1LAMA

Leucine aminopeptidase (unligated)
Total Genus 174
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
174
sequence length
484
structure length
484
Chain Sequence
b'TKGLVLGIYSKEKEEDEPQFTSAGENFNKLVSGKLREILNISGPPLKAGKTRTFYGLHEDFPSVVVVGLGKKTAGIDEQENWHEGKENIRAAVAAGCRQIQDLEIPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKRKVVVSAKLHGSEDQEAWQRGVLFASGQNLARRLMETPANEMTPTKFAEIVEENLKSASIKTDVFIRPKSWIEEQEMGSFLSVAKGSEEPPVFLEIHYKGSPNASEPPLVFVGKGITFDSGGISIKAAANMDLMRADMGGAATICSAIVSAAKLDLPINIVGLAPLCENMPSGKANKPGDVVRARNGKTIQVDNTDAEGRLILADALCYAHTFNPKVIINAATLTGAMDIALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVIDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMAGRPTRTLIEFLFRFSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LEUCINE AMINOPEPTIDASE
publication title Two-metal ion mechanism of bovine lens leucine aminopeptidase: active site solvent structure and binding mode of L-leucinal, a gem-diolate transition state analogue, by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase (alpha-aminoacylpeptide)
total genus 174
structure length 484
sequence length 484
ec nomenclature ec 3.4.11.1: Leucyl aminopeptidase.
pdb deposition date 1995-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00883 Peptidase_M17 Cytosol aminopeptidase family, catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 1lamA01
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 1lamA02
3GPOA 1ZLHA 5LYLA 4IQYA 4ABKA 2XEIA 4NGQA 4F8ZA 2GLJA 4X8IA 2EWBA 3Q6ZA 3B3VA 2O53A 3FVLA 4P4FA 1BAVA 1RTQA 3CDXA 3KGQA 5CB5A 2EK9A 1FT7A 2VL1A 2AFXA 3V38A 3KL9A 4KYBA 3CT9A 2AFSA 3WC6A 4FWUA 2ZEDA 4ETKA 4OC2A 5FSXA 1QQ9A 3PBBA 3D7DA 4UIBA 2AFWA 4P4BA 3KI9A 1LANA 3D7GA 6CPAA 3V2BA 3D7HA 4O23A 4P4DA 4B6ZA 3IJ3A 2BOAA 3BHXA 3GPQA 3ISXA 2XD7A 1YW4A 4ZY2A 4A38A 4KSIA 4Z65A 2C1CA 1CPSA 3PB6X 2ANPA 5FSUA 1CPXA 4WWVA 1HDQA 3N5FA 3RZAA 3GPGA 4ZY1A 1LCPA 1EE3P 1TXRA 4LQGA 5CBMA 4UF4A 1Y0RA 3ETIA 4MCQA 1XRYA 3FH4A 4NGRA 4DJLA 5LYDA 3TC8A 2AFMA 3IIFA 1PYTB 2C6PA 2J9AA 2C6CA 5AILA 1YMEA 2PJ3A 2PJAA 2V8HA 4PXDA 2Q43A 3VATA 2PVVA 1ELLP 4ESSA 3FJUA 4OKOA 4A94A 4TNUA 1LFWA 3FF3A 4OC5A 3RAMA 4P44A 3EWRA 3SJXA 2ZEMA 3SIJA 3SIHA 1F57A 3PB9X 1Z5RA 2ACFA 2PRQA 4NGSA 2FG1A 2PCUA 2ZENA 1HEEA 5FSYA 2GREA 2PJ6A 3B3TA 1FNOA 2XEGA 3KHXA 4OMEA 3BI0A 2HC9A 2EEEA 3NH8A 2BCOA 3B2YA 1YD9A 4JVVA 2OOTA 4IHMA 3VFQA 2WZNA 2ZEFA 4RUHA 1SPVA 3D67A 2Q51A 4OC3A 2PJ8A 3NH5A 4F9VA 1VHOA 5I4MA 3SI1A 3GUXA 4AXVA 2F8HA 2V8GA 3FEDA 5D29A 4MCPA 1LOKA 1R43A 1CBXA 2ZELA 2AFUA 4MCSA 3PFEA 3IC1A 3VARA 2VRIA 2PJ9A 3IEHA 3SJEA 1ZR3A 2ZEGA 1IGBA 1VHEA 4OP4A 5J1QA 3L2NA 3EWPA 4ZY0A 2LGRA 2JBKA 2ZEOA 4GM5A 4UEFA 3KQZA 3KZWA 5K8MA 3CPAA 4MHPA 3JZTA 4R6TA 2WYRA 4A37A 5FSZA 5HVFA 3HLPA 2G9DA 4K0CA 3VH9A 4MRIA 5THWA 2IQ6A 4NGPA 5LRKA 8CPAA 1BLLE 1CG2A 4PXBA 2IJZA 3GQOA 4NJRA 2JEWA 3S9MA 2FXKA 1TF8A 2BFRA 3SIGA 2DX6A 2ZOFA 4EWTA 2BFQA 4JYWA 1F2OA 4PQAA 4EFDA 1TKHA 3K9TA 1HDUA 4K3NA 4P4JA 2ZEPA 4W9YA 2GLFA 2POKA 3NH4A 3KR4A 3LMSA 4ETJA 2V8VA 2PE3A 3KASA 4YWYA 2JBJA 2RFHA 4WJBA 3KQXA 1ARLA 3SI2A 2RB7A 4OC1A 2X47A 4OC4A 1YW6A 4JZ0A 4ZX9A 1DTDA 3LWUA 4JCAA 4MXUA 1XJOA 1LAMA 5K8PA 1M4LA 1BPMA 2ABZA 4P6YA 2FAVA 2DEAA 2EK8A 2PJCA 5JH9A 1Q7LA 5LYFA 3MN8A 4ABLA 1VIXA 5JGFA 3EJFA 1ZG7A 2PJ2A 3QNVA 3PB8X 5HVGA 4ZX8A 1VHUA 2IMOA 4FUUA 4TWEA 1F2PA 3SI0A 5HVHA 3GLJA 1VGYA 2L8RA 3EWOA 2BO9A 4UEZA 3K2KA 3GQEA 1Z8LA 4OIDA 3H8EA 1AMPA 1ARMA 3IWWA 1Y0YA 4PXCA 4JGKA 3EKEA 3SJGA 3KR5A 3WC7A 1ZG8A 4D86A 4X3RA 3IFEA 4A39A 2V8DA 4GVVA 4NGTA 2CIJA 1CP6A 2PJ5A 2PJ7A 3EJGA 2PJ1A 2PIZA 3Q71A 1OBRA 1KWMA 2PJBA 4EMEA 5F09A 1GYTA 3B3SA 3D7FA 2PIYA 1ZLIA 3CPXA 3NFZA 3S9LA 2XEFA 3FX6A 4UEEA 4F9UA 2QJ8A 4G1PA 4DYOA 4OC0A 2V77A 1NJRA 3I1UA 4UIAA 1CP7A 2C6GA 5E3BA 3DLJA 2ZOGA 5LYIA 1TXZA 4NGNA 2AFCA 1ELMP 3MRUA 2CTCA 2F7VA 2I3CA 1BPNA 4MCRA 5DS0A 3IO1A 4ZYQA 4R8FA 4P4EA 3PRTA 5HXDA 2GU2A 1PCAA 5D8NA 5HIHA 3IIDA 3NA6A 5CB3A 1TKJA 3IIBA 5DUSA 1Y7EA 1LAPA 5ELYA 4DUKA 3WABA 3PBEA 4J5SA 3BI1A 3V7ZA 3H8FA 2AFZA 1TKFA 2NYQA 1H8LA 4UMLA 2FVGA 2PJ4A 4P4IA 2NSMA 3RBUA 4ZI6A 4P45A 3D68A 4PPZA 1NSAA 2PVWA 1ZR5A 2O4HA 5LRJA 4FBEA 1TY8A 4J5QA 7CPAA 2OR4A 3B3CA 4R76A 5CPAA 1XMBA 3FMCA 4MHNA 4CPAA 4IK2A 1R3NA 4P10A 4MHYA 2QYVA 3DGVA 5K8OA 2ZEHA 4YU9A 2HB6A 4J4ZA 3TX8A 3BXMA 4FAIA 2Q4ZA 4MMOA 2CTBA 3EWQA 4PXEA 1QMUA 3D66A 3PEIA 4ONWA 3SJFA 4BD9A 1XFOA 4GUAA 1UWYA 2AFOA 3V45A 2XEJA 2PJ0A 5FSVA 5K8NA 4GVWA 1IY7A 3WT4A 1Z2LA 3PFOA 4X2TA 3B35A 1YLOA 4H2KA 5HOLA 1CX8A 3HUVA 3B7IA 4OIWA 3FEEA 3JRUA 3GB0A 4NGMA 2QVPA 3S9NA 5JM6A 4TU0A 4Q7AA 1ZG9A 2CF4A 5IB9A 3WC5A 3ISZA 4IAVA 5CMSA 4R7MA 1YSJA 3H8GA 1TF9A 4J5RA 3SIIA 3T8WA 3PB7X 1AYEA 4NJQA 4JLLA 3B3WA 3EW5A 3FECA 1JQGA 1XBUA 4MHZA 4NFRA 2ZEEA 3D4UA 5LRGA 1HJZA 3PB4X 3KHZA 1DE4C
chains in the Genus database with same CATH superfamily
3GYAA 3R1KA 4A2ZA 2EVNA 3GPOA 1NMTA 1ZLHA 3F8KA 5LYLA 4IQYA 4ABKA 5J8FA 2XEIA 2JZFA 4MHDA 4NGQA 2Z3OA 3F5BA 2Q7SA 4F8ZA 2GLJA 4R87A 4X8IA 2EWBA 3Q6ZA 2GANA 2OZHA 2VZYA 3B3VA 2O53A 4ORFA 3FVLA 4P4FA 2OU2A 2B4DB 2B3UA 1BAVA 1RTQA 3CDXA 2B4BA 3KGQA 4PK2A 5CB5A 5J8CA 2EK9A 1FT7A 2VL1A 2AFXA 2JDCA 4KOYA 1P4NA 3I3GA 3V38A 3KL9A 2B58A 2J8RA 4KYBA 1S3ZA 3CT9A 2AFSA 3QAHA 3WC6A 4FWUA 2ZEDA 3DR8A 4ETKA 1XIXA 2Z3NA 5AG6A 4OC2A 4E0AA 5FSXA 1QQ9A 3D3SA 3D7DA 3PBBA 2P6GA 4PV6A 4UIBA 4B11A 4MJ8A 5A27A 2A4NA 5G22A 2FE7A 2AFWA 1AUGA 4P4BA 3KI9A 1LANA 3D7GA 6CPAA 3V2BA 2KCWA 3D7HA 4O23A 4P4DA 2Z0ZA 4C7IA 2P0WA 4B6ZA 3A9LA 3SXNA 3IJ3A 1Z8XA 2BOAA 2YGWA 3BHXA 4KORA 4F0YA 3GPQA 2FL4A 3ISXA 2XD7A 3S6FA 4CYOA 1YW4A 4ZY2A 4UA3A 4A38A 4KZTA 3GY9A 4KSIA 1I21A 4MY3A 4CAWA 2C1CA 4Z65A 1CPSA 3PB6X 2I79A 2ANPA 2B5GA 3LACA 3R9FA 3WR7A 5FSUA 1Q2YA 1CPXA 3H5ZA 4U9YA 4WWVA 1HDQA 3N5FA 5GCNA 3RZAA 3TT2A 3GPGA 2R7HA 4ZY1A 1LCPA 1EE3P 1TXRA 3BLNA 4KOTA 5CBMA 4LQGA 4CGNA 4R3LA 3KKWA 4UF4A 3R9EA 4M6GA 1Y0RA 3ETIA 4MCQA 1XRYA 3FH4A 4NGRA 4DJLA 1CM0A 4MFZA 5LYDA 5H86A 3TC8A 3MGDA 2AFMA 3B8GA 3IIFA 1PYTB 2C6PA 3W6SA 2X7BA 2J9AA 2C6CA 4JLYA 2EBJA 5AILA 1YMEA 2PJ3A 2WSAA 2PJAA 2V8HA 5DWNA 4A31A 5AG4A 5IB0A 4PXDA 5ISVA 4CRZB 4JXRA 2K5TA 2Q43A 4KUBA 3VATA 2PVVA 1ELLP 3UY5A 2EO8A 3EC4A 4KUAA 2YNCA 2Q4YA 2W2GA 5AG7A 4XNHB 3RNZA 4QUSA 4ESSA 3FJUA 2DXQA 4KVME 1XEBA 1YGHA 2AE6A 4MFKA 1I1DA 1S60A 4XPDC 4OKOA 4A94A 2G3TA 4TNUA 1LFWA 3BJ7A 3FF3A 3H4QA 4OC5A 3JTKA 2D4PA 1LRZA 4Q38A 3RAMA 4LX9A 3CXSA 4P44A 3EWRA 4UWJA 4JJXA 3SJXA 2ZEMA 3SIJA 1X12A 3SIHA 2YNDA 1MJAA 3G3SA 4AVCA 4ZBGA 3FIXA 1F57A 3PB9X 1Z5RA 1IIDA 2ACFA 2PRQA 2VI7A 4NGSA 2G0BA 2FG1A 2PCUA 2ZENA 1HEEA 5FSYA 4H89A 2GREA 2ZXVA 4NCZA 4LQ6A 3QAYA 4HPSA 2PJ6A 3B3TA 1FNOA 1Y9KA 4ONUA 3IU1A 2XEGA 5KTCA 3KHXA 4RN7A 3D2PA 1KUYA 3R96A 4OMEA 3BI0A 2BEIA 2HC9A 2PDOA 2Q44A 4RI1A 4AVAA 2EEEA 4F0XA 3V8IA 4A32A 1TIQA 3NH8A 2BCOA 2FS5A 2R1IA 2Z3KA 2ZW5A 1L0CA 3B2YA 4Y49C 4B14A 4II9A 1YD9A 4JVVA 3NE7A 2OOTA 1Z8WA 4IHMA 3VFQA 2F5IA 2WZNA 1SQHA 1SPVA 2ZEFA 2ZW4A 3D67A 4RUHA 2Q51A 2I00A 4OC3A 2PJ8A 3NH5A 4H6ZA 1VHOA 1Q2DA 1YVOA 1IOFA 4LUAA 4QB9A 4F9VA 3SI1A 2VEZA 3GUXA 4AXVA 2F8HA 5DWMA 2V8GA 1QSTA 3FEDA 5D29A 4HNXB 4MCPA 1LOKA 1XF8A 1R43A 4JWPA 5A28A 1CBXA 1BO4A 2ZELA 4C68A 2AFUA 4MCSA 3PFEA 3IC1A 4XNHC 1QSRA 3VARA 5KTDA 3T9YA 3EFAA 2VRIA 2VZZA 3SXOA 2IL4A 4CRYB 2PJ9A 5G21A 2NMTA 3FNCA 4KOXA 3IEHA 4OAEA 4CS0B 3TOBA 1MK4A 4KLVA 3SJEA 2QECA 1ZR3A 2ZEGA 1IGBA 3LD2A 1YX0A 2GIVA 2RC4A 1VHEA 4OP4A 5J1QA 3L2NA 2PR8A 3EWPA 4ZY0A 3EXNA 2LGRA 2JBKA 3NE8A 2ZEOA 1P0HA 4NSQA 4C7HA 4GM5A 4UEFA 3KQZA 3KZWA 2PR1A 5K8MA 3CPAA 4MHPA 3JZTA 2HQYA 4R6TA 3JUWA 2WYRA 4A37A 5FSZA 3JVNA 2BUEA 5HVFA 2FSRA 3HLPA 2G9DA 4K0CA 2J8NA 3VH9A 3E0KA 4MRIA 3TO9A 5THWA 2IQ6A 2QIRA 4NGPA 3T90A 5LRKA 1A2ZA 1Z4EA 8CPAA 4F6AA 2ZW7A 5HH1A 1BLLE 1CG2A 4PXBA 2EUIA 2IJZA 3GQOA 4NJRA 2JEWA 3S9MA 2FXKA 1Y9WA 1TF8A 2D4OA 2BFRA 3SIGA 2DX6A 2ZOFA 3OWCA 4CGMA 2HUZA 1NSLA 4EWTA 2BFQA 2P6FA 4JYWA 1F2OA 4PQAA 2QMLA 4JXQA 4MBUA 4MI4A 3TO6A 3VWDA 4EFDA 2ARHA 5HMNA 1WWZA 3D2MA 2ATRA 1TKHA 2FT0A 3K9TA 2VQYA 1HDUA 4K3NA 4P4JA 2ZEPA 4W9YA 1YQEA 2GLFA 2C27A 3TE4A 2GE3A 2JZDA 2POKA 3NH4A 4I49A 3KR4A 4IF5A 3LMSA 4ETJA 4NEXA 2V8VA 1I12A 4MFJA 3IU2A 1Z9UA 5I4MA 2PE3A 2R8VA 3KASA 4YWYA 5IV0A 4B5PA 3IWGA 4B10A 1CJWA 2JBJA 3ZJ0A 4BINA 2RFHA 4R9MA 4E8OA 4UFXA 2YNEA 3LODA 4WJBA 3S6KA 3KQXA 4KVXA 4K30A 1ARLA 4GS4A 1YLEA 1YR0A 1Z4RA 2RB7A 2VXKA 3P2HA 1ON0A 4OC1A 3SI2A 3G8WA 2X47A 4OC4A 1YW6A 4JZ0A 4YFJA 4ZX9A 4KVOE 2DPTA 1DTDA 4AVBA 4J3GA 3W91A 4AG7A 5BWAB 4CYNA 3LWUA 4MFLA 4JCAA 1M1DA 1KUXA 4MXUA 4UFWA 1XJOA 2PQ8A 1LAMA 2PC1A 4CAVA 1M4LA 1BPMA 5AGEA 5K8PA 1IYKA 4CGOA 2ABZA 3C26A 4P6YA 2FAVA 2DEAA 2EK8A 2PJCA 2WPWA 4KOUA 4A33A 1XE4A 2VBQA 1Q7LA 2Q04A 1RO5A 5JH9A 5LYFA 4KLWA 3IGRA 3MN8A 2Z10A 1RXTA 4ABLA 4FD4A 1VIXA 2OB0A 4KOWA 2Z3LA 5JGFA 3EJFA 1ZG7A 1FY7A 1M44A 2PJ2A 5IX3A 3QNVA 4NF1A 4JD6A 3PB8X 4L8AA 5HVGA 4ZX8A 4OLLA 2Q0YA 1VHUA 2PSWA 2B5GB 2IMOA 2CNMA 4FUUA 4TWEA 3FYNA 4FD6A 1JWQA 1F2PA 4UFVA 3SI0A 1M4IA 2B4DA 3DNSA 4M85A 3QB8A 5HVHA 3GLJA 1VGYA 2AJ6A 3FB3A 2L8RA 5C88A 3EWOA 1Z8TA 1UFHA 4M6IA 2BO9A 1S5KA 2PRBA 2OH1A 3DSBA 4UEZA 3K2KA 1S7LA 3GQEA 1Z8LA 2CNSA 4OIDA 3H8EA 1AMPA 1ARMA 3IWWA 4QVTA 3ZZIA 3DR6A 1Y0YA 4PXCA 4JGKA 3EKEA 3SJGA 5I0CA 3KR5A 5G1ZA 1PUAA 3WC7A 1ZG8A 5C82A 4D86A 4X3RA 2DF5A 2Y0MA 3IFEA 4HKFA 4A39A 2V8DA 4GVVA 4NGTA 2CIJA 1CP6A 3FBUA 2PJ5A 1M4DA 1Y7RA 2PJ7A 4NXYA 3EJGA 2H5MA 2PJ1A 5EBVA 5G20A 1OZPA 2PIZA 3D8PA 3Q71A 1OBRA 1KWMA 2CNTA 2PJBA 4EMEA 5F09A 1GYTA 4YGOA 4U5YA 1IYLA 3B3SA 2KQVA 3D7FA 1N71A 1ZLIA 2PIYA 3CPXA 3NFZA 4CYPA 4UBRA 3S9LA 3FXTA 2XEFA 3FX6A 4UEEA 5AG5A 1YK3A 2FXFA 2QJ8A 3GIUA 4G1PA 4F9UA 4C2YA 3BJ8A 4DYOA 1NE9A 2Q4VA 4H6UA 2JLMA 4OC0A 1M4GA 1KZFA 1MJ9A 2V77A 1NJRA 3I1UA 4AG9A 4UIAA 3W6XA 1B6BA 3TO7A 1CP7A 2C6GA 1GHEA 2GFQA 3VWEA 5E3BA 4B13A 3DLJA 2ZOGA 4R3KA 5FVJA 5LYIA 1S7FA 4DNCA 1TXZA 4M6HA 4NGNA 2AFCA 2JDDA 5EMIA 4M3SA 2OZGA 4IUSA 2FIAA 4EVYA 1ELMP 2B3VA 4B5OA 4BBHA 3MRUA 3DDDA 1B87A 2CTCA 2F7VA 1BPNA 2CY2A 2I3CA 4MCRA 5DS0A 4KOSA 3RYOA 3IO1A 4ZYQA 4R8FA 4P4EA 3PRTA 1IOIA 5HXDA 3TTHA 2GU2A 3FRMA 1PCAA 5D8NA 4UCNA 4HNWB 4X5KA 4BMHA 5HIHA 5E96A 3IIDA 3NA6A 4YRHA 5CB3A 1TKJA 3IIBA 4XPDB 3K9UA 3CXPA 4A30A 5DUSA 1IB1E 1LAPA 1Y7EA 2R98A 3CZXA 4GXHA 5ELYA 4DUKA 3WABA 3PBEA 4J5SA 3EO4A 1J4JA 4MFPA 1QSMA 4AB7A 3BI1A 3V7ZA 3H8FA 2AFZA 4CGPA 5EC4A 2YNCC 1TKFA 2JEVA 1H8LA 4UMLA 2FVGA 1QSNA 2NYQA 2NSMA 2PJ4A 4P4IA 3RBUA 4ZI6A 4XPLA 4P45A 2WPXA 4KSFA 1IICA 1X10A 3D68A 4PPZA 1NSAA 2PVWA 4XPKA 1ZR5A 2O4HA 2J8MA 4PK3A 4Q36A 1TY8A 4J5QA 5LRJA 4FBEA 7CPAA 2OR4A 3B3CA 4R76A 4A95A 4FD5A 5CPAA 4OADA 1XMBA 2HV2A 4KSAA 3FMCA 1VHSA 4MHNA 4CAXA 4CPAA 1U6MA 4IK2A 3S6HA 4Y49B 1R57A 1VKCA 1R3NA 4ZGYB 5F48A 1MJBA 2FCKA 3I9SA 2Z11A 2ODFA 4P10A 2WUUA 4MHYA 2REFA 4MFQA 2QYVA 3DGVA 4HNYB 5K8OA 4C2ZA 3TFYA 2ZEHA 4YU9A 2HB6A 4J4ZA 2Q7BA 3TX8A 1BOBA 4CGLA 3BXMA 1Q2CA 4FAIA 4B12A 2FIWA 2Q4ZA 1QSOA 3PZJA 4MMOA 2CTBA 3EWQA 4PXEA 1QMUA 4CAEA 5F49A 1KUVA 2Z3MA 3D66A 3PEIA 4ONWA 3SJFA 4UWIA 1XFOA 4GUAA 2CXAA 3TOAA 4BD9A 4CAFA 2BSWA 1UWYA 5F46A 4UCMA 2AFOA 3V45A 2XEJA 1S7NA 2PJ0A 5FSVA 5K8NA 1S7KA 4GVWA 1IY7A 3WT4A 1Z2LA 5F47A 4C2XA 3F0AA 1YVKA 1XMTA 3PFOA 4L89A 4X2TA 3B35A 1YLOA 4H2KA 5HOLA 4PSWA 1V0CA 3PP9A 4PSXA 3R95A 4E2AA 4QBJA 3IWEA 4QC6A 2ZW6A 3S6GA 1CX8A 3HUVA 3B7IA 4OIWA 2ZPAA 3FEEA 4KOVA 3JRUA 3GB0A 4NGMA 2REEA 3N7ZA 2QVPA 2JZEA 4B5PB 3RO0A 3S9NA 5JM6A 4TU0A 5CNPA 4Q7AA 1ZG9A 3SHPA 4KS9A 2CF4A 1YREA 4R57A 1PU9A 5IB9A 3WC5A 2OZUA 3ISZA 4IAVA 4MY0A 4U9ZA 5CMSA 4CYQA 3P2FA 3TCVA 4RS2A 4R7MA 1ZO0A 1YSJA 3H8GA 1TF9A 4J5RA 2DPSA 3SIIA 3T8WA 3PB7X 1AYEA 1K4JA 4NJQA 4JLLA 4UCPA 1WK4A 3B3WA 3GKRA 3EW5A 5KTAA 3PGPA 5JQ4A 3FECA 3CXQA 3R9GA 1JQGA 1XBUA 2BL1A 2WCTA 2G3AA 1IU8A 1XOVA 4MHZA 2Z3PA 4NFRA 2RNKA 2ZEEA 3D4UA 4FD7A 2P6EA 5LRGA 1HJZA 2O28A 3EY5A 5JPHA 5H84A 3PB4X 3KHZA 1DE4C
chains in the Genus database with same CATH topology
3GPOA 1ZLHA 5LYLA 4IQYA 4ABKA 2XEIA 4NGQA 4F8ZA 2GLJA 4X8IA 2EWBA 3Q6ZA 3B3VA 2O53A 3FVLA 4P4FA 1BAVA 1RTQA 3CDXA 3KGQA 5CB5A 2EK9A 1FT7A 2VL1A 2AFXA 3V38A 3KL9A 4KYBA 3CT9A 2AFSA 3WC6A 4FWUA 2ZEDA 4ETKA 4OC2A 5FSXA 1QQ9A 3PBBA 3D7DA 4UIBA 2AFWA 4P4BA 3KI9A 1LANA 3D7GA 6CPAA 3V2BA 3D7HA 4O23A 4P4DA 4B6ZA 3IJ3A 2BOAA 3BHXA 3GPQA 3ISXA 2XD7A 1YW4A 4ZY2A 4A38A 4KSIA 4Z65A 2C1CA 1CPSA 3PB6X 2ANPA 5FSUA 1CPXA 4WWVA 1HDQA 3N5FA 3RZAA 3GPGA 4ZY1A 1LCPA 1EE3P 1TXRA 4LQGA 5CBMA 4UF4A 1Y0RA 3ETIA 4MCQA 1XRYA 3FH4A 4NGRA 4DJLA 5LYDA 3TC8A 2AFMA 3IIFA 1PYTB 2C6PA 2J9AA 2C6CA 5AILA 1YMEA 2PJ3A 2PJAA 2V8HA 4PXDA 2Q43A 3VATA 2PVVA 1ELLP 4ESSA 3FJUA 4OKOA 4A94A 4TNUA 1LFWA 3FF3A 4OC5A 3RAMA 4P44A 3EWRA 3SJXA 2ZEMA 3SIJA 3SIHA 1F57A 3PB9X 1Z5RA 2ACFA 2PRQA 4NGSA 2FG1A 2PCUA 2ZENA 1HEEA 5FSYA 2GREA 2PJ6A 3B3TA 1FNOA 2XEGA 3KHXA 4OMEA 3BI0A 2HC9A 2EEEA 3NH8A 2BCOA 3B2YA 1YD9A 4JVVA 2OOTA 4IHMA 3VFQA 2WZNA 2ZEFA 4RUHA 1SPVA 3D67A 2Q51A 4OC3A 2PJ8A 3NH5A 4F9VA 1VHOA 5I4MA 3SI1A 3GUXA 4AXVA 2F8HA 2V8GA 3FEDA 5D29A 4MCPA 1LOKA 1R43A 1CBXA 2ZELA 2AFUA 4MCSA 3PFEA 3IC1A 3VARA 2VRIA 2PJ9A 3IEHA 3SJEA 1ZR3A 2ZEGA 1IGBA 1VHEA 4OP4A 5J1QA 3L2NA 3EWPA 4ZY0A 2LGRA 2JBKA 2ZEOA 4GM5A 4UEFA 3KQZA 3KZWA 5K8MA 3CPAA 4MHPA 3JZTA 4R6TA 2WYRA 4A37A 5FSZA 5HVFA 3HLPA 2G9DA 4K0CA 3VH9A 4MRIA 5THWA 2IQ6A 4NGPA 5LRKA 8CPAA 1BLLE 1CG2A 4PXBA 2IJZA 3GQOA 4NJRA 2JEWA 3S9MA 2FXKA 1TF8A 2BFRA 3SIGA 2DX6A 2ZOFA 4EWTA 2BFQA 4JYWA 1F2OA 4PQAA 4EFDA 1TKHA 3K9TA 1HDUA 4K3NA 4P4JA 2ZEPA 4W9YA 2GLFA 2POKA 3NH4A 3KR4A 3LMSA 4ETJA 2V8VA 2PE3A 3KASA 4YWYA 2JBJA 2RFHA 4WJBA 3KQXA 1ARLA 3SI2A 2RB7A 4OC1A 2X47A 4OC4A 1YW6A 4JZ0A 4ZX9A 1DTDA 3LWUA 4JCAA 4MXUA 1XJOA 1LAMA 5K8PA 1M4LA 1BPMA 2ABZA 4P6YA 2FAVA 2DEAA 2EK8A 2PJCA 5JH9A 1Q7LA 5LYFA 3MN8A 4ABLA 1VIXA 5JGFA 3EJFA 1ZG7A 2PJ2A 3QNVA 3PB8X 5HVGA 4ZX8A 1VHUA 2IMOA 4FUUA 4TWEA 1F2PA 3SI0A 5HVHA 3GLJA 1VGYA 2L8RA 3EWOA 2BO9A 4UEZA 3K2KA 3GQEA 1Z8LA 4OIDA 3H8EA 1AMPA 1ARMA 3IWWA 1Y0YA 4PXCA 4JGKA 3EKEA 3SJGA 3KR5A 3WC7A 1ZG8A 4D86A 4X3RA 3IFEA 4A39A 2V8DA 4GVVA 4NGTA 2CIJA 1CP6A 2PJ5A 2PJ7A 3EJGA 2PJ1A 2PIZA 3Q71A 1OBRA 1KWMA 2PJBA 4EMEA 5F09A 1GYTA 3B3SA 3D7FA 2PIYA 1ZLIA 3CPXA 3NFZA 3S9LA 2XEFA 3FX6A 4UEEA 4F9UA 2QJ8A 4G1PA 4DYOA 4OC0A 2V77A 1NJRA 3I1UA 4UIAA 1CP7A 2C6GA 5E3BA 3DLJA 2ZOGA 5LYIA 1TXZA 4NGNA 2AFCA 1ELMP 3MRUA 2CTCA 2F7VA 2I3CA 1BPNA 4MCRA 5DS0A 3IO1A 4ZYQA 4R8FA 4P4EA 3PRTA 5HXDA 2GU2A 1PCAA 5D8NA 5HIHA 3IIDA 3NA6A 5CB3A 1TKJA 3IIBA 5DUSA 1Y7EA 1LAPA 5ELYA 4DUKA 3WABA 3PBEA 4J5SA 3BI1A 3V7ZA 3H8FA 2AFZA 1TKFA 2NYQA 1H8LA 4UMLA 2FVGA 2PJ4A 4P4IA 2NSMA 3RBUA 4ZI6A 4P45A 3D68A 4PPZA 1NSAA 2PVWA 1ZR5A 2O4HA 5LRJA 4FBEA 1TY8A 4J5QA 7CPAA 2OR4A 3B3CA 4R76A 5CPAA 1XMBA 3FMCA 4MHNA 4CPAA 4IK2A 1R3NA 4P10A 4MHYA 2QYVA 3DGVA 5K8OA 2ZEHA 4YU9A 2HB6A 4J4ZA 3TX8A 3BXMA 4FAIA 2Q4ZA 4MMOA 2CTBA 3EWQA 4PXEA 1QMUA 3D66A 3PEIA 4ONWA 3SJFA 4BD9A 1XFOA 4GUAA 1UWYA 2AFOA 3V45A 2XEJA 2PJ0A 5FSVA 5K8NA 4GVWA 1IY7A 3WT4A 1Z2LA 3PFOA 4X2TA 3B35A 1YLOA 4H2KA 5HOLA 1CX8A 3HUVA 3B7IA 4OIWA 3FEEA 3JRUA 3GB0A 4NGMA 2QVPA 3S9NA 5JM6A 4TU0A 4Q7AA 1ZG9A 2CF4A 5IB9A 3WC5A 3ISZA 4IAVA 5CMSA 4R7MA 1YSJA 3H8GA 1TF9A 4J5RA 3SIIA 3T8WA 3PB7X 1AYEA 4NJQA 4JLLA 3B3WA 3EW5A 3FECA 1JQGA 1XBUA 4MHZA 4NFRA 2ZEEA 3D4UA 5LRGA 1HJZA 3PB4X 3KHZA 1DE4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPO A;  1ZLH A;  5LYL A;  4IQY A;  4ABK A;  2XEI A;  4NGQ A;  4F8Z A;  2GLJ A;  4X8I A;  2EWB A;  3Q6Z A;  3B3V A;  2O53 A;  3FVL A;  4P4F A;  1BAV A;  1RTQ A;  3CDX A;  3KGQ A;  5CB5 A;  2EK9 A;  1FT7 A;  2VL1 A;  2AFX A;  3V38 A;  3KL9 A;  4KYB A;  3CT9 A;  2AFS A;  3WC6 A;  4FWU A;  2ZED A;  4ETK A;  4OC2 A;  5FSX A;  1QQ9 A;  3PBB A;  3D7D A;  4UIB A;  2AFW A;  4P4B A;  3KI9 A;  1LAN A;  3D7G A;  6CPA A;  3V2B A;  3D7H A;  4O23 A;  4P4D A;  4B6Z A;  3IJ3 A;  2BOA A;  3BHX A;  3GPQ A;  3ISX A;  2XD7 A;  1YW4 A;  4ZY2 A;  4A38 A;  4KSI A;  4Z65 A;  2C1C A;  1CPS A;  3PB6 X;  2ANP A;  5FSU A;  1CPX A;  4WWV A;  1HDQ A;  3N5F A;  3RZA A;  3GPG A;  4ZY1 A;  1LCP A;  1EE3 P;  1TXR A;  4LQG A;  5CBM A;  4UF4 A;  1Y0R A;  3ETI A;  4MCQ A;  1XRY A;  3FH4 A;  4NGR A;  4DJL A;  5LYD A;  3TC8 A;  2AFM A;  3IIF A;  1PYT B;  2C6P A;  2J9A A;  2C6C A;  5AIL A;  1YME A;  2PJ3 A;  2PJA A;  2V8H A;  4PXD A;  2Q43 A;  3VAT A;  2PVV A;  1ELL P;  4ESS A;  3FJU A;  4OKO A;  4A94 A;  4TNU A;  1LFW A;  3FF3 A;  4OC5 A;  3RAM A;  4P44 A;  3EWR A;  3SJX A;  2ZEM A;  3SIJ A;  3SIH A;  1F57 A;  3PB9 X;  1Z5R A;  2ACF A;  2PRQ A;  4NGS A;  2FG1 A;  2PCU A;  2ZEN A;  1HEE A;  5FSY A;  2GRE A;  2PJ6 A;  3B3T A;  1FNO A;  2XEG A;  3KHX A;  4OME A;  3BI0 A;  2HC9 A;  2EEE A;  3NH8 A;  2BCO A;  3B2Y A;  1YD9 A;  4JVV A;  2OOT A;  4IHM A;  3VFQ A;  2WZN A;  2ZEF A;  4RUH A;  1SPV A;  3D67 A;  2Q51 A;  4OC3 A;  2PJ8 A;  3NH5 A;  4F9V A;  1VHO A;  5I4M A;  3SI1 A;  3GUX A;  4AXV A;  2F8H A;  2V8G A;  3FED A;  5D29 A;  4MCP A;  1LOK A;  1R43 A;  1CBX A;  2ZEL A;  2AFU A;  4MCS A;  3PFE A;  3IC1 A;  3VAR A;  2VRI A;  2PJ9 A;  3IEH A;  3SJE A;  1ZR3 A;  2ZEG A;  1IGB A;  1VHE A;  4OP4 A;  5J1Q A;  3L2N A;  3EWP A;  4ZY0 A;  2LGR A;  2JBK A;  2ZEO A;  4GM5 A;  4UEF A;  3KQZ A;  3KZW A;  5K8M A;  3CPA A;  4MHP A;  3JZT A;  4R6T A;  2WYR A;  4A37 A;  5FSZ A;  5HVF A;  3HLP A;  2G9D A;  4K0C A;  3VH9 A;  4MRI A;  5THW A;  2IQ6 A;  4NGP A;  5LRK A;  8CPA A;  1BLL E;  1CG2 A;  4PXB A;  2IJZ A;  3GQO A;  4NJR A;  2JEW A;  3S9M A;  2FXK A;  1TF8 A;  2BFR A;  3SIG A;  2DX6 A;  2ZOF A;  4EWT A;  2BFQ A;  4JYW A;  1F2O A;  4PQA A;  4EFD A;  1TKH A;  3K9T A;  1HDU A;  4K3N A;  4P4J A;  2ZEP A;  4W9Y A;  2GLF A;  2POK A;  3NH4 A;  3KR4 A;  3LMS A;  4ETJ A;  2V8V A;  2PE3 A;  3KAS A;  4YWY A;  2JBJ A;  2RFH A;  4WJB A;  3KQX A;  1ARL A;  3SI2 A;  2RB7 A;  4OC1 A;  2X47 A;  4OC4 A;  1YW6 A;  4JZ0 A;  4ZX9 A;  1DTD A;  3LWU A;  4JCA A;  4MXU A;  1XJO A;  1LAM A;  5K8P A;  1M4L A;  1BPM A;  2ABZ A;  4P6Y A;  2FAV A;  2DEA A;  2EK8 A;  2PJC A;  5JH9 A;  1Q7L A;  5LYF A;  3MN8 A;  4ABL A;  1VIX A;  5JGF A;  3EJF A;  1ZG7 A;  2PJ2 A;  3QNV A;  3PB8 X;  5HVG A;  4ZX8 A;  1VHU A;  2IMO A;  4FUU A;  4TWE A;  1F2P A;  3SI0 A;  5HVH A;  3GLJ A;  1VGY A;  2L8R A;  3EWO A;  2BO9 A;  4UEZ A;  3K2K A;  3GQE A;  1Z8L A;  4OID A;  3H8E A;  1AMP A;  1ARM A;  3IWW A;  1Y0Y A;  4PXC A;  4JGK A;  3EKE A;  3SJG A;  3KR5 A;  3WC7 A;  1ZG8 A;  4D86 A;  4X3R A;  3IFE A;  4A39 A;  2V8D A;  4GVV A;  4NGT A;  2CIJ A;  1CP6 A;  2PJ5 A;  2PJ7 A;  3EJG A;  2PJ1 A;  2PIZ A;  3Q71 A;  1OBR A;  1KWM A;  2PJB A;  4EME A;  5F09 A;  1GYT A;  3B3S A;  3D7F A;  2PIY A;  1ZLI A;  3CPX A;  3NFZ A;  3S9L A;  2XEF A;  3FX6 A;  4UEE A;  4F9U A;  2QJ8 A;  4G1P A;  4DYO A;  4OC0 A;  2V77 A;  1NJR A;  3I1U A;  4UIA A;  1CP7 A;  2C6G A;  5E3B A;  3DLJ A;  2ZOG A;  5LYI A;  1TXZ A;  4NGN A;  2AFC A;  1ELM P;  3MRU A;  2CTC A;  2F7V A;  2I3C A;  1BPN A;  4MCR A;  5DS0 A;  3IO1 A;  4ZYQ A;  4R8F A;  4P4E A;  3PRT A;  5HXD A;  2GU2 A;  1PCA A;  5D8N A;  5HIH A;  3IID A;  3NA6 A;  5CB3 A;  1TKJ A;  3IIB A;  5DUS A;  1Y7E A;  1LAP A;  5ELY A;  4DUK A;  3WAB A;  3PBE A;  4J5S A;  3BI1 A;  3V7Z A;  3H8F A;  2AFZ A;  1TKF A;  2NYQ A;  1H8L A;  4UML A;  2FVG A;  2PJ4 A;  4P4I A;  2NSM A;  3RBU A;  4ZI6 A;  4P45 A;  3D68 A;  4PPZ A;  1NSA A;  2PVW A;  1ZR5 A;  2O4H A;  5LRJ A;  4FBE A;  1TY8 A;  4J5Q A;  7CPA A;  2OR4 A;  3B3C A;  4R76 A;  5CPA A;  1XMB A;  3FMC A;  4MHN A;  4CPA A;  4IK2 A;  1R3N A;  4P10 A;  4MHY A;  2QYV A;  3DGV A;  5K8O A;  2ZEH A;  4YU9 A;  2HB6 A;  4J4Z A;  3TX8 A;  3BXM A;  4FAI A;  2Q4Z A;  4MMO A;  2CTB A;  3EWQ A;  4PXE A;  1QMU A;  3D66 A;  3PEI A;  4ONW A;  3SJF A;  4BD9 A;  1XFO A;  4GUA A;  1UWY A;  2AFO A;  3V45 A;  2XEJ A;  2PJ0 A;  5FSV A;  5K8N A;  4GVW A;  1IY7 A;  3WT4 A;  1Z2L A;  3PFO A;  4X2T A;  3B35 A;  1YLO A;  4H2K A;  5HOL A;  1CX8 A;  3HUV A;  3B7I A;  4OIW A;  3FEE A;  3JRU A;  3GB0 A;  4NGM A;  2QVP A;  3S9N A;  5JM6 A;  4TU0 A;  4Q7A A;  1ZG9 A;  2CF4 A;  5IB9 A;  3WC5 A;  3ISZ A;  4IAV A;  5CMS A;  4R7M A;  1YSJ A;  3H8G A;  1TF9 A;  4J5R A;  3SII A;  3T8W A;  3PB7 X;  1AYE A;  4NJQ A;  4JLL A;  3B3W A;  3EW5 A;  3FEC A;  1JQG A;  1XBU A;  4MHZ A;  4NFR A;  2ZEE A;  3D4U A;  5LRG A;  1HJZ A;  3PB4 X;  3KHZ A;  1DE4 C; 
#chains in the Genus database with same CATH topology
 3GYA A;  3R1K A;  4A2Z A;  2EVN A;  3GPO A;  1NMT A;  1ZLH A;  3F8K A;  5LYL A;  4IQY A;  4ABK A;  5J8F A;  2XEI A;  2JZF A;  4MHD A;  4NGQ A;  2Z3O A;  3F5B A;  2Q7S A;  4F8Z A;  2GLJ A;  4R87 A;  4X8I A;  2EWB A;  3Q6Z A;  2GAN A;  2OZH A;  2VZY A;  3B3V A;  2O53 A;  4ORF A;  3FVL A;  4P4F A;  2OU2 A;  2B4D B;  2B3U A;  1BAV A;  1RTQ A;  3CDX A;  2B4B A;  3KGQ A;  4PK2 A;  5CB5 A;  5J8C A;  2EK9 A;  1FT7 A;  2VL1 A;  2AFX A;  2JDC A;  4KOY A;  1P4N A;  3I3G A;  3V38 A;  3KL9 A;  2B58 A;  2J8R A;  4KYB A;  1S3Z A;  3CT9 A;  2AFS A;  3QAH A;  3WC6 A;  4FWU A;  2ZED A;  3DR8 A;  4ETK A;  1XIX A;  2Z3N A;  5AG6 A;  4OC2 A;  4E0A A;  5FSX A;  1QQ9 A;  3D3S A;  3D7D A;  3PBB A;  2P6G A;  4PV6 A;  4UIB A;  4B11 A;  4MJ8 A;  5A27 A;  2A4N A;  5G22 A;  2FE7 A;  2AFW A;  1AUG A;  4P4B A;  3KI9 A;  1LAN A;  3D7G A;  6CPA A;  3V2B A;  2KCW A;  3D7H A;  4O23 A;  4P4D A;  2Z0Z A;  4C7I A;  2P0W A;  4B6Z A;  3A9L A;  3SXN A;  3IJ3 A;  1Z8X A;  2BOA A;  2YGW A;  3BHX A;  4KOR A;  4F0Y A;  3GPQ A;  2FL4 A;  3ISX A;  2XD7 A;  3S6F A;  4CYO A;  1YW4 A;  4ZY2 A;  4UA3 A;  4A38 A;  4KZT A;  3GY9 A;  4KSI A;  1I21 A;  4MY3 A;  4CAW A;  2C1C A;  4Z65 A;  1CPS A;  3PB6 X;  2I79 A;  2ANP A;  2B5G A;  3LAC A;  3R9F A;  3WR7 A;  5FSU A;  1Q2Y A;  1CPX A;  3H5Z A;  4U9Y A;  4WWV A;  1HDQ A;  3N5F A;  5GCN A;  3RZA A;  3TT2 A;  3GPG A;  2R7H A;  4ZY1 A;  1LCP A;  1EE3 P;  1TXR A;  3BLN A;  4KOT A;  5CBM A;  4LQG A;  4CGN A;  4R3L A;  3KKW A;  4UF4 A;  3R9E A;  4M6G A;  1Y0R A;  3ETI A;  4MCQ A;  1XRY A;  3FH4 A;  4NGR A;  4DJL A;  1CM0 A;  4MFZ A;  5LYD A;  5H86 A;  3TC8 A;  3MGD A;  2AFM A;  3B8G A;  3IIF A;  1PYT B;  2C6P A;  3W6S A;  2X7B A;  2J9A A;  2C6C A;  4JLY A;  2EBJ A;  5AIL A;  1YME A;  2PJ3 A;  2WSA A;  2PJA A;  2V8H A;  5DWN A;  4A31 A;  5AG4 A;  5IB0 A;  4PXD A;  5ISV A;  4CRZ B;  4JXR A;  2K5T A;  2Q43 A;  4KUB A;  3VAT A;  2PVV A;  1ELL P;  3UY5 A;  2EO8 A;  3EC4 A;  4KUA A;  2YNC A;  2Q4Y A;  2W2G A;  5AG7 A;  4XNH B;  3RNZ A;  4QUS A;  4ESS A;  3FJU A;  2DXQ A;  4KVM E;  1XEB A;  1YGH A;  2AE6 A;  4MFK A;  1I1D A;  1S60 A;  4XPD C;  4OKO A;  4A94 A;  2G3T A;  4TNU A;  1LFW A;  3BJ7 A;  3FF3 A;  3H4Q A;  4OC5 A;  3JTK A;  2D4P A;  1LRZ A;  4Q38 A;  3RAM A;  4LX9 A;  3CXS A;  4P44 A;  3EWR A;  4UWJ A;  4JJX A;  3SJX A;  2ZEM A;  3SIJ A;  1X12 A;  3SIH A;  2YND A;  1MJA A;  3G3S A;  4AVC A;  4ZBG A;  3FIX A;  1F57 A;  3PB9 X;  1Z5R A;  1IID A;  2ACF A;  2PRQ A;  2VI7 A;  4NGS A;  2G0B A;  2FG1 A;  2PCU A;  2ZEN A;  1HEE A;  5FSY A;  4H89 A;  2GRE A;  2ZXV A;  4NCZ A;  4LQ6 A;  3QAY A;  4HPS A;  2PJ6 A;  3B3T A;  1FNO A;  1Y9K A;  4ONU A;  3IU1 A;  2XEG A;  5KTC A;  3KHX A;  4RN7 A;  3D2P A;  1KUY A;  3R96 A;  4OME A;  3BI0 A;  2BEI A;  2HC9 A;  2PDO A;  2Q44 A;  4RI1 A;  4AVA A;  2EEE A;  4F0X A;  3V8I A;  4A32 A;  1TIQ A;  3NH8 A;  2BCO A;  2FS5 A;  2R1I A;  2Z3K A;  2ZW5 A;  1L0C A;  3B2Y A;  4Y49 C;  4B14 A;  4II9 A;  1YD9 A;  4JVV A;  3NE7 A;  2OOT A;  1Z8W A;  4IHM A;  3VFQ A;  2F5I A;  2WZN A;  1SQH A;  1SPV A;  2ZEF A;  2ZW4 A;  3D67 A;  4RUH A;  2Q51 A;  2I00 A;  4OC3 A;  2PJ8 A;  3NH5 A;  4H6Z A;  1VHO A;  1Q2D A;  1YVO A;  1IOF A;  4LUA A;  4QB9 A;  4F9V A;  3SI1 A;  2VEZ A;  3GUX A;  4AXV A;  2F8H A;  5DWM A;  2V8G A;  1QST A;  3FED A;  5D29 A;  4HNX B;  4MCP A;  1LOK A;  1XF8 A;  1R43 A;  4JWP A;  5A28 A;  1CBX A;  1BO4 A;  2ZEL A;  4C68 A;  2AFU A;  4MCS A;  3PFE A;  3IC1 A;  4XNH C;  1QSR A;  3VAR A;  5KTD A;  3T9Y A;  3EFA A;  2VRI A;  2VZZ A;  3SXO A;  2IL4 A;  4CRY B;  2PJ9 A;  5G21 A;  2NMT A;  3FNC A;  4KOX A;  3IEH A;  4OAE A;  4CS0 B;  3TOB A;  1MK4 A;  4KLV A;  3SJE A;  2QEC A;  1ZR3 A;  2ZEG A;  1IGB A;  3LD2 A;  1YX0 A;  2GIV A;  2RC4 A;  1VHE A;  4OP4 A;  5J1Q A;  3L2N A;  2PR8 A;  3EWP A;  4ZY0 A;  3EXN A;  2LGR A;  2JBK A;  3NE8 A;  2ZEO A;  1P0H A;  4NSQ A;  4C7H A;  4GM5 A;  4UEF A;  3KQZ A;  3KZW A;  2PR1 A;  5K8M A;  3CPA A;  4MHP A;  3JZT A;  2HQY A;  4R6T A;  3JUW A;  2WYR A;  4A37 A;  5FSZ A;  3JVN A;  2BUE A;  5HVF A;  2FSR A;  3HLP A;  2G9D A;  4K0C A;  2J8N A;  3VH9 A;  3E0K A;  4MRI A;  3TO9 A;  5THW A;  2IQ6 A;  2QIR A;  4NGP A;  3T90 A;  5LRK A;  1A2Z A;  1Z4E A;  8CPA A;  4F6A A;  2ZW7 A;  5HH1 A;  1BLL E;  1CG2 A;  4PXB A;  2EUI A;  2IJZ A;  3GQO A;  4NJR A;  2JEW A;  3S9M A;  2FXK A;  1Y9W A;  1TF8 A;  2D4O A;  2BFR A;  3SIG A;  2DX6 A;  2ZOF A;  3OWC A;  4CGM A;  2HUZ A;  1NSL A;  4EWT A;  2BFQ A;  2P6F A;  4JYW A;  1F2O A;  4PQA A;  2QML A;  4JXQ A;  4MBU A;  4MI4 A;  3TO6 A;  3VWD A;  4EFD A;  2ARH A;  5HMN A;  1WWZ A;  3D2M A;  2ATR A;  1TKH A;  2FT0 A;  3K9T A;  2VQY A;  1HDU A;  4K3N A;  4P4J A;  2ZEP A;  4W9Y A;  1YQE A;  2GLF A;  2C27 A;  3TE4 A;  2GE3 A;  2JZD A;  2POK A;  3NH4 A;  4I49 A;  3KR4 A;  4IF5 A;  3LMS A;  4ETJ A;  4NEX A;  2V8V A;  1I12 A;  4MFJ A;  3IU2 A;  1Z9U A;  5I4M A;  2PE3 A;  2R8V A;  3KAS A;  4YWY A;  5IV0 A;  4B5P A;  3IWG A;  4B10 A;  1CJW A;  2JBJ A;  3ZJ0 A;  4BIN A;  2RFH A;  4R9M A;  4E8O A;  4UFX A;  2YNE A;  3LOD A;  4WJB A;  3S6K A;  3KQX A;  4KVX A;  4K30 A;  1ARL A;  4GS4 A;  1YLE A;  1YR0 A;  1Z4R A;  2RB7 A;  2VXK A;  3P2H A;  1ON0 A;  4OC1 A;  3SI2 A;  3G8W A;  2X47 A;  4OC4 A;  1YW6 A;  4JZ0 A;  4YFJ A;  4ZX9 A;  4KVO E;  2DPT A;  1DTD A;  4AVB A;  4J3G A;  3W91 A;  4AG7 A;  5BWA B;  4CYN A;  3LWU A;  4MFL A;  4JCA A;  1M1D A;  1KUX A;  4MXU A;  4UFW A;  1XJO A;  2PQ8 A;  1LAM A;  2PC1 A;  4CAV A;  1M4L A;  1BPM A;  5AGE A;  5K8P A;  1IYK A;  4CGO A;  2ABZ A;  3C26 A;  4P6Y A;  2FAV A;  2DEA A;  2EK8 A;  2PJC A;  2WPW A;  4KOU A;  4A33 A;  1XE4 A;  2VBQ A;  1Q7L A;  2Q04 A;  1RO5 A;  5JH9 A;  5LYF A;  4KLW A;  3IGR A;  3MN8 A;  2Z10 A;  1RXT A;  4ABL A;  4FD4 A;  1VIX A;  2OB0 A;  4KOW A;  2Z3L A;  5JGF A;  3EJF A;  1ZG7 A;  1FY7 A;  1M44 A;  2PJ2 A;  5IX3 A;  3QNV A;  4NF1 A;  4JD6 A;  3PB8 X;  4L8A A;  5HVG A;  4ZX8 A;  4OLL A;  2Q0Y A;  1VHU A;  2PSW A;  2B5G B;  2IMO A;  2CNM A;  4FUU A;  4TWE A;  3FYN A;  4FD6 A;  1JWQ A;  1F2P A;  4UFV A;  3SI0 A;  1M4I A;  2B4D A;  3DNS A;  4M85 A;  3QB8 A;  5HVH A;  3GLJ A;  1VGY A;  2AJ6 A;  3FB3 A;  2L8R A;  5C88 A;  3EWO A;  1Z8T A;  1UFH A;  4M6I A;  2BO9 A;  1S5K A;  2PRB A;  2OH1 A;  3DSB A;  4UEZ A;  3K2K A;  1S7L A;  3GQE A;  1Z8L A;  2CNS A;  4OID A;  3H8E A;  1AMP A;  1ARM A;  3IWW A;  4QVT A;  3ZZI A;  3DR6 A;  1Y0Y A;  4PXC A;  4JGK A;  3EKE A;  3SJG A;  5I0C A;  3KR5 A;  5G1Z A;  1PUA A;  3WC7 A;  1ZG8 A;  5C82 A;  4D86 A;  4X3R A;  2DF5 A;  2Y0M A;  3IFE A;  4HKF A;  4A39 A;  2V8D A;  4GVV A;  4NGT A;  2CIJ A;  1CP6 A;  3FBU A;  2PJ5 A;  1M4D A;  1Y7R A;  2PJ7 A;  4NXY A;  3EJG A;  2H5M A;  2PJ1 A;  5EBV A;  5G20 A;  1OZP A;  2PIZ A;  3D8P A;  3Q71 A;  1OBR A;  1KWM A;  2CNT A;  2PJB A;  4EME A;  5F09 A;  1GYT A;  4YGO A;  4U5Y A;  1IYL A;  3B3S A;  2KQV A;  3D7F A;  1N71 A;  1ZLI A;  2PIY A;  3CPX A;  3NFZ A;  4CYP A;  4UBR A;  3S9L A;  3FXT A;  2XEF A;  3FX6 A;  4UEE A;  5AG5 A;  1YK3 A;  2FXF A;  2QJ8 A;  3GIU A;  4G1P A;  4F9U A;  4C2Y A;  3BJ8 A;  4DYO A;  1NE9 A;  2Q4V A;  4H6U A;  2JLM A;  4OC0 A;  1M4G A;  1KZF A;  1MJ9 A;  2V77 A;  1NJR A;  3I1U A;  4AG9 A;  4UIA A;  3W6X A;  1B6B A;  3TO7 A;  1CP7 A;  2C6G A;  1GHE A;  2GFQ A;  3VWE A;  5E3B A;  4B13 A;  3DLJ A;  2ZOG A;  4R3K A;  5FVJ A;  5LYI A;  1S7F A;  4DNC A;  1TXZ A;  4M6H A;  4NGN A;  2AFC A;  2JDD A;  5EMI A;  4M3S A;  2OZG A;  4IUS A;  2FIA A;  4EVY A;  1ELM P;  2B3V A;  4B5O A;  4BBH A;  3MRU A;  3DDD A;  1B87 A;  2CTC A;  2F7V A;  1BPN A;  2CY2 A;  2I3C A;  4MCR A;  5DS0 A;  4KOS A;  3RYO A;  3IO1 A;  4ZYQ A;  4R8F A;  4P4E A;  3PRT A;  1IOI A;  5HXD A;  3TTH A;  2GU2 A;  3FRM A;  1PCA A;  5D8N A;  4UCN A;  4HNW B;  4X5K A;  4BMH A;  5HIH A;  5E96 A;  3IID A;  3NA6 A;  4YRH A;  5CB3 A;  1TKJ A;  3IIB A;  4XPD B;  3K9U A;  3CXP A;  4A30 A;  5DUS A;  1IB1 E;  1LAP A;  1Y7E A;  2R98 A;  3CZX A;  4GXH A;  5ELY A;  4DUK A;  3WAB A;  3PBE A;  4J5S A;  3EO4 A;  1J4J A;  4MFP A;  1QSM A;  4AB7 A;  3BI1 A;  3V7Z A;  3H8F A;  2AFZ A;  4CGP A;  5EC4 A;  2YNC C;  1TKF A;  2JEV A;  1H8L A;  4UML A;  2FVG A;  1QSN A;  2NYQ A;  2NSM A;  2PJ4 A;  4P4I A;  3RBU A;  4ZI6 A;  4XPL A;  4P45 A;  2WPX A;  4KSF A;  1IIC A;  1X10 A;  3D68 A;  4PPZ A;  1NSA A;  2PVW A;  4XPK A;  1ZR5 A;  2O4H A;  2J8M A;  4PK3 A;  4Q36 A;  1TY8 A;  4J5Q A;  5LRJ A;  4FBE A;  7CPA A;  2OR4 A;  3B3C A;  4R76 A;  4A95 A;  4FD5 A;  5CPA A;  4OAD A;  1XMB A;  2HV2 A;  4KSA A;  3FMC A;  1VHS A;  4MHN A;  4CAX A;  4CPA A;  1U6M A;  4IK2 A;  3S6H A;  4Y49 B;  1R57 A;  1VKC A;  1R3N A;  4ZGY B;  5F48 A;  1MJB A;  2FCK A;  3I9S A;  2Z11 A;  2ODF A;  4P10 A;  2WUU A;  4MHY A;  2REF A;  4MFQ A;  2QYV A;  3DGV A;  4HNY B;  5K8O A;  4C2Z A;  3TFY A;  2ZEH A;  4YU9 A;  2HB6 A;  4J4Z A;  2Q7B A;  3TX8 A;  1BOB A;  4CGL A;  3BXM A;  1Q2C A;  4FAI A;  4B12 A;  2FIW A;  2Q4Z A;  1QSO A;  3PZJ A;  4MMO A;  2CTB A;  3EWQ A;  4PXE A;  1QMU A;  4CAE A;  5F49 A;  1KUV A;  2Z3M A;  3D66 A;  3PEI A;  4ONW A;  3SJF A;  4UWI A;  1XFO A;  4GUA A;  2CXA A;  3TOA A;  4BD9 A;  4CAF A;  2BSW A;  1UWY A;  5F46 A;  4UCM A;  2AFO A;  3V45 A;  2XEJ A;  1S7N A;  2PJ0 A;  5FSV A;  5K8N A;  1S7K A;  4GVW A;  1IY7 A;  3WT4 A;  1Z2L A;  5F47 A;  4C2X A;  3F0A A;  1YVK A;  1XMT A;  3PFO A;  4L89 A;  4X2T A;  3B35 A;  1YLO A;  4H2K A;  5HOL A;  4PSW A;  1V0C A;  3PP9 A;  4PSX A;  3R95 A;  4E2A A;  4QBJ A;  3IWE A;  4QC6 A;  2ZW6 A;  3S6G A;  1CX8 A;  3HUV A;  3B7I A;  4OIW A;  2ZPA A;  3FEE A;  4KOV A;  3JRU A;  3GB0 A;  4NGM A;  2REE A;  3N7Z A;  2QVP A;  2JZE A;  4B5P B;  3RO0 A;  3S9N A;  5JM6 A;  4TU0 A;  5CNP A;  4Q7A A;  1ZG9 A;  3SHP A;  4KS9 A;  2CF4 A;  1YRE A;  4R57 A;  1PU9 A;  5IB9 A;  3WC5 A;  2OZU A;  3ISZ A;  4IAV A;  4MY0 A;  4U9Z A;  5CMS A;  4CYQ A;  3P2F A;  3TCV A;  4RS2 A;  4R7M A;  1ZO0 A;  1YSJ A;  3H8G A;  1TF9 A;  4J5R A;  2DPS A;  3SII A;  3T8W A;  3PB7 X;  1AYE A;  1K4J A;  4NJQ A;  4JLL A;  4UCP A;  1WK4 A;  3B3W A;  3GKR A;  3EW5 A;  5KTA A;  3PGP A;  5JQ4 A;  3FEC A;  3CXQ A;  3R9G A;  1JQG A;  1XBU A;  2BL1 A;  2WCT A;  2G3A A;  1IU8 A;  1XOV A;  4MHZ A;  2Z3P A;  4NFR A;  2RNK A;  2ZEE A;  3D4U A;  4FD7 A;  2P6E A;  5LRG A;  1HJZ A;  2O28 A;  3EY5 A;  5JPH A;  5H84 A;  3PB4 X;  3KHZ A;  1DE4 C; 
#chains in the Genus database with same CATH homology
 3GPO A;  1ZLH A;  5LYL A;  4IQY A;  4ABK A;  2XEI A;  4NGQ A;  4F8Z A;  2GLJ A;  4X8I A;  2EWB A;  3Q6Z A;  3B3V A;  2O53 A;  3FVL A;  4P4F A;  1BAV A;  1RTQ A;  3CDX A;  3KGQ A;  5CB5 A;  2EK9 A;  1FT7 A;  2VL1 A;  2AFX A;  3V38 A;  3KL9 A;  4KYB A;  3CT9 A;  2AFS A;  3WC6 A;  4FWU A;  2ZED A;  4ETK A;  4OC2 A;  5FSX A;  1QQ9 A;  3PBB A;  3D7D A;  4UIB A;  2AFW A;  4P4B A;  3KI9 A;  1LAN A;  3D7G A;  6CPA A;  3V2B A;  3D7H A;  4O23 A;  4P4D A;  4B6Z A;  3IJ3 A;  2BOA A;  3BHX A;  3GPQ A;  3ISX A;  2XD7 A;  1YW4 A;  4ZY2 A;  4A38 A;  4KSI A;  4Z65 A;  2C1C A;  1CPS A;  3PB6 X;  2ANP A;  5FSU A;  1CPX A;  4WWV A;  1HDQ A;  3N5F A;  3RZA A;  3GPG A;  4ZY1 A;  1LCP A;  1EE3 P;  1TXR A;  4LQG A;  5CBM A;  4UF4 A;  1Y0R A;  3ETI A;  4MCQ A;  1XRY A;  3FH4 A;  4NGR A;  4DJL A;  5LYD A;  3TC8 A;  2AFM A;  3IIF A;  1PYT B;  2C6P A;  2J9A A;  2C6C A;  5AIL A;  1YME A;  2PJ3 A;  2PJA A;  2V8H A;  4PXD A;  2Q43 A;  3VAT A;  2PVV A;  1ELL P;  4ESS A;  3FJU A;  4OKO A;  4A94 A;  4TNU A;  1LFW A;  3FF3 A;  4OC5 A;  3RAM A;  4P44 A;  3EWR A;  3SJX A;  2ZEM A;  3SIJ A;  3SIH A;  1F57 A;  3PB9 X;  1Z5R A;  2ACF A;  2PRQ A;  4NGS A;  2FG1 A;  2PCU A;  2ZEN A;  1HEE A;  5FSY A;  2GRE A;  2PJ6 A;  3B3T A;  1FNO A;  2XEG A;  3KHX A;  4OME A;  3BI0 A;  2HC9 A;  2EEE A;  3NH8 A;  2BCO A;  3B2Y A;  1YD9 A;  4JVV A;  2OOT A;  4IHM A;  3VFQ A;  2WZN A;  2ZEF A;  4RUH A;  1SPV A;  3D67 A;  2Q51 A;  4OC3 A;  2PJ8 A;  3NH5 A;  4F9V A;  1VHO A;  5I4M A;  3SI1 A;  3GUX A;  4AXV A;  2F8H A;  2V8G A;  3FED A;  5D29 A;  4MCP A;  1LOK A;  1R43 A;  1CBX A;  2ZEL A;  2AFU A;  4MCS A;  3PFE A;  3IC1 A;  3VAR A;  2VRI A;  2PJ9 A;  3IEH A;  3SJE A;  1ZR3 A;  2ZEG A;  1IGB A;  1VHE A;  4OP4 A;  5J1Q A;  3L2N A;  3EWP A;  4ZY0 A;  2LGR A;  2JBK A;  2ZEO A;  4GM5 A;  4UEF A;  3KQZ A;  3KZW A;  5K8M A;  3CPA A;  4MHP A;  3JZT A;  4R6T A;  2WYR A;  4A37 A;  5FSZ A;  5HVF A;  3HLP A;  2G9D A;  4K0C A;  3VH9 A;  4MRI A;  5THW A;  2IQ6 A;  4NGP A;  5LRK A;  8CPA A;  1BLL E;  1CG2 A;  4PXB A;  2IJZ A;  3GQO A;  4NJR A;  2JEW A;  3S9M A;  2FXK A;  1TF8 A;  2BFR A;  3SIG A;  2DX6 A;  2ZOF A;  4EWT A;  2BFQ A;  4JYW A;  1F2O A;  4PQA A;  4EFD A;  1TKH A;  3K9T A;  1HDU A;  4K3N A;  4P4J A;  2ZEP A;  4W9Y A;  2GLF A;  2POK A;  3NH4 A;  3KR4 A;  3LMS A;  4ETJ A;  2V8V A;  2PE3 A;  3KAS A;  4YWY A;  2JBJ A;  2RFH A;  4WJB A;  3KQX A;  1ARL A;  3SI2 A;  2RB7 A;  4OC1 A;  2X47 A;  4OC4 A;  1YW6 A;  4JZ0 A;  4ZX9 A;  1DTD A;  3LWU A;  4JCA A;  4MXU A;  1XJO A;  1LAM A;  5K8P A;  1M4L A;  1BPM A;  2ABZ A;  4P6Y A;  2FAV A;  2DEA A;  2EK8 A;  2PJC A;  5JH9 A;  1Q7L A;  5LYF A;  3MN8 A;  4ABL A;  1VIX A;  5JGF A;  3EJF A;  1ZG7 A;  2PJ2 A;  3QNV A;  3PB8 X;  5HVG A;  4ZX8 A;  1VHU A;  2IMO A;  4FUU A;  4TWE A;  1F2P A;  3SI0 A;  5HVH A;  3GLJ A;  1VGY A;  2L8R A;  3EWO A;  2BO9 A;  4UEZ A;  3K2K A;  3GQE A;  1Z8L A;  4OID A;  3H8E A;  1AMP A;  1ARM A;  3IWW A;  1Y0Y A;  4PXC A;  4JGK A;  3EKE A;  3SJG A;  3KR5 A;  3WC7 A;  1ZG8 A;  4D86 A;  4X3R A;  3IFE A;  4A39 A;  2V8D A;  4GVV A;  4NGT A;  2CIJ A;  1CP6 A;  2PJ5 A;  2PJ7 A;  3EJG A;  2PJ1 A;  2PIZ A;  3Q71 A;  1OBR A;  1KWM A;  2PJB A;  4EME A;  5F09 A;  1GYT A;  3B3S A;  3D7F A;  2PIY A;  1ZLI A;  3CPX A;  3NFZ A;  3S9L A;  2XEF A;  3FX6 A;  4UEE A;  4F9U A;  2QJ8 A;  4G1P A;  4DYO A;  4OC0 A;  2V77 A;  1NJR A;  3I1U A;  4UIA A;  1CP7 A;  2C6G A;  5E3B A;  3DLJ A;  2ZOG A;  5LYI A;  1TXZ A;  4NGN A;  2AFC A;  1ELM P;  3MRU A;  2CTC A;  2F7V A;  2I3C A;  1BPN A;  4MCR A;  5DS0 A;  3IO1 A;  4ZYQ A;  4R8F A;  4P4E A;  3PRT A;  5HXD A;  2GU2 A;  1PCA A;  5D8N A;  5HIH A;  3IID A;  3NA6 A;  5CB3 A;  1TKJ A;  3IIB A;  5DUS A;  1Y7E A;  1LAP A;  5ELY A;  4DUK A;  3WAB A;  3PBE A;  4J5S A;  3BI1 A;  3V7Z A;  3H8F A;  2AFZ A;  1TKF A;  2NYQ A;  1H8L A;  4UML A;  2FVG A;  2PJ4 A;  4P4I A;  2NSM A;  3RBU A;  4ZI6 A;  4P45 A;  3D68 A;  4PPZ A;  1NSA A;  2PVW A;  1ZR5 A;  2O4H A;  5LRJ A;  4FBE A;  1TY8 A;  4J5Q A;  7CPA A;  2OR4 A;  3B3C A;  4R76 A;  5CPA A;  1XMB A;  3FMC A;  4MHN A;  4CPA A;  4IK2 A;  1R3N A;  4P10 A;  4MHY A;  2QYV A;  3DGV A;  5K8O A;  2ZEH A;  4YU9 A;  2HB6 A;  4J4Z A;  3TX8 A;  3BXM A;  4FAI A;  2Q4Z A;  4MMO A;  2CTB A;  3EWQ A;  4PXE A;  1QMU A;  3D66 A;  3PEI A;  4ONW A;  3SJF A;  4BD9 A;  1XFO A;  4GUA A;  1UWY A;  2AFO A;  3V45 A;  2XEJ A;  2PJ0 A;  5FSV A;  5K8N A;  4GVW A;  1IY7 A;  3WT4 A;  1Z2L A;  3PFO A;  4X2T A;  3B35 A;  1YLO A;  4H2K A;  5HOL A;  1CX8 A;  3HUV A;  3B7I A;  4OIW A;  3FEE A;  3JRU A;  3GB0 A;  4NGM A;  2QVP A;  3S9N A;  5JM6 A;  4TU0 A;  4Q7A A;  1ZG9 A;  2CF4 A;  5IB9 A;  3WC5 A;  3ISZ A;  4IAV A;  5CMS A;  4R7M A;  1YSJ A;  3H8G A;  1TF9 A;  4J5R A;  3SII A;  3T8W A;  3PB7 X;  1AYE A;  4NJQ A;  4JLL A;  3B3W A;  3EW5 A;  3FEC A;  1JQG A;  1XBU A;  4MHZ A;  4NFR A;  2ZEE A;  3D4U A;  5LRG A;  1HJZ A;  3PB4 X;  3KHZ A;  1DE4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...