1LB2A

Structure of the e. coli alpha c-terminal domain of rna polymerase in complex with cap and dna
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
201
structure length
201
Chain Sequence
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*TP*TP*TP*TP*TP*TP*CP*CP*TP*AP*AP*AP*AP*TP*GP*TP*GP*
publication title Structural basis of transcription activation: the CAP-alpha CTD-DNA complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 61
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2002-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1lb2A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lb2A01
1FC3A 3H1MA 2IJLA 2X0LA 2P5KA 3LOIA 4WK8F 2LKPA 2COMA 1R58A 2L54A 2EFWA 5HDGA 5FLJA 3E5QA 3O3KA 1U2WA 3D82A 3L2HA 2RQPA 1MZBA 1U5TC 5LEJA 1QBJA 3GFMA 2M87A 4AXOA 2G9WA 3M70A 2LNBA 4YFXF 3KLOA 1WLTA 4N9IA 2ET1A 1ZN2A 4MTEA 1ZH5A 4D7TA 4LK1F 4HN1A 5FQ0B 1NE4A 3P9IA 3U0ZA 3RYKA 4EWEA 4I09A 4IHTA 2XL7A 5JI6A 4RGRA 2DK5A 1L3LA 1T0FA 3E6MA 2L4AA 5FLXZ 3BALA 2ETHA 2BEOA 4GCVA 5LGNA 1HKTA 4EWAA 3AAFA 4M74A 4IETA 1ON1A 3FHZA 4BHBA 3ULQB 1E17A 2A6HF 1FWZA 2PAKA 4ZU5A 3H1WA 4XFBA 3NJZA 5E1WA 3H92A 2PLYA 1MJ9A 2WWYA 5BY5A 1D3YA 3BDDA 1FLIA 3E5XA 2ESHA 4XF4A 5JR3A 4HF0A 1LDJA 1YWKA 4XFFA 4FX4A 2ESNA 3F8MA 4FT8A 2VODA 3M9AA 3GVAA 1YFWA 1AWCA 1A04A 2LDUA 1FYMA 1R5GA 1USTA 5ICEA 1YHFA 3WGIA 5BUVA 1NYWA 2PFWA 2O8XA 3HUGA 3JSOA 1WQ2A 2DAOA 1UHWA 2A61A 2RDPA 4WWCA 4M6YA 2PTMA 5ILSA 1VP6A 1KU9A 1JGSA 2QJVA 4XF3A 4ESFA 4UVCA 1NZCA 4KA4A 3HQXA 2M1BA 4Z2YA 5LGTA 2NNNA 2Z3YA 4META 5HLIA 2KIFA 2G7UA 3JW4A 4L9VA 2Q0AA 2EVXA 4AIHA 4UV9A 1RC6A 5K8SA 3WE2A 2STWA 2Z2SB 3V7CA 1LB2A 2XKOA 4XFAA 3TDUC 3NRVA 3HSRA 2M30A 3MZYA 3FX3A 4ON0A 1XCVA 2W24A 4UUVA 3LAJA 1SFXA 1RI7A 5BOXA 2Z69A 2HQRA 1BC8C 5E17F 3RNSA 3H3UA 3HRTA 2MHFA 3HRSA 3HOTA 2IA1A 2EA7A 3FWEA 3IWFA 3K0LA 5CJ9A 5ICGA 1O5LA 4DQ2A 3C3WA 4IHSA 2HQNA 3HYIA 5ERIA 5LBQA 3KP7A 4XF9A 1LNWA 1C0WA 5A2QZ 2HKXA 1QZYA 4KFCA 3EUHA 4HSLA 2Z99A 2XRNA 2ZCWA 4WXDA 1H1MA 4QGNA 4XETA 5HLGA 2GC2A 2HWVA 5HDNA 1TNSA 4L18B 1UD1A 1BM9A 3DEUA 1R5HA 3DPTA 4Q5SF 3R61A 4GULA 3K2ZA 5HI0A 1Z9CA 4ZZDA 1FT9A 1R22A 1SD4A 3MFKA 3OTFA 3BJOA 2IVMA 5JR7B 2ATFA 3EHKA 3EYYA 4IEYA 2J5PA 4ASNA 1FI2A 1WI9A 2VE9A 2ZO4A 3S7EA 3MZHA 4Q29A 3KFWX 2QBYB 3WTWC 1J3RA 2XUBA 2IP2A 2Y75A 2BNMA 3TO9A 3CUQA 2KIUA 4D0PA 2WTEA 2RN7A 5KHIA 5BS6A 5CVUA 3IRRA 2XGXA 4Y15A 4YYOA 2RVCA 5CVRA 2GZWA 1HSTA 1W7PB 3GUDA 4ENKA 2FF4A 1IN7A 4KDPA 2NS0A 4YIIA 2L01A 1CAVB 2YPRA 2KIMA 4LJZF 3WTUC 3CLOA 4UXAA 1L0OC 2ADUA 3K1MA 2KJBA 1SMTA 2BV6A 5C8WA 5ED4A 1J7KA 1MJBA 2LSOA 2VBYA 3GZ6A 4F7ZA 3F23A 4IEOA 1J0RA 5FDBA 3JZVA 5D6EA 1Z7UA 5BPIA 3V8LA 1SAXA 5BXXA 1UW8A 4LMYA 4OMZA 3HT2A 3T0YA 3BPZA 1BN5A 3FHIB 1WKMA 2J5OA 4Y17A 2HYGD 3E3VA 3GFLA 1KYZA 3L7WA 1EPZA 4MHGA 3RPQA 2E7WA 4YFKF 4MEYF 1IN5A 3WTVC 1S6LA 5EFUA 2HFHA 3IKTA 3BPVA 4R1HA 2QDRA 3HSEA 4AD9A 4HVOA 4U0YA 4L9NA 4YARA 1IN6A 4TLFA 4YRDA 3M8EA 4O9EA 4M9SA 2P5LC 1TQ5A 3DQVC 1TQIA 4JV4A 4EROA 2L4MA 3SZPA 3WE3A 2OAZA 4I01A 2B5HA 1W7PA 1XN7A 3MCZA 1FP2A 1RUOA 1K7AA 3WTZA 4IXAA 1XSVA 2EAAA 5HS7A 4LLLA 4NQWA 4MGZE 2K7LA 5E8IA 3RZZA 1IW7F 3CUQC 4Q4ZF 4HAMA 3V4GA 4ENMA 5JSRA 1PUEE 4B09A 4RS8A 4A0XA 5K5QA 1I1GA 3GYHX 4P5OA 3PQJA 5DD8A 4LB5A 5FLXK 2UYBA 1XMKA 3MDPA 5FGMA 1CF7A 3CO7C 5F64A 1FXZA 1DGRA 4CGZA 3ZN1A 4RGSA 1XGNA 3FFQA 5I0TA 1U6GA 1J58A 3ZN0A 2DCTA 4MUVA 4Q48A 5DV5A 2XL9A 3NEUA 2M45A 1O3RA 3QOPA 3QPHA 2P8TA 4RB1A 3DXJF 2EV6A 1X3UA 3M8FA 3I0TA 5HS9A 1LEBA 5L3BA 1MD0A 4M71A 1YFXA 1TTYA 1LVAA 1STZA 4XRFA 2ACJA 4A5MA 4EGYA 2MA3A 3QP6A 1DGWA 2HZTA 1HW2A 4WBBA 3SMHA 4P9UA 5H20A 4EVIA 1UIKA 1ZZBA 3GZ5A 4E2GA 2CV6A 2R7FA 4BXUA 4ZYEA 1Z05A 3T8RA 3WGGA 4LLGF 5L3EA 2GC1A 3WW4A 2DT5A 4I0AA 3PLQA 1JUHA 4KYWA 2JPBA 4RGUA 2P17A 1MDMB 2OBPA 1K78B 1ZRRA 4ZU4A 1U8RA 3TOBA 2A69F 4D7SA 2ET7A 3CUOA 2DFIA 2DPDA 2V79A 4H0EA 1Y0UA 1S7AA 1ZGJA 3I59B 3GXOA 2VOPA 3B02A 4HMZA 4A6DA 1FOKA 2PJPA 3J81Z 4GYIA 2D5HA 1JHFA 3IBMA 3N97A 5KHGA 4HBNA 1KU2A 4KUMA 5F6FA 3ES4A 3LA3A 2Q0OA 5E20A 3S0MA 3E6CC 3L2CA 2ISYA 2Q2EA 2C0ZA 3OOPA 4G7OF 2IXKA 3C7JA 4MH0E 3W6JB 2A5YB 4IEQA 3J80Z 3WODF 4MTDA 1YG2A 1CGPA 1BI0A 3L00A 4XFCA 4LTAA 2L02A 2FQPA 4Z82A 2EV0A 2Z5UA 2IXCA 1BI2A 4CYDA 1SFNA 2H6BA 1NHAA 1X8EA 1UPIA 4EJWA 5A2QK 1QXJA 2O61A 2ZNZA 4HDUA 1HW1A 1BI3A 2XAGA 5E16A 3BY6A 1K78A 3W6KB 3RKYA 2XAJA 4ZYHA 5D5VB 2JRTA 3LZZA 5ILUA 3QRFF 3ROUA 4S04A 4LULA 1XDUA 4PZJA 1K6OA 1VJ2A 1KGSA 1RZ4A 3USSA 2QENA 3F3XA 3BWGA 3KGLA 2XIGA 4LD5A 3NKTA 2OA4A 2XLFA 2FNAA 2VPVA 4WX9A 3VFZA 4BH9A 1B4AA 3SXWA 2MNGA 4CXFA 1HKQA 1WRJA 1XSXA 1I5ZA 1RL3A 2IC1A 3CO6C 3KP4A 3HOSA 2OPKA 3RJPA 3SHRA 5CLSA 3RIRA 1YUDA 4Y13A 4G7ZF 2QQAA 3GEZA 1DZRA 1Q5OA 2ELHA 2KJCA 4IJAA 1YFYA 1ZREA 4LEJA 1DDNA 1J3PA 3OF1A 4EMSA 3UKTA 4LGWA 2YX7A 2XLGA 3ML6A 3SCFA 2CQKA 4QX5A 1LJ9A 3KETA 3BOQA 1ZX5A 5DCMA 4IPAA 1ONVA 1EH6A 3PVBB 1E2XA 4EV0A 3R4KA 4X6RB 4PIXA 4CDGA 2FOKA 3P7NA 4HBLA 4IRIA 2RV8A 2DW4A 3QACA 3U2RA 4HLXA 3HHHA 3RKWA 3FZ3A 1JE8A 4UV8A 1IPKA 3FMQA 5L3FA 4U0WA 3RDIA 1HW5A 3MYXA 1Z1DA 2D1HA 5BV6A 2DBBA 4I98B 1UB9A 4XF0A 5BQTA 3GW2A 1ZYRF 1YFUA 3RPUA 3ELKA 3ECOA 1YO5C 1GXQA 4HQEA 4IEUA 1FNNA 4GGGA 4PGHA 5HOOA 1WSUA 4RB3C 4JVAA 4KWKA 1TQPA 4AVPA 4XLPF 4RB0A 1XB4A 2V09A 1J9IA 4KU7A 3GWZA 1O3TA 3V7SA 4HYEA 1QPMA 1YIOA 3IKVA 3EQLF 3I71A 1JXSA 2VXZA 4NB5A 2QVOA 2HYFA 1J3QA 4MNUA 1CAUB 5KHHA 5FQ0A 4OU0A 5I93A 1RTVA 1XCBA 3B73A 4IEWA 4K8FA 2W57A 2ZJ2A 2Z9OA 1CX4A 3SCGA 4RAZA 2CFXA 2Y48A 2HTSA 1KU3A 1IXRC 2YR2A 1O4TA 2QVSB 3DKWA 1U3EM 5CYVA 2CAUA 2D93A 3L9FA 3HSFA 3HT1A 5DUKA 3BPXA 4HVRA 1YLLA 1KQ8A 1S3JA 4LB6B 4KN7X 5CVJA 2FU4A 2CO5A 2IA0A 5D6FA 4E2SA 4LK0F 1B9MA 2GC0A 3SHFA 3FXUA 3IDBB 3CJNA 4U7DA 4P9GA 4MQVA 1WGPA 1P4XA 4HVQA 1YW7A 3ECHA 2Q8KA 2LF7A 4ESJA 2DI3A 2XROA 2IT0A 4EJUA 3NSTA 1IXSB 5FFXA 2ZMEB 3WTXC 3F6VA 3JAMZ 1H0MA 4Q0UA 4ESBA 4K2EA 2ZKZA 1X8MA 4EJTA 3F8BA 2OU2A 2LF8A 1TBXA 3TKYA 4TV7A 4KIFA 1D8JA 2IPQX 1J1LA 4PGGA 1ZVFA 4UXNA 5F1RA 2PAMA 3SQNA 4RB2C 2HJIA 3IWZA 5CVIA 2L3DA 3ZMUA 2GA1A 4KNYA 3HIFA 1R00A 1MJAA 3T5XA 3ABUA 5LHHA 4OLLA 4IEVA 4AVBA 1TNTA 3FJSA 5JSOA 4A0ZA 4P9FA 4M9XA 1T38A 1X7NA 2P5VA 4MGRA 1G3YA 4R8HA 1VTNC 4ZZLA 5FPZA 3E6BA 1F1ZA 3ZQ7A 1RIOH 2GA2A 3DP7A 2E1NA 3J81K 1BIBA 4KMUX 4G94A 3FMRA 5DUIA 4AVCA 2H09A 4H7LA 3EO6A 2ZMEA 4FHTA 3J7AO 2NYXA 2PMUA 5FB2A 2VT2A 5TRDA 1ON2A 5D4SA 5FFZA 2WFPA 2FMYA 3CDHA 2PFBA 2PA7A 4MGKE 4FX0A 1LR5A 2IXLA 4ZH4F 3RTRA 5IT3A 4I2OA 1YW8A 4M9ZA 4MEXF 5J6XA 2RC4A 2JTVA 2O3FA 1J5YA 4WVZA 2FQ3A 4X6QB 3LSTA 4EWDA 1P2FA 5EZWA 5E8GA 2XLAA 2FBIA 3I58A 1KA8A 3TNQA 3DPLC 2VC0A 3IC7A 4G7HF 5K5RA 4O5VA 1PP8F 2VECA 4WXHA 4OMYA 1G3SA 2QLZA 2V9VA 4M73A 4OIPF 3QPTA 5DD4A 3MWMA 4RGXA 3SXYA 4I7HA 1V70A 3EDPA 5DDGA 3LA2A 1Q43A 4B8XA 2ETEA 3ZMVA 3EYIA 1W5TA 5KK1A 2A6EF 1TLHB 1R1UA 1V3FA 3REOA 4HDVA 3I54A 4F8AA 4R79A 3L09A 2QUFA 3F8CA 2QBYA 5L3GA 2OZUA 4L9JA 2NNYA 4HLYA 2HR3A 3HHGA 2XAQA 2DTRA 2H0VA 4OFGA 1CAWB 5D4RA 1Q1HA 3U10A 2ZXJA 2QWWA 4N9HA 3CEWA 3ELNA 4NVPA 4KWJA 4MV2A 5EEGA 2FXAA 1Y3TA 3MPBA 2GIVA 4Q0PA 1I27A 3FXQA 5JVTA 1B9NA 2DQLA 5D1IA 1CAVA 3U9GA 1EV7A 4KICA 2V6CA 3JSPA 3G73A 4Q0VA 1ZZ6A 4DINB 5HS8A 1O5UA 5I0UA 1VR3A 1XD7A 2OA2A 4IF4A 3WW2A 1XDSA 2PYTA 4YNIA 1LDDA 2R7DA 5IT9Z 4PDKA 1WA4A 1U12A 4QMAA 5L3CA 5TJJA 2WC2A 3RKXA 4EM0B 1JHHA 4A6EA 2OYZA 4LG0B 2GU9A 1W4MA 4JTOA 3F72A 2VQAA 1NXMA 1F4KA 2GXBA 1ZGAA 1REPC 3GFIA 3TNPB 1K79A 3I53A 4Q47A 2TDXA 1HBXG 2O8QA 1SMYF 3BJ6A 5JSPA 2FBHA 1EYBA 3M7GA 3V7RA 3F22A 3GLXA 4PCQA 1CAWA 4G6DA 5DCFA 2IXJA 5E1RA 2D45A 2FA5A 3ABTA 2Y0OA 4QGMA 5CVVA 2HS5A 4JBAA 4E2QA 5H6RA 2VONA 4L0YB 3V8JA 2VBWA 2YSRA 1AOYA 4GXOA 4MZUA 1W5SA 1ZZ7A 1R23A 5LGUA 2M5WA 1IRGA 1DZTA 3VOEA 2XKPA 4L9TA 3R0AA 2WV0A 4BIFA 4B29A 2P7CB 5LRSA 3Q5FA 4Q0QA 1D8KA 2D40A 2H27A 4EQQA 2UZKA 1IUYA 2EJRA 4ZYDA 1O57A 1USSA 2K02A 2K27A 2ZBKA 4KU8A 3KP3A 1ODDA 5DYMA 3IIAA 1TW3A 3H3ZA 1R7JA 3TO6A 4O3MA 1YQAA 2VBXA 1BBYA 5AIQA 1T2KA 3ZP5A 4HX8A 3PFIA 3CJXA 1G3TA 2MLGA 4WF2A 3BROA 3OCPA 3V8KA 4YIFA 5ICCA 1FYLA 4IERA 4LLOA 3KMHA 4J1WA 3ETQA 1IAWA 1I1SA 1T6SA 1SD6A 5JFRA 1QGPA 4FAGA 1ZARA 1B1BA 2GQQA 1Z91A 1O3QA 3TGNA 2DO7A 3T1BA 1EH8A 2UWMA 1B59A 1Y9QA 2JPCA 2XAHA 5CU1A 2XASA 1ULYA 1LEAA 2YU3A 1DPUA 4OOIA 1ZLKA 3KLNA 1ZRCA 1F5TA 3TO7A 2CWEA 2FE3A 1H9GA 3BCWA 4L11A 2EFOA 5LEKA 1MDMA 2EA2A 1OYYA 1ZZ8A 4HN0A 3KGZA 2ISZA 4UNOA 1RNLA 3DF8A 3I59A 4XFIA 4AIJA 4LLNA 2FMLA 2HEOA 1SD7A 2M8EA 3KP6A 3CF6E 2MD5A 5FCCA 1RGSA 2P6SA 4MX3A 1BC7C 1SFEA 1FBUA 2HKOA 1IN8A 2EK5A 1LKNA 3VB2A 1ZLJA 1SQ4A 3C1DA 2W25A 3KEOA 4U7BA 5FLHA 4FAHA 2IA2A 2OZJA 4XLNF 4AQ2A 4ETSA 3K1NA 2O1QA 3WW1A 2PBIA 3E6DA 3OD0A 4QGLA 1F9NA 1FBQA 3BZ6A 3I5UA 2E7XA 3D5LA 2NAZA 3RI4A 5D5UB 2MPFA 4HQMA 2CSOA 1FSHA 1LDKB 2O0YA 4NHJA 1J2XA 2A68F 1PDNC 4HF2A 2W84A 4Q0SA 1BJAA 3M1EA 4AVAA 5I8SA 4EM2A 3O14A 1QNTA 3TDZC 4KIBA 4EM1A 5BPDA 1GVJA 3QAHA 1KQ9A 3KP5A 5J48A 5KBFA 1P92A 4BNCA 3Q9VA 3OV8A 3QU6A 2UY9A 2KRFA 1IN4A 1UHMA 2UYAA 2UY8A 3U11A 3D0SA 5LLQA 3F8FA 2BYVE 3BB6A 1IXCA 2DLLA 2DQRA 4ENJA 2QM3A 1O3SA 2D5FA 1QWRA 1UIJA 4ZYGA 3Q9SA 4AIKA 5D5XB 2O6GE 1OYIA 4CO8A 4XFHA 3R6SA 3NQOA 2ZKLA 2MLKA 2Q4SA 4HX4A 5JHUA 3LQQA 5JCTA 4QXKA 3NVCA 4EGZA 1XGOA 4PIZA 3FE5A 4JK1X 3H9AA 5D8LB 4LA2A 3WU1B 1DUXC 2G7HA 3KEQA 3SFZA 5E1ZB 3LA7A 4OIOF 2VN2A 1ZZ9A 4IESA 3SZTA 1Z6TA 2E1CA 5KVRA 2F5EA 2R3SA 3WW3A 4HSJA 4HOBA 2B9UA 2QQBA 2PI0A 3CLPA 1FY7A 4ORFA 3BJAA 5IT9K 4LUMA 4XSXF 5K1YA 3CTAA 3UKVA 5J7MA 3HTSB 5FD5A 2PHDA 2RNJA 5C6CA 1W7PD 4YG2F 1FYKA 1P4AA 4UVBA 1YS7A 2B0LA 4AWXB 2HGCA 2RKHA 3DL3A 5KHKA 4JTNA 4MGIE 1OYWA 2A3SA 3WG9A 4KMFA 3I7DA 2D1VA 2QZ8A 3R0JA 2GC3A 4CZZA 2DU9A 3OGJA 4BHPA 2YX4A 1SD5A 2EB7A 3C3VA 3S2WA 2PN6A 3I4PA 4IEZA 4UBGA 5H6QA 1CAUA 4XBFA 3U1DA 1XGSA 2XV4S 4HV6A 3H1YA 1LQ1A 4GO1A 1ZAOA 2UXNA 3CUQB 1H1IA 1FX7A 1J59A 3EJKA 4IEPA 4LA3A 1XRUA 1OR7A 5I8YA 2BNOA 4G9YA 3IHUA 1NE6A 2V1DA 4O6JA 2H94A 5J3UA 3GBFA 5LHIA 1SEFA 5BMZA 2EWNA 2K0GA 3WTYC 3IDCB 2OZ6A 3G7DA 4CICA 2MBFA 2EA4A 3BU7A 2QNKA 1RUNA 2JZYA 2CGPA 1OD5A 5K5OA 1O7LA 2BGCA 1QO0D 1ZG5A 1FZPB 4N0BA 3M3IA 4EJOA 2V1XA 3WTTC 2DPUA 1HKSA 1R1TA 1UCRA 3RYRA 4YSFA 1FP1D 3TQNA 3CO2A 1UCXA 1Q3EA 3ISPA 1IPJA 2QYOA 1QY4A 3GYDA 4ENNA 3KCCA 3EQEA 4L0ZB 1T39A 4HA8A 2HTJA 2KKOA 1D5VA 1ZNPA 2F4PA 3TOAA 6PAXA 2UXXA 1ZG3A 5I91A 4S05A 4P96A 5HVQC 2BE5F 3QP5A 2FEZA 4E70A 3H8UA 4L5IA 4IVNA 3KSCA 3FMSA 1KU7A 3MAJA 1J75A 1XSDA 1R36A 3J80K 5FPXA 2PHLA 2PMHA 2H6CA 3HRMA 4J1XA 3ZMDA 5KHJA 3BP8A 1PP7U 2OD5A 5J8CA 1ZRDA 3KZYA 4G8XA 2VC1A 3H50A 1EY2A 4JQFA 4MGYE 4XEZA 3LAGA 3VEPA 4I02A 4KL1A 3CL1A 4HLTA 2RGVA 1OI6A 1O7FA 1TQMA 4I3PA 1OPCA 2FNPA 4BYYA 2Y0MA 2BNNA 4A2UA 2XAFA 3MEXA 2MH9A 2F5DA 3O6BB 1HSJA 1G3WA 1X82A 3D0JA 2P4WA 2N7GA 2CYYA 3H7JA 2IXHA 4KWLA 2B8MA 4R52A 3HRUA 4HX7A 4OINF 5JAXA 1KYWA 1U78A 5ICFA 4L5JA 1GHCA 4OIQF 4XF1A 1R1VA 2K4BA 4U88A 4G6QA 2Q30A 5FLIA 5BPXA 1ZZCA 1V4RA 1CF7B 5I8TA 3VODA 2FRHA 3P9KA 4ZU7A 3QU3A 3RYPA 2MC3A 4M72A 3COAC 4WZCA 2PAEA 5HLHA 2O03A 1H9TA 1FPQA 2AXLA 2XVCA 1KQ0A 3P9CA 3F6OA 2VOOA 2VE8A 5LHGA 1YFHA 3ERED 4Z07A 2PG4A 4XFGA 3GFJA 1S8NA 4L2NA 2QQ9A 4M6XA 2ZFWA 2C6YA 1XMAA 3ZPLA 3LAPA 3R60A 1HXDA 2D2WA 3G3ZA 4LUKA 2Q1ZB 3K1PA 5D5WB 4CHUA 4U0VA 3T8TA 1HQCA 3DN7A 4HF1A 1BOAA 5L3DA 1BIAA 3MQ0A 2VBZA 3ZMSA 2HOEA 1YS6A 1CAXB 5AIPA 1EP0A 5I0RA 3GX4X 5LRRA 5ILVA 3C18A 4PJYA 1QQIA 2P6TA 3S7IA 3F21A 3WTSC 2GWRA 1DP7P 4UHTA 3FXRA 4BHCA 3JTHA 5AVPA 1WWXA 3H7YA 4YFNF 2A07F 2EFPA 4IRHA 5J8FA 2NRAC 3KE2A 2W85A 4HW0A 3WGHA 2V1UA 5E18F 1U5TB 3FM3A 4A5NA 2KXLA 4HZFA 2F5CA 2Z33A 2HDCA 5FO5A 5FD6A 3PQKA 3ZMTA 2JT1A 2X4HA 1ZHFA 3GO5A 4BAYA 2JSCA 1UFMA 3ZMZA 3FF5A 2FSWA 2IW5A 3ACLA 3FZVA 1SFUA 2GAUA 4DNCA 4KN4X 2F5FA 3KP2A 4UVAA 3JTGA 2FBKA 3EBRA 4WCGA 2DK8A 4P55A 4HV5A 2K4JA 1QZZA 1CAXA 4LG0A 4A0YA 5AONA 4QWQA 4O9GA 2STTA 4FBFA 1IF1A 3N4MA 4LFUA 1T98A 2QCSB 4MQ9F 4IEXA 3LQRA 1FBSA 3ST7A 4XSZF 1Z6RA 3WU0A 1XE7A 3IRQA 1DPRA 4QM8A 4ONUA 3O2PE 1GQGA 3EETA 3SCHA 1ZRFA 1P4WA 1ZG1A 1OKRA 2AS5F 2K9ZA 5CADA 2PEXA 2EFQA 4KT5C 1XGMA 2XHKA 1GQHA 1L3JA 1YYVA 2OQRA 1U5TA 1G6NA 1I6XA 1YW9A 4KIGA 1IRFA 4GYGA 4QM9A 4I0BA 3JAMK 3I64A 1S29A 3IL2A 2F2EA 1YLFA 3K69A 4AQ6A 2PQQA 1BI1A 3DFGA 3DV8A 3NL1A 4IRGA 3NW4A 2CAVA 4QLCU 2OQGA 2CW0F 2MH2A 1MKMA 4BQAA 5I0SA 3UKNA 1PMIA 1IZ1A 1OMIA 1QXRA 4EJVA 2K86A 3E5UA 2EFNA 2GXGA 3LWFA 2CG4A 1LRHA 1B6AA 1MGTA 2IRFG 2PQ8A 3F8NA 1G4DA 1GXPA 2ZNYA 5E1XA 3ES1A 3E97A 3PNAA 3KZZA 1P6RA 3LWCA 3FM5A 4UBHA 1FSEA 4A12A 1PM7A 5HDKA 4OIRF 1TW2A 4RD7A 3K9TA 1EH7A 2E9QA 3VHRA 5DCMB 1OFNA 2BBYA 2GH2A 3HTUA 2EV5A 1YTYA 4RAYA 5DEQA 5D8KB 4WXCA 3LFKA 3ZDSA 2I45A 4PIYA 1XE8A 2VT3A 2IXIA 5T3NA 3GF2A 5EEHA 1S7OA 2P7VB
chains in the Genus database with same CATH superfamily
4ES9A 4OULA 4KGQA 3P5BA 1JU3A 1S0EA 4NROA 2LKPA 2COMA 5JOWA 5FZDA 4BEHB 2EFWA 5FLJA 3WV6A 2VC9A 3E5QA 4B44A 3O3KA 1VB2A 3RQ0A 2VTXJ 2RQPA 3OG2A 4CEWA 1W8NA 1AR92 2H8RA 4GZ9A 5JLWA 2W1QA 4HRIA 1AR71 2A6XA 4XRSA 5IYBJ 5LEJA 1RUJ2 5FYZA 3SDGA 4YFXF 4AI3A 5HCAA 4NRPA 4BKXA 2ET1A 3VDBA 2HWF3 5L73A 3WP6A 5FQ0B 1NE4A 2YS9A 2IAIA 5G04L 4A3FJ 3LDBA 4QPIC 4I09A 4IHTA 1RUI3 2C24A 5JI6A 4TTGA 2ETHA 4J01A 4EWAA 1J83A 3AAFA 3KM5A 2DVBA 2JD9A 5FZ6A 3L2UA 1DU3D 2HWE3 3ULQB 5LY1A 1Q8VA 2A6HF 4XKBA 2PAKA 4G4FA 4ZU5A 1BEV2 4XFBA 1D3YA 3BDDA 1AX2A 1PVC3 1Y9GA 3DTIA 2H0BA 2JN6A 4RFRB 4Y26A 2TCTA 4XFFA 3KV5A 3NKGA 4UOJA 3F8MA 4FT8A 1AXYA 4BL0B 1A04A 2DXIA 1R5GA 1Q8PA 1S0IA 5C3QA 1USTA 4MFEA 1NYWA 2RS33 3NAPC 2RM22 2Y6HA 2LR8A 1NLQA 4C3JJ 4GWMA 4WWCA 4M6YA 2PTMA 2V9KA 1KU9A 3P3PA 1WGXA 2QJVA 4XF3A 5AC92 3BTXA 1XC6A 3CF2A 3ENRA 4Y1VA 3C8XA 2Y2ZA 5ISLA 5FO9B 5LGTA 2NNNA 5A7OA 1IHMA 4META 3K4MA 3HPHA 4Q4W3 1HDDC 2OUHA 4DOZA 1VQ8I 2QE3A 1RC6A 5FJHA 5K8SA 2STWA 4Z92B 4BDZA 1WMFA 3MV11 5FPVA 3LPFA 2M30A 3DEMA 3HKZA 1V6IA 5DUVA 1XCVA 2ILMA 1U9OA 4UUVA 3LAJA 4YG6A 3MLJA 1SEUA 1RI7A 1TP4A 3OSGA 3HRTA 1PO22 1RC9A 3R0RA 3TYJA 1V5GA 3HOTA 1FNZA 1GZWB 5DAVA 5FYCA 3IWFA 1SCSA 1K61A 4IHXA 5CJ9A 3A1YA 5ICGA 2VUAA 3D5RC 3JU9A 4LE3A 5SV5A 2HQNA 4LKDA 2NVXJ 5C8CA 5GZFA 4XF9A 1LNWA 1IS5A 2W92A 2UUZA 2XRLA 3EUHA 4HSLA 3WF2A 1UKGA 1W8UA 4QB1A 3KD4A 2YG0A 4HKWA 4C0HA 1H1MA 3PU3A 4TZDA 1QDCA 3LSRA 2OTLI 4L18B 5DQ0A 4BU2A 1XPXA 4XPVA 4LT5A 2KRHA 1N3QA 3R61A 3K2ZA 1FT9A 1R22A 2BGOA 5CFDA 4OHVA 2IVMA 2LREA 5FYIA 4ASNA 1CD3G 3MZHA 3ZCOA 4DW6A 3RZJA 2XUBA 4QU1A 3CUQA 5F2SA 2KIUA 1OF3A 2BY2A 5KHIA 4QX2A 4G12A 1HLCA 3WUDA 5BS6A 5CVUA 1D7PM 4Y15A 2RVCA 1W7PB 2VQGA 2L01A 4LJZF 4BS9A 3QH7A 4UXAA 3CLOA 1OQ1A 2DCZA 1XJAA 3K1MA 1SMTA 1LFUP 1UL9A 4UI9L 1R1A1 1C8M2 3A01A 3LOBA 3ZLIA 4IEOA 2P3YA 1J0RA 2QQJA 5FDBA 1UZCA 3WSOA 1A6QA 1UOGA 3WNOA 4JYKA 5BXXA 3DU5A 2FX0A 3T0YA 3FHIB 1WKMA 2XF7A 2HYGD 3E3VA 3RPQA 4PK4A 1V5FA 4RM2A 3HL2A 1X1AA 1VBC3 1GZ9A 2BHZA 4ZTFA 1IN5A 1V6OA 1S6LA 3BPVA 1NCRA 2QDRA 5IFTA 3H3VK 1WCQA 4YZ5A 2V26A 4YARA 1IN6A 3F9KA 4O9EA 4M9SA 3MIBA 4JV4A 1K42A 2OAZA 1VRBA 2WADA 3CMEI 4NHXA 3ZN6B 4HXCA 2EAAA 1ZYBA 5DDJ2 4LLLA 4MGZE 2XBO3 3RZZA 4Y33A 3NJVA 1QIQA 2F4MB 3H5RA 2OKXA 5GZGA 3V4GA 2RM21 1PUEE 5EYYA 1OXCA 4F92B 3BCAA 1AJKA 1BKZA 1AHSA 3MDPA 4ZZ5A 1W0UA 1RJ8A 1J1TA 2VNGA 1FXZA 5C4XJ 3LEIA 3I3BA 4RGSA 2D97A 3ZYIB 4XOPA 4MUVA 4Q48A 2B9SA 1SHWB 3JRFA 1ENHA 3LL7A 1BK0A 1GU3A 2XL9A 1F15A 2FDFA 1KDKA 3O8HA 2ZX3A 3PNYA 3WDXA 3QPHA 3DXJF 2EV6A 4ZDPA 3N3HA 1UQXA 1LEBA 2J1VA 4M71A 4QU2A 1TTYA 4ZTJA 1PNGA 5FR3A 2Q2EB 2VZPA 3SEZA 2WR9A 3M3CA 2TBVA 4ZKTB 4G6TB 4UWDA 2MA3A 1RHI3 1POGA 1NG6A 1DGWA 2A3WA 3LFMA 1HW2A 1ZZBA 2XB5A 3T8RA 5FYMA 5JPMB 1G9CA 3PLQA 4QPYA 3PUQA 3GZEA 4KYWA 2JPBA 2BVBA 2P17A 4DNYA 2OBPA 1K78B 1YQ6A 1U8RA 1VBB3 3A02A 1VMHA 3F0CA 2C9AA 3Q3SA 1ZGJA 4EJRA 5IAXA 3K75B 3N9LA 1PK6B 3IBMA 3OEAA 3N97A 5KHGA 3PIPF 3T30A 4HBNA 3DKXA 2EQRA 3D8CA 3ES4A 5GLUA 5E20A 2ISYA 4AEDA 2UU8A 3OOPA 3W6JB 1W5CC 5EWSA 3J80Z 3WP3A 1NQJA 4MTDA 1CGPA 1BI0A 4LTAA 2L02A 1KZHA 5FWEA 4C1XA 3VGIA 5GP9A 2PMZA 1SLLA 1U8BA 5A2QK 1GLHA 2VZQA 2O61A 2DUOA 4KBBA 5K7HA 2HWF2 4IOCF 4J00A 4LBLA 4AGRA 3GZNB 1XTAA 4ZYHA 2VMHA 5FUNA 1HB3A 4K9SA 5FREA 2JRTA 1V0AA 3I8TA 5BNNA 1NH3A 1RUI2 2YZ4A 4S04A 2BPA2 4YVSA 1XDUA 5FY7A 4H55A 4PI2A 2CJJA 1QJX2 3USSA 2QENA 2VL8A 3BWGA 2XIGA 3CC7I 2D3PA 2YDEA 3MHZA 5DAQA 2OA4A 2VPVA 4GB32 3IKWA 3VFZA 4BH9A 3SXWA 2HWE2 4YVWB 1XSXA 1I5ZA 2CHHA 2DJNA 3OPTA 2GOMA 4AEMA 5DS9A 3JQXA 4DXSA 5A7PA 3TEYA 3WX5A 4G7ZF 1RIRA 3OPWA 1HN1A 1Q5OA 3LEKA 2KJCA 2C9KA 1Y1WJ 4NR1A 4DY5A 3H8OA 4IV3B 2XJPA 4G9SB 2RG4A 1J3PA 4I6ZA 4LGWA 2L7FP 4IXLA 4LIUA 1AL0G 2KQRA 2BOLA 2ZHKA 5IWFA 3C7OA 2CQKA 2RS32 1ONVA 5LATA 4C8DA 2R7VA 2X05A 4PIXA 2FOKA 5FBJA 2LK2A 1DQ2A 4NDLA 3K46A 4XLCA 2E60A 1Y43B 3FKIJ 3U2RA 3RKWA 1G9AA 1JE8A 4F91B 4QXBA 1AL21 4UV8A 4D5FA 1LOFA 1WZXA 3MYXA 4CCDA 5BV6A 1OLME 3OUIA 1Z3YA 4Q4W2 3RPUA 3ELKA 4D6RA 3OYEA 2QSHX 4Z6YA 2VUJA 5A3UA 4E7LA 3O1PA 2VW0A 4KWKA 1ZBA2 4AVPA 4B3XA 1J9IA 3POWA 2VKVA 2DYRH 1O3TA 3V7SA 1RMU2 1VQOI 4HYEA 1YNAA 1Y0NA 4JZRA 4NB5A 2QVOA 1R083 5FZGA 4MNUA 1CAUB 2XONA 4LXLA 1UY0A 4LOSA 4Y4RA 4CDWA 1UXZA 3DYOA 4PT6A 3KCXA 3ZXDA 1KGYA 3INAA 5FTTC 1KU3A 1IXRC 1JTZX 2VXDA 4QSHA 3WCSA 4P9LA 2AEYA 1VZ0A 3L9FA 5F27A 3N9PA 1I3AA 4JHTA 5DUKA 4ZDOA 2WDBA 4HPQA 1YLLA 4LB6B 1N1VA 2CO5A 3K51A 1R6RA 4A93J 5HBAA 2WV1A 4P9GA 1SAUA 3BR2A 3ZQGA 2WLQA 3NWTA 1YW7A 2OT7A 2CMPA 1HRV2 4ESJA 2GP3A 4IW3A 5JUVA 5EG0B 5FPBA 3FXKA 3SH4A 2ZMEB 4N53A 3WTXC 2H1LA 4CA9A 1F4HA 4Y7NJ 4YZ2A 1W28A 3I2OA 5F04A 3OBTA 4YVWC 1TBXA 3TKYA 4ET7A 1D0HA 3K4DA 1J1LA 3W2WA 1VBA3 3VDDB 4RDUA 3MKZA 1ZVFA 2KR2A 1QF3A 3PIOF 4IQPA 5CVIA 1RUC1 2AQEA 2CV0A 4IV3C 5FZOB 3ABUA 5LHHA 4IEVA 4JGYA 2ORZA 3FJSA 3SNMA 3GTPJ 2ZX2A 2DBIA 3UV9A 4A6OA 5FZ1A 3I3MA 4R8HA 4CP9B 3V65A 4UB6C 2E7AA 2ZAAA 3E6BA 5FZ7A 1F1ZA 3ZQ7A 2OVUA 3J26N 4KMUX 3ZXSA 3K4AA 4DQAA 5DUIA 1VALA 2YU9J 3POYA 1QJX1 2YY1A 3J7AO 1QJFA 4D0QA 4GB31 1ON2A 1W9SA 3PJYA 3C2UA 2FMYA 5JVGF 4QQLA 5M5XJ 2PFBA 2E33A 1LR5A 2IXLA 4ZH4F 4E4HA 3P5JA 4AHZA 4MEXF 3CMAI 3WF0A 5FZ8A 2O3FA 3TBIA 3WLUA 1HB1A 1KITA 1P2FA 2ZGSA 2VJIA 4GH4A 2XLAA 5C3OA 4LOCA 1NA1A 3DPLC 1MBHA 3WQ0A 4OMYA 4M73A 2QLZA 3ABKH 3QPTA 2QEXI 1CZTA 1H4GA 1P9QC 2PHWA 1W1WE 5GJ6A 1V70A 3EPZA 3EDPA 3S30A 5CKNA 1BJQA 3VZOA 2TUNA 1W5TA 5KK1A 2ES3A 4NIIA 4HDVA 4R79A 4CCMA 4UF0A 4Q5OA 5IP6A 1EUTA 5EF6A 3HOBA 2WRAA 3A2KA 3PUBA 3BG9A 5F39A 3GGLA 3RJRA 3G6JB 1LFBA 1XBFA 5D4RA 2ZS6B 3DPRB 1RUG3 2QQ8A 2DF7A 2GIVA 4Q0PA 1OCOH 3FXQA 2VKHA 1LHOA 3PUFA 2DA5A 1CAVA 1ZBA1 3AKSA 2JDMA 4Q0VA 3G73A 1O5UA 4AGVA 2XB6C 3ACFA 3OGRA 1RMU1 1Z7S3 2ZMEC 1PJRA 1XD7A 2E71A 1YJ9I 2A6VA 5JIUA 2PHTA 2GM4A 2VZUA 3WNLA 5IT9Z 1WA4A 1RHI2 2A6WA 4QMAA 4C0BA 3BG6A 5DUUA 3CF5F 2Y6GA 2BP6A 2YPJA 1JHHA 3CJQB 1SCRA 4LG0B 3RSNA 3VDDC 3J7AY 4J6GA 4XJ8A 1F4KA 3SQOA 4UT5A 5BNGA 2NPIA 1MW7A 2J1SA 1ZGAA 1E3PA 5JMOA 2X6XA 1YQCA 1VNDA 4GA9A 1YRNA 1QNYA 4Z2WA 1O8SA 4P9IA 2GDFA 4URTA 4P5YA 2FBHA 4XIDA 3QYEA 4O7XA 4BQ5A 3M7GA 3B94A 1CVNA 2WO7A 4G6DA 2ENRA 4M3CE 2NS7A 1P8JA 5GTIC 4AI9A 2A6ZA 2YFZA 3GHNA 4MXVA 1HRV1 3SKVA 3VUOA 3ABTA 2Y0OA 5F7UA 1RUE1 2E63A 5CVVA 1DGLA 2P0WA 3ZXAC 3DXUA 4F52A 4RR3A 2D6KA 3M1CA 3WEZA 3PTRB 2VONA 4L0YB 2KL4A 1FJLA 3O1UA 5C33A 3JRBA 2VBWA 2FHRA 2AUYA 1DYOA 1Z0XA 1R23A 2ZGQA 1PUFA 1BR4A 4CDQA 2X48A 3S3NA 3R0AA 3WNXA 5C5TA 4B29A 1W6PB 1IQAA 2XJUA 3OYFA 3BPSA 3LIGA 3T2PA 3G6EI 4EQQA 2UZKA 5HPOA 1IUYA 4BM8A 4ZYDA 3G1MA 2VZ3A 3O1SA 5FZHA 1O57A 2K27A 4KU8A 4BLJA 1O6UA 1SLCA 1ODDA 5FOBB 2MABA 2WZR1 3B01A 2VR4A 1HJGA 2R5ZB 4C2MJ 4WM8B 1R7JA 4O3MA 3D6EA 1YQAA 2VBXA 1BBYA 5AIQA 1DLCA 3LSMA 4CDUA 3BI3A 1WMDA 3PFIA 1W9FA 3AVRA 4Q4V3 4QX1A 2R7TA 3BROA 3OCPA 2L7KA 5ICCA 1WD3A 1FYLA 2ZEZA 4J1WA 2WIIB 5FY9A 2R1DA 1LTEA 5FP7A 4K20A 1T6SA 1SD6A 2VOWA 4YW2A 1ZARA 1Z91A 1O3QA 2DO7A 4PUSA 1B59A 3B69A 3MVPA 3DPRC 1VE0A 4C91A 4NOTA 5FP3A 1ZLKA 4RAFA 4L11A 2EFOA 2I8DA 5C9AA 1MDMA 4DUWA 3SJMA 3PUSA 4QX0A 4UB8C 3OBRA 4V2FA 4UNOA 3KPHA 3FUOA 5FY0A 1P7JA 3MZ8A 1JZ6A 4LLNA 4CUGA 3HOWJ 3PJRA 2M8EA 1RGSA 2P6SA 4MX3A 2HEYF 1LGBA 5F3EA 4G3YC 2D3SA 2YC4A 5FZMA 1UYYA 1C28A 4FQGA 2ARAA 4OQ9A 3C1DA 2W25A 1RUF3 5FLHA 2IA2A 3WW1A 3OD0A 4QGLA 3WINE 2CSGA 3BZ6A 1JKQC 3WG4A 2CDOA 2NAZA 4D9JA 4BZ4A 5D5UB 4HQMA 2ERFA 2CSOA 5LWBA 4NHJA 3Q8AA 5APAA 1J2XA 1Z0HA 1JTYA 2VMIA 1HRI3 3PMEA 1WW5A 2PLV1 5IVBA 3CJRB 2W84A 5IVFA 3BIWE 2OJED 3MLLA 1UZZA 2KPMA 4KIBA 5FYSA 2JWPA 2TEPA 3TRSB 2WAQN 4S0HB 5J48A 3WHBA 3MV01 3ZOBA 5M5WJ 3JBG3 5JR2A 4PSXA 3BR6A 2VZSA 3V0BB 3D0SA 1H9PA 1X9TA 4Y20B 4UUSB 3I3DA 1IXCA 1PO12 2CW8A 4PLOA 1W06A 4BY1J 1A3KA 1QWRA 1UIJA 3K6GA 3Q9SA 2P3JA 4CO8A 2UWAA 3POBA 4B43A 4WVMB 5JHUA 5FIXA 4BXSV 5F0HA 1TC3C 1I5PA 3K2AA 3OOXA 4LBOA 4WM8C 4JK1X 1MVQA 1QVUA 3AM2A 2VB6A 3BZCA 1W6OB 1F31A 5B3SH 3POEA 2Y6JA 3S5QA 3LA7A 5FMOL 4XRSG 1BA5A 4A4AA 2VN2A 4IESA 3SZTA 5DXDA 4JX4A 1OCRH 1REDA 1APLC 4EATA 4LHNA 3CLPA 2PI0A 2JDYA 2LOOA 2IS2A 5K1YA 1DF0A 2F4OB 1VBA2 4W50A 3LMMA 3HTSB 4DEQA 4A3MJ 4S2HA 1VB4A 2PHDA 2RAEA 1FPN3 3MIFA 4QQ2A 5IYDJ 4AUXA 2VI6A 1AVBA 1AXKA 2CV2A 4AWXB 1LKXA 2HGCA 1PGW2 4JTNA 4MO3M 3MN2A 2AXTC 4XOGA 5FO8B 2DU0A 2QZ8A 2GC3A 2COBA 1UY2A 2WN2A 2DU9A 2LS6A 1ZELA 4LO4B 4BCUA 4CU6A 5AFBA 4IEZA 2QFEA 4UBGA 4HPKB 5F8PA 3HOZJ 1PMJX 2EIJH 4XBFA 1QJZA 1YJKA 3OGSA 2XPVA 3V0AB 4CEYA 2QQUA 2UXNA 1FX7A 1J59A 4IEPA 5A1AA 1OR7A 1TNRA 1ETVA 1GV2A 1DDLA 1CZVA 5FZCA 2LRPA 1F2NA 2K0GA 4RQPB 3OYGA 1ZTRA 1DGRM 4IV1B 2BTVC 1VBE1 3BU7A 2CGPA 5J36A 2WNEA 2H8WA 1BOBA 3VBUA 1QO0D 3ZFGA 3WTTC 1POV3 1UJ8A 2DUPA 1W2UA 1UCRA 1NLRA 2EILH 1FP1D 5T5JA 2VGDA 4FPFA 1LHUA 1MS9A 2Z42A 1QY4A 3CDLA 1AHDP 3GYDA 1T39A 4HA8A 2HTJA 1MMGA 2KP6A 2O8OA 1D5VA 4AQSA 2F4PA 2A70A 3TOAA 4HK9A 1NG7A 5FUIA 4CZCA 4HONA 3S17J 4S05A 4XZPA 2FEZA 1Z67A 5KR7A 3MAJA 3J80K 2PMHA 3HRMA 1AYM3 2E5NA 1ND2A 3AKQA 4J1XA 2CGNA 2RV9A 3B5LB 2ZGOA 1RYYA 1HV0A 4LHSA 4IZZA 4MGYE 2HWC3 5T52A 4DYQA 3CL1A 2RGVA 5GAGJ 4ZZ8A 1W6MB 1TQMA 1I6HJ 4BJ5C 2FNPA 4BYYA 3TL4X 2BNNA 3KF5A 2R041 1Z7S2 4WZFA 2YU2A 2F5DA 3WDYA 2NLRA 1X82A 3D0JA 5A7QA 3H7JA 1KD7A 2BW8A 1OT5A 1KXGA 4R52A 4HX7A 4QPWA 2P4EA 1MSEC 4EYUA 5ICFA 5F1JA 4L5JA 2R7ZJ 1CX1A 2DVAA 1SBEA 2VD7A 3RGBA 3WQ1A 5KC5A 3RYPA 2W1SA 3LFUA 1PO11 5HLHA 1K45A 1N3PA 4XUTA 3HQRA 4CDXB 5A1LA 1UYXA 2H1KA 4S2DA 2Y0SN 2BWCA 1AR62 3MKLA 4N7IA 1S8NA 2C6YA 3R60A 1LOGA 2E7QA 1W2TA 2Q1ZB 3K1PA 5D5WB 4CHUA 3MI8A 1EV11 3T8TA 2A7AA 3KQ4B 3SC7X 3DN7A 1QH7A 2J1EA 1GOGA 4W6XA 2DTWA 1EP0A 1S2BA 3S8PA 1W9YA 2K46A 3ZR5A 5LRRA 1JTXA 1RVF2 3CZUA 2VPRA 2IBDA 2DTYA 1X3ZB 5ERLA 1IPSA 1QQIA 4E8DA 4RQPC 3S7IA 5M3MJ 3WTSC 4IV1C 3NV3A 4BJTA 2GWRA 2HU9A 3VD5A 3FXRA 1FMD1 5AVPA 2R7SA 4JHZA 3H7YA 5JPNB 2EFPA 4IRHA 2ID6A 5J8FA 2NRAC 1PGW1 2VASA 3WGHA 4C1WA 5IP7J 4CUBA 5E18F 2YFUA 2KXLA 3VBSA 2DJIA 2WA4A 1L7RA 3FBYA 4Q4V2 2ZFUA 4BAYA 3ZMZA 3WP4A 3FF5A 1A78A 3J8F3 5FYTA 2VBPA 4KN4X 2BOIA 4PF5A 4UVAA 1WCMJ 2FBKA 2L9NA 4XKVA 3EBRA 1AXZA 1DIWA 1HJFA 2G9FA 4HV5A 1R093 4HSRA 3RZMA 3ABZA 3HJRA 2A75A 4A0YA 5AONA 1BHGA 2GN7A 5CQGA 2UWBA 5FZBA 1FATA 5EJCA 5CFCC 3S1MJ 1T98A 2QCSB 3J7LA 1ULDA 5K0UC 3W9AA 3LQRA 3NJYA 1FIAA 3ST7A 1CN1A 1Z6RA 3WU0A 3IRQA 5FRNA 4QM8A 4ONUA 2HNHA 3O2PE 1OQYA 3EETA 2W9XA 4PBPA 5ABJA 2AS5F 3I2IA 2PEXA 1Z78A 4AM3A 1QQP3 2AYHA 1L3JA 1KS5A 1XSRA 2XJQA 1ZKGA 1U5TA 5K7ZA 1VFCA 5FLVA 1IRFA 4GYGA 4OUSA 3ZQIA 3EUAA 2F2EA 4DB5A 5A6ZA 1JBCA 2SBAA 1HIXA 4LIVA 2QKLB 4QLCU 2OQGA 2CW0F 5C3SA 1MKMA 5I0SA 3UKNA 4KBZA 1PMIA 1YO8A 1YIJI 2K86A 4XK4A 3D5SC 2DWRA 1VAMA 2IRFG 2J42A 4E4DX 1IQDC 1GXPA 2V6EA 2DN0A 1K83J 1PM7A 3CDIA 4OIRF 2WFF2 3ZFFA 3K9TA 4MYEA 3M8JA 4CCKA 3I3LA 1LNSA 3KIOA 2EV5A 1CJDA 4RAYA 2PJRA 4HG6B 5D8KB 4WXCA 3WHTA 3LFKA 2I45A 4LBQD 2D6MA 1D1BA 3JBG2 4YIRX 2E36A 1G86A 3ACHA 1APNA 2J22A 3O12A 2P7VB 3A22A 1PNFA 2X0LA 3L9JT 1IDYA 2VKDA 1GQPA 1R58A 1H2MA 5HDGA 1N47A 5JHFA 4KWUA 4H7MA 1W6NB 1QZEA 5HXMA 1U2WA 4XBNA 1BW5A 2X1DA 3OYHA 4GKYA 1VBD3 4RYDA 1AR61 4AXOA 2LNBA 4UFHA 3KLOA 1WLTA 2E32A 3B6AA 3U21A 1ZN2A 5J47A 3VL9A 4TYSA 4MTEA 3ZSJA 4IO9F 4UW5A 4NHLA 2VZ1A 1GVDA 3P9IA 3AZYA 4RGAA 1MS4A 3U0ZA 4MXWA 5F08A 3A0HC 2XL7A 1F4AA 5FPUA 1CESA 4RGRA 3OY8A 3ZYFA 1L3LA 3SZGA 5HV0A 5GM0A 4RHV2 4PJMA 2HI3A 5FZAA 1POQA 1UXXX 4LHKA 1RVF1 5IVCA 1SBDA 4X8NA 3QPLA 3H1WA 2LG4A 3NJZA 4FP2A 4NPRA 3CDZB 2WWYA 5BY5A 3A4CA 2VBDA 1W6QB 1COV3 1WUVA 4B4PA 1V54H 1FLIA 1H88C 3DCFA 4XF4A 4FX4A 5HNHA 2Q8CA 2GNDA 2VODA 3WR0A 4P9JA 1YFWA 2LDUA 4JKMA 1FYMA 4XMAA 5CQEA 3JRDA 1YHFA 3PVEA 3I2FA 4XN3A 3WGIA 5BUVA 2PFWA 5IK4A 3KV6A 4ITVA 3JSOA 1WQ2A 3VD4A 5FP8A 1UHWA 2A61A 5C8CB 4WM7A 5ILSA 1GFF2 4GMP3 3HAGA 4MHUA 1JGSA 1E5HA 1MACA 5GADJ 1S0FA 4ESFA 4LBQB 1W8OA 5IOZA 3VBHA 4CPBA 4KA4A 4X6AJ 3ZKYA 4Z2YA 4PF1A 3Q8BA 1LEDA 4FISA 1IS3A 3VBRB 4OI1A 2KIFA 3JW4A 2HBTA 1QJEA 2EVXA 4AIHA 4UV9A 4AI0A 1X4PA 2JE8A 2WNVA 2Z2SB 5CFDB 5E3NA 1WW6A 2CUJA 2RDNA 4CP1A 2XKOA 4XFAA 3RZKA 3NRVA 2MSYA 2WN3A 2JUGA 3MZYA 4MO7A 2W24A 1E5IA 3OYAA 2HQRA 2GP5A 1BC8C 5TISC 2MHFA 3DUIA 3VYRB 3O1RA 3A7QA 1BVP1 4XR6A 3WUCA 5ERIA 5D8AA 4IE7A 2FQ4A 3LPGA 2HKXA 1QZYA 2DMUA 3ZYPA 2HWC2 1RKWA 4M3BA 4QGNA 3A01B 3KWVA 5IATA 2QQIA 1Z21A 4NIDA 1KS4A 2WFF1 1TNSA 2XAUA 3PJQA 3KS7A 1BM9A 3DEUA 4UFMA 3K4CA 3FXLA 5HI0A 1Z9CA 4FPJA 1SD4A 1OCCH 1IS4A 3BTCA 2LKSA 2ATFA 3AB0A 2NOGA 3S7EA 3KFWX 2QBYB 2MEV1 5FKKA 2R1BA 2WSVA 1ND3A 5A7WA 2Y75A 5J37A 1G59A 3LSDA 2RN7A 2XH6A 1W9WA 4OZOA 4A3ZA 1JUMA 1CZSA 5FPAA 2HVRA 1D1AA 1HSTA 3GUDA 3KEYA 3VKFC 2FF4A 2YBPA 4YIIA 3OUJA 3BTZA 2NYYA 5A3PA 2YPRA 3BQZA 1L0OC 3QYFA 1F43A 1OCPA 2QQPA 3J7HA 3UGFA 2VBYA 1OLRA 3GZ6A 4TWTA 2W48A 4CCCA 2W82A 4FTSA 4YWAA 4GJYA 3JZVA 5FJKA 5D6EA 5C8CC 3V8LA 5TSWA 1W39A 1NG0A 1UW8A 4LMYA 4OMZA 2LP0A 2JDNA 4RHV1 5JXGA 1RUH1 3TEZA 3HT2A 3WY6A 4O61A 4EN8B 5CG9A 1V5EA 3E1SA 1AX1A 1KYZA 3F2ZA 1XNBA 4QX3A 1ETYA 4LKEA 4MIMA 2DU1A 4MVTA 1WLCA 5EFUA 5F0CA 1UKRA 4ARXA 4L9NA 2DTZA 2D44A 4TLFA 2ZHLA 4FFIA 2P5LC 1TQ5A 3DQVC 1UMIA 4EROA 5CFDC 2DOFA 3AL0B 3WE3A 2X10A 2XGDA 5K7FA 2B45X 3MCZA 1FP2A 5IVJA 2G0EA 3WTZA 4W6WA 2DDUA 1OOPB 4AI8A 5HS7A 2JG8A 4NQWA 3J8F2 1IW7F 3CUQC 1B35A 4Q4ZF 2DOEA 4FP3A 2WS92 4XOTA 4XLAA 3MIHA 1LHWA 2PHFA 5JSRA 3B00A 5GLTA 4RS8A 1TMF3 3IT8A 5C44J 5D2AA 3GYHX 4LMFA 3T4VA 4P5OA 1OFCX 3PQJA 5DD8A 5FLXK 3PU8A 1WJAA 1XMKA 5FGMA 3UETA 3BG5A 3S32A 1CF7A 2EZHA 4C3IJ 1DGRA 4XICA 4IE4A 1KDMA 1W9TA 2FUG2 2JB8A 3L1PA 4BBRJ 2RMU3 3PHMA 4E7KA 5IK8A 3NEUA 2RDQA 1O3RA 4RB1A 4BE0A 1HN0A 1ONAA 3I0TA 5HS9A 3CJIA 3H0GJ 2K85A 1MD0A 1JOBA 5DPNA 5DUWA 1YFXA 2JUCA 4AEDB 1STZA 1GR3A 2X53S 3VZKA 1H8TA 3L2YA 3N05A 1LAJA 5CEHA 3O1MA 4NHMA 3GZTB 1AYN3 3VD3A 2ZGLA 2HZTA 2AHQA 1NCRC 1QA6A 4WBBA 2X5IA 2B9VA 4P9UA 4CRQA 4CZSA 1X2MA 5FZLA 3GZ5A 1HQLA 2CV6A 2A3XA 1Z05A 1G7YA 4XIKA 4DRVA 2GC1A 5L3EA 1W2AX 2GMEA 3LE0A 4PHZA 5B2GB 1CIWA 5T54A 1BMV2 1Y8RB 3QCWA 3RSJA 3TOBA 4QPOA 4D7SA 4HKOA 4H0EA 4YVSB 3B02A 1DQ1A 3BT9A 2K3FA 2OC6A 3DGTA 4YGEA 2PJPA 4MOAA 4ZPIA 1UY1A 4MGSA 5J1UA 3B3QE 1AF9A 1MZEA 3BTAA 3ZQCA 3I2GA 1KU2A 2W95A 4KUMA 1XE0A 1I9RA 2E7TA 4CP0A 3E6CC 3L2CA 1GICA 3FLTA 3GXUA 4QPIA 3ZFEA 2IXKA 3PNVA 4CPBD 5L36A 1WJ5A 4MH0E 4QPGA 3NAUA 3JUUA 3MLKA 4IEQA 4NIGA 5DMYA 3RWNA 2AQFA 5J1XA 2FZ2A 3IDEA 2Z1DA 3GTGJ 1I1EA 4FPGA 3GCXA 4EE2A 1SFNA 2H6BA 1UPIA 1D4M3 1PGL1 4EJWA 2DMPA 3LB9A 5H9SA 4OMCA 2VQCA 1BI3A 2XAGA 1V6KA 1OOPC 4HOOA 1VRH3 1ENXA 2JDHA 2XAJA 1NY72 3VN4A 4QQOA 3LZZA 2R073 4BE2A 2VY0A 3QRFF 3ROUA 3WU2C 4LULA 4PZJA 1DP3A 3VDCA 2GH8A 1ORKA 1LE8A 3UL2A 4CUAA 3H36A 1VQPI 3KGLA 4OVEA 5FKCA 2XMLA 4E4ZA 3T0AA 3NAPA 3R4DB 1B4AA 2MNGA 5T5OA 2F5VA 1RL3A 2Y69H 3CO6C 2ZGUA 4Q4X2 3HOSA 3VDXA 3UK9A 4ZHNA 4BJ6C 3G4SI 2OPKA 3ECQA 1IOAA 5FY5A 3RIRA 4BQOA 4Y13A 1YUDA 2R5YA 3GEZA 1COV2 3WDUA 2NVUB 1UYPA 1YFYA 1ZREA 1EKEA 2X51A 1V6LA 1HXS3 1US3A 4HG2A 1DDNA 4EMSA 3UKTA 5FMBA 4B3AA 2DA2A 4AEJA 4AEDC 2ZMKA 1LJ9A 3KETA 1ZX5A 5DCMA 1A6CA 4YZ1A 1EH6A 4GWIA 3PVBB 1E2XA 4EV0A 1JZ7A 1QJY3 4ZJZA 2LM3A 3K3OA 1XNDA 2WS91 1FIPA 3TEDA 2Y60A 3P7NA 2CGOA 1DQ4A 4HBLA 5A7SA 2RS52 2JXAA 2VJ5A 2RV8A 1DQ6A 2DT7B 3HHHA 3FZ3A 5A1FA 4DGWB 2BJSA 5A33B 2VUDA 3USUB 3OEBA 5JVVA 3POIA 1JZ5A 3RZOJ 1TME1 2C6SA 3RDIA 2BY1A 4CXWA 1UMZA 4DS0A 5H9QA 5BQTA 1YFUA 3ECOA 3M4OJ 3OYWA 4BDVB 1YO5C 4EN9B 1GXQA 4GGGA 5BNNC 1DQUA 4MLOA 1WSUA 1QJU3 4RB3C 4JX5A 4RB0A 4YVSC 4D5CA 3OWTA 1W90A 2JKXA 1ETOA 4N53B 1G8XA 2J1RA 1QPMA 1YIOA 4DZJA 1W0NA 3HC7A 4DYCA 3OB8A 4A3JJ 5FQ0A 3T09A 2YC0A 1XCBA 3UNGC 3H5NA 1YIPA 2W57A 2J1TA 2ZJ2A 2Z9OA 4UFLA 5LA9A 4RAZA 4IHWA 2CFXA 1O4TA 2WWSA 5F5CA 4YGBA 1Z7LA 2CUFA 2JE7A 4P9YA 3BPXA 5IVYA 4JGYB 4KN7X 2FU4A 3K2OA 2RJ2A 5D6FA 3NWKA 1AR83 2W91A 4M01A 4JX0A 1ASJ3 4Y1UA 4LPLA 2WINB 2Q8KA 3ECHA 4HFSA 4LLFA 2DI3A 2QQKA 2BFUS 4XL9A 3ASIA 3ILFA 2F48A 3NSTA 1V9U2 1IXSB 4XXAA 3IIIA 2ECBA 1ZGWA 5BYNA 2EIBA 3B9CA 3AKRA 3FLPA 3LEGA 1H0MA 3UGGA 4ESBA 4Y4YA 2ZKZA 1LOFC 1X8MA 1QU0A 3F8BA 4BLIA 3CQZJ 2XJVA 3AMNA 4ZYAA 5B5EC 4AHXA 4PGGA 5CKQA 2PAMA 3SQNA 4RB2C 1UYZA 1XQNA 3IWZA 1SPPB 4GH4B 1JUPA 1NA1B 3ZMUA 2GA1A 4KNYA 3AYEA 3W2VA 1MJAA 4W8JA 1E3HA 1TNTA 5K4LA 3FC0A 4M9XA 1T38A 1W0TA 5EYRA 2BY3A 4MGRA 5ACA3 1G3YA 1U5ZA 3T2QA 2GA2A 2WABA 3J81K 4MSVA 5F5QA 1BIBA 5C7GA 2VVFA 3K70C 5E3OA 3FMRA 5FMCA 1H2NA 1JS9A 2HWD2 4EQVA 1EUUA 3TN91 3AZWA 5TRDA 5D4SA 5FFZA 1GZWA 2WFPA 2I74A 3CDHA 5ANQA 3NMBA 1OHFA 2PA7A 4MGKE 1OBNA 4Q4X1 4P1WA 4FX0A 1ERDA 2UV1A 2AENA 2IS1A 2IWGB 5J6XA 2JTVA 1C1FA 2VXRA 1GBGA 1UF2C 4PQQA 5EZWA 1C4RA 3SITA 1H2KA 3DKQA 4N53C 1HB2A 2Y0SA 4G7HF 4O5VA 1WZ2A 2VECA 4XTPA 3M7AA 1UZ0A 1G3SA 3N9QA 3ZSEA 2LTNA 5DD4A 4KG0A 1PGSA 4A3IJ 1MS3A 3LA2A 1Q43A 2Y0IA 1YEWA 3O8GA 1TLHB 1R1UA 1V3FA 3REOA 2I5UA 1C57A 2RS51 3P3NA 1HDPA 4XCAA 2EXHA 5SV8A 1DBNA 3HR9A 2NNYA 2KISA 3BR3A 4HLYA 2HR3A 4JGYC 1WBFA 4OFGA 2ZJRF 4XIOA 2ARCA 3DLLF 3ELNA 5FRMA 4OHYA 4NVPA 3AL5A 3FN9A 5FXXA 3MPBA 5JVTA 2R0HA 5DZFA 5A3NA 1PZ7A 1EV7A 2V6CA 3JSPA 4ITCA 5FZKA 3T08A 5I0UA 1N1YA 1JYVA 2OA2A 1MMSA 1W8WA 4IF4A 1BBT3 3WW2A 1XDSA 4W65A 4FQZA 4PDKA 5FY4A 3KT1A 1AYN2 5TJJA 1XYNA 4CDQB 1WFXA 2V7FA 1M1EB 3OS0A 2W94A 5FKBA 3RKXA 4ASKA 1K6YA 3VKLA 2OYZA 2GU9A 4JTOA 1SACA 2VQAA 3UJQA 4GH4C 2HQ5A 4XURA 5FXVA 1AA7A 3ABMH 1FOD3 3IH4A 1WJDA 1NA1C 1K79A 3I53A 5ANNA 2TDXA 1HX6A 1YJWI 4GWNA 1QRYA 1FTTA 3GLXA 1CAWA 5J09A 2IXJA 4YW1A 3S2HJ 2VUMJ 2RR13 1E5SA 3KHCA 2NP0A 3ZN6A 2HS5A 4JBAA 1V9U1 4XNFA 2RNGA 3OPZA 3L2RA 1S0CA 3JRHA 4NMIA 1D5YA 4A3DJ 1WI3A 2IEKA 3I97A 2YSRA 1AOYA 1W5SA 4RLFA 5GPCA 4X1EA 2M3AA 4FOWA 4AYBN 1IRGA 5GKAC 3VOEA 2WV0A 4BIFA 1YJNI 4Q0QA 5C9AB 2H27A 3O7OA 2NVTJ 3WP5A 1TE1B 4AQTA 2WZEA 1JN2P 2ZBKA 1R71A 1IGOA 1ZM1A 2O8KA 1H89C 1VRH2 4DZGA 1TW3A 3ITQA 1Q8SA 3N9MA 1T2KA 4UUTA 4P5HA 4CCOA 2R072 1G3TA 5C5UA 2NMNA 4YIFA 1VQNI 1JKOC 2BUKA 4DXZA 3KMHA 3PO3J 1I1SA 2VW1A 1PX4A 3J7MA 5FK7A 2HWD1 2VOVA 1BK1A 1RR8C 3BTIA 4JKKA 1JHNA 2VVEA 5DN2A 1IKPA 5CU1A 4OI2A 5EJ3A 5C70A 1IG7A 2YU1A 1VMFA 3U14A 1ZRCA 3TO7A 4Q4Y3 2CWEA 3AP9A 3BCWA 3LSIA 1HXS2 3CKHA 3AP7A 4RR3C 1S55A 4HN0A 3IB3A 1SG3A 4QAWA 1IUFA 3W5NA 2ISZA 3K4BA 1RNLA 2DVFA 5T50A 4XFIA 4BQNA 3K77A 2FMLA 1QJY2 1SD7A 1PK6A 4CDQC 1O4XA 3KP6A 2WA3A 1ZBE3 3KZ4C 1BR1A 4RM3A 1V6MA 2M8GX 3HOUJ 2OQ7A 2EK5A 2D98A 3CMMA 1ZLJA 1NOVA 2A71A 3PL0A 4QKNA 4DYRA 1F35A 1RR7A 3KEOA 4WV8A 4U7BA 1MS8A 4FAHA 4ETSA 2O1QA 5BNOB 1ODNA 4V2GA 2YUSA 4CDUC 3RI4A 1PZ8A 1U0AA 4L92A 1MBGA 1QJU2 1LDKB 4R9BA 1LPQA 2ZXHA 4C2TA 5FYBA 5FZEA 1GKBA 1H9WA 3O1OA 2VQTA 2A68F 2FDJA 2IFWA 1WVRA 1HQNA 1I3HA 2RJLA 5JZGB 1BJAA 2WZPP 3PO2J 4EM2A 1QNTA 3TDZC 5BPDA 3HUGB 3QAHA 1YCIA 1KQ9A 3ZN4A 3KP5A 3BC8A 1NK3P 3N35A 4PJ0C 2UY9A 5EDNA 2KRFA 5FYHA 1IN4A 4BUPA 5LLQA 1GANA 3F8FA 3BB6A 4ENJA 2QM3A 3VYSB 5C9AC 1RUD3 1W36C 5DM7F 4ZYGA 5D5XB 4AIKA 5F37A 1DYKA 4JDMA 4XFHA 4K6BA 3NQOA 5JXIA 2MLKA 1AR82 2HOTA 3QODA 3AVSA 4BK5A 4I30A 4PIZA 1KFXL 5D8LB 4LA2A 3WU1B 2ZGNA 2G7HA 2HPMA 1TWCJ 3SFZA 4P08A 4YW7A 1EAH3 4QB6A 4ATFA 2E1CA 1MEC1 3ZQQA 2R3SA 3WW3A 2L9VA 4HSJA 2QQBA 2WO3A 4ORFA 1U5YA 1AKHB 3CJTB 2RE9A 5T55A 4RSUA 1W8ZA 3THPA 5J7MA 2JX9A 3I55I 3MPPG 2NN8A 2JVHA 2OIIA 3BOPA 3WF3A 4RGGA 2RNJA 1X33A 4COYA 5C6CA 1W7PD 1ULOA 1B8IA 3MMYB 1HC8A 2W7NA 2ID3A 4UVBA 3ZSLA 3V42A 5B1AH 4NO4A 3ZX7A 4JAAA 5KHKA 4HL0A 1WCSA 3OYNA 4MGIE 1OYWA 2R0FA 2A3SA 3WG9A 4N43B 4AIDA 2VZTA 1PIV2 2YX4A 1SD5A 3RQIA 2WQZC 5EHDA 3GCMA 3S2WA 3C2BA 2W87A 2A6TA 3I4PA 2L2OA 3JD72 1CAUA 1LVKA 1XGSA 1I50J 1NX9A 1IV6A 2XV4S 3M8LA 2GBYA 4GO1A 1ZAOA 2MW8A 3EJKA 3OYKA 4TN7A 3PUAA 2X9DA 1XRUA 4LA3A 3NV2A 5BNOC 3IHUA 5J1RA 1NE6A 4YZ3A 2V1DA 2ID4A 3GBFA 5LHIA 2CTVA 1SBFA 2HVSA 4HK8A 3QH6A 5IVEA 2QNKA 1RUNA 1MPXA 2QTWB 2V5YA 1OD5A 5K5OA 2RS13 1O7LA 2BGCA 4NNJA 2M9HA 2Z4FA 2WY7Q 3HKZN 2CH0A 2XWJB 2V1XA 1X3WB 5CISA 1HKSA 1R1TA 3RYRA 5JZGC 4YSFA 3TQNA 4CU7A 3DPUA 2B46X 1ZK8A 2VJXA 2LH9A 2XDVA 5EG0A 4MGTA 2G9ZA 1CWPA 1LU2A 3GBGA 4L0ZB 3P1IA 3LSKA 5DAWA 1QHGA 3CZ6A 1S9HA 1Y9MA 1YQ5A 1YC61 3FK7A 3MKWB 6PAXA 3S5AA 1ZG3A 5I91A 2ICWG 2BE5F 3FLRA 1TWAJ 1XX5A 4IVNA 1KU7A 3RVHA 3ZMDA 3CCVI 1PP7U 2LLKA 5J8CA 3KZYA 1UU6A 4G8XA 2OUJA 2VC1A 2Y26A 5EPAA 1JYTA 4HNVA 3LAGA 2XF6A 3KX2A 3I4MJ 2HWB3 1AR91 5FZOA 2DFEA 2BW3B 1IG3A 4BIOA 1RUJ1 4P02B 1BBT2 3O6BB 4D7YA 2NVQJ 5LFAA 2P4WA 2VMFA 2CYYA 2IXHA 1OR7C 5HV4A 3IN9A 2JDAA 3DKYA 2Y6LA 2KIQA 2WQ8A 1OPMA 1GHCA 1UZWA 1XS9A 2K4BA 4U88A 4G6QA 5BPXA 1NXD1 2D6PA 1ZZCA 3GZUC 3W6VA 4NN0A 3QU3A 2MC3A 1UAIA 3VBUC 2NM1A 1YITI 2OCCH 2O03A 1LESA 2WYFA 5J3LA 3HEFA 3GHMA 4IL6C 3WZ1A 5M5YJ 1KQ0A 3HN3A 2BVMA 2ZEYA 1BEV1 3VBSB 4NAOA 4N43C 5LHGA 4ASLA 3HM5A 3NQHA 3ERED 2PG4A 4XFGA 2J7MA 1GLNA 3VV1A 3LSGA 2QQ9A 1XMAA 1HXDA 4HNTA 3G3ZA 1BJZA 2BZTA 1GOHA 1R5ID 2QSGX 3K4JA 1BOAA 1BIAA 2VBZA 1T95A 2WUHA 1ND2C 1YS6A 2HH9A 3FXMA 1DQ5A 4NIAA 3WNPA 2VQUA 4A3XA 3C18A 4PJYA 4IUGA 5T5PA 3ZSKA 2XWBB 2MG4A 1DP7P 4UHTA 5AC91 2FDHA 3JTHA 4IE5A 1WWXA 1AR73 2NXNB 4YFNF 2QQVA 3KE2A 4HW0A 4XACA 1U5TB 1SFKA 2DFBA 3JQWA 4A5NA 4Q2FA 4A42A 2GXAA 1PIV1 2WWJA 3ZMTA 4QXHA 5LBCA 4M3EA 4XUOA 4DBRA 2QBXA 4ARYA 2IW5A 4PDWB 4PBOA 4B3NA 3JD71 4DNCA 3ZXEA 2F5FA 3KP2A 1AUYA 1DQ0A 4QT6A 3S3MA 2WL1A 2K4JA 1PO21 1SVMA 2OUMA 4LG0A 4UAPA 4XBQA 3I2HA 5FO7B 4FBFA 3OIQA 1KRIA 4A3GJ 4IEXA 4Q4Y2 3W58A 4XSZF 1XE7A 1YXWA 5DZEA 3VSLA 1FTZA 2R062 2BQPA 1ZRFA 3BR5A 1ZG1A 1OKRA 2Y30A 3IZOA 3S1QJ 2EFQA 2ZAHA 3VL8A 4A44A 4KT5C 2XHKA 3GCWA 1G6NA 3Q9OA 4JQTA 1T08B 3VBFA 3VHNA 4RN5A 1WLWA 3OYBA 1YLFA 2PQQA 1BI1A 3DV8A 5IJRA 2BDRA 4IRGA 2ZGMA 4V19K 1WCKA 2VM9A 2L5QA 3M3OA 3NW4A 3WD5A 5E8AA 3DLAA 3ZQFA 5IPAA 5KC6A 3BZKA 4E7ZA 1W05A 1Y4WA 1HOMA 2D6NA 4EJVA 2EFNA 3LWFA 2CG4A 2ZA9A 4HANA 2VNVA 1MGTA 3F8NA 1JOJA 1TZOA 2ZNYA 3VD9A 1EPWA 1QVTA 3VBSC 3CD6I 1UU4A 4BQ3A 1MBFA 1A5JA 2VKEA 4UBHA 4XABA 4A12A 3AKPA 5HDKA 1MNMC 1TW2A 4X8PA 4RD7A 5F5IA 1OA2A 3MUZ1 2R5ZA 4WM8A 2IXSA 3OY8B 4E8CA 4IHVA 1US2A 1IRZA 5KXBA 3HTUA 4DXTA 5A6YA 4K40A 1REFA 1MQTA 1C8M1 1XYPA 2DA4A 3WG3A 2AREA 1XE8A 3R05A 3S57A 3EB7A 3KLSA 4QX8A 2PMZN 2X29A 5A3OA 3W3CA 4XORA 1FC3A 3A21A 4BQXA 2YPDA 2L54A 3HBLA 5ABJC 2LALA 2PHUA 3D82A 4XM3A 3L2HA 3K7AJ 5CB7A 3QWLA 3ZR8X 1MZBA 3S15J 1PVC2 1U5TC 3S6PA 1MH3A 1ACIA 1HDKA 4M00A 2BERA 2M87A 1WMXA 2G9WA 3M70A 4Q8KA 4N9IA 1EAH2 3MIGA 4FTEA 1ZH5A 2K40A 4D7TA 4F83A 4LK1F 4HN1A 1LULA 4AHWA 4PDWC 1F9KA 3AP6A 5DDJ1 3CCLI 5B4NA 1AJOA 3ZOIA 2M0CA 2DK5A 1T0FA 3E6MA 2L4AA 4XUQA 3TWIA 2FMDA 1LU1A 1UOFA 3BALA 5L7OA 1YQ2A 2BEOA 4GCVA 5LGNA 3VBHB 1GT0C 3FISA 2B63J 3C7GA 4RFT0 2QKDA 4XUPA 1UWWA 4IETA 1FEXA 3FHZA 4BHBA 5G05L 4D7NA 3ON7A 3HPNA 1FWZA 2Z79A 5E1WA 1C3HA 2V5DA 1MJ9A 4IOAF 3F95A 3JXSA 2XQRA 1CR7A 4L0PA 3E5XA 5JR3A 2YBKA 3CP2A 1LENA 4PLMA 1YWKA 1R1A3 1GWMA 2ESNA 4FOYA 4P9XA 4LQRA 2A3YA 4M3DA 3M9AA 3GVAA 4BOWA 1AWCA 4LO8A 5IHRA 5ICEA 2WB1A 3SH3A 2O8XA 4OAZA 2D7FA 2DFFA 2KD7A 3DEWA 4KITB 2ZEXA 2RDPA 1IDZA 1VP6A 2ORXA 5JMCA 2DDAA 1B09A 2W47A 4XJUA 1E0EA 1NZCA 2E2JJ 4UUSA 3AFGA 2OPTA 1AU7A 1QEXA 2Y6KA 3NWSA 3TP0A 4LO7A 2CWSA 2W3JA 2N8GA 2RS12 3VKNA 2FDIA 1QOTA 4MG2A 4BXFA 4WVMA 2Q0AA 4HEA2 1GV9A 2R061 3WE2A 1VQ4I 3V7CA 1W6OA 1LB2A 3E1F1 2QQNA 2CUEA 3MBWA 1CIYA 2VMCA 2CV1A 2P81A 3HMYA 2RM23 5LY2A 1SFXA 5BOXA 1O59A 5E17F 1TT0A 3RNSA 3HRSA 2IA1A 4DUXA 4YM3A 3VPRA 3K0LA 2F4LA 4H14A 4IHSA 2FJ1A 1E3OC 2G19A 3HYIA 2VO5A 3ZYJB 4NHKA 3VHOA 3WDTA 3KP7A 4FETA 2JE9A 2MYSA 1C0WA 1Z3XA 5A2QZ 2Y6FA 2FD8A 1TG7A 1OUSA 2XRNA 4WXDA 1DU6A 4JGZA 1KONA 5EQUA 4D6QA 5HLGA 5LASA 2HWVA 3ILRA 5HDNA 4Q1PA 1RJ7A 1UD1A 3E7LA 4NAMA 3IAM2 4CTEA 2HWF1 4GULA 4WM7C 2LBFB 4ZZDA 1AZDA 3U07A 4OYUA 3EHKA 4IEYA 4HPKA 4IGQA 1FI2A 3VBHC 1WI9A 3IAS2 2VE9A 2ZO4A 1RUI1 4M0HA 4COUA 5KAIC 2QA4I 3AFKA 3WTWC 1J3RA 2BNMA 2FZ1A 4YG3A 2XJTA 1OKQA 4H2AA 4D0PA 3A03A 4YW4A 1N78A 2XSJC 4ZS3A 1VBC2 3THCA 1IS6A 2HWE1 2P3KA 3IRRA 2WNVC 5L9VA 3WQ7A 3AMHA 4RQPA 2XVLA 4IV1A 4KDPA 1IN7A 2NS0A 5A6QA 1FOXA 4XJAA 1WH7A 2KIMA 1PVC1 3WTUC 3OYIA 4NQWB 4Y5SA 4QPQA 2KJBA 4V2WA 4D6SA 3VSKA 2CWMA 2VOTA 1B35B 1G9DA 1ZA4A 1MMDA 2VH9A 1X1DA 2FD5A 1J7KA 2XOMA 4F7ZA 3F23A 3WDWA 2XBO2 4Z1VA 5BPIA 2RS31 2YYOA 4UW3A 5F5AA 1NZIA 2WO2A 4AAXA 3BPZA 5HXVA 4EZ4A 4Y17A 3GFLA 3L7WA 1X58A 4MHGA 2E7WA 4YFKF 3NV4A 4MEYF 2HFHA 4F93B 3IKTA 4R1HA 3HSEA 4XMYA 4B48A 1AX0A 3AP4A 1XNCA 1QHHD 4YRDA 3M8EA 3VZNA 3CJIB 3DBLB 4Q4W1 1A31A 4NC7A 1TQIA 4XONA 3MW2A 1VQ5I 2ZSIB 1QDOA 5FP4A 5KXEA 1W6MA 2WO1A 2BU9A 3U1XA 5GALA 1K12A 2HEVF 2EPFA 2K7LA 5IYCJ 5H9PA 2LY2A 3EYPA 5LK5A 3SH5A 3DECA 1WJFA 2ARBA 4B09A 2GIZA 3VBOB 1JUIA 2IS6A 2L7MP 4LK7A 4EZHA 2GLOA 1RRJA 4M3FA 5LD2C 1SFPA 2VCCA 3P6BA 2W1OA 5F64A 2KRCA 1BCXA 4CGZA 2DMQA 1XGNA 3FFQA 5I0TA 3CCEI 4UFIA 3IH2A 2EZKA 3ZN0A 2VG9A 2VZRA 1GZCA 3RZDJ 4CDXA 5FWJA 4Y22B 2EIDA 2QQMA 1F36A 2VQLA 2M45A 3QOPA 5FRAA 3WHCA 4P14A 2P8TA 1VBB2 4U87A 3H9GA 3M8FA 4BE3A 4TXWA 2RREA 1LVAA 2ECCA 1FAYA 3ZFEB 1CPNA 2DURA 1Q56A 2B39A 2ACJA 4A5MA 4QPGB 5C4WA 2QGUA 1YYNA 3QP6A 3ME2A 1N1TA 2C26A 5CNAA 3HD8B 1R64A 3SMHA 1OLMA 3THTA 2R7OA 1AL23 1WJEA 5H20A 4EVIA 2AGSA 1UIKA 4E2GA 2R7FA 4BXUA 2LKXA 4LLGF 3OUHA 5FPLA 2VOXA 2DT5A 2WAAA 1JUHA 2VPLA 1VAVA 1DFQA 4QIWN 1SLTA 2CDPA 4GDFA 4RGUA 1JJ8C 1X19A 4ZC3A 1LHVA 4XHBA 1WPKA 1IKQA 3FUQA 2VQHA 1DP0A 1B35C 1OVPA 2ET7A 3CUOA 2DFIA 2DPDA 2V79A 1Y0UA 4M4RA 2LY1A 3VB9A 3I59B 2VOPA 4HMZA 1FOKA 1A34A 1GP4A 1UZVA 3B7MA 3MD2A 4GYIA 2D5HA 1LE8B 1JHFA 3ZR6A 4HNUA 4B4RA 1T33A 5F6FA 4JOMA 3LA3A 3JCIA 4YZ4A 1PM4A 3SLIA 3C7JA 3PL8A 1KFUL 2M34A 2A5YB 3ZMNA 5BNPB 2R5YB 4HKLA 2HZDA 3L00A 1C5IA 1W99A 1S2KA 1J09A 1LOEA 2XPUA 2FQPA 3TEXA 4Z82A 4XLHA 1VBC1 2EIEA 1BI2A 5F6LB 1GSLA 1K3IA 3CJIC 2WNUB 2FDGA 2X8KA 3K4NA 4EEFG 1YE9A 1QXJA 1ULGA 2ZSHB 4HDUA 1H8TC 5FZ3A 3OIOA 3PUIA 4CSWA 4WVWA 2EZIA 4FPYA 1W3VA 1JXNA 2NOJB 5D5VB 2DUQA 5ILUA 4RGKA 2XBO1 1K6OA 3VBOC 5DG2A 1VJ2A 5LCWL 2IGOA 1RZ4A 2B4KA 1GZTA 3EUKL 3F3XA 4LD5A 2HYXA 3NKTA 1PX3A 2XLFA 2FNAA 4JC1A 1VQMI 1JJ6C 4CXFA 1RB8G 1HKQA 1WCDJ 2ZMNA 5EGOB 2F6CA 4FPOB 3OYWB 3B93A 1RUC3 3EXUA 1GP5A 3RJPA 3SHRA 3AZXA 4GQ7A 2QQAA 1DZRA 2CYFA 2DYSH 1Y39A 4NPLA 3NARA 4C2UA 5C4JJ 5C3RA 4LEJA 1R1A2 1I3QJ 5JXHA 3LNQA 3MUY1 3OF1A 2K9LA 3GTOJ 2YX7A 5M3FJ 5JLVA 4D8MA 1IGNA 2VIXA 3WNNA 1K5MA 3ML6A 3ZFEC 4QX5A 1ZQ3P 2WZ8A 2XVKA 2VW2A 3BOQA 5FY1A 3KYLA 4QPGC 4AI1A 2HPIA 1OPOA 5JOXA 1R082 3R4KA 1QJX3 4LKSA 3ZO0B 3VZLA 4QDQA 1ENRA 4XJ9A 4CDGA 4GB33 1S0BA 1WLDA 2EXJA 2EXIA 1RHI1 4U36A 3BYWA 3AMQA 1U0JA 3URFA 4QHBA 3X2QH 3UYJA 4PJLA 3FMQA 2R92J 4L8QA 1UHSA 4XCBA 4U0WA 4JCKA 1HW5A 2D1HA 2DBBA 2WT0A 2AC1A 2C1FA 4UFKA 5F2WA 3SYTA 2FBEA 2ZJPF 1W6NA 2JG9B 1M4WA 1FNNA 4PGHA 3N7JA 5HOOA 3RCOA 4RLQA 4JVAA 1DGWY 1TQPA 2VOKA 2ME0A 2LTPA 3A0KA 1VBB1 4XAAA 3UGHA 3GWZA 5KNLA 3IKVA 3AJZA 1JXSA 2VBBA 4PSWA 2HYFA 1CJPA 5KHHA 4OU0A 1WA6X 3FHQA 3HPGA 3AXEA 2C4XA 3AYCA 3ERMA 4K8FA 4V1PA 3RWKX 3FDYA 3ZYRA 2KA3A 2VLAA 1CX4A 3SCGA 5BNPC 4B1RA 3K4ZA 5CYYA 4E27A 4YGDA 2W68A 3AJYA 3WXPA 2OV7A 3DKWA 1T56A 3Q8EA 5CYVA 3RFRA 3HSFA 3AKZA 4KMQA 4YGCA 1EF4A 2WNUC 1S0DA 2KFDA 1JYCA 4HVRA 1KQ8A 1S3JA 5CVJA 2EH3A 4KQ7A 4E2SA 4LK0F 3SHFA 1VMJA 1W6QA 1ZBA3 3IDBB 1JZ2A 4YM0A 3K48A 4A7KA 3CJNA 3D1NI 1WGPA 2LF7A 1RMU3 1MH4A 3HXLA 3AG3H 1IRXA 2XROA 2IT0A 2HDWA 4O65A 2W00A 3BCBA 5FFXA 2GN3A 3F6VA 4S2GA 1KEXA 2CU5A 4Q0UA 5IYYA 4URAA 3HNMA 2PXJA 1XNKA 1IG0A 4NC8A 1K4SA 2OU2A 2LF8A 5A32B 3Q8FA 5CG8A 4TV7A 1JU4A 2VMDA 1D8JA 3UJOA 3ZQHA 2BY0A 4JRAA 1S7EA 5F1RA 2VCBA 4RS5B 4UW4A 3K10A 2GOXB 3DXTA 4LBQA 3BOWA 4M3CA 4AI2A 2E1OA 5HLTA 3CP8A 5FYVA 3KYDB 4P00B 5A7NA 4BQYA 1FNYA 3HIFA 3VBRA 2EALA 4AVZA 3ZXFA 4M3GA 5HCBA 1HRV3 4AVBA 2V4VA 3OR2C 5JSOA 1ST8A 3OD4A 4P9FA 1XMXA 2ADDA 1RUE3 4IHYA 4XDQA 1X7NA 1F5JA 3DTKA 2LW8A 1H6YA 1VTNC 4ZZLA 3ORJA 1RIOH 2XGEA 4YW3A 3DP7A 2E1NA 4GRIA 4H7LA 1TL8A 1B72B 3EO6A 2QZ2A 2NYXA 2VZOA 2VT2A 3J4UH 2L9RA 2GALA 1I39A 4JX6A 3NNLA 1HV1A 1WMEA 3I3QA 4I2OA 4COWA 2JJ7A 4M9ZA 1NT0A 2IVIB 2HQAA 2JG9C 4WVZA 1RUG2 3AZZA 4B7KA 4L9BA 4X6QB 2WZR3 1UX7A 1JKRC 5CFCB 2Q8OA 2FBIA 3I58A 4A7YA 2FCVA 3TNQA 5K0UB 1X50A 3IC7A 3BODA 5K5RA 1PP8F 4WXHA 3M3EA 4DIQA 3J7ZI 2V9VA 2YC2A 3KVBA 4DBQA 1YOVB 2KDZA 3SXYA 4I7HA 3CESA 1FOYA 1OH4A 4LITA 1R081 4WVVA