1LAMA

Leucine aminopeptidase (unligated)
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
484
structure length
484
Chain Sequence
TKGLVLGIYSKEKEEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Two-metal ion mechanism of bovine lens leucine aminopeptidase: active site solvent structure and binding mode of L-leucinal, a gem-diolate transition state analogue, by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase (alpha-aminoacylpeptide)
molecule keywords LEUCINE AMINOPEPTIDASE
total genus 174
structure length 484
sequence length 484
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 1995-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1lamA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1lamA02
2JEWA 1ZR3A 2PCUA 3GQEA 1Y0RA 4MCQA 3D7GA 2PJ3A 4EWTA 3VFQA 4K0CA 3SI1A 4AXVA 5LRKA 2BOAA 4NGSA 2BCOA 4MHNA 2OOTA 2ZOGA 1H8LA 3V2BA 1Q7LA 3BI0A 4PXCA 5LYDA 3IWWA 1NSAA 2V8VA 4BD9A 1BAVA 3FEEA 2BO9A 3WC5A 2GLFA 1YMEA 6CPAA 2ZENA 3IFEA 5CB5A 4ZY0A 3B7IA 4P4JA 3BHXA 5HOLA 3GB0A 1YW4A 2CTCA 2ZEDA 5AILA 1ZG7A 3PB6X 2QVPA 2PJ6A 3WT4A 3Q71A 4A38A 5I4MA 1ELMP 2C6CA 3FH4A 3ISZA 3KASA 2QJ8A 1OBRA 4ESSA 4TU0A 1YD9A 3GQOA 2AFSA 2WYRA 1LANA 2PJ9A 4P44A 4NJRA 4IK2A 5FSXA 1YLOA 3TX8A 4OC4A 3B35A 4G1PA 1ZG8A 3RAMA 2ACFA 3GLJA 4OC5A 4JYWA 4MCRA 3NH8A 4P10A 4RUHA 3PRTA 4R6TA 1PYTB 1TKHA 3CPAA 1FT7A 3SJXA 3H8FA 3EJFA 5K8MA 1FNOA 3FECA 4OP4A 3S9LA 2PJBA 4MHPA 5JH9A 1HJZA 4ONWA 4NGQA 2RB7A 1TY8A 2ZEMA 5HXDA 8CPAA 2O53A 2RFHA 4P4EA 4F9UA 1LCPA 4MXUA 1BPMA 4H2KA 3MN8A 3D7HA 1ZLIA 3EKEA 4OMEA 5LYIA 2ZELA 3EJGA 2V77A 1Z8LA 3D68A 2ANPA 4R76A 3IC1A 4UF4A 1LAPA 4JZ0A 3PBBA 4A94A 4UEZA 5K8PA 1VHUA 4UEFA 1CG2A 3KHXA 1CPXA 4DJLA 2XD7A 4TWEA 2PVVA 5HIHA 4EMEA 4Q7AA 5LRJA 4ZYQA 5CB3A 3B2YA 2ZEEA 2PJ4A 4OIDA 3KR5A 2Q4ZA 2AFUA 3PB8X 5DUSA 1XMBA 3SIIA 2PJAA 2F7VA 1Y0YA 3KQXA 3SJEA 1ELLP 3K2KA 4MCSA 4A39A 5HVHA 4P4DA 4ETJA 3B3TA 2C1CA 1TXRA 5LYFA 4A37A 3EWPA 3FF3A 5DS0A 5FSUA 2FXKA 3I1UA 4UIAA 3WC6A 5F09A 3D4UA 2EK8A 3EWQA 4MMOA 4B6ZA 1YSJA 3D67A 5CBMA 2GU2A 4JVVA 1CP6A 3H8GA 4KSIA 1XJOA 3FJUA 3D66A 1UWYA 4F8ZA 4TNUA 3T8WA 3NH5A 4DYOA 2CTBA 3B3VA 1EE3P 4OC2A 2Q43A 2VRIA 2PJ5A 3CDXA 2PJ7A 4MHZA 3QNVA 4FWUA 5IB9A 4JLLA 4OC3A 3IO1A 2PJ0A 4JCAA 4KYBA 3JRUA 2ABZA 1XBUA 4LQGA 2NYQA 2XEJA 2O4HA 1ARMA 2AFZA 4JGKA 5LRGA 4FBEA 4DUKA 3S9MA 3K9TA 2CIJA 2PE3A 4F9VA 3GPQA 2PVWA 3SJFA 2XEIA 4J5QA 2AFMA 3SIJA 1R43A 2XEFA 4NJQA 3IJ3A 1ZLHA 2IQ6A 3PBEA 3PB4X 2ZEFA 3KQZA 1TKJA 4WWVA 4R7MA 4J4ZA 3KZWA 2AFWA 3D7FA 4O23A 5HVGA 4MCPA 3CT9A 5CMSA 4PQAA 4ETKA 2DX6A 2JBKA 3SJGA 5K8OA 2PJCA 4UEEA 5JM6A 4OC1A 3S9NA 4MRIA 3EW5A 3GPOA 2JBJA 3D7DA 4UIBA 1TKFA 4NFRA 2IMOA 1GYTA 4OKOA 3PFEA 3PB9X 3SIGA 1BLLE 3GPGA 1IY7A 3SI0A 2ZEHA 3B3SA 2PIZA 2WZNA 2F8HA 2ZEOA 3HLPA 4YWYA 3KL9A 1CPSA 3MRUA 4OIWA 1R3NA 2L8RA 4PXEA 1TF9A 2POKA 3EWRA 3BI1A 2XEGA 4NGRA 3JZTA 4GVWA 2CF4A 2J9AA 2HC9A 1AYEA 4YU9A 4P4IA 3TC8A 4WJBA 3KGQA 2NSMA 2G9DA 4NGPA 1JQGA 5THWA 4GUAA 7CPAA 5K8NA 3DLJA 4D86A 1BPNA 3LMSA 2LGRA 4P4FA 2FVGA 2ZEPA 4P45A 2PJ8A 1AMPA 5ELYA 5D29A 4UMLA 3HUVA 3FEDA 5E3BA 2QYVA 3WABA 1CP7A 2IJZA 1SPVA 3LWUA 4ABLA 1ZR5A 1HDUA 2I3CA 3PEIA 3GUXA 2BFRA 3IIDA 5HVFA 3FVLA 4FAIA 3B3WA 1Z2LA 3VH9A 3VATA 3IIFA 2PJ1A 3RBUA 5J1QA 1VHEA 2VL1A 2FG1A 2Q51A 4MHYA 3IEHA 4OC0A 4NGMA 4W9YA 3V45A 3BXMA 4IQYA 2ZEGA 3NFZA 4Z65A 4P6YA 1F2OA 3KHZA 3VARA 1LFWA 3NH4A 1F2PA 3CPXA 1DTDA 1RTQA 1ARLA 1QMUA 3V7ZA 2V8HA 1QQ9A 4R8FA 2C6PA 4P4BA 5LYLA 4ZY2A 2PIYA 3KI9A 2OR4A 4X3RA 4CPAA 3DGVA 4ZX9A 2AFXA 2BFQA 1NJRA 1M4LA 4ZI6A 1IGBA 1ZG9A 4IAVA 4NGNA 2X47A 4ZX8A 1Y7EA 2PRQA 3SIHA 2HB6A 2V8GA 1DE4C 4K3NA 3PFOA 1VHOA 1PCAA 3V38A 3KR4A 4GVVA 4NGTA 3EWOA 2AFCA 1F57A 1CX8A 4J5RA 3FMCA 4PXDA 1HDQA 2C6GA 1TF8A 1XFOA 4X8IA 3NA6A 1VIXA 2EWBA 2FAVA 1YW6A 3ISXA 2AFOA 3H8EA 3ETIA 3B3CA 3WC7A 1Z5RA 4ZY1A 4EFDA 2PJ2A 2GREA 5JGFA 3RZAA 4X2TA 1LAMA 5FSZA 5D8NA 1XRYA 1LOKA 1HEEA 3IIBA 2DEAA 2GLJA 4FUUA 2V8DA 2EEEA 3L2NA 5CPAA 3FX6A 1KWMA 1CBXA 2ZOFA 1TXZA 4PXBA 5FSVA 5FSYA 3PB7X 4IHMA 4J5SA 3SI2A 3Q6ZA 1VGYA 3N5FA 4ABKA 2EK9A 4PPZA 4GM5A
chains in the Genus database with same CATH superfamily
2JEWA 1ZR3A 2PCUA 4Y49C 1S7LA 1M4GA 3GQEA 1Y0RA 2B5GB 4MCQA 3D7GA 2PJ3A 4RN7A 4EWTA 3VFQA 3G3SA 2HV2A 4KVXA 1KZFA 3BLNA 4K0CA 1IU8A 2WPWA 3SI1A 4AXVA 2EBJA 3UY5A 3W91A 4BBHA 1Y9WA 3DR6A 4R3LA 1IYKA 5LRKA 2BOAA 2Q0YA 4NGSA 2BCOA 2EVNA 4QVTA 4AG9A 1S5KA 3RNZA 1FY7A 4MHNA 2ZOGA 4LQ6A 4U9ZA 1H8LA 3V2BA 2R8VA 3CZXA 1NMTA 1Q7LA 3BI0A 4PXCA 5LYDA 3EFAA 2FXFA 3IWWA 4NXYA 1NSAA 3SXNA 2V8VA 4BD9A 1BAVA 2FL4A 3FEEA 2G3AA 2P6GA 3QAYA 3W6SA 4C7HA 2B3UA 1S7NA 5G20A 1YVOA 1M1DA 2BO9A 4UWJA 3WC5A 5F49A 2GLFA 4C2YA 4A31A 2VI7A 1YMEA 2Q7BA 1PU9A 6CPAA 1YREA 2ZENA 4UFVA 3IFEA 1MJAA 5CB5A 2YNDA 4ZY0A 1RO5A 3B7IA 4KVME 4P4JA 4A95A 3BHXA 5HOLA 3GB0A 2BEIA 1YW4A 2FS5A 3F0AA 3D2PA 2CTCA 4B5PA 2PC1A 2ZEDA 3R9FA 5AILA 1ZG7A 3PB6X 4QC6A 2QMLA 2QVPA 2J8RA 3F5BA 5AGEA 3FIXA 2PJ6A 3WT4A 3Q71A 1XF8A 4A38A 5G1ZA 5I4MA 1ELMP 2C6CA 2QECA 3FH4A 3ISZA 3KASA 2J8NA 4F0XA 2GFQA 2QJ8A 3PP9A 1OBRA 3A9LA 5J8CA 4ESSA 5DWNA 4UBRA 4TU0A 4HNYB 1Q2DA 1YD9A 1V0CA 4EVYA 5C88A 4X5KA 4XNHC 3GQOA 2AFSA 2WYRA 4MI4A 1LANA 3ZZIA 4UA3A 2BSWA 2PJ9A 4R3KA 4XPDB 1BO4A 4P44A 1KUXA 5A28A 4NJRA 4HNXB 4IK2A 5FSXA 1YLOA 3TX8A 1WWZA 4OC4A 2OZGA 3B35A 4G1PA 1ZG8A 3RAMA 4M6GA 2ACFA 4R9MA 3GLJA 3P2FA 4OC5A 3TFYA 4OADA 2ARHA 1K4JA 4JYWA 4IUSA 2PR8A 4MCRA 4B12A 3NH8A 1B87A 1MK4A 4P10A 4YRHA 3PRTA 4RUHA 4R6TA 1PYTB 1TKHA 2Y0MA 3CPAA 4L8AA 1FT7A 4ZBGA 4B13A 3SJXA 3H8FA 4KVOE 3EJFA 3T9YA 5K8MA 1FNOA 4LUAA 3FECA 1Q2YA 2ZW5A 3H5ZA 1IOFA 3IU2A 4MY0A 4OP4A 1YGHA 2OZUA 3D3SA 3R9EA 3S9LA 2PJBA 4MHPA 5JH9A 1HJZA 4MHDA 4ONWA 4NGQA 2RB7A 1TY8A 1ON0A 2GIVA 2ZEMA 5C82A 5HXDA 8CPAA 1AUGA 2O53A 2RFHA 4GM5A 4P4EA 2JDCA 5EC4A 2B4BA 4F9UA 2VZYA 1LCPA 4MXUA 4UFXA 1XE4A 2G3TA 3TCVA 1BPMA 4H2KA 1X10A 2REEA 3MN8A 4F0YA 1B6BA 3D7HA 1ZLIA 1Z8XA 3EKEA 4OMEA 1QSNA 5LYIA 2ZELA 1Y9KA 3EJGA 3LD2A 3ZJ0A 2Q4VA 1Z8LA 1S7FA 2OZHA 2V77A 3D68A 2ANPA 1CJWA 4R76A 3IC1A 4FD4A 4UF4A 1LAPA 1SQHA 4KOSA 3PBBA 4JZ0A 4UEZA 4UCPA 4A2ZA 4A94A 5K8PA 4UFWA 1VHUA 4UEFA 1CG2A 3IWEA 5KTDA 3K9UA 3KHXA 1CPXA 2WUUA 4DJLA 1RXTA 4H6ZA 2CNSA 2XD7A 4TWEA 2PVVA 5HIHA 1QSOA 4AVAA 1N71A 4Q7AA 5LRJA 4EMEA 2KCWA 4AG7A 4ZYQA 5CB3A 3TO6A 3B2YA 3R95A 2Z3KA 2ZEEA 2GE3A 2P0WA 2PJ4A 4OIDA 3LODA 3DNSA 1YX0A 2D4OA 3KR5A 2Q4ZA 4KOVA 4KUBA 2AFUA 2VEZA 1L0CA 3PB8X 5DUSA 3FNCA 4CAXA 1XMBA 3SIIA 2PJAA 2F7VA 4CRYB 1Y0YA 5G22A 5KTCA 2REFA 2PDOA 4R57A 3KQXA 3FBUA 1NSLA 4B11A 3SJEA 2BL1A 4Q36A 1ELLP 5AG4A 4OLLA 1NE9A 3K2KA 4MCSA 1BOBA 4PSXA 4A39A 4F6AA 3EXNA 4CGOA 2CY2A 1UFHA 4BMHA 5HVHA 2FSRA 3IWGA 2ODFA 2R1IA 3NE8A 4KSAA 4P4DA 2Z3OA 3FRMA 4ETJA 3B3TA 2YGWA 2C1CA 1TXRA 2DPTA 3TO9A 1J4JA 2NMTA 5DWMA 5LYFA 4JJXA 4A37A 2O28A 3EWPA 5AG5A 4H6UA 5AG6A 4KORA 3FF3A 5DS0A 4CAVA 5FSUA 2FXKA 4MFQA 3I1UA 2Z3NA 4UIAA 1XMTA 1Z4RA 3WC6A 4CS0B 2BUEA 3JUWA 5F09A 1YLEA 3D4UA 2EK8A 3EWQA 3GY9A 2EUIA 4K30A 4MMOA 4ORFA 4B6ZA 1YSJA 2W2GA 5AG7A 4CYOA 3D67A 3SXOA 5CBMA 4KUAA 4C2XA 2GU2A 4CRZB 2CNTA 2PSWA 3GYAA 4CAEA 2GANA 3IU1A 4JVVA 4I49A 3PGPA 2DF5A 1CP6A 3H8GA 4KSIA 1XJOA 4MFLA 1KUYA 3FJUA 3D66A 1UWYA 4F8ZA 4FD7A 4TNUA 3T8WA 3NH5A 4R87A 4DYOA 2ZW4A 2CTBA 3B3VA 3FB3A 1JWQA 4XPKA 1EE3P 2AE6A 3CXQA 2B4DB 4NCZA 4JWPA 2Q43A 4OC2A 3WR7A 2VRIA 1Z4EA 4MY3A 2FE7A 2PJ5A 3CDXA 4M6HA 2PJ7A 4MHZA 3JVNA 1LRZA 3QNVA 3S6KA 4FWUA 4MFJA 3VWDA 5IB9A 4OAEA 4JLLA 1CM0A 4OC3A 4MFKA 3IO1A 2PJ0A 2CNMA 2ABZA 3JRUA 4JCAA 4KYBA 1XBUA 4LQGA 4E8OA 2NYQA 2JZEA 2XEJA 5CNPA 4BINA 2O4HA 3P2HA 1ARMA 4FD6A 3T90A 3BJ8A 2AFZA 4JGKA 5LRGA 4FBEA 4U9YA 2FIAA 1IB1E 4DUKA 4KLVA 2PR1A 3S9MA 4L89A 3TT2A 4KLWA 3K9TA 2CIJA 3G8WA 2DPSA 4HKFA 2H5MA 2ZW6A 2PE3A 3E0KA 4JXQA 1M44A 3GPQA 2PVWA 4B14A 4F9VA 3SJFA 2XEIA 3QAHA 4M6IA 2VBQA 4J5QA 4H89A 2AFMA 3SIJA 1R43A 3N7ZA 2XEFA 4NJQA 2Z3LA 3IJ3A 4NF1A 1ZLHA 2IQ6A 3JTKA 3PBEA 3PB4X 3DDDA 2WCTA 1KUVA 2ZEFA 4CAWA 3KQZA 1TKJA 1MJ9A 4WWVA 4R7MA 4J4ZA 3KZWA 2AFWA 3D7FA 5E96A 5IV0A 4O23A 3V8IA 5HH1A 3W6XA 5HVGA 4MCPA 3CT9A 5CMSA 4HNWB 4PQAA 4KS9A 4ETKA 2Z3PA 4CYQA 2DX6A 2JBKA 1S60A 2B58A 3SJGA 2B4DA 2OU2A 2YNCA 2PJCA 4UEEA 3NE7A 5K8OA 2JZFA 5JM6A 3MGDA 4MFZA 4OC1A 4E0AA 2A4NA 3S9NA 4MRIA 3EW5A 3GPOA 2JBJA 2ATRA 3D7DA 4UIBA 4ONUA 1TKFA 5H86A 5F47A 4NFRA 2IMOA 1GYTA 4B5PB 3D2MA 3PFEA 4OKOA 2EO8A 2OOTA 4M85A 3PB9X 2Q4YA 3SIGA 4JXRA 3R9GA 5JPHA 2Z11A 4CGLA 3R96A 1BLLE 3DSBA 3EO4A 2OB0A 3LACA 3GPGA 1IY7A 3SI0A 2ZEHA 1YR0A 3B3SA 2IL4A 3F8KA 2PIZA 4CYPA 4ZGYB 2WZNA 2F8HA 1GHEA 2ZEOA 3HLPA 2VZZA 2ZW7A 4PSWA 3KL9A 4YWYA 5F48A 1CPSA 3MRUA 1QSMA 1IIDA 4OIWA 3OWCA 1R3NA 2P6FA 4LX9A 2L8RA 3S6GA 1P4NA 4PXEA 1MJBA 1TF9A 2POKA 1IYLA 3EWRA 3TOBA 3I9SA 3EC4A 1PUAA 3BI1A 2XEGA 4NGRA 2QIRA 3JZTA 4GVWA 2CF4A 5G21A 2J9AA 2HC9A 4CYNA 1AYEA 2RC4A 1U6MA 1VHSA 2ZXVA 2OH1A 4YU9A 2B5GA 2CXAA 4P4IA 1Z9UA 1Y7RA 5KTAA 2Q7SA 4JLYA 1XIXA 3TC8A 4YFJA 5BWAB 4WJBA 3TOAA 3KGQA 4QUSA 1YVKA 5EBVA 3I3GA 2NSMA 2G9DA 5H84A 4NGPA 2WSAA 1JQGA 2RNKA 4GUAA 2WPXA 4KOYA 5THWA 3DR8A 7CPAA 5K8NA 3DLJA 4D86A 1I12A 3H4QA 2YNCC 1BPNA 3LMSA 2LGRA 4P4FA 2FVGA 2Z10A 2ZEPA 4P45A 2PJ8A 4PV6A 1AMPA 5ELYA 4QB9A 2FIWA 3GKRA 2DXQA 2R98A 2ZPAA 4KOTA 4IF5A 4RI1A 5D29A 3S6FA 4UMLA 1QSTA 3FEDA 3HUVA 5E3BA 2FCKA 2JLMA 2QYVA 3QB8A 4HPSA 3WABA 5I0CA 4J3GA 1CP7A 2KQVA 2IJZA 1SPVA 3LWUA 4ABLA 4U5YA 4MJ8A 2PRBA 1ZR5A 1IICA 1HDUA 3TO7A 2R7HA 2I3CA 2J8MA 3PEIA 3GUXA 4CGMA 2BFRA 3IIDA 5HVFA 1Q2CA 1XEBA 3FVLA 5J8FA 2Q04A 4FAIA 1TIQA 1Z2LA 3B3WA 2JZDA 1YQEA 3R1KA 4GXHA 3VATA 3VH9A 3IIFA 2PJ1A 4II9A 3RBUA 4CAFA 3D8PA 5J1QA 1VHEA 2VL1A 2FG1A 2K5TA 2Q51A 4KSFA 3SHPA 4MHYA 3IEHA 4Y49B 4MBUA 4OC0A 4NGMA 2HQYA 4JD6A 4AVBA 4W9YA 3V45A 1M4DA 1S7KA 1P0HA 3BXMA 4IQYA 4UWIA 2ZEGA 3NFZA 4Z65A 4P6YA 3TTHA 1F2OA 3KHZA 3VARA 4C2ZA 1LFWA 3NH4A 3FXTA 1F2PA 5FVJA 3CPXA 5IB0A 2Z3MA 4KOWA 1DTDA 1RTQA 2I00A 5EMIA 2JEVA 4YGOA 1ARLA 1QMUA 3V7ZA 4XPDC 2X7BA 1QSRA 1QQ9A 2V8HA 4R8FA 2C6PA 5A27A 4P4BA 2VQYA 1I1DA 2JDDA 4NEXA 5HMNA 4ZY2A 4C68A 2PIYA 5LYLA 3KI9A 2OR4A 4UCNA 4X3RA 4CPAA 3DGVA 4ZX9A 3TE4A 2AFXA 1A2ZA 2BFQA 1IOIA 1ZO0A 1NJRA 1M4LA 1M4IA 4ZI6A 1IGBA 1XOVA 2AJ6A 1ZG9A 4IAVA 4XPLA 2HUZA 4AB7A 3CXSA 4NGNA 4PK2A 2X47A 4ZX8A 1Y7EA 2PRQA 3C26A 2VXKA 3SIHA 2HB6A 2V8GA 5JQ4A 1DE4C 5ISVA 2YNEA 4K3NA 5GCNA 2G0BA 4XNHB 3PFOA 1VHOA 3VWEA 1PCAA 3RYOA 3KR4A 3V38A 4A32A 4GVVA 4NGTA 3PZJA 3EWOA 4KOXA 2AFCA 4NSQA 1F57A 1CX8A 1YK3A 4PK3A 4CGNA 4J5RA 1VKCA 3FMCA 3FYNA 4PXDA 1HDQA 2C6GA 1TF8A 2D4PA 1XFOA 2C27A 2FT0A 3GIUA 4KZTA 1WK4A 4X8IA 3NA6A 1VIXA 2EWBA 2FAVA 1YW6A 3ISXA 4A30A 3RO0A 4RS2A 4C7IA 2AFOA 3H8EA 3ETIA 3B3CA 3WC7A 1Z5RA 4ZY1A 4EFDA 2PJ2A 3KKWA 2GREA 4A33A 4B5OA 2Q44A 5JGFA 1S3ZA 4M3SA 4X2TA 3RZAA 1OZPA 2I79A 1LAMA 2B3VA 4GS4A 5FSZA 5D8NA 1XRYA 1LOKA 2P6EA 1HEEA 3IIBA 4Q38A 2DEAA 2GLJA 4FUUA 4B10A 1Z8WA 2V8DA 2EEEA 1X12A 4QBJA 4MFPA 5IX3A 4DNCA 3L2NA 5CPAA 1R57A 3CXPA 3FX6A 1KWMA 1CBXA 2ZOFA 1TXZA 3BJ7A 3EY5A 4PXBA 2F5IA 5FSVA 5FSYA 3PB7X 4IHMA 3B8GA 4CGPA 4J5SA 3SI2A 4E2AA 3Q6ZA 1VGYA 1Z8TA 3S6HA 4FD5A 1I21A 2PQ8A 4ABKA 3N5FA 2EK9A 3IGRA 4AVCA 4UCMA 4KOUA 4PPZA 5F46A 2Z0ZA
chains in the Genus database with same CATH topology
2JEWA 1ZR3A 2PCUA 3GQEA 1Y0RA 4MCQA 3D7GA 2PJ3A 4EWTA 3VFQA 4K0CA 3SI1A 4AXVA 5LRKA 2BOAA 4NGSA 2BCOA 4MHNA 2OOTA 2ZOGA 1H8LA 3V2BA 1Q7LA 3BI0A 4PXCA 5LYDA 3IWWA 1NSAA 2V8VA 4BD9A 1BAVA 3FEEA 2BO9A 3WC5A 2GLFA 1YMEA 6CPAA 2ZENA 3IFEA 5CB5A 4ZY0A 3B7IA 4P4JA 3BHXA 5HOLA 3GB0A 1YW4A 2CTCA 2ZEDA 5AILA 1ZG7A 3PB6X 2QVPA 2PJ6A 3WT4A 3Q71A 4A38A 5I4MA 1ELMP 2C6CA 3FH4A 3ISZA 3KASA 2QJ8A 1OBRA 4ESSA 4TU0A 1YD9A 3GQOA 2AFSA 2WYRA 1LANA 2PJ9A 4P44A 4NJRA 4IK2A 5FSXA 1YLOA 3TX8A 4OC4A 3B35A 4G1PA 1ZG8A 3RAMA 2ACFA 3GLJA 4OC5A 4JYWA 4MCRA 3NH8A 4P10A 4RUHA 3PRTA 4R6TA 1PYTB 1TKHA 3CPAA 1FT7A 3SJXA 3H8FA 3EJFA 5K8MA 1FNOA 3FECA 4OP4A 3S9LA 2PJBA 4MHPA 5JH9A 1HJZA 4ONWA 4NGQA 2RB7A 1TY8A 2ZEMA 5HXDA 8CPAA 2O53A 2RFHA 4P4EA 4F9UA 1LCPA 4MXUA 1BPMA 4H2KA 3MN8A 3D7HA 1ZLIA 3EKEA 4OMEA 5LYIA 2ZELA 3EJGA 2V77A 1Z8LA 3D68A 2ANPA 4R76A 3IC1A 4UF4A 1LAPA 4JZ0A 3PBBA 4A94A 4UEZA 5K8PA 1VHUA 4UEFA 1CG2A 3KHXA 1CPXA 4DJLA 2XD7A 4TWEA 2PVVA 5HIHA 4EMEA 4Q7AA 5LRJA 4ZYQA 5CB3A 3B2YA 2ZEEA 2PJ4A 4OIDA 3KR5A 2Q4ZA 2AFUA 3PB8X 5DUSA 1XMBA 3SIIA 2PJAA 2F7VA 1Y0YA 3KQXA 3SJEA 1ELLP 3K2KA 4MCSA 4A39A 5HVHA 4P4DA 4ETJA 3B3TA 2C1CA 1TXRA 5LYFA 4A37A 3EWPA 3FF3A 5DS0A 5FSUA 2FXKA 3I1UA 4UIAA 3WC6A 5F09A 3D4UA 2EK8A 3EWQA 4MMOA 4B6ZA 1YSJA 3D67A 5CBMA 2GU2A 4JVVA 1CP6A 3H8GA 4KSIA 1XJOA 3FJUA 3D66A 1UWYA 4F8ZA 4TNUA 3T8WA 3NH5A 4DYOA 2CTBA 3B3VA 1EE3P 4OC2A 2Q43A 2VRIA 2PJ5A 3CDXA 2PJ7A 4MHZA 3QNVA 4FWUA 5IB9A 4JLLA 4OC3A 3IO1A 2PJ0A 4JCAA 4KYBA 3JRUA 2ABZA 1XBUA 4LQGA 2NYQA 2XEJA 2O4HA 1ARMA 2AFZA 4JGKA 5LRGA 4FBEA 4DUKA 3S9MA 3K9TA 2CIJA 2PE3A 4F9VA 3GPQA 2PVWA 3SJFA 2XEIA 4J5QA 2AFMA 3SIJA 1R43A 2XEFA 4NJQA 3IJ3A 1ZLHA 2IQ6A 3PBEA 3PB4X 2ZEFA 3KQZA 1TKJA 4WWVA 4R7MA 4J4ZA 3KZWA 2AFWA 3D7FA 4O23A 5HVGA 4MCPA 3CT9A 5CMSA 4PQAA 4ETKA 2DX6A 2JBKA 3SJGA 5K8OA 2PJCA 4UEEA 5JM6A 4OC1A 3S9NA 4MRIA 3EW5A 3GPOA 2JBJA 3D7DA 4UIBA 1TKFA 4NFRA 2IMOA 1GYTA 4OKOA 3PFEA 3PB9X 3SIGA 1BLLE 3GPGA 1IY7A 3SI0A 2ZEHA 3B3SA 2PIZA 2WZNA 2F8HA 2ZEOA 3HLPA 4YWYA 3KL9A 1CPSA 3MRUA 4OIWA 1R3NA 2L8RA 4PXEA 1TF9A 2POKA 3EWRA 3BI1A 2XEGA 4NGRA 3JZTA 4GVWA 2CF4A 2J9AA 2HC9A 1AYEA 4YU9A 4P4IA 3TC8A 4WJBA 3KGQA 2NSMA 2G9DA 4NGPA 1JQGA 5THWA 4GUAA 7CPAA 5K8NA 3DLJA 4D86A 1BPNA 3LMSA 2LGRA 4P4FA 2FVGA 2ZEPA 4P45A 2PJ8A 1AMPA 5ELYA 5D29A 4UMLA 3HUVA 3FEDA 5E3BA 2QYVA 3WABA 1CP7A 2IJZA 1SPVA 3LWUA 4ABLA 1ZR5A 1HDUA 2I3CA 3PEIA 3GUXA 2BFRA 3IIDA 5HVFA 3FVLA 4FAIA 3B3WA 1Z2LA 3VH9A 3VATA 3IIFA 2PJ1A 3RBUA 5J1QA 1VHEA 2VL1A 2FG1A 2Q51A 4MHYA 3IEHA 4OC0A 4NGMA 4W9YA 3V45A 3BXMA 4IQYA 2ZEGA 3NFZA 4Z65A 4P6YA 1F2OA 3KHZA 3VARA 1LFWA 3NH4A 1F2PA 3CPXA 1DTDA 1RTQA 1ARLA 1QMUA 3V7ZA 2V8HA 1QQ9A 4R8FA 2C6PA 4P4BA 5LYLA 4ZY2A 2PIYA 3KI9A 2OR4A 4X3RA 4CPAA 3DGVA 4ZX9A 2AFXA 2BFQA 1NJRA 1M4LA 4ZI6A 1IGBA 1ZG9A 4IAVA 4NGNA 2X47A 4ZX8A 1Y7EA 2PRQA 3SIHA 2HB6A 2V8GA 1DE4C 4K3NA 3PFOA 1VHOA 1PCAA 3V38A 3KR4A 4GVVA 4NGTA 3EWOA 2AFCA 1F57A 1CX8A 4J5RA 3FMCA 4PXDA 1HDQA 2C6GA 1TF8A 1XFOA 4X8IA 3NA6A 1VIXA 2EWBA 2FAVA 1YW6A 3ISXA 2AFOA 3H8EA 3ETIA 3B3CA 3WC7A 1Z5RA 4ZY1A 4EFDA 2PJ2A 2GREA 5JGFA 3RZAA 4X2TA 1LAMA 5FSZA 5D8NA 1XRYA 1LOKA 1HEEA 3IIBA 2DEAA 2GLJA 4FUUA 2V8DA 2EEEA 3L2NA 5CPAA 3FX6A 1KWMA 1CBXA 2ZOFA 1TXZA 4PXBA 5FSVA 5FSYA 3PB7X 4IHMA 4J5SA 3SI2A 3Q6ZA 1VGYA 3N5FA 4ABKA 2EK9A 4PPZA 4GM5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JEW A;  1ZR3 A;  2PCU A;  3GQE A;  1Y0R A;  4MCQ A;  3D7G A;  2PJ3 A;  4EWT A;  3VFQ A;  4K0C A;  3SI1 A;  4AXV A;  5LRK A;  2BOA A;  4NGS A;  2BCO A;  4MHN A;  2OOT A;  2ZOG A;  1H8L A;  3V2B A;  1Q7L A;  3BI0 A;  4PXC A;  5LYD A;  3IWW A;  1NSA A;  2V8V A;  4BD9 A;  1BAV A;  3FEE A;  2BO9 A;  3WC5 A;  2GLF A;  1YME A;  6CPA A;  2ZEN A;  3IFE A;  5CB5 A;  4ZY0 A;  3B7I A;  4P4J A;  3BHX A;  5HOL A;  3GB0 A;  1YW4 A;  2CTC A;  2ZED A;  5AIL A;  1ZG7 A;  3PB6 X;  2QVP A;  2PJ6 A;  3WT4 A;  3Q71 A;  4A38 A;  5I4M A;  1ELM P;  2C6C A;  3FH4 A;  3ISZ A;  3KAS A;  2QJ8 A;  1OBR A;  4ESS A;  4TU0 A;  1YD9 A;  3GQO A;  2AFS A;  2WYR A;  1LAN A;  2PJ9 A;  4P44 A;  4NJR A;  4IK2 A;  5FSX A;  1YLO A;  3TX8 A;  4OC4 A;  3B35 A;  4G1P A;  1ZG8 A;  3RAM A;  2ACF A;  3GLJ A;  4OC5 A;  4JYW A;  4MCR A;  3NH8 A;  4P10 A;  4RUH A;  3PRT A;  4R6T A;  1PYT B;  1TKH A;  3CPA A;  1FT7 A;  3SJX A;  3H8F A;  3EJF A;  5K8M A;  1FNO A;  3FEC A;  4OP4 A;  3S9L A;  2PJB A;  4MHP A;  5JH9 A;  1HJZ A;  4ONW A;  4NGQ A;  2RB7 A;  1TY8 A;  2ZEM A;  5HXD A;  8CPA A;  2O53 A;  2RFH A;  4P4E A;  4F9U A;  1LCP A;  4MXU A;  1BPM A;  4H2K A;  3MN8 A;  3D7H A;  1ZLI A;  3EKE A;  4OME A;  5LYI A;  2ZEL A;  3EJG A;  2V77 A;  1Z8L A;  3D68 A;  2ANP A;  4R76 A;  3IC1 A;  4UF4 A;  1LAP A;  4JZ0 A;  3PBB A;  4A94 A;  4UEZ A;  5K8P A;  1VHU A;  4UEF A;  1CG2 A;  3KHX A;  1CPX A;  4DJL A;  2XD7 A;  4TWE A;  2PVV A;  5HIH A;  4EME A;  4Q7A A;  5LRJ A;  4ZYQ A;  5CB3 A;  3B2Y A;  2ZEE A;  2PJ4 A;  4OID A;  3KR5 A;  2Q4Z A;  2AFU A;  3PB8 X;  5DUS A;  1XMB A;  3SII A;  2PJA A;  2F7V A;  1Y0Y A;  3KQX A;  3SJE A;  1ELL P;  3K2K A;  4MCS A;  4A39 A;  5HVH A;  4P4D A;  4ETJ A;  3B3T A;  2C1C A;  1TXR A;  5LYF A;  4A37 A;  3EWP A;  3FF3 A;  5DS0 A;  5FSU A;  2FXK A;  3I1U A;  4UIA A;  3WC6 A;  5F09 A;  3D4U A;  2EK8 A;  3EWQ A;  4MMO A;  4B6Z A;  1YSJ A;  3D67 A;  5CBM A;  2GU2 A;  4JVV A;  1CP6 A;  3H8G A;  4KSI A;  1XJO A;  3FJU A;  3D66 A;  1UWY A;  4F8Z A;  4TNU A;  3T8W A;  3NH5 A;  4DYO A;  2CTB A;  3B3V A;  1EE3 P;  4OC2 A;  2Q43 A;  2VRI A;  2PJ5 A;  3CDX A;  2PJ7 A;  4MHZ A;  3QNV A;  4FWU A;  5IB9 A;  4JLL A;  4OC3 A;  3IO1 A;  2PJ0 A;  4JCA A;  4KYB A;  3JRU A;  2ABZ A;  1XBU A;  4LQG A;  2NYQ A;  2XEJ A;  2O4H A;  1ARM A;  2AFZ A;  4JGK A;  5LRG A;  4FBE A;  4DUK A;  3S9M A;  3K9T A;  2CIJ A;  2PE3 A;  4F9V A;  3GPQ A;  2PVW A;  3SJF A;  2XEI A;  4J5Q A;  2AFM A;  3SIJ A;  1R43 A;  2XEF A;  4NJQ A;  3IJ3 A;  1ZLH A;  2IQ6 A;  3PBE A;  3PB4 X;  2ZEF A;  3KQZ A;  1TKJ A;  4WWV A;  4R7M A;  4J4Z A;  3KZW A;  2AFW A;  3D7F A;  4O23 A;  5HVG A;  4MCP A;  3CT9 A;  5CMS A;  4PQA A;  4ETK A;  2DX6 A;  2JBK A;  3SJG A;  5K8O A;  2PJC A;  4UEE A;  5JM6 A;  4OC1 A;  3S9N A;  4MRI A;  3EW5 A;  3GPO A;  2JBJ A;  3D7D A;  4UIB A;  1TKF A;  4NFR A;  2IMO A;  1GYT A;  4OKO A;  3PFE A;  3PB9 X;  3SIG A;  1BLL E;  3GPG A;  1IY7 A;  3SI0 A;  2ZEH A;  3B3S A;  2PIZ A;  2WZN A;  2F8H A;  2ZEO A;  3HLP A;  4YWY A;  3KL9 A;  1CPS A;  3MRU A;  4OIW A;  1R3N A;  2L8R A;  4PXE A;  1TF9 A;  2POK A;  3EWR A;  3BI1 A;  2XEG A;  4NGR A;  3JZT A;  4GVW A;  2CF4 A;  2J9A A;  2HC9 A;  1AYE A;  4YU9 A;  4P4I A;  3TC8 A;  4WJB A;  3KGQ A;  2NSM A;  2G9D A;  4NGP A;  1JQG A;  5THW A;  4GUA A;  7CPA A;  5K8N A;  3DLJ A;  4D86 A;  1BPN A;  3LMS A;  2LGR A;  4P4F A;  2FVG A;  2ZEP A;  4P45 A;  2PJ8 A;  1AMP A;  5ELY A;  5D29 A;  4UML A;  3HUV A;  3FED A;  5E3B A;  2QYV A;  3WAB A;  1CP7 A;  2IJZ A;  1SPV A;  3LWU A;  4ABL A;  1ZR5 A;  1HDU A;  2I3C A;  3PEI A;  3GUX A;  2BFR A;  3IID A;  5HVF A;  3FVL A;  4FAI A;  3B3W A;  1Z2L A;  3VH9 A;  3VAT A;  3IIF A;  2PJ1 A;  3RBU A;  5J1Q A;  1VHE A;  2VL1 A;  2FG1 A;  2Q51 A;  4MHY A;  3IEH A;  4OC0 A;  4NGM A;  4W9Y A;  3V45 A;  3BXM A;  4IQY A;  2ZEG A;  3NFZ A;  4Z65 A;  4P6Y A;  1F2O A;  3KHZ A;  3VAR A;  1LFW A;  3NH4 A;  1F2P A;  3CPX A;  1DTD A;  1RTQ A;  1ARL A;  1QMU A;  3V7Z A;  2V8H A;  1QQ9 A;  4R8F A;  2C6P A;  4P4B A;  5LYL A;  4ZY2 A;  2PIY A;  3KI9 A;  2OR4 A;  4X3R A;  4CPA A;  3DGV A;  4ZX9 A;  2AFX A;  2BFQ A;  1NJR A;  1M4L A;  4ZI6 A;  1IGB A;  1ZG9 A;  4IAV A;  4NGN A;  2X47 A;  4ZX8 A;  1Y7E A;  2PRQ A;  3SIH A;  2HB6 A;  2V8G A;  1DE4 C;  4K3N A;  3PFO A;  1VHO A;  1PCA A;  3V38 A;  3KR4 A;  4GVV A;  4NGT A;  3EWO A;  2AFC A;  1F57 A;  1CX8 A;  4J5R A;  3FMC A;  4PXD A;  1HDQ A;  2C6G A;  1TF8 A;  1XFO A;  4X8I A;  3NA6 A;  1VIX A;  2EWB A;  2FAV A;  1YW6 A;  3ISX A;  2AFO A;  3H8E A;  3ETI A;  3B3C A;  3WC7 A;  1Z5R A;  4ZY1 A;  4EFD A;  2PJ2 A;  2GRE A;  5JGF A;  3RZA A;  4X2T A;  1LAM A;  5FSZ A;  5D8N A;  1XRY A;  1LOK A;  1HEE A;  3IIB A;  2DEA A;  2GLJ A;  4FUU A;  2V8D A;  2EEE A;  3L2N A;  5CPA A;  3FX6 A;  1KWM A;  1CBX A;  2ZOF A;  1TXZ A;  4PXB A;  5FSV A;  5FSY A;  3PB7 X;  4IHM A;  4J5S A;  3SI2 A;  3Q6Z A;  1VGY A;  3N5F A;  4ABK A;  2EK9 A;  4PPZ A;  4GM5 A; 
#chains in the Genus database with same CATH topology
 2JEW A;  1ZR3 A;  2PCU A;  4Y49 C;  1S7L A;  1M4G A;  3GQE A;  1Y0R A;  2B5G B;  4MCQ A;  3D7G A;  2PJ3 A;  4RN7 A;  4EWT A;  3VFQ A;  3G3S A;  2HV2 A;  4KVX A;  1KZF A;  3BLN A;  4K0C A;  1IU8 A;  2WPW A;  3SI1 A;  4AXV A;  2EBJ A;  3UY5 A;  3W91 A;  4BBH A;  1Y9W A;  3DR6 A;  4R3L A;  1IYK A;  5LRK A;  2BOA A;  2Q0Y A;  4NGS A;  2BCO A;  2EVN A;  4QVT A;  4AG9 A;  1S5K A;  3RNZ A;  1FY7 A;  4MHN A;  2ZOG A;  4LQ6 A;  4U9Z A;  1H8L A;  3V2B A;  2R8V A;  3CZX A;  1NMT A;  1Q7L A;  3BI0 A;  4PXC A;  5LYD A;  3EFA A;  2FXF A;  3IWW A;  4NXY A;  1NSA A;  3SXN A;  2V8V A;  4BD9 A;  1BAV A;  2FL4 A;  3FEE A;  2G3A A;  2P6G A;  3QAY A;  3W6S A;  4C7H A;  2B3U A;  1S7N A;  5G20 A;  1YVO A;  1M1D A;  2BO9 A;  4UWJ A;  3WC5 A;  5F49 A;  2GLF A;  4C2Y A;  4A31 A;  2VI7 A;  1YME A;  2Q7B A;  1PU9 A;  6CPA A;  1YRE A;  2ZEN A;  4UFV A;  3IFE A;  1MJA A;  5CB5 A;  2YND A;  4ZY0 A;  1RO5 A;  3B7I A;  4KVM E;  4P4J A;  4A95 A;  3BHX A;  5HOL A;  3GB0 A;  2BEI A;  1YW4 A;  2FS5 A;  3F0A A;  3D2P A;  2CTC A;  4B5P A;  2PC1 A;  2ZED A;  3R9F A;  5AIL A;  1ZG7 A;  3PB6 X;  4QC6 A;  2QML A;  2QVP A;  2J8R A;  3F5B A;  5AGE A;  3FIX A;  2PJ6 A;  3WT4 A;  3Q71 A;  1XF8 A;  4A38 A;  5G1Z A;  5I4M A;  1ELM P;  2C6C A;  2QEC A;  3FH4 A;  3ISZ A;  3KAS A;  2J8N A;  4F0X A;  2GFQ A;  2QJ8 A;  3PP9 A;  1OBR A;  3A9L A;  5J8C A;  4ESS A;  5DWN A;  4UBR A;  4TU0 A;  4HNY B;  1Q2D A;  1YD9 A;  1V0C A;  4EVY A;  5C88 A;  4X5K A;  4XNH C;  3GQO A;  2AFS A;  2WYR A;  4MI4 A;  1LAN A;  3ZZI A;  4UA3 A;  2BSW A;  2PJ9 A;  4R3K A;  4XPD B;  1BO4 A;  4P44 A;  1KUX A;  5A28 A;  4NJR A;  4HNX B;  4IK2 A;  5FSX A;  1YLO A;  3TX8 A;  1WWZ A;  4OC4 A;  2OZG A;  3B35 A;  4G1P A;  1ZG8 A;  3RAM A;  4M6G A;  2ACF A;  4R9M A;  3GLJ A;  3P2F A;  4OC5 A;  3TFY A;  4OAD A;  2ARH A;  1K4J A;  4JYW A;  4IUS A;  2PR8 A;  4MCR A;  4B12 A;  3NH8 A;  1B87 A;  1MK4 A;  4P10 A;  4YRH A;  3PRT A;  4RUH A;  4R6T A;  1PYT B;  1TKH A;  2Y0M A;  3CPA A;  4L8A A;  1FT7 A;  4ZBG A;  4B13 A;  3SJX A;  3H8F A;  4KVO E;  3EJF A;  3T9Y A;  5K8M A;  1FNO A;  4LUA A;  3FEC A;  1Q2Y A;  2ZW5 A;  3H5Z A;  1IOF A;  3IU2 A;  4MY0 A;  4OP4 A;  1YGH A;  2OZU A;  3D3S A;  3R9E A;  3S9L A;  2PJB A;  4MHP A;  5JH9 A;  1HJZ A;  4MHD A;  4ONW A;  4NGQ A;  2RB7 A;  1TY8 A;  1ON0 A;  2GIV A;  2ZEM A;  5C82 A;  5HXD A;  8CPA A;  1AUG A;  2O53 A;  2RFH A;  4GM5 A;  4P4E A;  2JDC A;  5EC4 A;  2B4B A;  4F9U A;  2VZY A;  1LCP A;  4MXU A;  4UFX A;  1XE4 A;  2G3T A;  3TCV A;  1BPM A;  4H2K A;  1X10 A;  2REE A;  3MN8 A;  4F0Y A;  1B6B A;  3D7H A;  1ZLI A;  1Z8X A;  3EKE A;  4OME A;  1QSN A;  5LYI A;  2ZEL A;  1Y9K A;  3EJG A;  3LD2 A;  3ZJ0 A;  2Q4V A;  1Z8L A;  1S7F A;  2OZH A;  2V77 A;  3D68 A;  2ANP A;  1CJW A;  4R76 A;  3IC1 A;  4FD4 A;  4UF4 A;  1LAP A;  1SQH A;  4KOS A;  3PBB A;  4JZ0 A;  4UEZ A;  4UCP A;  4A2Z A;  4A94 A;  5K8P A;  4UFW A;  1VHU A;  4UEF A;  1CG2 A;  3IWE A;  5KTD A;  3K9U A;  3KHX A;  1CPX A;  2WUU A;  4DJL A;  1RXT A;  4H6Z A;  2CNS A;  2XD7 A;  4TWE A;  2PVV A;  5HIH A;  1QSO A;  4AVA A;  1N71 A;  4Q7A A;  5LRJ A;  4EME A;  2KCW A;  4AG7 A;  4ZYQ A;  5CB3 A;  3TO6 A;  3B2Y A;  3R95 A;  2Z3K A;  2ZEE A;  2GE3 A;  2P0W A;  2PJ4 A;  4OID A;  3LOD A;  3DNS A;  1YX0 A;  2D4O A;  3KR5 A;  2Q4Z A;  4KOV A;  4KUB A;  2AFU A;  2VEZ A;  1L0C A;  3PB8 X;  5DUS A;  3FNC A;  4CAX A;  1XMB A;  3SII A;  2PJA A;  2F7V A;  4CRY B;  1Y0Y A;  5G22 A;  5KTC A;  2REF A;  2PDO A;  4R57 A;  3KQX A;  3FBU A;  1NSL A;  4B11 A;  3SJE A;  2BL1 A;  4Q36 A;  1ELL P;  5AG4 A;  4OLL A;  1NE9 A;  3K2K A;  4MCS A;  1BOB A;  4PSX A;  4A39 A;  4F6A A;  3EXN A;  4CGO A;  2CY2 A;  1UFH A;  4BMH A;  5HVH A;  2FSR A;  3IWG A;  2ODF A;  2R1I A;  3NE8 A;  4KSA A;  4P4D A;  2Z3O A;  3FRM A;  4ETJ A;  3B3T A;  2YGW A;  2C1C A;  1TXR A;  2DPT A;  3TO9 A;  1J4J A;  2NMT A;  5DWM A;  5LYF A;  4JJX A;  4A37 A;  2O28 A;  3EWP A;  5AG5 A;  4H6U A;  5AG6 A;  4KOR A;  3FF3 A;  5DS0 A;  4CAV A;  5FSU A;  2FXK A;  4MFQ A;  3I1U A;  2Z3N A;  4UIA A;  1XMT A;  1Z4R A;  3WC6 A;  4CS0 B;  2BUE A;  3JUW A;  5F09 A;  1YLE A;  3D4U A;  2EK8 A;  3EWQ A;  3GY9 A;  2EUI A;  4K30 A;  4MMO A;  4ORF A;  4B6Z A;  1YSJ A;  2W2G A;  5AG7 A;  4CYO A;  3D67 A;  3SXO A;  5CBM A;  4KUA A;  4C2X A;  2GU2 A;  4CRZ B;  2CNT A;  2PSW A;  3GYA A;  4CAE A;  2GAN A;  3IU1 A;  4JVV A;  4I49 A;  3PGP A;  2DF5 A;  1CP6 A;  3H8G A;  4KSI A;  1XJO A;  4MFL A;  1KUY A;  3FJU A;  3D66 A;  1UWY A;  4F8Z A;  4FD7 A;  4TNU A;  3T8W A;  3NH5 A;  4R87 A;  4DYO A;  2ZW4 A;  2CTB A;  3B3V A;  3FB3 A;  1JWQ A;  4XPK A;  1EE3 P;  2AE6 A;  3CXQ A;  2B4D B;  4NCZ A;  4JWP A;  2Q43 A;  4OC2 A;  3WR7 A;  2VRI A;  1Z4E A;  4MY3 A;  2FE7 A;  2PJ5 A;  3CDX A;  4M6H A;  2PJ7 A;  4MHZ A;  3JVN A;  1LRZ A;  3QNV A;  3S6K A;  4FWU A;  4MFJ A;  3VWD A;  5IB9 A;  4OAE A;  4JLL A;  1CM0 A;  4OC3 A;  4MFK A;  3IO1 A;  2PJ0 A;  2CNM A;  2ABZ A;  3JRU A;  4JCA A;  4KYB A;  1XBU A;  4LQG A;  4E8O A;  2NYQ A;  2JZE A;  2XEJ A;  5CNP A;  4BIN A;  2O4H A;  3P2H A;  1ARM A;  4FD6 A;  3T90 A;  3BJ8 A;  2AFZ A;  4JGK A;  5LRG A;  4FBE A;  4U9Y A;  2FIA A;  1IB1 E;  4DUK A;  4KLV A;  2PR1 A;  3S9M A;  4L89 A;  3TT2 A;  4KLW A;  3K9T A;  2CIJ A;  3G8W A;  2DPS A;  4HKF A;  2H5M A;  2ZW6 A;  2PE3 A;  3E0K A;  4JXQ A;  1M44 A;  3GPQ A;  2PVW A;  4B14 A;  4F9V A;  3SJF A;  2XEI A;  3QAH A;  4M6I A;  2VBQ A;  4J5Q A;  4H89 A;  2AFM A;  3SIJ A;  1R43 A;  3N7Z A;  2XEF A;  4NJQ A;  2Z3L A;  3IJ3 A;  4NF1 A;  1ZLH A;  2IQ6 A;  3JTK A;  3PBE A;  3PB4 X;  3DDD A;  2WCT A;  1KUV A;  2ZEF A;  4CAW A;  3KQZ A;  1TKJ A;  1MJ9 A;  4WWV A;  4R7M A;  4J4Z A;  3KZW A;  2AFW A;  3D7F A;  5E96 A;  5IV0 A;  4O23 A;  3V8I A;  5HH1 A;  3W6X A;  5HVG A;  4MCP A;  3CT9 A;  5CMS A;  4HNW B;  4PQA A;  4KS9 A;  4ETK A;  2Z3P A;  4CYQ A;  2DX6 A;  2JBK A;  1S60 A;  2B58 A;  3SJG A;  2B4D A;  2OU2 A;  2YNC A;  2PJC A;  4UEE A;  3NE7 A;  5K8O A;  2JZF A;  5JM6 A;  3MGD A;  4MFZ A;  4OC1 A;  4E0A A;  2A4N A;  3S9N A;  4MRI A;  3EW5 A;  3GPO A;  2JBJ A;  2ATR A;  3D7D A;  4UIB A;  4ONU A;  1TKF A;  5H86 A;  5F47 A;  4NFR A;  2IMO A;  1GYT A;  4B5P B;  3D2M A;  3PFE A;  4OKO A;  2EO8 A;  2OOT A;  4M85 A;  3PB9 X;  2Q4Y A;  3SIG A;  4JXR A;  3R9G A;  5JPH A;  2Z11 A;  4CGL A;  3R96 A;  1BLL E;  3DSB A;  3EO4 A;  2OB0 A;  3LAC A;  3GPG A;  1IY7 A;  3SI0 A;  2ZEH A;  1YR0 A;  3B3S A;  2IL4 A;  3F8K A;  2PIZ A;  4CYP A;  4ZGY B;  2WZN A;  2F8H A;  1GHE A;  2ZEO A;  3HLP A;  2VZZ A;  2ZW7 A;  4PSW A;  3KL9 A;  4YWY A;  5F48 A;  1CPS A;  3MRU A;  1QSM A;  1IID A;  4OIW A;  3OWC A;  1R3N A;  2P6F A;  4LX9 A;  2L8R A;  3S6G A;  1P4N A;  4PXE A;  1MJB A;  1TF9 A;  2POK A;  1IYL A;  3EWR A;  3TOB A;  3I9S A;  3EC4 A;  1PUA A;  3BI1 A;  2XEG A;  4NGR A;  2QIR A;  3JZT A;  4GVW A;  2CF4 A;  5G21 A;  2J9A A;  2HC9 A;  4CYN A;  1AYE A;  2RC4 A;  1U6M A;  1VHS A;  2ZXV A;  2OH1 A;  4YU9 A;  2B5G A;  2CXA A;  4P4I A;  1Z9U A;  1Y7R A;  5KTA A;  2Q7S A;  4JLY A;  1XIX A;  3TC8 A;  4YFJ A;  5BWA B;  4WJB A;  3TOA A;  3KGQ A;  4QUS A;  1YVK A;  5EBV A;  3I3G A;  2NSM A;  2G9D A;  5H84 A;  4NGP A;  2WSA A;  1JQG A;  2RNK A;  4GUA A;  2WPX A;  4KOY A;  5THW A;  3DR8 A;  7CPA A;  5K8N A;  3DLJ A;  4D86 A;  1I12 A;  3H4Q A;  2YNC C;  1BPN A;  3LMS A;  2LGR A;  4P4F A;  2FVG A;  2Z10 A;  2ZEP A;  4P45 A;  2PJ8 A;  4PV6 A;  1AMP A;  5ELY A;  4QB9 A;  2FIW A;  3GKR A;  2DXQ A;  2R98 A;  2ZPA A;  4KOT A;  4IF5 A;  4RI1 A;  5D29 A;  3S6F A;  4UML A;  1QST A;  3FED A;  3HUV A;  5E3B A;  2FCK A;  2JLM A;  2QYV A;  3QB8 A;  4HPS A;  3WAB A;  5I0C A;  4J3G A;  1CP7 A;  2KQV A;  2IJZ A;  1SPV A;  3LWU A;  4ABL A;  4U5Y A;  4MJ8 A;  2PRB A;  1ZR5 A;  1IIC A;  1HDU A;  3TO7 A;  2R7H A;  2I3C A;  2J8M A;  3PEI A;  3GUX A;  4CGM A;  2BFR A;  3IID A;  5HVF A;  1Q2C A;  1XEB A;  3FVL A;  5J8F A;  2Q04 A;  4FAI A;  1TIQ A;  1Z2L A;  3B3W A;  2JZD A;  1YQE A;  3R1K A;  4GXH A;  3VAT A;  3VH9 A;  3IIF A;  2PJ1 A;  4II9 A;  3RBU A;  4CAF A;  3D8P A;  5J1Q A;  1VHE A;  2VL1 A;  2FG1 A;  2K5T A;  2Q51 A;  4KSF A;  3SHP A;  4MHY A;  3IEH A;  4Y49 B;  4MBU A;  4OC0 A;  4NGM A;  2HQY A;  4JD6 A;  4AVB A;  4W9Y A;  3V45 A;  1M4D A;  1S7K A;  1P0H A;  3BXM A;  4IQY A;  4UWI A;  2ZEG A;  3NFZ A;  4Z65 A;  4P6Y A;  3TTH A;  1F2O A;  3KHZ A;  3VAR A;  4C2Z A;  1LFW A;  3NH4 A;  3FXT A;  1F2P A;  5FVJ A;  3CPX A;  5IB0 A;  2Z3M A;  4KOW A;  1DTD A;  1RTQ A;  2I00 A;  5EMI A;  2JEV A;  4YGO A;  1ARL A;  1QMU A;  3V7Z A;  4XPD C;  2X7B A;  1QSR A;  1QQ9 A;  2V8H A;  4R8F A;  2C6P A;  5A27 A;  4P4B A;  2VQY A;  1I1D A;  2JDD A;  4NEX A;  5HMN A;  4ZY2 A;  4C68 A;  2PIY A;  5LYL A;  3KI9 A;  2OR4 A;  4UCN A;  4X3R A;  4CPA A;  3DGV A;  4ZX9 A;  3TE4 A;  2AFX A;  1A2Z A;  2BFQ A;  1IOI A;  1ZO0 A;  1NJR A;  1M4L A;  1M4I A;  4ZI6 A;  1IGB A;  1XOV A;  2AJ6 A;  1ZG9 A;  4IAV A;  4XPL A;  2HUZ A;  4AB7 A;  3CXS A;  4NGN A;  4PK2 A;  2X47 A;  4ZX8 A;  1Y7E A;  2PRQ A;  3C26 A;  2VXK A;  3SIH A;  2HB6 A;  2V8G A;  5JQ4 A;  1DE4 C;  5ISV A;  2YNE A;  4K3N A;  5GCN A;  2G0B A;  4XNH B;  3PFO A;  1VHO A;  3VWE A;  1PCA A;  3RYO A;  3KR4 A;  3V38 A;  4A32 A;  4GVV A;  4NGT A;  3PZJ A;  3EWO A;  4KOX A;  2AFC A;  4NSQ A;  1F57 A;  1CX8 A;  1YK3 A;  4PK3 A;  4CGN A;  4J5R A;  1VKC A;  3FMC A;  3FYN A;  4PXD A;  1HDQ A;  2C6G A;  1TF8 A;  2D4P A;  1XFO A;  2C27 A;  2FT0 A;  3GIU A;  4KZT A;  1WK4 A;  4X8I A;  3NA6 A;  1VIX A;  2EWB A;  2FAV A;  1YW6 A;  3ISX A;  4A30 A;  3RO0 A;  4RS2 A;  4C7I A;  2AFO A;  3H8E A;  3ETI A;  3B3C A;  3WC7 A;  1Z5R A;  4ZY1 A;  4EFD A;  2PJ2 A;  3KKW A;  2GRE A;  4A33 A;  4B5O A;  2Q44 A;  5JGF A;  1S3Z A;  4M3S A;  4X2T A;  3RZA A;  1OZP A;  2I79 A;  1LAM A;  2B3V A;  4GS4 A;  5FSZ A;  5D8N A;  1XRY A;  1LOK A;  2P6E A;  1HEE A;  3IIB A;  4Q38 A;  2DEA A;  2GLJ A;  4FUU A;  4B10 A;  1Z8W A;  2V8D A;  2EEE A;  1X12 A;  4QBJ A;  4MFP A;  5IX3 A;  4DNC A;  3L2N A;  5CPA A;  1R57 A;  3CXP A;  3FX6 A;  1KWM A;  1CBX A;  2ZOF A;  1TXZ A;  3BJ7 A;  3EY5 A;  4PXB A;  2F5I A;  5FSV A;  5FSY A;  3PB7 X;  4IHM A;  3B8G A;  4CGP A;  4J5S A;  3SI2 A;  4E2A A;  3Q6Z A;  1VGY A;  1Z8T A;  3S6H A;  4FD5 A;  1I21 A;  2PQ8 A;  4ABK A;  3N5F A;  2EK9 A;  3IGR A;  4AVC A;  4UCM A;  4KOU A;  4PPZ A;  5F46 A;  2Z0Z A; 
#chains in the Genus database with same CATH homology
 2JEW A;  1ZR3 A;  2PCU A;  3GQE A;  1Y0R A;  4MCQ A;  3D7G A;  2PJ3 A;  4EWT A;  3VFQ A;  4K0C A;  3SI1 A;  4AXV A;  5LRK A;  2BOA A;  4NGS A;  2BCO A;  4MHN A;  2OOT A;  2ZOG A;  1H8L A;  3V2B A;  1Q7L A;  3BI0 A;  4PXC A;  5LYD A;  3IWW A;  1NSA A;  2V8V A;  4BD9 A;  1BAV A;  3FEE A;  2BO9 A;  3WC5 A;  2GLF A;  1YME A;  6CPA A;  2ZEN A;  3IFE A;  5CB5 A;  4ZY0 A;  3B7I A;  4P4J A;  3BHX A;  5HOL A;  3GB0 A;  1YW4 A;  2CTC A;  2ZED A;  5AIL A;  1ZG7 A;  3PB6 X;  2QVP A;  2PJ6 A;  3WT4 A;  3Q71 A;  4A38 A;  5I4M A;  1ELM P;  2C6C A;  3FH4 A;  3ISZ A;  3KAS A;  2QJ8 A;  1OBR A;  4ESS A;  4TU0 A;  1YD9 A;  3GQO A;  2AFS A;  2WYR A;  1LAN A;  2PJ9 A;  4P44 A;  4NJR A;  4IK2 A;  5FSX A;  1YLO A;  3TX8 A;  4OC4 A;  3B35 A;  4G1P A;  1ZG8 A;  3RAM A;  2ACF A;  3GLJ A;  4OC5 A;  4JYW A;  4MCR A;  3NH8 A;  4P10 A;  4RUH A;  3PRT A;  4R6T A;  1PYT B;  1TKH A;  3CPA A;  1FT7 A;  3SJX A;  3H8F A;  3EJF A;  5K8M A;  1FNO A;  3FEC A;  4OP4 A;  3S9L A;  2PJB A;  4MHP A;  5JH9 A;  1HJZ A;  4ONW A;  4NGQ A;  2RB7 A;  1TY8 A;  2ZEM A;  5HXD A;  8CPA A;  2O53 A;  2RFH A;  4P4E A;  4F9U A;  1LCP A;  4MXU A;  1BPM A;  4H2K A;  3MN8 A;  3D7H A;  1ZLI A;  3EKE A;  4OME A;  5LYI A;  2ZEL A;  3EJG A;  2V77 A;  1Z8L A;  3D68 A;  2ANP A;  4R76 A;  3IC1 A;  4UF4 A;  1LAP A;  4JZ0 A;  3PBB A;  4A94 A;  4UEZ A;  5K8P A;  1VHU A;  4UEF A;  1CG2 A;  3KHX A;  1CPX A;  4DJL A;  2XD7 A;  4TWE A;  2PVV A;  5HIH A;  4EME A;  4Q7A A;  5LRJ A;  4ZYQ A;  5CB3 A;  3B2Y A;  2ZEE A;  2PJ4 A;  4OID A;  3KR5 A;  2Q4Z A;  2AFU A;  3PB8 X;  5DUS A;  1XMB A;  3SII A;  2PJA A;  2F7V A;  1Y0Y A;  3KQX A;  3SJE A;  1ELL P;  3K2K A;  4MCS A;  4A39 A;  5HVH A;  4P4D A;  4ETJ A;  3B3T A;  2C1C A;  1TXR A;  5LYF A;  4A37 A;  3EWP A;  3FF3 A;  5DS0 A;  5FSU A;  2FXK A;  3I1U A;  4UIA A;  3WC6 A;  5F09 A;  3D4U A;  2EK8 A;  3EWQ A;  4MMO A;  4B6Z A;  1YSJ A;  3D67 A;  5CBM A;  2GU2 A;  4JVV A;  1CP6 A;  3H8G A;  4KSI A;  1XJO A;  3FJU A;  3D66 A;  1UWY A;  4F8Z A;  4TNU A;  3T8W A;  3NH5 A;  4DYO A;  2CTB A;  3B3V A;  1EE3 P;  4OC2 A;  2Q43 A;  2VRI A;  2PJ5 A;  3CDX A;  2PJ7 A;  4MHZ A;  3QNV A;  4FWU A;  5IB9 A;  4JLL A;  4OC3 A;  3IO1 A;  2PJ0 A;  4JCA A;  4KYB A;  3JRU A;  2ABZ A;  1XBU A;  4LQG A;  2NYQ A;  2XEJ A;  2O4H A;  1ARM A;  2AFZ A;  4JGK A;  5LRG A;  4FBE A;  4DUK A;  3S9M A;  3K9T A;  2CIJ A;  2PE3 A;  4F9V A;  3GPQ A;  2PVW A;  3SJF A;  2XEI A;  4J5Q A;  2AFM A;  3SIJ A;  1R43 A;  2XEF A;  4NJQ A;  3IJ3 A;  1ZLH A;  2IQ6 A;  3PBE A;  3PB4 X;  2ZEF A;  3KQZ A;  1TKJ A;  4WWV A;  4R7M A;  4J4Z A;  3KZW A;  2AFW A;  3D7F A;  4O23 A;  5HVG A;  4MCP A;  3CT9 A;  5CMS A;  4PQA A;  4ETK A;  2DX6 A;  2JBK A;  3SJG A;  5K8O A;  2PJC A;  4UEE A;  5JM6 A;  4OC1 A;  3S9N A;  4MRI A;  3EW5 A;  3GPO A;  2JBJ A;  3D7D A;  4UIB A;  1TKF A;  4NFR A;  2IMO A;  1GYT A;  4OKO A;  3PFE A;  3PB9 X;  3SIG A;  1BLL E;  3GPG A;  1IY7 A;  3SI0 A;  2ZEH A;  3B3S A;  2PIZ A;  2WZN A;  2F8H A;  2ZEO A;  3HLP A;  4YWY A;  3KL9 A;  1CPS A;  3MRU A;  4OIW A;  1R3N A;  2L8R A;  4PXE A;  1TF9 A;  2POK A;  3EWR A;  3BI1 A;  2XEG A;  4NGR A;  3JZT A;  4GVW A;  2CF4 A;  2J9A A;  2HC9 A;  1AYE A;  4YU9 A;  4P4I A;  3TC8 A;  4WJB A;  3KGQ A;  2NSM A;  2G9D A;  4NGP A;  1JQG A;  5THW A;  4GUA A;  7CPA A;  5K8N A;  3DLJ A;  4D86 A;  1BPN A;  3LMS A;  2LGR A;  4P4F A;  2FVG A;  2ZEP A;  4P45 A;  2PJ8 A;  1AMP A;  5ELY A;  5D29 A;  4UML A;  3HUV A;  3FED A;  5E3B A;  2QYV A;  3WAB A;  1CP7 A;  2IJZ A;  1SPV A;  3LWU A;  4ABL A;  1ZR5 A;  1HDU A;  2I3C A;  3PEI A;  3GUX A;  2BFR A;  3IID A;  5HVF A;  3FVL A;  4FAI A;  3B3W A;  1Z2L A;  3VH9 A;  3VAT A;  3IIF A;  2PJ1 A;  3RBU A;  5J1Q A;  1VHE A;  2VL1 A;  2FG1 A;  2Q51 A;  4MHY A;  3IEH A;  4OC0 A;  4NGM A;  4W9Y A;  3V45 A;  3BXM A;  4IQY A;  2ZEG A;  3NFZ A;  4Z65 A;  4P6Y A;  1F2O A;  3KHZ A;  3VAR A;  1LFW A;  3NH4 A;  1F2P A;  3CPX A;  1DTD A;  1RTQ A;  1ARL A;  1QMU A;  3V7Z A;  2V8H A;  1QQ9 A;  4R8F A;  2C6P A;  4P4B A;  5LYL A;  4ZY2 A;  2PIY A;  3KI9 A;  2OR4 A;  4X3R A;  4CPA A;  3DGV A;  4ZX9 A;  2AFX A;  2BFQ A;  1NJR A;  1M4L A;  4ZI6 A;  1IGB A;  1ZG9 A;  4IAV A;  4NGN A;  2X47 A;  4ZX8 A;  1Y7E A;  2PRQ A;  3SIH A;  2HB6 A;  2V8G A;  1DE4 C;  4K3N A;  3PFO A;  1VHO A;  1PCA A;  3V38 A;  3KR4 A;  4GVV A;  4NGT A;  3EWO A;  2AFC A;  1F57 A;  1CX8 A;  4J5R A;  3FMC A;  4PXD A;  1HDQ A;  2C6G A;  1TF8 A;  1XFO A;  4X8I A;  3NA6 A;  1VIX A;  2EWB A;  2FAV A;  1YW6 A;  3ISX A;  2AFO A;  3H8E A;  3ETI A;  3B3C A;  3WC7 A;  1Z5R A;  4ZY1 A;  4EFD A;  2PJ2 A;  2GRE A;  5JGF A;  3RZA A;  4X2T A;  1LAM A;  5FSZ A;  5D8N A;  1XRY A;  1LOK A;  1HEE A;  3IIB A;  2DEA A;  2GLJ A;  4FUU A;  2V8D A;  2EEE A;  3L2N A;  5CPA A;  3FX6 A;  1KWM A;  1CBX A;  2ZOF A;  1TXZ A;  4PXB A;  5FSV A;  5FSY A;  3PB7 X;  4IHM A;  4J5S A;  3SI2 A;  3Q6Z A;  1VGY A;  3N5F A;  4ABK A;  2EK9 A;  4PPZ A;  4GM5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...