  1BPN A;  1YSJ A;  3SJX A;  5FSY A;  3KI9 A;  1HDU A;  1PCA A;  4A38 A;  4MCS A;  4GVW A;  3VH9 A;  3GPG A;  3IC1 A;  4EFD A;  1DTD A;  3PB8 X;  3PB7 X;  1F2P A;  2PJC A;  4ONW A;  2PRQ A;  4IK2 A;  3D66 A;  4TU0 A;  4R7M A;  4G1P A;  3KR4 A;  4YWY A;  3H8G A;  1SPV A;  2ZEH A;  2ZEL A;  1UWY A;  5FSV A;  2EK8 A;  3VFQ A;  2X47 A;  3T8W A;  1NSA A;  2GRE A;  4P4J A;  3B3S A;  4ABK A;  4WJB A;  5FSX A;  3IIB A;  2OR4 A;  2ZED A;  3L2N A;  2RFH A;  3S9M A;  3KGQ A;  4AXV A;  3PB6 X;  4P4F A;  1YW4 A;  3BXM A;  1Q7L A;  5K8N A;  3KZW A;  2C1C A;  4YU9 A;  3TC8 A;  4MMO A;  1ZG7 A;  4P4D A;  2CF4 A;  3D7G A;  4IAV A;  4PXD A;  1YME A;  4TWE A;  3B3T A;  5FSU A;  3D7F A;  1VHE A;  2PJ5 A;  2CTC A;  3D67 A;  1LOK A;  4MCR A;  5CMS A;  1ZR5 A;  3FVL A;  2GLJ A;  4ZX8 A;  5LYD A;  1CX8 A;  4JZ0 A;  2QVP A;  4RUH A;  5K8M A;  4X2T A;  2HB6 A;  1VIX A;  3K9T A;  4OP4 A;  3SJG A;  4NGM A;  4K0C A;  1ARL A;  5THW A;  4B6Z A;  3PB9 X;  5CBM A;  7CPA A;  4A37 A;  4X3R A;  4P4I A;  2VL1 A;  1R43 A;  4OC0 A;  4PXB A;  3GPQ A;  5DUS A;  3D4U A;  4OC3 A;  1VHO A;  4NGP A;  4DJL A;  5F09 A;  5HIH A;  2I3C A;  4JVV A;  4IQY A;  4TNU A;  5I4M A;  3EWP A;  4ZY2 A;  5JM6 A;  3GQE A;  4MXU A;  1ZR3 A;  3B2Y A;  4H2K A;  3S9N A;  3WC7 A;  5HOL A;  2IQ6 A;  2FG1 A;  2ZEO A;  4O23 A;  1LAM A;  3GPO A;  2WYR A;  1LAN A;  2PE3 A;  4Z65 A;  4R76 A;  2FVG A;  4MHY A;  1ELL P;  2ANP A;  2J9A A;  3B7I A;  3BHX A;  1DE4 C;  4MHN A;  1XFO A;  3VAR A;  4NGN A;  2Q4Z A;  5LRJ A;  2OOT A;  3IJ3 A;  1FT7 A;  4MCQ A;  3D7D A;  5LYI A;  1AYE A;  4OC4 A;  3PB4 X;  4ZI6 A;  3CDX A;  5LYL A;  1FNO A;  5JGF A;  1ZLI A;  5LRK A;  1CP7 A;  5AIL A;  1TF9 A;  3WT4 A;  2BFQ A;  1LFW A;  2PJ0 A;  1TKJ A;  3N5F A;  2PCU A;  4P4B A;  3RAM A;  1QQ9 A;  3IID A;  4NFR A;  4NGS A;  3CPA A;  1H8L A;  2ZOF A;  3EWQ A;  1CPX A;  4ESS A;  2ZEP A;  4UIA A;  2EK9 A;  5HVG A;  2LGR A;  1BAV A;  1TKF A;  1BLL E;  3DGV A;  4J5R A;  1HEE A;  2V8D A;  1TXZ A;  1ZG8 A;  3KHX A;  3WAB A;  3FED A;  3EKE A;  1M4L A;  2C6G A;  4W9Y A;  2PJ6 A;  1HJZ A;  4UF4 A;  5JH9 A;  5LYF A;  4OKO A;  2FAV A;  2PVV A;  3JRU A;  2PIZ A;  1QMU A;  3PFO A;  2EEE A;  3EWR A;  3FX6 A;  3PBB A;  2XEF A;  3ISZ A;  5K8O A;  3WC5 A;  3SJE A;  3D7H A;  1Z8L A;  2DEA A;  4OC1 A;  3KHZ A;  3IIF A;  3NH8 A;  3CT9 A;  3SII A;  5CPA A;  2XD7 A;  1LAP A;  3MRU A;  4OC5 A;  2VRI A;  3B3W A;  1JQG A;  4FUU A;  3EWO A;  2F7V A;  4FAI A;  2PJ2 A;  1RTQ A;  3GUX A;  4NJQ A;  1BPM A;  3LWU A;  2ZEN A;  3EW5 A;  4R8F A;  1VHU A;  2O4H A;  3HLP A;  1F2O A;  5K8P A;  1CG2 A;  3PRT A;  4J5Q A;  4UEZ A;  3ETI A;  2AFS A;  2V77 A;  4ABL A;  3PEI A;  3SI2 A;  3V45 A;  2PJ1 A;  1TY8 A;  4KSI A;  2ZEG A;  2ZEE A;  3I1U A;  4OID A;  1IY7 A;  1ARM A;  4EWT A;  3FF3 A;  4GVV A;  4A39 A;  2ZOG A;  4DUK A;  2NYQ A;  4CPA A;  4X8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...