1LB2A

Structure of the e. coli alpha c-terminal domain of rna polymerase in complex with cap and dna
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
201
structure length
201
Chain Sequence
b'PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*TP*TP*TP*TP*TP*TP*CP*CP*TP*AP*AP*AP*AP*TP*GP*TP*GP*
publication title Structural basis of transcription activation: the CAP-alpha CTD-DNA complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 61
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2002-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1lb2A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lb2A01
3R6SA 3JW4A 2QYOA 2HQRA 1S7OA 3CO2A 5FPXA 1R1TA 3F72A 1FNNA 1J58A 4LJZF 1HW1A 2DQLA 4E2GA 3HUGA 1Y0UA 4UVCA 2QVSB 3NQOA 4UNOA 1NE4A 4IPAA 5KK1A 4XBFA 4R52A 5JI6A 2M45A 3I4PA 1HBXG 3ETQA 3DV8A 5BS6A 3WTTC 1X8EA 4O6JA 1D8KA 3E5XA 1DDNA 6PAXA 2D40A 3L7WA 4I09A 1TNTA 3E3VA 3IBMA 3DXJF 3GYDA 4ASNA 4HLXA 3BPXA 1NHAA 2ELHA 4IERA 2D2WA 1YS7A 2P4WA 4HF2A 5LHGA 3HHHA 5K1YA 4KWLA 2ISYA 2XAGA 3SQNA 3M1EA 4JV4A 5EZWA 4DNCA 1IRGA 5DDGA 3Q9VA 1H0MA 1S3JA 4BXUA 1SEFA 1KYWA 4HMZA 3HIFA 2W57A 1V3FA 4YSFA 2MD5A 5L3DA 3JAMK 5FPZA 3ERED 5KVRA 3D82A 2QLZA 2DLLA 5DYMA 3VHRA 1MGTA 1R22A 1FYLA 4LFUA 3I54A 3VEPA 1LDDA 3B73A 3RNSA 3KEOA 4XEZA 3VB2A 2VC0A 2HS5A 2ZBKA 5D8KB 4PCQA 2O03A 4MHGA 4M73A 3U11A 5ICGA 2HYFA 3WTVC 3LQQA 2ZNZA 2NNYA 1XCBA 1KU3A 3ZPLA 1IN6A 5DCMA 4A12A 1FOKA 4I0AA 1T6SA 3LFKA 5H6RA 3EHKA 1LEAA 1SD7A 2QCSB 3P9CA 2ZXJA 3QP5A 2WC2A 5JSRA 4M6YA 5DEQA 2ETHA 1DP7P 3T8RA 4KU7A 1EH7A 4HV5A 3U0ZA 1YS6A 1U78A 2CWEA 2P17A 2F5FA 5BPDA 1KQ8A 4Q29A 3BJOA 1Z9CA 2PMUA 4A5MA 4IEQA 3M8EA 1Z6TA 3BZ6A 1YLFA 3O14A 2L3DA 2BEOA 1I1GA 1ZN2A 1XGMA 5EEHA 3D0JA 1TW2A 4ZYGA 1MZBA 1O5UA 4EWEA 5KBFA 2Y0MA 4D0PA 1BN5A 1IN4A 3GXOA 4MZUA 3DPLC 1YO5C 2ZJ2A 4WWCA 3Q9SA 3H9AA 1L3LA 4ZYHA 2P6SA 3LA2A 4Y13A 3BJ6A 3IKTA 2FF4A 2KXLA 3SCHA 5ILUA 2HYGD 4OIQF 5BQTA 2F4PA 3C1DA 5L3EA 3K1NA 3RJPA 4RB2C 2FBKA 1H9GA 4KWJA 3TOAA 3CLPA 1QNTA 4UUVA 4WVZA 1FSEA 5E18F 1HW2A 2EK5A 2PTMA 1GVJA 1JHFA 2L4MA 4S05A 1WSUA 1CAVA 3D0SA 1FBQA 4IEPA 4KMFA 5HS7A 2HEOA 4AIJA 4A0YA 2E9QA 3WGGA 5E1ZB 3S0MA 5D5VB 1QGPA 2B5HA 4PZJA 5D6FA 5BMZA 4WXCA 2WWYA 3PVBB 3O2PE 4N9HA 3HT2A 5TJJA 2G7HA 2Q8KA 4ZYEA 1EP0A 1CAXB 3KGLA 4I7HA 2H27A 2DPUA 3V7SA 2RQPA 2UXNA 3ZMSA 5CVVA 3NKTA 5EFUA 1FYMA 1IZ1A 3FHIB 5BV6A 2JRTA 1VTNC 2AXLA 4DQ2A 1P92A 1QY4A 2XHKA 3DKWA 3H8UA 2D5HA 5H6QA 2XAQA 3DQVC 3F8MA 3FMSA 2P6TA 4HVOA 4IHSA 4QMAA 2MNGA 2K9ZA 4EJTA 1T98A 1OMIA 5JR7B 3J81Z 2EA2A 3P7NA 4G8XA 5KHHA 1DZTA 3LSTA 2ETEA 2NYXA 4J1XA 3MQ0A 2XAFA 4ZYDA 1FBUA 1UIKA 2GC0A 4KL1A 4E70A 3WTSC 4YFKF 3EJKA 4LUKA 4MUVA 1EH8A 3RDIA 4AVBA 2PHDA 3DEUA 3QPHA 4EROA 1QQIA 2R3SA 4I2OA 4CO8A 2K0GA 2BE5F 2GC3A 2BV6A 1F9NA 1FI2A 2HOEA 3OGJA 4B29A 4EM1A 1YIOA 2D93A 4Z82A 2RGVA 3ABUA 2DO7A 1ZLJA 4ZU4A 5ERIA 2HJIA 3WTXC 3S2WA 3H3ZA 4L0YB 3RZZA 4AVAA 2ZNYA 2IT0A 4M9SA 1G3YA 2J5PA 3C3VA 2L54A 4HBNA 2VT3A 4RGSA 3N4MA 4A0ZA 2XLFA 1IXCA 5DCFA 2B9UA 3JTHA 4WCGA 2VT2A 2OZJA 4OU0A 1RUOA 4LB5A 3E6BA 3MYXA 1NYWA 2IXCA 5CVRA 5I93A 3G7DA 1OYWA 2GA1A 1BM9A 1U5TB 1XDUA 1Z7UA 3QPTA 2QENA 3U9GA 4AWXB 4EM0B 5E8GA 3DFGA 4GGGA 2CQKA 3DP7A 1YFYA 1RZ4A 3LWFA 1B6AA 3N97A 2K27A 3ST7A 4RS8A 4KN7X 1YFUA 1YYVA 2K7LA 5HS9A 2XLGA 2ZFWA 3QAHA 4XFGA 2VXZA 3L2HA 3PFIA 1HKTA 3GUDA 3KGZA 3CJNA 1IXRC 5D4RA 5FLJA 4ZU7A 1YW9A 1KGSA 4EJOA 1XGSA 2FBIA 2MBFA 3WTUC 1RNLA 1FLIA 1J7KA 1R1UA 2HTJA 4FAGA 1XE7A 3NRVA 3FE5A 1R23A 3ZMTA 3EBRA 4Z07A 1DGWA 3SHFA 1IF1A 5TRDA 1J9IA 2VBYA 4YG2F 3Q5FA 3HT1A 2A3SA 1O7LA 2C6YA 4XFFA 1HQCA 3IL2A 4L18B 5I0TA 3V8JA 4H7LA 5LRSA 4EQQA 4LUMA 4YRDA 3FJSA 3TO6A 5ICEA 4XLNF 4M72A 3J80Z 1B1BA 2JPCA 1VP6A 5IT9K 5JHUA 4U7DA 3BOQA 4J1WA 4L9NA 1YW8A 1YG2A 1H1MA 4QM9A 1VJ2A 5HDKA 3EYIA 5FFXA 3SXYA 3ULQB 1ZVFA 3V7RA 2H6BA 3KLOA 2Y0OA 1Q5OA 4IRGA 2PI0A 4XF1A 2QJVA 3EQLF 1LDKB 1FC3A 3C7JA 3F8CA 5FQ0B 3U10A 1UFMA 1TNSA 2DAOA 5HS8A 2P5KA 5FLXK 4HLTA 1E2XA 3KMHA 2UWMA 4LEJA 3RYKA 2GWRA 4UXAA 2O8XA 1XB4A 4I02A 2VBXA 3OV8A 1K7AA 3KE2A 2IXLA 2A5YB 2OBPA 4ENNA 2DK5A 4KN4X 4MV2A 1ZNPA 1GHCA 3T5XA 4KNYA 2DTRA 2R7DA 1CAXA 4EV0A 1MKMA 3FMQA 4HZFA 2BNNA 1ZRDA 4NB5A 2OPKA 1QXJA 4IXAA 4WXHA 4CDGA 4AD9A 5C6CA 1FSHA 4PIXA 5DV5A 4FX0A 2RKHA 1QBJA 3KP5A 3KZYA 1EY2A 4ESFA 3H1MA 3F3XA 2LF7A 5FFZA 4IEUA 4R8HA 2RDPA 4LG0B 4OIOF 1ZHFA 2B8MA 2E7XA 4P9FA 4EWAA 2HZTA 2V6CA 5A2QZ 2KIMA 4KICA 5HVQC 2UYAA 3L2CA 1WQ2A 5D5UB 4P96A 3ML6A 1TQ5A 3I58A 1LDJA 1IUYA 3QOPA 1CAUB 4HA8A 4LTAA 3GW2A 5J48A 1OI6A 2XASA 4OOIA 2EVXA 1O3TA 1IAWA 4WK8F 2LSOA 5LHHA 1AOYA 2X0LA 3T0YA 4WBBA 4HQEA 5HI0A 3S7EA 4IVNA 2QQ9A 2XL9A 2M87A 1ZYRF 4LMYA 4LLNA 1IXSB 4B8XA 3MEXA 2A6EF 4IHTA 4MEXF 2F5DA 3IDCB 3KP3A 4A6DA 2STWA 2EA7A 2M5WA 4U0VA 3C3WA 3H7JA 5KHKA 1IN5A 2K4BA 2D1VA 3CO7C 4XFHA 1C0WA 1S8NA 4RB1A 3ZN1A 1FP1D 4EM2A 2PFWA 4EVIA 1Z91A 1O57A 1XSDA 1O3RA 4MEYF 1JUHA 1FP2A 2ZKLA 3MDPA 4FBFA 4KIGA 3OD0A 4P9UA 3CDHA 2A6HF 1CGPA 3PQJA 2MH9A 3SCGA 2YX7A 5E17F 1U5TC 2CFXA 2P5VA 5D6EA 4QM8A 1OKRA 1QXRA 3D5LA 2AS5F 1WGPA 4KU8A 1OR7A 4IEVA 4L11A 3DF8A 5I0UA 3K1PA 1JE8A 2GC2A 3BWGA 3H1WA 3F22A 4RGRA 3ECOA 4EWDA 4XRFA 1F1ZA 2XIGA 2VPVA 2C0ZA 1ZZ9A 2GH2A 5KHIA 1FWZA 3R4KA 3PNAA 2G9WA 2IXKA 2N7GA 3ZN0A 1CF7B 5FB2A 2D45A 1YTYA 3G73A 4Q0SA 3PQKA 4Y15A 4TLFA 2O8QA 4MTDA 4FT8A 2PQQA 3BJAA 4EJUA 5LLQA 1E17A 1G3TA 5IT3A 1R1VA 1Q43A 3DPTA 4UHTA 3E6MA 4XF0A 3TOBA 4LK0F 5BY5A 3GEZA 1XGNA 4YIFA 4QX5A 4XFIA 2OA4A 3CJXA 1IPKA 3IRQA 3ES4A 3DN7A 3V4GA 2PJPA 2YR2A 3T8TA 5AIQA 1O7FA 3NJZA 2LKPA 2XGXA 2QQAA 3CUOA 2MPFA 2IXJA 2VBZA 3HTSB 3EYYA 2YU3A 1FT9A 3HRSA 1YWKA 4NVPA 5FQ0A 5C8WA 5JAXA 3U2RA 2KIFA 2W25A 1XSVA 1DPRA 5DD8A 2MC3A 1RGSA 3R0AA 1HW5A 1QZYA 4ONUA 1RC6A 2XLAA 4I3PA 4HX4A 3E97A 4M9ZA 4YIIA 3JAMZ 2IP2A 3IKVA 4G6DA 4WX9A 4IEWA 1HSJA 3TNQA 1RUNA 1REPC 4O5VA 4Q5SF 4MX3A 2QDRA 3KSCA 4XF3A 1YW7A 3UKNA 2DFIA 3KCCA 1YFXA 4RAYA 3GFJA 1TQPA 1U3EM 2E7WA 5F6FA 2Z3YA 4Q0QA 4IEXA 2EFWA 5J7MA 4LG0A 1XRUA 2V1UA 2GXBA 1OPCA 2PA7A 5CADA 3R60A 2CO5A 1EV7A 3FZ3A 1XGOA 3LOIA 2LF8A 1HKSA 4HF1A 3M70A 2HQNA 2O6GE 2Q4SA 1QPMA 1MJ9A 1OD5A 3OCPA 5D8LB 1CAUA 1WA4A 4IEZA 1J0RA 2COMA 2ESHA 4AVCA 1O5LA 2FMLA 3H92A 3GF2A 2VQAA 4GXOA 1ZRFA 3QRFF 2EJRA 4WZCA 4ENKA 1YQAA 5DD4A 3O6BB 1IRFA 2H0VA 2P7VB 4YFNF 2VN2A 1XDSA 2TDXA 4X6QB 4U0WA 1J3QA 2ZKZA 5HDGA 1HSTA 4Q0VA 3CL1A 1BOAA 3HOSA 5JSPA 1PDNC 4KYWA 3F8BA 5CU1A 4R79A 3IWZA 3KEQA 3FHZA 3EETA 5E20A 3TGNA 3SZTA 2MHFA 1BC7C 4RB3C 3WW4A 3OOPA 2EWNA 1LVAA 4OMZA 2E1CA 1YLLA 4BIFA 2EFOA 2UXXA 5HDNA 5BUVA 1TTYA 3TNPB 3H7YA 3HHGA 2RN7A 2IC1A 5CVJA 2O0YA 2V1XA 2L4AA 3E5QA 2L02A 3BY6A 5F1RA 1ZH5A 3LA7A 2QZ8A 4KIBA 1CAWB 1JGSA 4L5JA 1FBSA 5JVTA 3WW3A 3MPBA 4KT5C 4HN1A 5I8YA 3HRMA 2G7UA 3BALA 3M8FA 3W6KB 2PAKA 1P4AA 2OD5A 3CLOA 5LGTA 3GFIA 4K2EA 3V8KA 1W5SA 1ZZ7A 2DK8A 3RKWA 4PJYA 5ILSA 1SFXA 4FHTA 1U6GA 1P4WA 1SMTA 2GXGA 1J1LA 5CLSA 2Y75A 3I59B 4EJVA 2XKPA 5D4SA 5E1WA 3FXRA 4QGLA 1PUEE 1H1IA 3L9FA 2IXHA 3QU6A 4RD7A 3WG9A 4LD5A 3GBFA 3TO9A 4KIFA 2QQBA 4WF2A 1CF7A 3TDZC 3DL3A 2D5FA 3K9TA 5J8FA 4RB0A 5L3GA 3RI4A 1LKNA 1ZGJA 2P8TA 3NEUA 2NRAC 2QUFA 4QGMA 2HFHA 4KWKA 2XVCA 1GQGA 3O3KA 3RPQA 3CUQC 3V8LA 4UBHA 2FSWA 3KLNA 2A69F 1UCRA 1X8MA 2W24A 1DZRA 1DPUA 2HWVA 4CHUA 1DGRA 3J7AO 4IEYA 4OFGA 2CG4A 1Y3TA 2ZMEB 2PBIA 3VOEA 2OZ6A 4HVQA 1NE6A 4QXKA 2VODA 5E8IA 2HTSA 5BPXA 4N0BA 1KA8A 1W7PD 2EFPA 3NVCA 2Q2EA 3BPZA 1UIJA 4M71A 5E16A 4QGNA 4MGZE 3MAJA 3FM3A 2OU2A 4U7BA 3FF5A 4G7OF 4XF4A 4BAYA 4Q0PA 1IPJA 2DW4A 1R00A 3KZZA 1S29A 2H09A 4HOBA 4NHJA 1RL3A 1BIBA 2VOOA 4M9XA 3KP6A 3LAJA 1ZX5A 3F21A 1JXSA 3IWFA 4HYEA 2Y48A 3HSEA 2VE9A 3BU7A 2J5OA 4IJAA 4UXNA 2QVOA 4G9YA 4L9VA 1QO0D 2XAJA 3GLXA 2XKOA 3AAFA 2VONA 4JVAA 2XRNA 1QZZA 4L2NA 5LEKA 4UVBA 2PMHA 3M9AA 5LBQA 1XN7A 1HKQA 4E2QA 3VODA 3QU3A 4LK1F 2OA2A 3WE2A 2F5CA 3M3IA 2P5LC 3IC7A 1ON1A 1Q3EA 2WV0A 2UYBA 4MGRA 4LGWA 1LR5A 5FCCA 3TQNA 3WE3A 1I27A 4JBAA 1HXDA 2M30A 4EGYA 4HSJA 3ZMVA 3TDUC 3ELNA 2Z33A 2QM3A 2PAMA 2ZCWA 3F6VA 4ENJA 1KYZA 4EJWA 4IETA 1RTVA 4CZZA 1G3SA 3WTYC 4L5IA 1ULYA 2PEXA 4HSLA 5DUKA 4L9TA 2WTEA 1X82A 3JZVA 3KP4A 1KU7A 3GO5A 3GZ5A 2MLKA 1V70A 2KKOA 1WLTA 2YPRA 4HX8A 1CX4A 1BIAA 2F2EA 4U0YA 3FXUA 3KP2A 2ADUA 2CV6A 4OMYA 2Q0AA 3BB6A 5DUIA 2K02A 2V1DA 1IN7A 5FD5A 3FMRA 5IT9Z 3IDBB 3F8FA 3W6JB 3WGIA 1KU2A 2RVCA 3WW1A 2XAHA 3SCFA 4CGZA 1Z05A 4GULA 4RGUA 4ON0A 1WWXA 1FX7A 3HRTA 4N9IA 1J59A 4GCVA 5K5QA 1SQ4A 1EPZA 4XETA 3ECHA 4HDVA 3GFMA 4Q0UA 3BDDA 1D3YA 4G6QA 2FA5A 3HSFA 4OIRF 1T38A 1FZPB 4YARA 5FLXZ 1CAWA 2MH2A 2CSOA 3ZMZA 1LNWA 5ICFA 1BI0A 2VECA 4Q47A 3R0JA 2VOPA 3I53A 4O9EA 1K6OA 5ICCA 5K5RA 3I7DA 1J3PA 3C18A 4JQFA 5HLHA 1X7NA 3I59A 3ELKA 4M74A 4JK1X 3NSTA 4HDUA 5CVUA 5J8CA 1F5TA 3QP6A 5ED4A 4QLCU 1USTA 4ENMA 5HLGA 2F5EA 1O3SA 3KETA 1P6RA 4JTNA 3H3UA 1BI1A 1ONVA 4A2UA 1G6NA 1ZLKA 2E1NA 1FPQA 1PP8F 3BPVA 2PN6A 2NNNA 1U5TA 1GXQA 3WTZA 4M6XA 5KHJA 4UVAA 2PFBA 5D5WB 2OZUA 5H20A 1Y9QA 1MDMB 2FQPA 3SMHA 1SFEA 2BNMA 1LRHA 2M8EA 2V9VA 3MZYA 1B9MA 2RC4A 4I01A 2GZWA 1I1SA 2W84A 2EV0A 3TO7A 2ZMEA 5EEGA 2RNJA 3BCWA 1SD6A 2IJLA 4JTOA 2FU4A 5I0SA 3I5UA 3WGHA 3HOTA 2FMYA 1AWCA 4GO1A 4HQMA 3RYPA 1I5ZA 2PAEA 2D1HA 5CVIA 4A6EA 1YUDA 1ON2A 1R5GA 1RI7A 4PIYA 3BROA 2FQ3A 2BYVE 1GXPA 2PYTA 2KRFA 4FX4A 2GQQA 3CEWA 3CUQB 5AONA 5JFRA 4ZU5A 3K1MA 5KHGA 5LGNA 4G7HF 5BPIA 2DBBA 4S04A 1A04A 2XROA 2V09A 4BHCA 4F8AA 2HKOA 3RIRA 4F7ZA 4BQAA 4META 1R7JA 1W7PB 2IA2A 2HDCA 3F6OA 5FLIA 4Q4ZF 1OYYA 2IXIA 2FRHA 2KJCA 1ZREA 2P7CB 4P55A 4AQ2A 4Y17A 2ACJA 1IW7F 5JSOA 1WRJA 3F8NA 4BYYA 1LEBA 5FO5A 4G94A 4ZZLA 1TQMA 3TKYA 3UKVA 2FNPA 3QACA 1S7AA 5LRRA 3MZHA 2CAVA 4XFAA 3EO6A 1ZZ6A 4L0ZB 1YHFA 1G4DA 2EV5A 1ZAOA 3IIAA 2EA4A 2O61A 3K2ZA 4O9GA 5F64A 4ZZDA 1J5YA 4MQ9F 5LGUA 3RKYA 3USSA 3EDPA 3LA3A 4A5NA 2K4JA 4XSZF 2EV6A 1G3WA 1DUXC 3ZDSA 4YYOA 4AVPA 2A68F 5E1RA 4HV6A 2VE8A 4EMSA 1YFWA 4D7SA 1IN8A 2R7FA 2JSCA 3NL1A 2OYZA 4AQ6A 3J81K 2Z69A 2OQGA 1SFUA 1ODDA 4I98B 4ESJA 1ZZ8A 1XMKA 4TV7A 1ZZBA 3KP7A 2DI3A 2CGPA 4IRHA 3GX4X 3ZMDA 2DT5A 4HX7A 2UY9A 1D5VA 3MFKA 3E6DA 4LA3A 2PQ8A 4XFCA 5CJ9A 3S7IA 3ES1A 1R58A 2GC1A 2QBYB 4Z2YA 1P4XA 3IRRA 4HN0A 1X3UA 3RKXA 2GA2A 5CYVA 4KUMA 2FEZA 3GWZA 1ZRCA 1B4AA 2DCTA 4LA2A 3I71A 4A0XA 2JTVA 3GVAA 4Q48A 2Q1ZB 1OYIA 4AIHA 3OTFA 4OINF 1USSA 1P2FA 2PHLA 3H1YA 1LB2A 4YFXF 4IF4A 3JSOA 1ZARA 3FWEA 1T2KA 1J75A 4BNCA 4KA4A 2BBYA 4GYIA 1ZRRA 1KQ9A 2MA3A 1T0FA 3WTWC 5HOOA 4KDPA 1GQHA 1V4RA 4K8FA 1PM7A 2I45A 2PG4A 1MJBA 4KFCA 2YX4A 3I0TA 3KFWX 4PDKA 3SXWA 4MQVA 4GYGA 2NS0A 2KJBA 1SD5A 2Q30A 3OF1A 5E1XA 3WW2A 4IESA 4P5OA 4PGHA 1VR3A 3UKTA 4H0EA 4ORFA 1MDMA 2ISZA 4R1HA 2A61A 2EAAA 5T3NA 1R36A 1TQIA 2OAZA 2VC1A 3RTRA 2IA1A 4U88A 3E6CC 4UV9A 3GYHX 2O3FA 4XF9A 2ZO4A 4OLLA 2VBWA 2EFNA 3F23A 3COAC 3BP8A 1UB9A 1WI9A 4MGIE 4FAHA 1STZA 3SFZA 4YNIA 1WKMA 4L9JA 1K78B 3ISPA 1Z1DA 2MLGA 2Z2SB 2JZYA 5BXXA 2EFQA 3PLQA 4KMUX 3ZP5A 3EUHA 1NXMA 3H50A 2HR3A 1TLHB 2CW0F 5D5XB 1XSXA 3LQRA 3CUQA 5FLHA 1XD7A 3K69A 4DINB 4D7TA 2H94A 3I64A 5BOXA 5J6XA 3ACLA 4ETSA 2GIVA 2DU9A 3E5UA 1L3JA 3J80K 3SZPA 4PGGA 1EH6A 3FX3A 4O3MA 2KIUA 1LJ9A 3ROUA 2XUBA 1W4MA 3RYRA 2HKXA 4BHPA 1W7PA 3WU1B 4BH9A 4PIZA 4RAZA 1ZZCA 1ZG5A 4G7ZF 4BHBA 2L01A 2BGCA 2OQRA 4X6RB 1UD1A 3FFQA 3LZZA 3HTUA 3CTAA 1XMAA 2LDUA 4QWQA 4IEOA 1Q1HA 2V79A 3WODF 5D1IA 5L3CA 2K86A 3FM5A 3GFLA 1SAXA 1TBXA 2JPBA 5I8SA 5LEJA 1JHHA 3JTGA 4LLGF 2JT1A 5FGMA 3G3ZA 1W5TA 1SD4A 3R61A 1ZG1A 1KU9A 2IW5A 1QWRA 1UHMA 1XE8A 5I0RA 1U12A 2PLYA 3REOA 5AVPA 1PP7U 3LAPA 2DPDA 2XL7A 2DQRA 5DCMB 2Q0OA 1BJAA 3ABTA 1B59A 2FXAA 4CYDA 2STTA 4XFBA 1UW8A 3LAGA 4HW0A 5K5OA 5LHIA 3HSRA 2UZKA 2O1QA 1O4TA 4MTEA 1TW3A 3IHUA 1SFNA 4ESBA 2FBHA 5A2QK 3FXQA 1MJAA 5L3FA 1T39A 3U1DA 5J3UA 4MNUA 3P9IA 1ZGAA 1L0OC 1O3QA 3FZVA 2FE3A 2B0LA 4P9GA 2ATFA 2X4HA 5I91A 2FOKA 1BI3A 4XSXF 5JR3A 5FD6A 2CAUA 1ZG3A 3LWCA 2RV8A 3L09A 2QBYA 5K8SA 1I6XA 4HBLA 2GAUA 3HYIA 3GZ6A 3ZMUA 1EYBA 4ZH4F 1U8RA 1FYKA 2IRFG 2ESNA 2ET1A 4MGYE 2HGCA 1Z6RA 2YSRA 3ZQ7A 3CO6C 1D8JA 2IPQX 1PMIA 1NZCA 1BBYA 3NW4A 4OIPF 1UHWA 3VFZA 4HLYA 3CF6E 4UV8A 5I8TA 1YFHA 3K0LA 3P9KA 2A07F 4HVRA 4AIKA 1S6LA 1XCVA 1FXZA 1BC8C 1FY7A 4CXFA 3MCZA 5FDBA 2Z99A 4LLOA 1U2WA 3WU0A 1KQ0A 1B9NA 3L00A 2UY8A 2H6CA 2IA0A 2EB7A 4AXOA 3JSPA 2XV4S 2LNBA 2WFPA 4IRIA 4MGKE 1CAVB 1RIOH 1OFNA 4LLLA 1UPIA 4E2SA 1BI2A 3MWMA 4B09A 2FNAA 2ET7A 3RPUA 4UBGA 4XLPF 3SHRA 5AIPA 3EQEA 5L3BA 2Z9OA 3V7CA 2CYYA 2W85A 1J3RA 2BNOA 4HF0A 5ILVA 4CICA 4HAMA 3T1BA 5JCTA 1LQ1A 2M1BA 2Z5UA 4EGZA 2GU9A 2QNKA 3HRUA 4LB6B 4RGXA 2QWWA 4I0BA 4LULA 5HLIA 1H9TA 1R5HA 1F4KA 2NAZA 1K79A 4MH0E 1J2XA 1SMYF 4NQWA 3HQXA 1UCXA 4WXDA 3B02A 1MD0A 3M7GA 1K78A 2IVMA
chains in the Genus database with same CATH superfamily
1W8TA 3KB5A 2HQRA 1S7OA 3CJIA 1KRIA 5IP6A 3Q0VA 1HW1A 4UW6A 2NS7A 1QJY1 4R52A 1QJX2 4NRMA 3R0RA 1HBXG 4MIMA 3ETQA 4PSWA 5B4NA 4A6SA 1WW7A 1D8KA 1G9CA 2R5YB 2ILMA 2D40A 5FO9B 3L7WA 1TNTA 3IBMA 3RZJA 4AVTA 4YEJA 4ASNA 2QZ2A 3VZNA 1NHAA 2N8GA 4IERA 4CEYB 1TEIA 2WIIB 5KNLA 4HF2A 2OPTA 2YY1A 5LHGA 2YHJA 2MEV2 5EJZB 4KWLA 2ISYA 4AI3A 1IO2A 3M1EA 4JV4A 3DWLE 2YPDA 4EYUA 2VIXA 3KHBA 4BCUA 2GP5A 2KZGA 4BXUA 3OEAA 4AHYA 2Y69H 4HMZA 4OMDA 3WU2C 1KONA 5G04L 2L7KA 1E5HA 1R71A 1RUF1 3VHRA 2Q8CA 1JOBA 3I2JA 1R22A 4IOAF 3ZFEA 4FTSA 1BR2A 3B73A 1HRV1 2WZR3 2DMTA 2ZBKA 4PCQA 4A3LJ 4BK5A 1OISA 5ICGA 1QHGA 2XBO3 4TLGA 3WTVC 3KIOA 1XCBA 3TWIA 2F4MB 3LFKA 3BR2A 3BTLA 2F17A 4B4CA 3ZYBA 4AK3A 2QCSB 1AVBA 5BYNA 4NUBA 3QP5A 5JSRA 1A34A 3IAS2 5IW0A 3ZYJB 1DP7P 1EH7A 3U0ZA 3L2YA 1YS6A 1U78A 2CWEA 5EZHA 1K4TA 4LOCA 2R7XA 4HL0A 4RFRB 5FRMA 1KQ8A 4XZUG 3PO3J 4Q29A 1Z9CA 2GNMA 2J1UA 3DYOA 3N9NA 3M8EA 1PVEA 2AGSA 4ASKA 4QX8A 1KJLA 3VGIA 3BTCA 1K4SA 4DXRA 3LCPA 5EEHA 1RXGA 3D0JA 1O5UA 3CU7A 4EWEA 4FPYA 1CR7A 5B3SH 1AJKA 4D0PA 3MPPG 1ZELA 1QDOA 1TNFA 1IN4A 1HJGA 3DPLC 1YO5C 2ZJ2A 2A3YA 4WWCA 2VCMA 3W21A 3THTA 2JDUA 4D0QA 3AP4A 3GZTB 1JTXA 4CP1A 1GWLA 2P37A 2BY2A 4CUGA 5DUXA 3BJ6A 3IKTA 5ILUA 1PVXA 2YROA 5BQTA 2F4PA 1SFYA 3EB7A 4FTEA 5L3EA 3K1NA 4Y1YA 4RB2C 3WG3A 5HCAA 2D6PA 2B45X 2X1EA 4WVZA 3LSDA 2DODA 1GVJA 5FWEA 3D0SA 4IEPA 3FXLA 4OAYA 4WVVA 4ASMB 4YM3A 2E51A 1SCRA 2AQFA 4A0YA 1OT5A 5E1ZB 4WM7C 5A3PA 4E7SA 1UF2C 5D5VB 2B5HA 4IQJA 5D6FA 4WXCA 2WWYA 3PMSA 5EEAA 3PURA 2MEV3 4LKFA 2OTJI 1SLLA 2QQKA 2BPA2 2Q1FA 2XQRA 4K1YA 3KGLA 1F31A 2H27A 2RQPA 2HBUA 3MLLA 3ZMSA 4L97A 4M3CF 5BNOC 4Z92B 1IZ1A 3V56A 5BV6A 2JRTA 3N9LA 5H6QA 3FMSA 1EV11 4HVOA 1VBB2 3O1MA 2LG4A 2K9ZA 2CH0A 1ETXA 3M4FA 2A5ZA 1VQPI 3VYTB 2ZGRA 2X6OA 1ASJ2 1DZTA 4Y26A 3SDGA 2VZPA 4UFJA 4ZYDA 3AG2H 3VZMA 3HN1A 1FMVA 2NYYA 3WTSC 3HN3A 1REEA 3AP9A 4LUKA 3CESA 1EH8A 3DBHB 5J40A 3RDIA 3DEUA 1JU4A 1W0UA 3WNOA 3BVCA 2BE5F 1XNTA 3B9CA 4YVWB 3RFRA 2BP6A 3D5OA 3PNTA 1YIOA 4LKSA 3AC0A 3T4VA 4CDQA 2DO7A 4A3IJ 2Y0IA 5F32A 4ZU4A 2AXTC 3H5AA 4CP9A 4ZZ5A 2OXBA 5FMOS 2ZNYA 4X0GA 2J5PA 2L54A 2C5DA 2ZXHA 2VT3A 3N4MA 1GOHA 5FPUA 1IXCA 5CFDA 2LTPA 2DFEA 4CVUA 4HXCA 4WCGA 2VT2A 4IL6C 5CFDC 3DBRB 2FDGA 3VBUA 4LB5A 3E6BA 3ZQHA 2IXCA 2JE8A 1F4AA 5CVRA 3OYWA 1BM9A 1QHHD 2QCOA 3QPTA 2QENA 1SDWA 3U9GA 4AWXB 2JD9A 2CQKA 4A3BJ 3S2DJ 1BBT1 1RUC1 2NZ9A 1VQMI 2R32A 4KWUA 2YC2A 3LMMA 2VVEA 1A6CA 1SCSA 2ZFWA 4RQPB 2VXZA 3PFIA 1QOSA 3BTIA 2D7FA 1IXRC 5D4RA 2ICWG 4F52A 2EALA 4GJZA 1JZ6A 2KL4A 4IGPA 3HG9A 3C2UA 4FISA 3FE5A 3O0WA 1TWHJ 2R042 4Z07A 2D43A 1JZ5A 1STMA 2VBYA 1NAEA 1VPHA 2A3SA 3SNMA 2C6YA 4LE4A 2DDUA 3S32A 1AYN2 1JUIA 1VBB3 3IL2A 5I0TA 3V8JA 4H7LA 3FJSA 5F6LB 4CDUB 1ASJ3 1A31A 3HOXJ 1B1BA 3KYDB 4QQOA 2YFUA 4Y4RA 3HQUA 4LE3A 2JUCA 2VCCA 1BR1A 2NN8A 1LFUP 4C2UA 5HDKA 4GMP0 5FFXA 1M1EB 1ZVFA 2FCUA 5A3WA 1YRNB 3KLOA 2GN3A 1W39A 2PI0A 4XF1A 2QJVA 1ALYA 2DU1A 3EQLF 3VBOA 1LDKB 1HB2A 3C7JA 2D6LX 5T55A 2XJSA 3VBOC 1TNSA 2DAOA 1S7EA 3CCRI 3LEIA 1ZBE1 3J26N 1PO21 1E2XA 1OVSA 1H4HA 5FZIA 2UWMA 3RYKA 2GWRA 1XC6A 4JP0A 3FDYA 2GM4A 4I02A 2K3PA 3OV8A 1PK6C 3KE2A 2IXLA 1N3QA 4MGSA 5FUPA 3WZ1A 2DK5A 1ZNPA 3T5XA 4KNYA 5IVYA 1SAUA 1WCKA 2W1WA 3N05A 3OUHA 1JTYA 3FMQA 3RI9A 1AZDA 1VMHA 5FK7A 4AD9A 5C6CA 1FSHA 3BQYA 5H9SA 1ST8A 1D2QA 1KEXA 3GJBA 3H1MA 3F3XA 3ATGA 4LK7A 1DLCA 4R8HA 2RDPA 1RIRA 3PFYA 4JGYB 3POYA 2AENA 1ZHFA 2B8MA 2E7XA 5A2QZ 3GTPJ 3GTJJ 5F3EA 5L36A 1EAH2 2J1TA 5FMOL 2RS51 4P96A 2R0QC 5F5CA 3CCJI 1MS8A 3WP4A 4YW5A 4JGZC 3QOPA 5BNGA 1OCRH 2ZGNA 2NM1A 3I4NJ 1HDDC 2XASA 4OOIA 2EVXA 1O3TA 1IAWA 4RR3A 5LHHA 1AOYA 5FREA 3ZN6B 1W03A 2P0WA 3RPUD 1ULOA 2R043 2DMPA 1IXSB 3O8HA 3BOPA 3UJQA 1SLCA 2XAUA 4DZJA 2QQNA 4A6DA 2M5WA 4U0VA 2LW8A 4NOTA 4KITB 1X2MA 1AYN3 5HPOA 3C3WA 4QU2A 3HR9A 1IN5A 3CO7C 2D1VA 2JA2A 1C0WA 2V4VA 2X29A 2WNUB 3VBSB 1D1CA 4HG2A 1GT0C 2JKXA 1FP1D 3VN4A 1MMNA 5IOYA 3K48A 4C1XA 1O57A 4AVSA 1FMD1 1YX5A 4QPGA 2DCJA 2HWC2 1C8M1 2WQ8A 4KIGA 4FBFA 5FV3A 2ZJPF 2A6HF 1YQ5A 2YX7A 4PLOA 1I1EA 1POQA 4NWWA 2P5VA 4QM8A 2WAQN 2R062 1QXRA 4OHVA 2ZSHB 3SH3A 1OR7A 3ZYRA 4UF0B 3DF8A 5I0UA 3K1PA 3AMHA 4LO5B 4M4PA 4AE2A 1UAIA 3F22A 4LJHA 4EN0A 2ZAHA 2GBYA 2Y6HA 4K3UA 2AYHA 3H9QA 5EP9A 5EGOB 1CJDA 1WD3A 1ZZ9A 2GH2A 5HV0A 2IXKA 2VC9A 3RZLA 2FCTA 3ZN0A 2D45A 3CC2I 3B6AA 3BCBA 1ACIA 1XE0A 4WM8B 4FT8A 1XNDA 1TME1 3CMMA 2VJ4A 5IK8A 1R1VA 1Q43A 2AQEA 3E6MA 2FZ2A 3TOBA 2WZ8A 2DYRH 5E3LA 1QU0A 1PNFA 1XGNA 4YIFA 3APBA 4XFIA 2OA4A 3MN2A 3S93A 1AL22 3ES4A 3DN7A 3V4GA 2YR2A 2WQZC 2W39A 2PLV2 5AIQA 3WEZA 1O7FA 5C5TA 2E7QA 4FVVA 3N9QA 2QQAA 4E4DX 5IY5H 5CZKA 3JRIA 1YWKA 2DU0A 1SACA 4NVPA 1US3A 4YM0A 1OLRA 4PBOA 1IKPA 3U2RA 4GWNA 2W25A 3J8F1 2R7SA 1U0AA 4JC1A 1MMAA 2EILH 2HVSA 1FOXA 3N3HA 5DD8A 2SLIA 4NPLA 5TGTA 1RC6A 3EUAA 2R4GA 4S2HA 4M9ZA 4YIIA 3JAMZ 1ENXA 4YELA 1SDDB 2WN3A 3JB8A 2D98A 4H14A 1KZHA 4MX3A 4GMP3 1YW7A 3UKNA 2XSJC 2DFIA 3KCCA 2JIGA 3R4UA 4AEJA 3VDDB 4BB3A 3WF0A 3CQOA 5IP7J 1VMFA 1YFXA 3GCXA 4PJMA 2P81A 1D4M2 2WZR1 4Q0QA 4M3FA 1YO8A 4IEXA 2HWC3 2OS2A 2GXBA 2XBO1 1XYOA 4YZ5A 5CADA 1W1WE 3FZ3A 1XGOA 2R7WA 5H2FC 4FOWA 4W4ZA 2W08A 1JI8A 3H0OA 2O6GE 2Q4SA 2ZBJA 1RUJ2 1MJ9A 1OD5A 3OCPA 5D8LB 4XUPA 1CAUA 1WA4A 2XWJB 2BZDA 2W0XA 2ZSIB 2COMA 3K3OA 2ESHA 4XJ9A 3GF2A 5EHDA 4GXOA 4N53A 4AI1A 1ZRFA 4OAZA 1YIFA 2EF6A 2EJRA 3J7HA 4L99A 1VBA3 2XR4A 4N53C 4Q4X2 1IRFA 3NWKA 1ZA7A 2P7VB 1X1CA 4YFNF 1W3XA 2TDXA 4W50A 5GZCA 2W1QA 5K0UA 2HZDA 3NJYA 4Q0VA 4CEWB 1VQ6I 1UY0A 5FZ8A 5K0UC 4NJ4A 2DA2A 4XZPA 4KYWA 3AK0A 3JRFA 4ISQA 3OY8B 3IWZA 5FRNA 1O6UA 3KEQA 3EETA 1SMVA 3M8JA 3SZTA 1BC7C 4RB3C 4LBOA 3VKFC 3WW4A 2GMEA 1ND2A 5FY8A 1YLLA 4BIFA 2EFOA 3GCMA 1QNYA 4MG2A 1AL23 4HKLA 5A32B 3H7YA 2XB0X 4CDWA 3HHGA 3KVAA 5FKLA 5CVJA 2O0YA 2V1XA 2WNEA 3TN92 3UV9A 3GTLJ 5JPNB 1Q8OA 2PLV3 1NT0A 4CDWC 5F1RA 3LA7A 2QZ8A 4KIBA 1P8JA 1W2TA 2NVTJ 3LIHA 4P5HA 5I8YA 1B8IA 1UZZA 1WW6A 5C3RA 3S5QA 1H1AA 3HKZN 4R9CA 4UW3A 1P4WA 2HQ5A 2GXGA 3WCRA 1MBGA 2VQTA 1QNWA 3I59B 1QXPA 1X9PA 3FXRA 3W6VA 4QGLA 1PUEE 1H1IA 2FZ1A 4NIIA 3NQHA 1I3AA 3G1LA 2MEV1 1KDKA 4LD5A 3GBFA 2DT7B 1ENHA 1XPWA 2FBEA 3G1MA 2YBPA 3Q3SA 3FC0A 5J8FA 4C2MJ 1A6IA 4KWKA 2YBKA 2XVCA 3MKWB 2I74A 2QBXA 5FZKA 3KV4A 1SLIA 5FAXA 2FSWA 3KLNA 2VD7A 3DPRC 4WV8A 1D4M3 5C33A 4KI5M 3MVPA 2W24A 3CCEI 3J7AO 4AFDA 3CZ6A 4OFGA 4RSUA 1PUFB 2ZMEB 2ARXA 5CFCA 2PBIA 1X3WB 3VOEA 3USUB 2OZ6A 1S0IA 4OUEA 5L19A 1NA1C 1W6MA 4AZZA 3AL5A 4N0BA 1KA8A 3GZEA 1RUJ3 2RJLA 4FP2A 1CZTA 2Q2EA 2GSYA 3VL9A 3U1KA 5B66C 5FPLA 1WPKA 2LVSA 3RSNA 3CD6I 3VD7A 1DGRM 1DGWX 1YQ8A 4UUSA 1GICA 3ACHA 3FF5A 3T30A 5FZ4A 5A7SA 1WJDA 2DW4A 3KZZA 4Q4X3 1Y1VJ 3PL8A 1DYOA 3ZMNA 5LA0A 4NHJA 3ETPA 1BIBA 2ZFUA 1ZX5A 4IV1B 2KIQA 1RKTA 3IWFA 3L2VA 2JK3A 3RZOJ 2CNAA 4M3GA 2VE9A 1BQPA 4IJAA 2XAJA 2R6QA 5JIAA 2XRNA 2OJED 1MW7A 3LFMA 2MFZA 4L2NA 3ZYGA 5J47A 1YI2I 2PMHA 3A23A 3M9AA 3ZN5A 5LBQA 2J42A 1IZ3A 1XN7A 3ZFGC 4EZ4A 2VM9A 3TN93 1W36D 3Q0UA 5JPMB 2WV0A 5J4VA 4MGRA 4HPQA 2X6XA 3BG5A 2EIBA 2ZABA 3E0JB 4QDSA 1O91A 4JBAA 1HXDA 2PHUA 3FBYA 4HSJA 2A6XA 3ELNA 4S2FA 2Z33A 1VNDA 2ZCWA 5LY2A 4YFWA 4ENJA 1KYZA 2RS12 4IETA 1VQNI 3P3NA 5IP9J 2JE7A 4N43C 4B7EA 1EKEA 4L5IA 3ITQA 3M3YJ 2PEXA 5DUKA 4L9TA 3I4MJ 4HOOA 1X82A 2DMQA 3ASNH 1KU7A 3GTOJ 5BNQA 3GO5A 1Z78A 2MLKA 4P14A 2KKOA 1PZ7A 4U0YA 3BG3A 2CUFA 3KP2A 5JI7A 5CNAA 3J7AY 2A6YA 4D5FA 3FBMA 3HPNA 3OYLA 4KG8A 3IDBB 5DAPA 3WGIA 1OA2A 2RVCA 1VFCA 1VBB1 5CA6A 2XAHA 4XE9A 3SCFA 5M5YJ 2BQPA 2K9SA 4GULA 4LBNA 4ON0A 9ANTA 1WWXA 2RDRA 4LXLA 1Z77A 5DM7F 2FMDA 3SEEA 1DP0A 4XDPA 4PBPA 1TWFJ 1JXNA 5FO8B 3ECHA 2BVBA 3AVRA 4LHNA 3BG7A 4G6QA 5F1JA 1JYXA 3HGGA 2R30A 2CSOA 4B1LA 4BDVB 2ID3A 5F39A 5F8PA 1FV3A 4NO4A 2NVQJ 3POWA 4O9EA 1K6OA 4MXVA 4LG3A 1D0HA 4NR1A 1ETQA 1X7NA 4OQ8A 4U87A 2CMPA 1ETOA 4HANA 1W5CC 5J8CA 4QLCU 3KETA 3IIIA 3T1MA 1IG7A 3PDQA 1FPQA 3SDBA 1PP8F 2VVFA 1U5TA 2JUGA 5KHJA 3WTZA 4M6XA 2B7YA 4UVAA 1G86A 1Y9QA 1I50J 4LBLA 2GMMA 1PNGA 3AG4H 1R49A 4IV3C 1I1SA 2VUCA 2EV0A 2H8RA 5FZDA 5C3QA 3W5NA 5IVEA 4UFMA 3WOGA 1WZ2A 1HXS2 5IFTA 3KWVA 1QIQA 4IOCF 5ISLA 5BNNB 2HYXA 3WGHA 2RS13 4H55A 3HOTA 2QSFX 4XICA 5B4XA 4GO1A 4HQMA 2VH9A 4Y20B 2WFF2 5CVIA 1L7LA 3MV01 1H6YA 2XJRA 4QHZA 1GXPA 1UU4A 3CUQB 2WO7A 4CCMA 5AONA 5FIXA 4ZU5A 3K1MA 2R7VA 4ZS3A 4G7HF 2CL2A 2V09A 3K10A 4DYCA 2R041 4F8AA 2XQXA 1UY3A 5FZCA 5LA9A 5FO7B 1YITI 4K9SA 2WO2A 1VBD3 4OULA 1AYN1 1ZREA 4P55A 2PMZN 1JI6A 1IW7F 5JSOA 5HCFA 4XAEA 4JQRA 1AA7A 2DYSH 3HD8B 5F7UA 1E5RA 3LOBA 3CP8A 3FHNA 3QACA 1S7AA 2CAVA 2HVRA 5F0CA 1K12A 3PJRA 4C0HA 2EV5A 3OMYA 4NROA 4JX0A 4O9GA 5L73A 2C26A 2TEPA 1B72B 4QPWA 5LGUA 4CRQA 2VNRA 3LA3A 2YUEA 2K4JA 4XSZF 2VUAA 4N4OB 4YYOA 4AVPA 4EN8B 1WLDA 2A68F 2EXIA 1JUSA 1PX4A 4X6AJ 3UT0A 5E1RA 4HV6A 1VZ0A 3NNLA 2YU1A 3NNFA 1QA6A 4TN7A 5DAXA 1Y39A 4D7SA 4CZSA 4AQ6A 3HJRA 3NL1A 2H1KA 1AJOA 4M3BA 1SFUA 4I98B 1XU2A 1PJRA 5C7GA 1XOYA 1MACA 4JKKA 1MIJA 4TV7A 1ZZBA 1Z7S2 1GWMA 2DI3A 1UY4A 2CGPA 2XXZA 4IRHA 3GX4X 3ZMDA 2M3AA 4AGVA 1WHUA 1QVUA 4GD4A 4LA3A 2V6EA 4GXLA 2DA4A 5CJ9A 3VHPA 3FXKA 4M0NA 1PYVA 5F6KA 1H0BA 3O1SA 5C8CB 3IRRA 3PUBA 2VQLA 5CYVA 3U4XA 1HXS3 3AFHA 1FTZA 5FWJA 1R1A1 3ZOIA 3MFCA 1OYIA 2D44A 5DM6F 5DABA 4XK4A 2WFF3 2VLAA 3JSOA 3ZCOA 5KR7A 3FWEA 1T2KA 3L2RA 1J75A 4KA4A 4D94A 4XIOA 2CS3A 1YI7A 3I3EA 2Y6GA 1ZRRA 4XL9A 4QB1A 2XGEA 1T0FA 4A3ZA 4KDPA 4HSRA 1EUUA 4XBLA 1OLQA 4K8FA 2GLOA 3SXWA 4MQVA 4GYGA 4AFAA 4ZY9A 1ZRIA 3VBRC 1SD5A 3THPA 4AVZA 1ZBA2 4L92A 2B46X 4XKBA 3RRDA 4GMP1 3TEWA 1VR3A 4INDA 4H0EA 2ISZA 4CXXA 3X29B 1G9DA 1XSRA 2EAAA 5T3NA 3SITA 2P3YA 2LUWA 2HWC1 5C9AA 4U88A 3C7OA 3E6CC 4RGAA 1V6JA 4KT6A 5A3OA 5C9AC 4AYBN 2EICA 4C9YA 3F23A 3UK9A 2XPUA 1BYHA 3P5BA 2WZPP 1WI9A 4NDLA 1W6OA 3ZVXA 2BWAA 5FZ1A 4DXSA 4BISA 4KNCA 5JLXA 4RLFA 2E5ZA 3S6PA 5HCBA 3GZNB 1DQ5A 3V65A 2HR3A 3HUGB 4M01A 5FLHA 1VBA1 3GTKJ 1LEDA 4GWJA 4D7TA 2H94A 1TZOA 3BODA 5BOXA 3D6EA 2YC0A 3E5UA 1GVDA 2NPIA 1ND3C 2LY1A 3AZXA 5FOBB 2KIUA 1BW5A 1LJ9A 3V0AB 2XHNA 1UN1A 5A6ZA 5A6XA 2BVLA 3B00A 3PM1A 4BH9A 4PHZA 3P1IA 2IFRA 2LLKA 5B5EC 3VL8A 1HJFA 3LZZA 4XTMA 3HTUA 5FKBA 1AL21 4BJTA 4FPEA 2LDUA 1MBFA 1Q1HA 4XACA 5D1IA 1W0NA 2PLV1 1VAVA 5IPAA 1OQYA 3SH4A 2RM23 4G3YC 1TBXA 3G71I 1MQTA 2QTWB 1N1TA 4GH4A 5F5IA 3VD4A 1JHHA 4LLGF 1D0YA 5FGMA 1W5TA 5FZLA 4AW7A 1S55A 1QWRA 1UHMA 4PI0A 2PLYA 4AEDA 4L0PA 1Q1VA 4AEDC 1A36A 5DDJ2 2Q0OA 1GZTA 1BJAA 4O61A 2FXAA 2E1MB 5FZHA 1SFKA 2RV9A 4LOSA 2STTA 3OUIA 4YRVA 1WMDA 5E79C 4HW0A 5K5OA 1UXXX 4I6ZA 2UZKA 3HM5A 2IZWA 3U1XA 3BR6A 3N7JA 1W36C 5IK5A 3FXQA 1FNYA 4CCKA 1OKQA 1ORKA 1L0OC 1O3QA 1VQ5I 1V00A 4QDRA 2WO3A 2X4HA 4XHBA 5I91A 1D4M1 2UV1A 4XSXF 4U2AA 2CAUA 1JKRC 3LWCA 3JBG3 2RV8A 3OOUA 3VD9A 3IAPA 3FK7A 4DMIA 2F48A 1I6XA 2JA6J 2IRFG 2ET1A 1CQ9A 4MGYE 2HGCA 3POJA 1POV0 3WP6A 1W6QB 4QWNA 4ARYA 2KHMA 1RUJ1 1BXHA 4LKDA 3C2HA 3FLPA 4FQZA 1NZCA 1UOBA 3CCYA 3IPVA 1N75A 5A1AA 3Q8BA 1H8VA 1YFHA 3P9KA 3KYCB 4OMCA 4NN0A 5FUIA 1IS5A 4QDQA 1F4HA 3OYNA 3QYEA 3I55I 4Q4X1 3A0KA 1G8XA 3WU0A 4M3DA 4E7LA 2H6CA 2IA0A 2VTFA 4MGKE 5JZGA 1NG6A 2QFEA 2ZTNA 4LLLA 1WWYA 2CQNA 2YPJA 1BI2A 2VBBA 3MWMA 4QIWN 2FNAA 2RR12 2PJRB 3FN9A 2DTYA 4ABZA 4AL9A 2Z9OA 3V7CA 2W3JA 1K3IA 2VZ3A 3GLLA 1VAMA 1QRYA 2BNOA 4HF0A 3RCOA 1LQ1A 2Z5UA 5FZOB 2GU9A 2JDKA 2QNKA 3HDDA 4LB6B 1E3PA 2QWWA 3HNMA 4W65A 5EV7A 1W9TA 3ZSKA 5IYCJ 1LOCA 4LULA 5HLIA 4NAMA 2MYSA 2NAZA 5C5UA 1SMYF 3ZPYA 1X50A 5M3FJ 1UCXA 4KH9A 4XORA 4V2VA 3AL0B 2DCKA 3AYAA 4PQQA 5LB6A 3CO2A 3WF2A 4BQ5A 1WCQA 1R1TA 3KZIC 4LJZF 1RB8G 1W9SA 1UO9A 5DDJ3 4Q4V2 2C6SA 2ME0A 2R0HA 1SFOJ 4FPOB 5KK1A 3BTZA 4UAPA 5JI6A 3VBFC 1K5MA 2BZTA 3HEIA 3DTKA 1AR62 3DV8A 4A3CJ 5BS6A 2V7FA 3WTTC 3VZJA 2G0EA 1J83A 3T08A 4Z8BA 2EXHA 1BEV2 6PAXA 3VD5A 5C4WC 3RG0A 4I09A 3PUSA 3GYDA 2WNVA 1VBC3 2J1SA 3MZ8A 2D2WA 3UJOA 2P4WA 1T95A 2QQMA 1XYPA 3GTGJ 4Q4W1 4CU9A 3HHHA 4KGGA 1LOBA 2Y8KA 2GMPA 4BA6A 1KJRA 1JW6A 1H0MA 1XNAA 3A7QA 1SEFA 3FHQA 3M07A 3AP5A 2ZEXA 2HOAA 2QLZA 5DYMA 3URFA 4LFUA 2GIZA 3VBHA 4RFT0 1KD7A 4XEZA 2VC0A 4B48A 3BU0A 3VBHC 5D8KB 3WD5A 2WT0A 3LQQA 2ZNZA 1L7RA 3ZPLA 3OUJA 3NWSA 5DCMA 4KMQA 4I0AA 1SD7A 1LGBA 3P9CA 2W94A 2ZXJA 3PVOA 3G4SI 1LCLA 4M6YA 2CDPA 5CFCB 2B42B 3E1F1 1YQCA 2RR13 3PIJA 2M7BA 4KU7A 4HV5A 3WQ7A 3WCSA 1W6MB 5ABJC 4XLAA 5IK7A 4W1UA 5BPDA 2JN6A 1JJ6C 4A5MA 1W8UA 1YLFA 3T2TA 2L3DA 2BEOA 3TMOA 4DJAA 2KZVA 3K7AJ 1IJWC 1ZN2A 1XGMA 4E7JA 3I3DA 3ZSLA 2B9VA 1FAYA 2DOAA 2NVYJ 3FBNB 1DQ2A 2RS11 2I07B 3JRBA 1BN5A 5EQUA 3WXPA 3KM5A 3H9AA 3OYKA 4AAPA 3POEA 4Q4V3 1RPWA 4LO6B 4XILA 3LA2A 2LBFB 4Y13A 4QD2A 2FF4A 3SCHA 4LBJA 1AR63 2Z5WA 3RJPA 1H9GA 3WUDA 4KWJA 3LE0A 1DGLA 2L9LA 1O59A 3TOAA 1IS4A 1QNTA 2RQQA 2DCZA 5E18F 4BQ4A 4JRLA 3TB0A 1UMQA 1BEV3 5CKMA 4FQGA 1ETVA 3CDZB 4DYQA 3AP7A 5FJKA 5GKAC 4AIJA 4C91A 1VBD1 3WGGA 2C9KA 3S1MJ 3OSDA 4RBOA 4QKNA 1JBCA 3PVBB 4CU6A 3HT2A 5TJJA 2JG9C 2Q8KA 4ZYEA 3V7SA 4NHKA 3OGGA 1MBEA 5CVVA 5EFUA 1FYMA 2AC1A 3CIHA 1VTNC 2AXLA 1N3OA 5GZGA 5FKMA 5GPCA 1W04A 1QY4A 3DQVC 1ZR2A 4CZCA 2DN0A 3WV6A 2MNGA 1H8AC 2CWMA 4II2A 4EJTA 1T98A 5JR7B 1X2NA 1MS5A 1W2OA 2HEWF 1CZVA 3LOCA 1RRJA 4K40A 1UIKA 4FCYA 2VASA 3P5JA 3JB4C 5GM0A 4YFKF 1J1TA 4MUVA 2W1UA 5JXGA 2BXZA 5L7OB 1QQIA 2R5YA 3N9OA 3S57A 4I2OA 4CO8A 3WNKA 1OF4A 1T8IA 4YW1A 3ZXGA 1F9NA 2JDAA 5D8AB 3SZGA 3OGJA 4OI1A 4B29A 1RJ7A 1IS6A 2EZHA 4CEYC 2VOXA 3S2WA 3H3ZA 5IHRA 3RZZA 1HXS1 2WJSA 3O8GA 4XABA 4HBNA 4RGSA 4CPBD 4LMFA 1WI3A 3A0NA 2XLFA 4XMAA 1D1BA 2WFF1 2B9UA 1OPMA 1LTEA 1MEC2 2HNHA 3CMGA 5E89A 4AYUA 1TWCJ 1I9RA 1X33A 3CP2A 1NYWA 2K9LA 2ES3A 4LBQB 1U5TB 1LE8B 4NC8A 2Y6LA 4CSWA 3ZFFB 4N90A 1CQTA 2XGDA 5E8GA 4GGGA 3POBA 1X3ZB 4NPMA 4CA9A 3K4AA 3NAPB 1YFUA 2WRAA 3HBZA 2XUMA 3QAHA 2QQOA 3KGZA 1DU3D 1VIWB 3CJNA 1M4WA 5LK7B 4K8RB 5LFAA 3OYIA 1KGSA 2X85A 1RUE2 4LBMA 1RNLA 3HOVJ 5FROA 1ULPA 4R4ZA 3ENRA 1R1UA 2HTJA 1XE7A 4PFPA 5CG8A 3NJVA 3HXLA 2WR9A 1DGWA 1ZTRA 1J9IA 3RQ0A 5FOJB 4YG2F 3PNVA 3IH2A 4DUWA 5LW9A 1H9WA 2IS6A 3PO2J 2E63A 1Y9GA 3A21A 1HQCA 4L18B 1R092 4BE2A 4DNYA 3POGA 5FLMJ 4LUMA 4YRDA 4FO9A 3TO6A 2DF7A 1FOYA 3OL4A 4RS5C 4Y24A 5IT9K 4TTGA 2BRTA 4QHOA 4L9NA 4C1WA 3SEPA 2EIJH 4CXYA 1YW8A 1XQNA 3EYIA 2YBSA 3ULQB 4D7YA 3V7RA 2H6BA 1G9BA 1Q5OA 4IRGA 5CBLA 5A80A 4G6TB 4AEMA 2PXJA 1XTAA 3KF5A 2Q8DA 1Y1WJ 4GWMA 2XVGA 2GOXB 5IYBJ 1SANA 5FLXK 1XMXA 4HLTA 1DG6A 1YCIA 3RMXA 3ZXKA 3DKYA 1W05A 4LEJA 4UXAA 2QQLA 2FOWA 2RAEA 4PJJA 3K4CA 2VQ0A 1XB4A 2VBXA 2VI6A 3VHOA 4GWIA 4KN4X 4MV2A 1GHCA 4XUQA 2DTRA 2R7DA 2D3SA 5B1AH 1GOFA 1S0DA 4AHZA 4HZFA 2BNNA 1ZRDA 2RM21 4IXAA 4OYUA 2WBMA 1XPXA 4XJAA 3NRUA 1YYNA 2CWSA 1XBFA 1VF9A 1MEC3 1KGYA 5DV5A 2OX0A 3SLIA 3WNMA 2VBDA 2RKHA 1QBJA 4NNJA 2XUEA 4PJ0C 2EPFA 3BTXA 4W6XA 5FFZA 5CKNA 1B35C 4WM7B 4LG0B 4OIOF 4I3GA 1P7IA 2WYSA 2JJ7A 4KICA 3L2CA 5CIRA 1WZXA 4NMIA 1NXD1 1TQ5A 2WSVA 4P9JA 1REDA 4EN9B 1CESA 1LDJA 4HA8A 2VJ5A 2DJIA 2YZ4A 4DXZA 4LTAA 1D2SA 2CUJA 5BNOB 1S1AA 1XJAA 5J36A 4XDQA 2PHTA 4K6BA 1OOPC 1CPNA 3ZR5A 3QWLA 4BQWA 2X0LA 3T0YA 2DFFA 4WBBA 4ANJA 1RUE3 4P9XA 1A3KA 2RE9A 4YVWC 3QH7A 3OIOA 3JBG1 2X48A 1SBDA 4QPYA 3S17J 4LLNA 4B8XA 3MEXA 3LDBA 2F5VA 1DGRN 4QPQA 2DUPA 3DXUA 4IZZA 5FYMA 1R093 2K4BA 4XFHA 5HXMA 5JIUA 2Y9YA 1YI9A 4RB1A 2JA5J 4BQYA 2QDNA 2P3IA 1FP2A 2CYFA 3I2FA 4TWTA 3PTYA 3OD0A 2OIIA 4DZGA 3CDHA 1RUH2 3SCGA 5E17F 1ETWA 1UL9A 1TC3C 2CQQA 4ZC3A 4A3FJ 3OBTA 4BQQA 5D6EA 1R9TJ 5GJ6A 4FOQA 3D5LA 3HOYJ 4IXLA 4L11A 3ZR8X 2HWF1 5JWPA 1JE8A 4QQLA 3H1WA 1OQ1A 2O0OA 1OH3A 3DLLF 2IGKA 4XMYA 4XRSG 4XRFA 2V4JC 5FYCA 1F1ZA 2QQPA 1RUG2 2QQIA 4RQPC 3CMAI 5IVVA 1SC7A 1E5SA 2OUJA 2YV8A 1I6HJ 3R4KA 4DBQA 2G9WA 2IEKA 2Y31A 4A7YA 2AO9A 5FB2A 4M3CB 1IV8A 3NO8A 4D5CA 5FXWA 4Y15A 4DO0A 2O9LA 1VLNA 2RMU2 2O8QA 1E17A 1G3TA 1DU6A 4QU1A 2XB6C 1E57A 1V5EA 4CDXC 4UHTA 3UNGC 5GAGJ 4LK0F 5BY5A 3L2WA 1NH3A 3KHCA 1DLLA 2X05A 4P9LA 3IRQA 4OCTA 5DDJ1 3OJBA 3I3BA 4CDUC 2ZGKA 4DIQA 2HPIA 4RDUA 3T8TA 2CV2A 1W28A 2VZUA 5IYDJ 3S1NJ 3CUOA 2MPFA 3HZJA 1FYUA 4Y22B 1FT9A 3HRSA 4R9BA 3LNQA 5C8WA 3J4UH 1VBC1 3OSFA 1XSVA 4DS0A 2A73B 4C3HJ 3R0AA 2R1DA 4ZXEA 1HW5A 4ONUA 2OCEA 2AHQA 5EJ1B 4I3PA 4LR4A 3E97A 2IP2A 4G6DA 4WX9A 4IEWA 4XKCA 4AR2A 5J09A 4O5VA 4Q5SF 3RJRA 5DS9A 2E33A 3TW6A 2VVDA 4XUOA 3H8OA 4IEJA 2L7MP 1S5LC 1IHMA 3VB9A 1TP4A 2M0MA 2W1OA 1IOAA 2GP3A 3GFJA 3UKGA 1U3EM 2E7WA 2JE9A 3ZSEA 2E6VA 4JGYA 1QEXA 1RUH3 1ZKGA 2PA7A 4JGYC 2UUZA 1RUD3 3QBQA 2LTNA 5GTIC 3ZXJA 3BZKA 4XIDA 3FUOA 1Y8QB 4E27A 3GTQJ 4F92B 1OCOH 1WKYA 4IEZA 1F9KA 2RR11 3HOWJ 1IGNA 5IFPA 2VQAA 4G12A 5B1BH 3HAGA 5FKNA 3QRFF 4WZCA 3HWJA 3LGRA 4U36A 3ZN6A 1LOAA 3O6BB 4X6QB 5KXEA 2VJXA 1ZM1A 1X1DA 2WADA 2RMU3 1HA8A 2XPVA 2DA3A 3N36A 5JVGF 1BOAA 5CU1A 5DAWA 3LSMA 3B3QE 2L9RA 2ZXWH 1HB3A 1RHI3 2MHFA 2VCAA 3OOPA 2EWNA 2R92J 2LY9A 1LVAA 1WD4A 2WNUA 3VBSA 4NIHA 2UXXA 5HDNA 5BUVA 2DA7A 5FPVA 2NOJB 2WNUC 2IC1A 1Q56A 2X8KA 2YC4A 1PZ8A 2L02A 1UKRA 2HOTA 1ZH5A 1AR61 4URAA 1JGSA 4L5JA 1FBSA 5JVTA 4KT5C 4C0BA 3T1LA 2VY0A 4A4AA 4FCAA 1BEV1 2OD5A 4BLIA 4K2EA 3V8KA 1W5SA 4QTRA 2DK8A 4UF0A 1H2NA 4P1WA 4CPBA 1J1LA 1YJNI 5CLSA 2CGOA 4Y7NJ 4EJVA 2Y6JA 2XKPA 5E1WA 4ZDOA 3QU6A 5EGOA 1WJBA 3K6GA 2D5FA 2UWAA 3V0BB 5L3GA 2IS1A 3RI4A 5DAVA 1ZGJA 2P8TA 3S14J 2XJTA 2QUFA 4QGMA 3F9KA 3UGGA 4WM8A 3V8LA 3TRSB 2VBPA 3A03A 3CMYA 3OYCA 4IE5A 4XRSA 4B43A 1FPN2 4CHUA 4OHZA 2CRGA 3I49A 1BW6A 4IEYA 5K7PA 4D8MA 3GTMJ 4P9YA 1Y3TA 2ORZA 3MEPA 3PL0A 3N7MA 4QXKA 4IO9F 2VODA 4RL7A 3M1CA 2ZX1A 3K3NA 1LOFA 4JX4A 4DRRA 2EFPA 1D0ZA 1A8DA 1LOFC 3K4MA 1VRH3 4DXTA 1UIJA 3LB9A 3WQ1A 4N8MA 3FM3A 1RMU3 2PHRA 3ZRGA 2WDBA 4JYKA 4Q0PA 2FCVA 1R00A 5J37A 2H09A 2Y0SN 4HOBA 1BLZA 1HCRA 4HYEA 2JDNA 5IAVA 4GZ9A 5FZFA 4L9VA 2XKOA 1ULGA 1SZBA 4JVAA 2XJPA 1QZZA 3FFZA 3PIOF 3NV4A 4UVBA 5JMOA 4Q1RA 3VDDA 4EN7B 2KD7A 2BVMA 4E2QA 3VDDC 1GP4A 2BFUS 1Z0HA 2RJ2A 1W99A 4CCLA 1ON1A 3T2PA 2P3JA 4LGWA 4Q27A 1O4YA 2IVJA 2M30A 2JVHA 4EGYA 4YGCA 3ZMVA 3D8CA 1W0PA 2RG4A 3CCQI 4CZZA 3WDYA 2YYOA 4BK4A 1ULYA 1RUI2 2WTEA 3ZKYA 2VMEA 4KBBA 2XONA 2YG0A 3AYEA 3ABKH 3H0DA 1WLTA 2YPRA 3MUY1 1CX4A 1BIAA 1KFXL 3FXUA 3PVNA 3EXUA 3OWTA 3ECQA 2XWBB 5F0FA 4P00B 1YJKA 3BB6A 1GNYA 5I0DA 2V1DA 2LKXA 5EG0B 1PX3A 5LBBA 1JT0A 2OCCH 3FMRA 4CEWC 4PF1A 3F8FA 3OY8A 4PLMA 2CUEA 3AZZA 2R0FA 1KU2A 1LUJB 4JDMA 4CGZA 5A3LA 1Z05A 1FPN3 2VKHA 2M4KA 4N9IA 5ANQA 2DYCA 2JD4A 4GCVA 5K5QA 1SQ4A 1BOBA 3NAUA 5A32A 4RGGA 4MHUA 2DV9A 4LOTA 4Q0UA 3GFMA 3BDDA 1D7PM 5HBAA 3HSFA 1Y9MA 4YARA 4XQFA 2A6ZA 3JRDA 4MLOA 4KQ7A 5FRAA 1LNWA 3F95A 5ICFA 1BI0A 4DUVA 2WWUA 4Q47A 4M3CE 2VOPA 3BR0A 4K1ZA 4QXHA 1J3PA 3C18A 5HLHA 3I59A 2JDHA 4M74A 4JK1X 4HDUA 3LPGA 3QP6A 1JHNA 1USTA 4UW4A 4MHRA 3MLJA 5C3SA 5FJHA 4LPLA 3IN9A 2PMWB 3JCUC 4ASLA 4JTNA 2CV0A 4A2UA 3I2KA 2ECBA 4DOZA 3CJIC 4FFFA 4YW6A 5IAXA 3NNMA 2Y2ZA 2LR8A 1OSGA 1PGSA 2KDZA 1IPSA 2QKDA 2H1LA 1MEC1 1MDMB 4YFZA 4R9DA 3SMHA 1SFEA 2DFCA 2WSUA 3AFGA 2BNMA 2ZGQA 2VQHA 5FYIA 2RC4A 2F4LA 2DFBA 2GZWA 3AMNA 2JG8B 1PUFA 2HVQA 1JKQC 1UYZA 2ZMEA 2DXIA 4ZDLA 3USUA 2RNJA 3BCWA 4QX0A 3OPZA 2ZMEC 4RAGA 4KISA 4PT6A 5I0SA 2VOTA 3I5UA 4UFLA 2KPMA 2DURA 2FDHA 3WDVA 1AWCA 4FPHA 3O1PA 2PAEA 1I5ZA 4NHYA 3WNLA 2LOOA 3RZGA 1RUI3 1YUDA 2ZHKA 1ON2A 2HXOA 2NMOA 3AZVA 4ES8A 3HVDA 2PYTA 2GQQA 1PGW1 3CEWA 4XQWA 1UXZA 1YJLA 5JFRA 2FDKA 3WDTA 1ENSA 3DPRB 5LGNA 2I8DA 5BPIA 3NV2A 1IV6A 2XROA 4IV1A 4BHCA 2HKOA 1AX1A 4F7ZA 3ZFEC 4IV1C 4YWAA 2BJSA 2HDCA 1NA1B 1FMWA 4BQ1A 2VMDA 4JX6A 2ZGOA 3JR9A 3CC7I 4Q4ZF 1PGL2 2KJCA 4AQ2A 2JA8J 1TT5B 4ISRA 1RKWA 4PLNA 1IRXA 5L9BA 4A7KA 1W8HA 4G94A 4ZZLA 3R4SA 1ULFA 2Z4FA 2ARAA 5LRRA 3MZHA 4BJ6C 3MKLA 4L0ZB 4C8DA 1OXCA 3KT7A 1ZAOA 4QT6A 2OC6A 3K2ZA 3ZXDA 1D0XA 5KXDA 5F64A 2WWSA 5E3NA 4I0WB 1J5YA 3RKYA 2QGUA 2DVAA 4P9WA 5EXOA 3K51A 5GP9A 3ZDSA 1EUTA 5D2AA 1JZ7A 2VE8A 2BW3B 2WYFA 4FFHA 1Q8SA 5M0TA 5ACA2 1YFWA 3ZFGB 2Y6KA 4IHXA 3I3MA 3J81K 1ZA4A 2OQGA 4CCOA 5T5JA 1BHGA 1XMKA 1GANA 2O14A 3KP7A 1QJX3 2C1FA 2DT5A 3AYDA 1UY2A 1LECA 2KRCA 3E6DA 1H4GA 2PQ8A 2IXSA 5A3NA 5M5XJ 4N43B 1R58A 4E7HA 1WUVA 2GC1A 2QBYB 1R64A 4Z2YA 3LQCA 3S8PA 1AR81 3S5AA 4CTEA 4HN0A 1X3UA 2B7EA 3DXTA 2FEZA 3GWZA 2O8KA 2ZGTA 1GFF2 4RM2A 3MBWA 4AIHA 2FX0A 4OINF 5LA2A 1HQWA 1JYNA 2PHLA 3H1YA 4BXSV 1LB2A 4YFXF 4IF4A 4A3MJ 3P6BA 3MW4A 4BNCA 2WT2A 3KCXA 4E4SA 4XJ8A 5EYYA 3L1PA 4MGTA 1KS4A 4WVMA 3O12A 4CCJA 1N1VA 1JS9A 2DTZA 3I0TA 3KFWX 4PDKA 1K61A 3K75B 4OZOA 3A1YA 3ABLH 1HRI2 2VZTA 3OF1A 4GKYA 5GLWA 3VZLA 3CMEI 3DYPA 2RDQA 2R93J 2IS2A 4X8PA 1OA3A 2CSGA 2WS92 2JB8A 5JHFA 4R1HA 2IWGB 2VGDA 1RESA 3IAQA 4FOVA 3HPHA 1TQIA 2OAZA 1FV2A 4LORA 2IAIA 2WUHA 5FYSA 1RUH1 1LODA 4UV9A 2O3FA 5EJCA 4OLLA 1RUD1 4Y4YA 2X9DA 3OYDA 3COAC 1AX2A 3VSKA 3BP8A 1ITYA 4MGIE 4FAHA 2IS4A 1QU3A 4XTPA 4BOWA 4HG6B 5BNNA 5IVCA 3NARA 1K78B 2RS32 4QX1A 3ISPA 4ZXKA 2E36A 3INAA 3LL7A 5JLVA 2JZYA 5BNNC 2EFQA 3PLQA 4CDQC 4Y20A 3SC7X 4UY8I 3EUHA 1JOJA 4DW6A 5APAA 2VPLA 1TLHB 3EUHC 4RGKA 3LQRA 3CUQA 4CH7A 4FPGA 1XD7A 4LLFA 5ACA3 3PUAA 1H30A 4AEKA 2HWE1 2E5NA 4ETSA 3SYTA 2XOMA 4CCCA 1L3JA 4IV3B 3J80K 4K7JA 3BT9A 4CYCB 1QH7A 1EH6A 4O3MA 3EMRA 2RMU1 3C7GA 2XUBA 3VBUC 1S0GA 5DZGA 2HKXA 4BHPA 1KFUL 2JWPA 3WU1B 4PIZA 4RAZA 1RYYA 1ZG5A 1E3OC 4PCRA 4IE6A 4ZZ8A 1RHI1 3DU5A 4LO7A 4X6RB 2OQRA 3FFQA 3A01B 4P02B 2WAAA 3T2OA 1NQDA 5FFOC 3CTAA 2BU9A 1XMAA 2A6TA 4HNTA 2YS9A 4QWQA 3M3EA 3WODF 2VE1A 5I8SA 2V9KA 1MZFA 4EEFG 2DFHA 1MSFC 1FEXA 3DBLB 5JXIA 4M3EA 3JTGA 2BHZA 1B72A 2WBKA 2JT1A 3RZKA 3G3ZA 1SD4A 3R61A 4ZONA 1XE8A 3IM0A 5FZ9A 1U12A 1OLTA 3JRGA 1R4NB 3QH6A 3C2GA 3LAPA 1ETYA 3WVJA 4LT5A 2DQRA 1OBNA 4BQ2A 2VQUA 5T5LA 4XR6A 5HCHA 1UW8A 2DBIA 5FP7A 5T50A 3ACFA 1HRI3 2LRPA 1DDLA 2D5VA 4AHWA 5J3UA 4MNUA 1SVOA 4ATEA 2J1EA 4UUTA 2WS93 3QOEA 2IUWA 1S2EA 3KCYA 3FZVA 2FE3A 5JDBA 1G59A 1KITA 4B7KA 2VCBA 5FYVA 5JR3A 5IATA 1UMIA 5SV5A 4PSXA 5C8CA 4COUA 1PIV2 2GAUA 3HYIA 3OOXA 3GZ6A 1R6RA 2X1DA 5F3CA 5C8CC 2ESNA 3OYJA 3ACIA 2R7ZJ 2R49A 3PMEA 1UOFA 2HEVF 1LU1A 1UELB 1D8JA 4QKFA 3HOZJ 2RS33 3MD2A 4URTA 2IPQX 1VRH1 1NK2P 1FX5A 5K4LA 1K42A 5CYYA 1UHWA 1RMU1 4HLYA 5I8TA 3C8XA 2A07F 4V2WA 4AIKA 2Y38A 2FUG2 1S6LA 2GXAA 2A70A 1FXZA 1BC8C 5GLUA 2JICA 4CXFA 3MCZA 1F35A 2HXIA 2Z99A 3AKQA 3OBAA 1U2WA 3M8LA 1W8WA 1US2A 3L00A 1QOOA 4KBZA 4LHKA 3WDWA 1BA5A 4AXOA 4MFEA 1CAVB 4XHXA 1UZ0A 5A7NA 4E2SA 2LMDA 3EQEA 5L3BA 2NVXJ 5TSWA 1VMJA 4MXWB 1EF4A 5CQEA 3GGLA 3SQOA 1FOD1 4XC9A 3HOUJ 2K40A 5ILVA 3W2AA 3T1BA 5JCTA 4LIVA 1XG1A 4JKMA 4XJUA 3E7LA 2K46A 3A0HC 1LHWA 2BVVA 4E8CA 4DFSA 1R5HA 4RR3C 3CC4I 4IKFA 3MMYB 3M2MA 5TISC 1HDPA 5A3MA 3M7GA 2IT0A 2IVMA 3JW4A 2BOIA 3VBRB 3NMBA 4XONA 3WNNA 1J58A 2DQLA 4E2GA 3HUGA 1Y0UA 4UVCA 3NQOA 2X5IB 4IPAA 4XBFA 1YEWA 4KG0A 2WB1N 1UU6A 1UZWA 5IK4A 2E2IJ 3JRCA 2ZXIA 3OG2A 4IL7A 2HU9A 1X8EA 2BWCA 3BIWE 4O6JA 4DOUA 4UFKA 5FZMA 5IT6A 3V0AA 1QJZA 1NQJA 1NLQA 4E4HA 4AQTA 4BJ5C 2IBDA 3DXJF 3LDRA 4QPGC 5K7ZA 4HLXA 4A3JJ 4LBQD 4BGDA 1V5FA 1YS7A 1FPN1 4OHXA 3CCVI 4DBRA 4OHWA 3WG4A 4L5EA 1PIV3 1R4MB 1UMZA 2IGNA 3FIWA 1W9WA 5EZWA 4BLJA 1OR7C 4DNCA 1IRGA 5DDGA 3Q9VA 3AYCA 3QPSA 5A3TA 1S3JA 1KYWA 4B1RA 1QMJA 2W57A 3NKGA 1QJU2 4YSFA 1ND3B 5L3DA 5KVRA 5BNPB 1FYLA 3I54A 3VEPA 2DDBA 4JHTA 5B2GB 4DPNA 2WN2A 4CXWA 4ARXA 2HS5A 2O03A 5DG2A 2HYFA 1Q8PA 2NNYA 1IN6A 4A12A 1MNEA 2FHRA 3ABZA 5LK5A 2A5WA 1LEAA 2K9NA 3TAYA 4CP0A 3VUOA 1IG0A 5K9YA 2E1MC 2ZEYA 2V72A 5DEQA 2AR6A 1W8ZA 4BPZA 1EAH3 2KT0A 2P17A 4JRAA 2F5FA 1WLWA 4B1MA 2YGMA 3GHNA 3BJOA 2PMUA 1XS9A 4FOYA 3KV5A 1Z6TA 5J4YA 4BXXJ 3BZ6A 3O14A 3BKZA 1I1GA 2JA7J 1JYCA 1TW2A 1MZBA 1OLME 1KXGA 3MF9A 5KBFA 1GZ9A 1NLRA 4ITCA 5AC92 1W6QA 4FQ4A 2XF5A 2BY1A 2OW4A 2VQCA 2ELKA 5L9VA 4MZUA 1DFQA 4A41A 1RUI1 1L3LA 4ZYHA 4RM3A 2P6SA 1G9FA 1GBGA 1LHUA 1NY71 3ZXAC 2EIDA 3G6EI 3C1DA 4Z2WA 3G6JB 1HN1A 1ZBE2 3ERMA 4UUVA 3LF7A 1QOTA 1DIWA 1FSEA 2JWTA 3CKHA 4QHBA 1HW2A 3U07A 2EK5A 2PTMA 3FISA 1JHFA 4S05A 1WSUA 2QQWA 4B47A 1QGLA 4XBQA 4XW3A 2BBAA 1PHMA 2VW2A 4KMFA 2P34A 1JKOC 2E9QA 3WQ0A 3S0MA 3T2QA 2PJRA 1QGPA 4FE4A 2R063 2CQ7A 1Z67A 5LY1A 3O2PE 1KQRA 2ZGPA 2G7HA 1EP0A 1CAXB 5FKOA 5C3OA 5FZOA 3L2UA 3S1RJ 3ACGA 2UWBA 3NKTA 1MMDA 5KHDA 1LESA 1H88C 1QJU3 4QPIB 1WCDJ 2X1CA 2ARCA 1S0EA 3QYFA 1P92A 3B94A 1OURA 1LPQA 5GAHJ 2XAQA 3F8MA 4QMAA 2EIGA 1CIWA 3DU6A 1W90A 3GCWA 3KPHA 1LU2A 2EA2A 2JVGA 3AL0C 1VBE2 2ETEA 2I2SA 2NYXA 3S16J 4J1XA 4COWA 4HKWA 2XAFA 3O0XA 1FBUA 2Y60A 1YC61 3QQAA 5F3IA 4E70A 2B9SA 1JOPA 4N7IA 1XX5A 1ND2C 3EJKA 3H42B 2OQ6A 2QEXI 3QPHA 2O7OA 4GJYA 1U5XA 3WHUA 1QJX1 1JYWA 2GNTA 4HONA 2GC3A 2BV6A 1GKBA 5L9RA 5A7WB 5C44J 5F5QA 4EM1A 1MMSA 3J7LA 3Q8FA 2RGVA 3ABUA 3BYWA 2NMNA 5IVJA 5ERIA 3WTXC 4L0YB 1U5YA 4M9SA 3C3VA 5AC93 2VO5A 1UHSA 4NIDA 1FMD2 2A6VA 3IMMA 1UZYA 1FIPA 3JTHA 2OZJA 4OU0A 3N9MA 3MYXA 3ILNA 5I93A 3G7DA 2GA1A 3H36A 1XDUA 1Z7UA 1Z3XA 3PJQA 2D3PA 4EM0B 2R072 3DFGA 4AWDA 1ZBE3 3DP7A 4IW3A 4QPOA 2K27A 2EQRA 3GXUA 1CX1A 3ST7A 4RS8A 4KN7X 2W46A 1QQP2 5HS9A 1MBJA 2D3RA 4SLIA 3WNPA 2MSYA 1PGL1 4DQAA 3L2HA 1HKTA 3GUDA 2XJVA 5CFCC 2EIEA 4JDNA 3IH3A 5FLJA 3U37A 5F2WA 5A1LA 1UAAA 4EJOA 1R1ZA 1XGSA 1VQOI 4YZ1A 2H0BA 1TME2 1FLIA 2KRHA 1C3HA 4AAXA 1DZQA 3SKVA 3ZMTA 1UX7A 4BQ3A 4XVHA 3SHFA 1JZ4A 1IF1A 4D3WA 3OR1C 3DTIA 1YJWI 3WP3A 3Q5FA 1AL0G 2WZEA 3HT1A 1O7LA 2XSDC 4XFFA 3WQBA 3ONQA 2HOSA 5LRSA 1TL8A 1WJEA 2ZGMA 4EQQA 2XJQA 2YMZA 4YLZA 4PK4A 2EINH 1W6PB 3IV5A 3FXOA 5ICEA 1VBE3 3B01A 1WCUA 5ABJB 5GLVA 3RS6A 1VP6A 1LGNA 1Q8VA 3BOQA 2LBFA 1YG2A 2GNBA 3WLUA 2X6WA 5ACA1 1H1MA 1MS0A 1QH6A 1VJ2A 4JCKA 4TXWA 3J8F2 1V54H 2DCEA 2BGPA 2Y0OA 3TEZA 2QKMB 1GDTA 5LBFA 1EPWA 5FQ0B 3IKWA 2VKDA 3U10A 2YU2A 1UFMA 5HS8A 2P5KA 4H3WA 3RMYA 3S3MA 5FMCA 2XC7A 3KMHA 2DT6A 4A44A 3H3VK 1H89C 1JYVA 1K7AA 2A5YB 5D21A 1P7JA 1NCQA 2WAEA 4EV0A 2NLRA 3MLKA 1ULEA 2WZR2 4NB5A 1WMFA 2Z79A 3BR1A 2VZSA 4WXHA 1DYKA 1UKGA 3VDCA 3ZQLA 1ERDA 2WA0A 1OKOA 4FX0A 4A3XA 3UGFA 1V6IA 3OS0A 3KP5A 1EY2A 3L2QA 3K4LA 1W8NA 3PVEA 5JOWA 4IEUA 2W1SA 3K4KA 3K46A 4PJNA 2R073 4P9FA 4EWAA 2V6CA 2R5ZB 5F37A 3LEKA 4MSVA 2V5YA 2JG9B 1WQ2A 5D5UB 3WSOA 1LHNA 4ZJZA 4XOGA 1PZ9A 1QQP3 1H6XA 3I58A 1YNAA 1ASJ1 1HRI1 5J48A 2JB4A 3ZXLA 5IVBA 1GLHA 5L7OA 4WK8F 2LSOA 2WS91 4II3A 1T56A 4HQEA 1TME3 5HI0A 1XNKA 5D8AA 2LALA 1ETKA 5D8AC 3WINE 3C7FA 4LMYA 2AACA 1BK0A 3R4DB 4MEXF 2F5DA 3IDCB 3KP3A 2STWA 2EA7A 2OTLI 4WVMB 4PFOA 3LSHA 4FXGB 4IUGA 4V1PA 3H7JA 3JREA 2RS31 1X1AA 3S3NA 5C4JJ 3OS2A 1S8NA 3WG2A 4EVIA 4BACA 4UW5A 1Z91A 1XSDA 2XGCA 1O3RA 2P2KA 3ZQCA 2ZKLA 4LBQA 1LE8A 3ZFFA 4P9UA 3OBZA 1CGPA 4YPJA 2MH9A 3J8F3 1U5TC 3ZFFC 2CFXA 1MS4A 2B4KA 2J22A 1OKRA 2F6CA 4YVSB 1WGPA 3FKIJ 2JDPA 3NAPA 3FKJA 4W8JA 5DZEA 1C1LA 5HLTA 4BXFA 3JCIA 3NAPC 3VZOA 3DCFA 4EWDA 1RINA 2XIGA 2VPVA 4Q4Y2 5FTTC 4B44A 5KHIA 1FWZA 1X9TA 3PNAA 1CF7B 5J3LA 1GWKA 5FZBA 1GSLA 1YTYA 1OF3A 3G73A 3EPZA 4Q0SA 3PQKA 3D1NI 2ZJCA 1ULDA 3I8TA 3CLQA 2KP6A 2KMUA 2RREA 3RGBA 2JIJA 4MTDA 3BJAA 3TP3A 3H35A 1RJ8A 1WJAA 4EE2A 5A1FA 5JUVA 5A33B 2W2IA 1VI0A 4F91B 2A1XA 4XF0A 4CUCA 2LY2A 3BLYA 1DQUA 1AR72 1IC8A 4QX5A 3CJXA 5AFEA 1IPKA 2WWJA 1DYPA 5CAZA 2D6KA 3N7KA 1NX9A 4JOMA 1EJ9A 5K7FA 2ZHMA 3NJZA 2M9HA 5FK8A 3MGUA 2XGXA 2HEYF 4OI2A 1W2NA 3ZR6A 2VBZA 3HC7A 1Y6IA 2L2OA 3JXSA 1JMUB 4QXBA 5FBZA 1X1PA 5JAXA 1UZVA 2MC4A 2LK2A 3OYBA 1Z3YA 4FXKB 2J1VA 1DPRA 1RGSA 5F0HA 1LAJA 3H9GA 2ZHNA 1QZYA 4D7MA 1GLNA 3WNXA 3HJEA 4HX4A 1MR5A 3ZGKA 1DQ0A 1PIV1 1W8OA 1GMMA 4RS5B 3IKVA 3VDAA 5J1RA 1HSJA 3TNQA 1RUNA 4PUSA 1UPSA 1N25A 2BOLA 1GNZA 3HEFA 2Y30A 1BVP1 1DF0A 4X1EA 3KSCA 4AF9A 4XF3A 3OIPA 4YIRX 2PELA 4AVVA 1MNMC 1W9FA 4Q8LA 3ZYHA 5IUQA 4RAYA 1TQPA 1NKGA 2Z1DA 1ODMA 4XCAA 4BMEA 2Z3YA 4WM7A 5J7MA 2HQAA 4LG0A 5A70A 1OPCA 4GDFA 4UB6C 3WR0A 2CO5A 2W47A 5GAEJ 3LOIA 2LF8A 3MIHA 2GALA 3M70A 4AGGA 2BY3A 1QPMA 1AF9A 2ID6A 3IAM2 1I3QJ 2TUNA 1H9PA 4OZXA 1M06G 5BNOA 5GZFA 1IRZA 1O5LA 1EAH1 2FMLA 3H92A 3KQRA 4Q26A 4BDYA 4D1QA 3S1QJ 4Q4Y3 4XQDA 3ALQA 3W59A 2LS6A 1YQAA 5DD4A 2H0VA 3FBIB 3ZXFA 1B35B 4YGDA 1XDSA 1S4CA 1XNBA 4ZS2A 4DEVA 4ZYAA 3QCWA 4UI9L 3CL1A 1MVQA 2SBAA 3HOSA 5JSPA 2JSPA 1PDNC 5FYTA 3F8BA 4R79A 1K45A 2WQ4A 3OEBA 1T0FC 1NG7A 5C71A 3FHZA 3TGNA 1OQDA 5F27A 1GUUA 1C5HA 1AR73 5A6YA 2J1AA 2WABA 1TTYA 2GH8A 1OOPB 4E8DA 4ZTJA 4BU2A 2WAFA 2L4AA 2R7QA 3B6CA 5FXVA 1HQNA 2CHHA <