1LB2A

Structure of the e. coli alpha c-terminal domain of rna polymerase in complex with cap and dna
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
201
structure length
201
Chain Sequence
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*CP*TP*TP*TP*TP*TP*TP*CP*CP*TP*AP*AP*AP*AP*TP*GP*TP*GP*
publication title Structural basis of transcription activation: the CAP-alpha CTD-DNA complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 61
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2002-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1lb2A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lb2A01
5DYMA 2PQ8A 4HVRA 2EV6A 1FXZA 4HDVA 2Q8KA 3PLQA 1ZRFA 4E2SA 4Q0UA 3E5XA 2QJVA 4R8HA 3RDIA 1P4XA 5F1RA 2PEXA 2ETHA 2HFHA 2JTVA 4KYWA 2V1XA 3BP8A 4XFGA 3LAPA 3LFKA 5HDKA 2JRTA 3ZN0A 4D7TA 2B8MA 5ICFA 1O57A 1LDDA 1YIOA 4WWCA 1EH8A 1ZAOA 1L3LA 3JW4A 4HZFA 3K1PA 1GXPA 1YG2A 1R1TA 3FXUA 1O7LA 1J3PA 3E5QA 1BIAA 5DEQA 2LF8A 3EYYA 1MJ9A 5FDBA 3MDPA 3V8KA 2FBKA 4MGIE 3WE3A 5FPXA 4I0BA 3WTWC 1MDMA 1WLTA 2QVOA 4U7DA 1OD5A 3UKNA 2VE8A 2Z99A 5HVQC 4MZUA 4OLLA 4L9JA 1K79A 3FJSA 3SXYA 2H94A 1YLLA 2QUFA 3C7JA 2EV0A 4LLOA 4QM8A 2A68F 2HKOA 3BJOA 5CVVA 5D6FA 2VBYA 3P7NA 2P7VB 3L2HA 3F8FA 2P7CB 4MQ9F 3TQNA 4ZYGA 3ZMVA 1USTA 5K1YA 3MWMA 3RZZA 5LBQA 2EFOA 4TLFA 3GFMA 1Q5OA 3TKYA 4R1HA 3Q5FA 1KA8A 4RGRA 5FFXA 3ZMUA 2UZKA 1FBSA 3ULQB 3WU0A 3M7GA 4Q0SA 4IF4A 2PA7A 2VE9A 1OFNA 1O3RA 1J75A 4Y17A 3V7SA 2O3FA 1FSHA 1YS6A 1WWXA 1NE6A 3BB6A 2FSWA 3CUQA 4ZYHA 3OCPA 2HS5A 4HN0A 4IEWA 4XEZA 3QPTA 5HI0A 3S7IA 2NS0A 1YTYA 3EBRA 1RI7A 3KP7A 2PAMA 4I0AA 3WTZA 3W6KB 2EFWA 1QZYA 2HKXA 4KNYA 4UXAA 1JGSA 3LAJA 2D93A 1V4RA 1F9NA 4A6EA 3E6BA 2GXGA 4M6XA 4BH9A 1ZZCA 4KL1A 4MX3A 4RGXA 3I71A 3U9GA 2HZTA 4J1WA 5JCTA 2BBYA 3J7AO 2P8TA 5L3CA 5KK1A 4LG0A 4JBAA 3NEUA 1W5SA 5E20A 1FBQA 3KEOA 4HBNA 1KYZA 3F8MA 5AIPA 2XRNA 2GZWA 4A6DA 4BNCA 3FM3A 4YFNF 2H0VA 1YYVA 3RYPA 4BQAA 2DU9A 3FMRA 2FBIA 4MGYE 1OKRA 4LB6B 2OAZA 1H9GA 1UIJA 4META 3CUQC 5KHGA 3KZZA 1NYWA 1S7AA 2EWNA 3M1EA 1TNTA 1PP8F 1O5UA 1IW7F 3N97A 1ZLJA 3KP5A 3M8FA 3H50A 2KJCA 2STTA 1G3YA 1SMYF 3BJAA 2K9ZA 2JSCA 3IDBB 1EY2A 3RYKA 3KLNA 3MFKA 1T6SA 2IJLA 2F5FA 5AVPA 3CO7C 5JR7B 4EM1A 3IIAA 2GC3A 3D0SA 4G94A 1W5TA 4UVCA 1JUHA 2NYXA 3P9CA 4IEXA 4EVIA 4HA8A 3C1DA 3E3VA 4AWXB 3VHRA 1ZN2A 5D1IA 3NL1A 2HYGD 3FM5A 2XLAA 1RC6A 1KU2A 2VT2A 3DV8A 2IW5A 1O7FA 4IJAA 5HOOA 1H1IA 2ISYA 4EWEA 4JK1X 2BGCA 5D4SA 5HDNA 4KICA 2IXLA 1R58A 2OU2A 2NNNA 1G3WA 3LOIA 3SHFA 2ADUA 3NQOA 5FLXZ 2ET1A 3ELKA 3HSEA 5HDGA 1D5VA 2V09A 5J48A 2JZYA 5A2QK 5ED4A 1LEAA 2XAFA 3VB2A 2ZO4A 2M1BA 1PDNC 4XETA 3K0LA 1IN8A 5I8YA 4EGYA 2K86A 2FNAA 3BDDA 3HOSA 2PTMA 1IN5A 2PYTA 3CEWA 4P9GA 3FXRA 2L4AA 4PIXA 4QX5A 2QCSB 2IVMA 2DAOA 5JAXA 1OYYA 3HT2A 3KE2A 3SCFA 1CAUA 2L3DA 1T2KA 1P4WA 3F6OA 2UY9A 5EEHA 5JI6A 2QBYB 5HLGA 2MBFA 1KQ8A 4UUVA 4ESBA 4HQEA 3ZPLA 2F4PA 3FXQA 4ENNA 1FT9A 3Q9VA 4LK1F 3KP3A 3J80K 2QVSB 5D6EA 3W6JB 4WX9A 1TW3A 1TQIA 2LSOA 4ZH4F 3SZTA 3LQRA 3H1WA 2QQBA 2K7LA 4KU7A 3T5XA 2GAUA 2KRFA 5ILSA 2E1CA 5E1WA 4LFUA 4O9GA 4IETA 4ETSA 5BMZA 3U2RA 3HRSA 1AWCA 5BY5A 4Z82A 1Q3EA 3KP2A 3IRQA 2Q0AA 1IN7A 2CW0F 3F72A 4RAZA 3BCWA 1HXDA 2GIVA 3PQKA 5F6FA 2YU3A 5CVRA 3ZQ7A 1DP7P 4PZJA 4LTAA 2A5YB 4XFBA 5T3NA 1R5GA 3EQLF 1BOAA 4ZU4A 3PQJA 2MA3A 4FX4A 1F4KA 4B8XA 4XBFA 4YRDA 2ZXJA 1U3EM 2EJRA 3TNQA 4XLNF 4I01A 2Z69A 2CAUA 2OQRA 1T38A 1O5LA 5H20A 1HKTA 4LK0F 1XMAA 3E6DA 4ESFA 2ISZA 4UHTA 5HS9A 5BS6A 2VOPA 1RIOH 3NSTA 2RDPA 4PGGA 2WC2A 2VECA 1UIKA 2COMA 3K1MA 4P96A 2MHFA 1HW5A 3USSA 4JVAA 1BI1A 4CO8A 1H9TA 4UV8A 1ZZBA 3GUDA 5DCFA 4XFCA 4LLNA 4N9HA 4LB5A 3ZMZA 4F8AA 1J2XA 3GFJA 2A61A 5I0RA 2YPRA 2BV6A 2X0LA 1G4DA 2VPVA 4G6DA 5CLSA 5DUKA 3L00A 1YW7A 1XB4A 1JXSA 3V7RA 3ERED 3WTSC 5HS7A 1B6AA 1D3YA 1XDUA 4ZZDA 2H6BA 2WFPA 3DL3A 2DK5A 5DV5A 4LLLA 2IP2A 3DFGA 3JTGA 4EWDA 2UYAA 4NB5A 1BC8C 1LQ1A 2HDCA 3IL2A 2FE3A 1RZ4A 1XDSA 3M8EA 1J59A 1QXJA 4BHPA 2FMYA 2OZ6A 4F7ZA 5L3BA 3KGLA 2RQPA 4XSXF 2P5LC 3J81K 1PP7U 4L18B 2DQLA 2CWEA 4HX8A 1R22A 3WW3A 4RB1A 2LF7A 3K9TA 4DINB 1XN7A 5FD5A 4ESJA 2W25A 4EMSA 3DF8A 3OGJA 5FLJA 1J9IA 3EQEA 2VN2A 4LEJA 5AONA 3OOPA 3HIFA 5I91A 1RNLA 3LA2A 4FHTA 2FQ3A 3WW2A 2F2EA 3E97A 4BYYA 1X3UA 3IDCB 4NQWA 2KIUA 3C18A 4CZZA 3C3WA 1QQIA 2Z9OA 1J3QA 4IRGA 3I7DA 5C8WA 1STZA 1J7KA 1FSEA 3TGNA 5FLIA 4X6RB 4WXDA 3IHUA 2HQRA 1IPJA 4RB2C 4U7BA 3F8NA 4L9TA 1EV7A 2Z3YA 5HS8A 2EVXA 5D5XB 3KMHA 4S05A 2R7FA 3T8RA 1IXSB 3HT1A 3FHZA 1WRJA 2BE5F 5KHIA 2ATFA 1MJAA 4A0ZA 1E2XA 2DTRA 2O8QA 2CSOA 3ZMDA 4MTEA 3EYIA 2NRAC 4R52A 3K1NA 4L5IA 3D82A 4G6QA 1KQ0A 4G7OF 2Y0OA 1XGSA 3LA7A 3AAFA 4GCVA 3HRUA 1BIBA 1FC3A 2DI3A 2ZMEA 1LB2A 1SEFA 1SAXA 3F3XA 3NRVA 1XMKA 3GLXA 4XF9A 3LWFA 1REPC 3PFIA 1YHFA 2NNYA 3CJNA 1U5TC 3IKTA 1LJ9A 4R79A 4BHBA 2O03A 5CYVA 2XV4S 1GQHA 4HX4A 1FP2A 1ZRCA 3FWEA 4G7HF 2PI0A 2Z2SB 5I8TA 5EZWA 2VC1A 4HF0A 4ZYDA 3DXJF 3OV8A 5TJJA 5BQTA 3WW1A 2J5PA 5D4RA 1WI9A 3QACA 2RGVA 3QRFF 2PFWA 4O5VA 2FQPA 1DDNA 2ETEA 3TOAA 4ZU7A 1MDMB 1KU7A 2ZNYA 4XF3A 3DKWA 2QNKA 2B9UA 2XIGA 2XKPA 5I8SA 1XSVA 2HR3A 3MEXA 1PM7A 1S8NA 3IRRA 2XAHA 4QGMA 2EFNA 1UCRA 1HBXG 2MH9A 2KXLA 1J5YA 1FPQA 4HV5A 1FLIA 3HRTA 3S2WA 2P6TA 4A5MA 1SQ4A 2FEZA 3S7EA 2HOEA 2O0YA 5K5OA 1EYBA 4NVPA 4BIFA 2CQKA 3KEQA 4LUKA 4HBLA 3SHRA 2QENA 4EQQA 1LVAA 4I7HA 3ZN1A 1W7PA 1TTYA 3QU3A 4K2EA 1X82A 5EEGA 2FMLA 4I02A 1HQCA 2OZUA 2XROA 1Z6TA 4HX7A 1SFUA 3T1BA 2CO5A 1IRGA 4ONUA 3CUQB 1BM9A 5LHIA 3GFIA 4U88A 1G3TA 3FMQA 3IWZA 2A6HF 3RTRA 3LAGA 1GVJA 2IA1A 1ZYRF 4HMZA 5JFRA 3L9FA 2E1NA 3CO6C 5JVTA 2K0GA 4A0YA 5LEKA 4AIKA 3JAMZ 3UKTA 5J3UA 4XFFA 4Y15A 1LDJA 2FXAA 5J8CA 3MZHA 1SFEA 3CTAA 4YSFA 4Q48A 3BROA 2LNBA 2CGPA 1XE8A 1KQ9A 3U10A 1UHWA 2IXKA 5J8FA 4HLTA 1UD1A 4NHJA 1FP1D 3NKTA 1R00A 4OIOF 2KKOA 4HYEA 2ZNZA 4LG0B 5D5VB 4IERA 3WTVC 4AD9A 3FHIB 1VR3A 3EDPA 4M71A 1IXCA 1ZZ9A 2R3SA 4B09A 1UB9A 1CAWA 4PIZA 1ON1A 4LULA 4OU0A 1BBYA 5LRRA 3BY6A 4AQ2A 1CAWB 5BV6A 4O3MA 5D8KB 3GVAA 1DZRA 2IA2A 3LA3A 1RUOA 3GYDA 1BI0A 4B29A 3Q9SA 4GULA 5CU1A 5EFUA 1K6OA 2TDXA 4M9ZA 3HYIA 4I3PA 4WZCA 4XFIA 4FT8A 4KIFA 1LDKB 4TV7A 4L2NA 3GBFA 1NE4A 2HQNA 3LQQA 4X6QB 5KVRA 1ZRRA 1H1MA 3C3VA 4MV2A 3IWFA 1IXRC 4BHCA 4KWLA 4L11A 1T0FA 2W85A 2VOOA 2D40A 3FZVA 1XSDA 3ZMSA 4IRHA 3RKYA 2QLZA 5CADA 1YQAA 2O61A 1AOYA 1Y9QA 1G6NA 1OYIA 1LNWA 1R1UA 4Q4ZF 1KU3A 2FRHA 3E5UA 1ZLKA 2X4HA 4I2OA 4KU8A 2RVCA 3SMHA 1TQPA 1B9NA 1RGSA 4QXKA 2BEOA 2BNNA 1EPZA 1PMIA 4HLXA 4E2GA 3V4GA 1V3FA 5D5UB 1YFHA 2L54A 1CAVA 2C0ZA 2Q4SA 1Z05A 2JPCA 2N7GA 5E8GA 2Q1ZB 3K2ZA 3GZ5A 2PFBA 2IXIA 4ZYEA 2R7DA 2CFXA 4M9XA 3NW4A 4YIFA 4IEQA 5D5WB 5ILVA 3CO2A 2VT3A 2UYBA 3WODF 2XAQA 4XRFA 1B59A 3M3IA 1P2FA 2KIMA 2IXJA 3B73A 3ECHA 4HV6A 4MQVA 1IF1A 3FZ3A 2GWRA 1FY7A 5LGNA 4KN7X 4EWAA 1IRFA 4YIIA 4IPAA 4LA2A 1MZBA 3BJ6A 1B9MA 2M5WA 2RC4A 3H7YA 1CAUB 3E6CC 2BNMA 2O8XA 2HJIA 3P9KA 1USSA 1YW9A 4QM9A 3SQNA 4LMYA 3OD0A 4L9VA 3G3ZA 4H7LA 5I0SA 4MNUA 1CGPA 2QQ9A 3GF2A 4HSLA 4M73A 3RJPA 1SMTA 4L5JA 1CF7A 2IRFG 3L7WA 4QGNA 1G3SA 2EA2A 1CF7B 1BI3A 1HKQA 4YARA 3H3ZA 1XE7A 1P4AA 1Y0UA 5CVIA 4XF0A 2UY8A 2EK5A 5LRSA 4O9EA 4N9IA 1NZCA 2PN6A 2FA5A 3BPXA 2EAAA 3JAMK 4CHUA 4L0ZB 3P9IA 3WGIA 5BPIA 2FNPA 5ILUA 3DPTA 1X7NA 3H92A 1R5HA 2JPBA 2V1UA 4S04A 1OI6A 2ET7A 5KHJA 5KHHA 2F5EA 3I53A 3JSOA 1CAXA 4GXOA 1S7OA 3WU1B 3REOA 3S0MA 2E7XA 2QDRA 5BPXA 3R0AA 1GQGA 3FFQA 1RUNA 4PGHA 2OA2A 1HW2A 3HHHA 1EH6A 5HLHA 2PLYA 1E17A 2DPDA 4AVCA 1Z6RA 2ELHA 4LD5A 2AS5F 3L2CA 4GO1A 1F1ZA 3GWZA 2Q2EA 1J1LA 5KBFA 4OIQF 2AXLA 4GGGA 4L0YB 3MYXA 4M6YA 1MJBA 4YFKF 4P9FA 1X8MA 5FFZA 2V1DA 3F8BA 2ZCWA 1EP0A 3H7JA 1OPCA 3CF6E 2EV5A 5JR3A 3FF5A 3NVCA 4CGZA 2XAJA 5AIQA 5DUIA 4AIHA 2XUBA 5FLHA 4LJZF 4IHTA 1T98A 5FQ0A 1DGRA 2RKHA 5DCMA 2XAGA 4HVQA 2C6YA 4HLYA 2VQAA 4YFXF 4A5NA 2DPUA 2PQQA 5KHKA 3MQ0A 3TDUC 4YG2F 4XLPF 1Q1HA 2WWYA 3R0JA 2OA4A 2ESHA 2OYZA 2ZKLA 1V70A 2FBHA 2QYOA 3GZ6A 3R4KA 3ACLA 1X8EA 1S3JA 4ZZLA 1I27A 1JHFA 3CLOA 5FLXK 5HLIA 4CDGA 1HW1A 1FX7A 3BALA 4XFAA 3QPHA 2FU4A 2WV0A 3R61A 1R36A 5ICEA 3LWCA 1U5TA 2GC0A 5JHUA 1GHCA 4AIJA 4P9UA 4KWKA 3M9AA 2EFQA 3GX4X 5BPDA 2LKPA 3JZVA 4IRIA 2K27A 4WCGA 2IXHA 5FCCA 2XHKA 3F22A 5L3DA 4M9SA 3OTFA 3MPBA 1ZRDA 2DK8A 3ABTA 2Y48A 5J6XA 3PVBB 2G9WA 2CYYA 1C0WA 2D5HA 1DZTA 2A6EF 4WK8F 5TRDA 1Z7UA 3I59A 4HAMA 1WKMA 4EGZA 3IKVA 1FWZA 3GFLA 1IAWA 1YUDA 4ORFA 2L4MA 5CVUA 3HRMA 3D0JA 3E6MA 1T39A 2L02A 1Y3TA 1TLHB 1R7JA 4QLCU 4Q29A 4UXNA 3O14A 1FBUA 2FF4A 3JSPA 3ES4A 2PHDA 1TQMA 5L3FA 4A0XA 2DBBA 1ZG3A 3HTUA 2UXNA 1HSTA 3SCGA 5JSRA 2Y75A 1ODDA 3ECOA 2V9VA 5ICCA 2ZMEB 5IT3A 1O4TA 4HSJA 1OR7A 3WTYC 1P92A 4A2UA 4K8FA 2O6GE 3BPVA 4EJUA 1RTVA 4BAYA 4A12A 2DQRA 1F5TA 3VOEA 4HQMA 2HWVA 3HUGA 4EJVA 2F5DA 4ON0A 3I0TA 4OIRF 3VODA 3RIRA 2OPKA 5L3GA 2ZBKA 1QNTA 5CVJA 3I5UA 1XCVA 5F64A 2W24A 4M74A 3SZPA 1U6GA 4JTOA 3CLPA 1BJAA 4WF2A 1ZVFA 3ST7A 1Q43A 3BWGA 3ELNA 3VFZA 4OIPF 5I0TA 2GQQA 3GXOA 4UNOA 1KYWA 4UVBA 1QZZA 1ZZ8A 1ZARA 4HN1A 4KA4A 4KUMA 1UPIA 1ONVA 2NAZA 5FD6A 4KT5C 2A3SA 1JE8A 3JTHA 3WTXC 4FAHA 3KP4A 1Z9CA 5IT9Z 4QGLA 5LLQA 4Z2YA 4PCQA 5I0UA 1W4MA 2HTJA 3QAHA 1YFUA 3IC7A 2B0LA 4IHSA 2VONA 1UW8A 3QU6A 2PAKA 1IN6A 2YX7A 3KFWX 1SFNA 2H6CA 1WGPA 4XF4A 5A2QZ 3I54A 5I93A 1P6RA 1QXRA 4UBHA 5E16A 5LGUA 3SXWA 3RPUA 1VP6A 1SD4A 2EA7A 5E18F 2PJPA 4U0YA 1QBJA 1WA4A 3I64A 3H9AA 3HTSB 4MTDA 4P5OA 2D1HA 4MGZE 4N0BA 4JV4A 2P4WA 1CX4A 1DPRA 2CAVA 4IEYA 4D7SA 1W7PB 2OBPA 1R23A 2IXCA 3HSRA 2G7UA 1XSXA 3COAC 4IEPA 4I09A 1LKNA 4LUMA 3WGGA 4Q5SF 1L3JA 1OMIA 2OD5A 3ROUA 1YWKA 1KGSA 1FZPB 3UKVA 1TW2A 3ABUA 2HYFA 1I1GA 2K02A 4WBBA 4MH0E 4Y13A 2YX4A 3J80Z 3L09A 3WTUC 1MGTA 2XGXA 1FI2A 4KIGA 3KSCA 4DQ2A 4Q0VA 2K4JA 3HHGA 1S29A 3K69A 1QY4A 1HSJA 2W57A 4KDPA 4MGRA 1TQ5A 4IEZA 4CICA 4HF2A 2ZKZA 1W7PD 4HF1A 4HOBA 1J0RA 3CJXA 5K5RA 4ENKA 2WTEA 4WXCA 4U0WA 5ICGA 1O3TA 4LLGF 2QWWA 4G8XA 2DFIA 2VODA 3ZMTA 2G7HA 2YSRA 4RB3C 3DEUA 4IVNA 2MPFA 4E2QA 1J58A 4KFCA 2DT5A 3LSTA 1IN4A 2A07F 5FO5A 3DP7A 3O6BB 4KMUX 1DGWA 5E1XA 1U78A 3G7DA 4OFGA 2P17A 2VBZA 4AVPA 3CUOA 3KGZA 2J5OA 2MLGA 1ZX5A 1VTNC 2V6CA 1SFXA 2IC1A 3VEPA 1BN5A 2QZ8A 2XASA 1ZG1A 4L9NA 3BOQA 2MH2A 5LGTA 2YR2A 1ZG5A 2M87A 4JQFA 1QGPA 1IUYA 3HQXA 2XVCA 2IT0A 3U11A 3WW4A 3WG9A 4OMZA 4KIBA 1H0MA 2GC1A 2Z5UA 3DN7A 4J1XA 3ETQA 2FOKA 2H09A 4IESA 4G7ZF 2GU9A 4ASNA 4EJWA 4GYGA 3TNPB 3ZP5A 5LHGA 2VBXA 1D8JA 2GA1A 3T0YA 1K78A 4G9YA 4ENJA 2VC0A 3ZDSA 3I58A 1ZGAA 1K78B 2CG4A 2P5VA 3EHKA 3BZ6A 4IEVA 3DQVC 2A69F 1UCXA 3KCCA 1SD7A 4OINF 2M8EA 2OZJA 2PMHA 2EB7A 4KN4X 3TDZC 2DCTA 5E8IA 3QOPA 3BPZA 3M70A 5BXXA 2PBIA 2CV6A 1YW8A 3B02A 4XFHA 2D45A 3TO9A 1CAVB 3R60A 3J81Z 1UFMA 1FYLA 2MC3A 1FYMA 2GA2A 2P6SA 4PDKA 5DD8A 1ON2A 4EJTA 3NJZA 5IT9K 5DDGA 5E17F 3KZYA 5JSOA 3CDHA 1ZH5A 2PAEA 2IA0A 1XRUA 1YFXA 4GYIA 1B1BA 3QP5A 3SCHA 4PIYA 2BYVE 4RGSA 2MNGA 1I6XA 4HVOA 1ZZ6A 3GEZA 2LDUA 4UBGA 4PJYA 4CYDA 1NXMA 3H8UA 4KWJA 4JTNA 3V7CA 2UWMA 2DO7A 2HEOA 2QBYA 5BOXA 2VXZA 3KLOA 1DPUA 5BUVA 1BI2A 1QWRA 3F23A 1EH7A 3SFZA 2QM3A 1WSUA 1ZREA 1U8RA 3R6SA 3RYRA 4YNIA 2Q0OA 1J3RA 2XL9A 2F5CA 1SD5A 1MD0A 4EM2A 3EUHA 4BXUA 1ZZ7A 5K8SA 5DD4A 1FYKA 4MEXF 2D5FA 5LHHA 1XGNA 2QQAA 2Q30A 4ZU5A 1YS7A 3OF1A 3CL1A 1FNNA 4I98B 5E1RA 3HOTA 2PMUA 3O2PE 4RS8A 3FX3A 4QMAA 2KIFA 4IXAA 4Q47A 2L01A 1SD6A 3ML6A 1KU9A 2GH2A 1UHMA 1I1SA 2RNJA 3EETA 1RL3A 4P55A 1DUXC 5D8LB 4EM0B 1CAXB 4MEYF 2RN7A 2HTSA 2XL7A 3PNAA 5ERIA 3HSFA 4LGWA 2DW4A 3MAJA 1XD7A 1Z91A 3RPQA 1L0OC 2D1VA 2EA4A 4MGKE 2K4BA 1HKSA 4OMYA 1LR5A 1ZGJA 1S6LA 3RKWA 2XKOA 3F6VA 3V8LA 1A04A 4DNCA 2BNOA 1FOKA 3GYHX 2O1QA 3GO5A 4KMFA 2MLKA 5C6CA 1LRHA 2ZJ2A 3MZYA 1U12A 4OOIA 1YO5C 1YFYA 3GW2A 1ZNPA 6PAXA 3ISPA 4ENMA 3G73A 4IEUA 4RD7A 4EJOA 4XF1A 4FBFA 3H1YA 4HDUA 3IBMA 1IPKA 3WE2A 1LEBA 2E9QA 2PHLA 2KJBA 4YYOA 2PG4A 5FQ0B 1WQ2A 1MKMA 5LEJA 5DCMB 4UV9A 2STWA 1QPMA 4H0EA 3O3KA 2E7WA 3FMSA 2UXXA 3MCZA 2ZFWA 3TOBA 3EJKA 2D2WA 1ZHFA 1BC7C 1TNSA 3I4PA 4AVBA 4QWQA 5FPZA 4MUVA 4XSZF 4RAYA 4Z07A 5E1ZB 4D0PA 3WGHA 4AXOA 2XLFA 5FB2A 3T8TA 2M45A 3BU7A 1ULYA 1TBXA 1OYWA 3QP6A 1Z1DA 2OQGA 5H6RA 4E70A 4CXFA 2GC2A 3LZZA 4UVAA 4EROA 4FAGA 3V8JA 2ACJA 2GXBA 4AQ6A 1U5TB 4IEOA 2B5HA 5H6QA 2VBWA 2MD5A 2Z33A 3KP6A 4AVAA 1U2WA 3DPLC 3RI4A 4EV0A 3TO7A 3TO6A 4RGUA 3F21A 1VJ2A 1XGMA 3U1DA 4M72A 2RV8A 1YFWA 5J7MA 4Q0QA 2HGCA 3N4MA 1D8KA 2XLGA 1K7AA 3H1MA 4RB0A 1O3SA 4O6JA 2JT1A 4MHGA 1PUEE 4LA3A 2DLLA 5CJ9A 1XGOA 3I59B 2ESNA 5K5QA 3FE5A 1I5ZA 4FX0A 4Q0PA 4WXHA 1R1VA 5L3EA 1YLFA 1IZ1A 2P5KA 2H27A 3U0ZA 3RKXA 5JSPA 5FGMA 4HW0A 3KETA 4U0VA 2EFPA 3D5LA 1XCBA 1B4AA 3RNSA 3F8CA 3WTTC 1QO0D 1NHAA 1O3QA 2I45A 3ES1A 4WVZA 2W84A 2Y0MA 2IPQX 1GXQA 2V79A 3H3UA 1JHHA 2M30A 3EO6A
chains in the Genus database with same CATH superfamily
5DYMA 2PQ8A 2EV6A 2VCMA 1FXZA 3PLQA 1ZRFA 3TMOA 3L2WA 1WKYA 2RREA 2VNOA 1LEDA 3AKZA 4CDUA 4LO7A 3VL8A 3OBZA 4AEDA 2V1XA 4XFGA 5FY5A 1GNYA 3ITQA 2JRTA 3ZN0A 4AEDB 2ZB9A 1YIOA 1QJX3 4LBQD 3ZN4A 1HN1A 1HB3A 1YG2A 1R1TA 1HJFA 2WV1A 1J3PA 1BIAA 3ESWB 1IHMA 1PVXA 3V8KA 4YW4A 1O6UA 4Z1VA 5FPXA 4QQPA 4NNJA 4LKDA 1ORKA 2WAFA 2JVHA 3FK6A 3JRCA 4Q4W2 1W8OA 4CCNA 2FJ1A 5HVQC 4IW3A 1RUC2 3HPGA 4TYSA 1YLLA 4CTEA 2E32A 2X29A 4P08A 4QM8A 2ZGUA 5BNOB 4TLGA 3P7NA 3SKVA 3WOGA 2P7CB 2YG0A 2QSGX 1VQLI 1S0FA 4MQ9F 3ZMVA 4BE1A 1VBB3 2Z16A 5ABJB 1Q5OA 1UNBA 2D7FA 4XIOA 4FETA 5GLZA 4QDQA 2C5DA 4BISA 2UZKA 2ZGLA 1FBSA 3S3MA 1OFNA 4Q4X3 2XBO1 1J75A 4IHYA 3NAUA 2VQUA 2X85A 1WWXA 3BB6A 3CUQA 5JPNB 4PJ0C 4JOMA 2OQ7A 3I3BA 3QH6A 1JZ7A 1SBFA 4N90A 3EBRA 3THDA 5M5YJ 4KNYA 1QZYA 2R7QA 1AF9A 3HB9A 4A6EA 2FDGA 2GXGA 5FZKA 4BH9A 4MX3A 2R0FA 4AUXA 3OG2A 4RGXA 1SCRA 3NJYA 2HZTA 2BBYA 2DT7B 2LUWA 4A3KJ 1SLLA 3K4LA 4GKXA 2J1SA 4K1ZA 2ZGMA 4PF1A 4LG0A 4JBAA 1OQDA 3ZSKA 3UJQA 4Q5OA 1XNDA 1NLQA 4AW7A 2ZHNA 3F8MA 3LSEA 5AIPA 1AR61 1LGBA 3OEAA 2E33A 5FXVA 5LASA 3VHOA 2XGEA 2DU9A 3FMRA 2R5YA 1OKRA 3R0RA 1H9GA 1R49A 4BXFA 4HT1T 3BG7A 3KT7A 3O1TA 4Z8BA 5E3NA 4QPOA 4FASD 1OHFA 2KJCA 2STTA 1SMYF 2K9ZA 1ZK8A 3RYKA 1Z77A 2A6TA 2IGOA 4BQ4A 5JR7B 4E7ZA 1WCQA 2ORZA 4CZSA 3BT9A 4EM1A 2VMFA 3AXDA 5FKMA 2GC3A 4YFZA 5JLVA 2Z79A 3MLKA 1U0AA 3GJBA 4HA8A 5D1IA 5J47A 1YQ5A 1AL22 3JBG1 5KCMA 2XLAA 2VT2A 5B3SH 3LPFA 3VHNA 5C8CB 4AHXA 3DV8A 1K4SA 3VBRC 4FE7A 5HOOA 4M3CA 2WY8Q 5HDNA 3ZFFA 3PSIA 1DQ2A 5FBZA 1DLCA 1PK6C 5IK4A 2V5YA 1W03A 1ULOA 1VRH2 2KT0A 1H6XA 3ZYFA 3C7EA 4AI2A 3FHQA 4E7SA 3FDYA 3GXUA 2RDSA 1D5VA 1WCSA 2V09A 5J48A 5A2QK 4PJJA 1GV9A 2AENA 4FQ4A 3Q0WA 1DYKA 1FNZA 1VBE1 5FYYA 4QIWN 3LD8A 2IS4A 3K0LA 1IN8A 4EGYA 3FXRA 3IAS2 4PIXA 3KYDB 2D6NA 1NCRB 2QCSB 2X1DA 5F04A 5JAXA 5JOZA 3HT2A 2XOMA 3K4DA 3SCFA 2R7SA 1CAUA 4CUGA 2VOXA 3U07A 4UF0B 4XONA 4UUVA 1O4YA 4ENNA 4J6GA 3E1F1 3MW3A 3IN9A 4XNFA 4HOOA 3W6JB 1TW3A 4WX9A 4A3GJ 3T2PA 2J42A 3LQRA 2QQBA 2GAUA 2KRFA 2E1CA 3G6EI 3S3OA 5IP7J 2B4KA 1UKRA 4O9GA 5CB7A 4ETSA 1F4HA 4Z82A 5F39A 1LPQA 1Q3EA 2Q0AA 3WQ0A 1AHDP 4I30A 2XJUA 1SBEA 2FUG2 4WM7C 3W59A 4X0GA 2WWSA 1QA6A 4FFIA 5T3NA 1R5GA 3N9QA 4YVSA 5J40A 3PQJA 3LSHA 5FUIA 1F4KA 4ARYA 2ZXJA 5HCFA 3JD72 3H8XA 1U3EM 2EJRA 4RLQA 1TG7A 2CAUA 3WG1A 2OQRA 1H8TC 1T38A 4LKSA 5FKOA 3E6DA 1DZQA 2VOWA 3NKGA 4A6SA 3SQOA 5DUVA 1WCUA 2COMA 2KZVA 4P96A 2MHFA 3OUJA 4AHWA 1YQ6A 3USSA 3GZTB 3WVJA 4JVAA 5M5XJ 1HIXA 4C9YA 3JRGA 4UV8A 1I6HJ 3GUDA 4XIDA 4N9HA 3ZMZA 1PO21 3JREA 4CDXA 5F0HA 2YPRA 3BTJA 2K3FA 4AF9A 3FLPA 1XOYA 3PIPF 2R93J 5CLSA 5DUKA 2BUKA 1XB4A 2WRAA 2BXZA 2VL8A 5GPCA 1XDUA 1GP5A 4HL0A 4GRIA 3DL3A 2DK5A 1VQMI 5A33A 2IP2A 3DFGA 3JTGA 5FZDA 3CZ6A 3IL2A 3PURA 3AP5A 1XDSA 4ASLA 3MD2A 5GLTA 3WR0A 1GP4A 2FMYA 2EH3A 3B6AA 2E5ZA 4YGCA 2P5LC 4L18B 3ACGA 3I3MA 2R0QC 3WW3A 5SV8A 5A3OA 1XN7A 5FD5A 4XOPA 1CONA 2BHYA 1AHSA 4NRQA 2DFCA 2YFZA 3OGJA 2VN2A 1GLHA 4C0BA 4DS0A 2HXIA 2QE3A 1E5RA 4BYYA 5IOZA 4NQWA 3IDCB 1AX2A 4ZPIA 3V56A 2HWD2 5D8AB 4IRGA 1RJ7A 3AMHA 4DUVA 3PM1A 1WI3A 3J8F2 1FSEA 4WXDA 3IHUA 4QX7A 2VXDA 2HQRA 1BBT1 4II2A 4U7BA 1KRIA 1XX5A 1F35A 2HBTA 3VBSB 1SHWB 3OBTA 2Z3YA 4S05A 3T8RA 4UFKA 2K9QA 3FHZA 1Y39A 4XCBA 2BE5F 3U37A 4A0ZA 1X1AA 4AI3A 2X6WA 3OL4A 3ZMDA 2ZXIA 2ZACA 4LHSA 1WJAA 1OVSA 1LU1A 1OLME 1SLCA 1PO13 2MSYA 4JKMA 2RS32 4LBQA 2KRHA 2VMGA 4GCVA 1DP0A 4FE4A 1BIBA 2ZMEA 3WQBA 3NRVA 3GLXA 3LWFA 1PVC3 3B9IA 3RMYA 2NNYA 1HRI1 3IKTA 3MUZ1 3AJYA 4JDMA 3OYGA 5FRAA 1BR4A 1X1CA 3K4MA 3Q8AA 1W8WA 2HBUA 4HX4A 4DBQA 4XKBA 1S4CA 3HJEA 3BG3A 4G7HF 1D1AA 3NNGA 3S93A 1NT0A 1FTZA 1RXGA 1RUJ2 2VC1A 1VBD3 3CCJI 4FVVA 4PQQA 1WI9A 2RGVA 2PFWA 1MH4A 4O5VA 2WAAA 1RESA 2Y6LA 2ETEA 3TOAA 4ZU7A 2Y69H 1UZVA 1KU7A 1QHGA 2ZFUA 1VB2A 3WX5A 2C9AA 1WH7A 4BL0B 3M3YJ 2MEV3 1XSVA 1GZWA 3JRDA 1YJNI 1B8IA 2ZEXA 3IRRA 4DUXA 5FPBA 4QGMA 1YJWI 2X8KA 4ASMB 2EFNA 3T1LA 2MH9A 3HQUA 1VQ7I 1J5YA 1FPQA 4HV5A 3HRTA 1G9FA 4U87A 2VKEA 4XUNA 1DFQA 1TNFA 5CA6A 2YS9A 4B3XA 1VMJA 3MIHA 3VBOC 2ZX4A 2VQ0A 1JHJA 2E1OA 3LQCA 4LUKA 3DBHB 4QHOA 3ZN1A 3QU3A 2OVUA 1ENHA 3M1HA 1QJZA 4I02A 1HQCA 5JXGA 3M8JA 1MPXA 3ABKH 2XROA 1PUFA 1JYXA 3LSGA 3W58A 1SFUA 1IRGA 3O1MA 2FBEA 2QQKA 1BJZA 3FMQA 2PXJA 3IWZA 4OI4A 2PLV3 1MBKA 1ZYRF 4HMZA 3OL3A 1Z3YA 2VNGA 3LSMA 2XBO2 2YU9J 5FMOS 4COVA 5A1FA 5LEKA 4AIKA 4A3FJ 3UKTA 3NJVA 2JDAA 1ZBA1 2M7AA 3WNLA 5EQUA 3RFRA 4CZCA 5L7OB 3RWNA 5FK8A 5J1YA 4P14A 2EQRA 5FY8A 2MG4A 1W9YA 3B3QE 1UHWA 5J8FA 4HLTA 3K48A 2AHQA 2EZKA 4GH4C 1I39A 2P6CA 2ZNZA 5D5VB 1QH7A 1XSQA 4KISA 3EDPA 3FMGA 4B09A 1DDLA 4KG0A 1ON1A 4AE2A 5F9TA 4OU0A 1BBYA 1OVPA 4N8MA 3MFCA 2YUSA 4HKOA 2L9NA 5FPUA 3PU8A 3GTGJ 1FTTA 1Y6IA 3GVAA 1NQDA 1DZRA 4YRVA 4M00A 1BI0A 5JMOA 4B29A 4GULA 1UAIA 3HYIA 2D3RA 2HWF1 1VQOI 3O1VA 2W9XA 3C7GA 1LDKB 3JRAA 3GBFA 4XCAA 3WP5A 5K0UA 5EF6A 1HN0A 1IXRC 3I2HA 4XPVA 4QKNA 4BHCA 1BKZA 1LHUA 2DJNA 2M3AA 4BQ1A 2FMDA 4RQPB 1W8HA 4YVWB 4AVZA 3FZVA 5CADA 1YQAA 5DDJ1 1G6NA 3JRHA 4D69A 4Q4ZF 3RMXA 4N43B 2FRHA 4PUSA 4LXLA 5J98B 1ZLKA 2X4HA 5FWJA 1OOPB 2JIJA 2ZGTA 1QJY3 1TQPA 3AYCA 1B9NA 4QXKA 2WN2A 1FYUA 4HLXA 4PFPA 1W5CC 5A7NA 5C3OA 1Y7BA 2WSUA 2Q4SA 4XJWA 1GP6A 4IZZA 3JBG2 3K70D 3ZO0B 3GZ5A 2Y38A 4A42A 1WPKA 2IFRA 2PHXA 2CFXA 2PMZN 1KS4A 4YIFA 2P3IA 4XZPA 4IEQA 4Y1XA 3ZFGA 2X6OA 1ALYA 2QKMB 4M3EA 4XRFA 2QQJA 2IXJA 3B73A 4E4ZA 2GLOA 1OLTA 4JQTA 4F55A 3FZ3A 1BZWA 5DUWA 4UW5A 5LGNA 5BNPC 1RVF3 4YIIA 4NIIA 1MZBA 2OKXA 4X6AJ 2M5WA 3H7YA 3RZJA 2NVXJ 2WT2A 2KFDA 4D8MA 1VBE2 5A1LA 4F92B 2WA0A 4FTBA 1S0JA 1MNEA 4OHXA 4FCAA 4G3YC 4QDRA 3FUQA 4L9VA 3G3ZA 4MNUA 3DPRA 1RUF3 2QQ9A 4QPGC 4M73A 1FPN1 1XYOA 3RJPA 1CF7A 1TE1B 3DKQA 2VJIA 2HWE3 1CF7B 1BI3A 1HKQA 2R30A 4YARA 3H3ZA 3SEQA 1XE7A 1HF0A 3VBUC 1Y0UA 4PJMA 4XF0A 4ATEA 2EK5A 2ZAHA 2YBPA 1MS4A 4QPIB 4L0ZB 3AYAA 3WG3A 3WGIA 1OLRA 2FNPA 5IY5H 5DM6F 1R5HA 2V1UA 2ET7A 4L9BA 1YYNA 2F5EA 1RHI3 3I53A 3K4CA 3JSOA 1CAXA 3WU1B 3REOA 3P3NA 3OSDA 3AMQA 2CDPA 4OI0A 1WD3A 1UOFA 4A3XA 2QDRA 1RUI1 1H8VA 4YW7A 1GQGA 4E6KG 1RUNA 3BR3A 3HHHA 2PLYA 1E17A 2DPDA 3ZDVA 3ZYGA 2R073 3HEFA 4LD5A 4BQQA 1LGCA 1F1ZA 1DG6A 2Q2EA 2DF7A 3JXSA 4CXXA 5KBFA 4O61A 3ZR8X 1H2LA 4BK5A 3BTZA 4GGGA 2J1AA 5JR2A 2HEWF 3F8BA 2ZCWA 1AKHA 3ZOBA 4XM3A 1QHHD 2WKKA 3CF6E 2EV5A 1CZTA 1OPMA 5JR3A 2YZ4A 3AFGA 5AVAA 2WB1N 5DUIA 2XUBA 5FLHA 4LJZF 3AP7A 2GNBA 3OIPA 2RKHA 1PO22 1QU3A 1X4OA 2XAGA 1YCIA 3BQZA 4OQ8A 3S57A 1WLDA 4KGQA 5FZFA 3M4FA 3KEYA 4PHZA 2R1DA 4YZ4A 5FWEA 1HRV1 3WCRA 2RVAA 4K20A 3I56I 4XOTA 2A5ZA 1FIAA 1H9WA 4IV1A 1OISA 1Q1HA 5FPAA 3R0JA 2OA4A 4A3ZA 1V70A 4L99A 5C4XJ 2VPLA 3MIFA 3JQWA 5C9AB 3T0AA 1R1ZA 2ZOEB 3BTXA 3AZWA 3OIOA 3CLQA 5GKAC 5KXEA 1W04A 4QKFA 3QPHA 3VPRA 4Y7NJ 3Q8CA 4RA2A 3LWCA 1U5TA 3DEEA 2VUDA 4Q4W3 1IS4A 2ELJA 1RUC3 3LF7A 2LW8A 4JDOA 2LTPA 2EFQA 4CCLA 2K27A 4WCGA 1J09A 4C1WA 1H8AC 1EUTA 3MPBA 5A7WA 2VZPA 3N7MA 2AR6A 4M0HA 3ABTA 3BODA 5CFCC 4PJNA 3INAA 3PVBB 4UW6A 1W06A 1C0WA 1DZTA 4WV8A 3PMEA 5JZGA 1Z21A 1ZTRA 1IAWA 4BMEA 4ORFA 5JZGB 4RHV1 3N9PA 1D1BA 3HRMA 3E6MA 1T39A 4IOAF 3K46A 2VIXA 1BBT2 1Y3TA 2C24A 4UXNA 2RE9A 1ZYBA 3ES4A 2CFOA 2CSGA 1K5MA 2JICA 2XQRA 2LC2A 2PHDA 4MHUA 2ZEYA 3VUOA 2DBBA 3WDTA 1ZG3A 1RPWA 1JTXA 2GP5A 2L7KA 4BUPA 1IQAA 3PFYA 4E4HA 2XONA 3DYMA 2EINH 4HSJA 2BQPA 2R7RA 1OR7A 1VQ4I 1POV3 1L7RA 2E19A 3KD4A 4IHWA 1UY2A 5FYMA 2P6HA 3TP3A 4UUSA 1F5TA 4PDWC 2HWVA 3I9V2 5FZOA 3MN2A 4EJVA 4K6BA 5A6ZA 1ULEA 1DQ0A 1REEA 5CVJA 4Y1VA 2VW2A 3I5UA 1HRI2 4MGTA 4UWDA 4P5HA 4WF2A 3ST7A 4BQ2A 3J7NA 3NV3A 2OX0A 3ZXLA 4C2MJ 3VFZA 2XR4A 1QZZA 1IG3A 1ZZ8A 4LIVA 2VXRA 4XJ8A 5GADJ 1LCLA 5LFAA 5GTIC 3JRBA 4XTPA 3GCXA 4KT5C 4W65A 1BCXA 1US2A 1VQPI 1R4NB 4YG6A 5FZGA 4F52A 1GFF2 3JTHA 4FAHA 1HLVA 4QGLA 1JN2P 3QAHA 1YFUA 4LBLA 1GKBA 2VONA 1UW8A 3BCAA 1IN6A 2H6CA 5A2QZ 3I54A 3MLJA 1OBNA 3BTAA 1BYHA 4Q27A 3I8TA 3RKQA 1UMZA 1W8UA 2VVFA 4AEDC 4JV4A 2W48A 2QQVA 1R23A 2IXCA 4OI2A 3VDCA 2NQYA 2G7UA 3NV2A 2TEPA 2ZSHB 3HBLA 2KD7A 4BQXA 1XSXA 4I09A 4Q5SF 4IQJA 1C57A 4XQDA 1HQNA 2E53A 1AL23 3WF0A 2QQNA 2K02A 1QVUA 4WBBA 4QPQA 4Y13A 3RZLA 2NVTJ 3KSCA 4BXXJ 5IVBA 4Q0VA 2K4JA 3PNYA 2VMCA 4CCKA 1NH3A 1BR2A 1QY4A 2J1UA 2W57A 3ALQA 1WHUA 4V2GA 1VRH3 3ZPYA 3ON7A 5T52A 4OMDA 3TW6A 3P3PA 2J7MA 3A4UA 1W7PD 3V0BA 4HOBA 4B47A 4UUTA 3CJXA 4O7XA 1N1TA 5BNOC 4LLGF 4IXLA 1KDMA 4XICA 2DFIA 1VIWB 5FK7A 3HNMA 3DEUA 4CCOA 2E63A 4IE7A 4BEHB 2WYFA 4AWDA 1MACA 4JRLA 1J58A 3A02A 3DP7A 1Z7LA 2DDBA 3S3NA 4CDWB 5E1XA 1PIV1 3H5NA 1ZBA2 3K7AJ 4I76A 3KGZA 2J5OA 4K9SA 2V6CA 5FREA 2IC1A 1ACIA 2DU1A 3OGRA 2MH2A 4AYBA 1ZG5A 2M87A 1DF0A 4JQFA 2XVCA 1MR5A 2IT0A 5DMYA 1I1EA 4P9WA 3B94A 4KJZA 4H2AA 1CD3G 3KZ4C 4C3IJ 3OGSA 1K61A 5FMOL 1GVDA 4GYGA 3T4HB 5LHGA 4YM0A 1A6CA 3VYSB 1RXFA 4XR6A 2VC0A 3ZDSA 5E3MA 3S2HJ 2CG4A 2P5VA 2R92J 2JA7J 2XF7A 2MABA 4EEFG 2A69F 2A6WA 1UCXA 2KIQA 2G19A 2YHJA 2RNGA 2A05A 5EDNA 3JD73 2M8EA 2Q8DA 4A44A 3WF1A 3AZXA 5DABA 3ZYHA 4KN4X 4OUEA 3QOPA 2C26A 3BPZA 3J26N 5KNLA 5BXXA 3KIOA 5DDJ2 1NCQA 3B02A 4K3UA 4XFHA 3QYFA 5AFBA 3Q8FA 2MC3A 2GA2A 1W8FA 4QB6A 1QVTA 4COYA 1RC9A 1WD4A 4NO4A 4GKYA 4EJTA 4K7JA 3ZQCA 5E17F 5F0FA 1LOGA 3KZYA 3H3VK 2ARAA 3CDHA 1ZH5A 5A7QA 3MV11 2CDOA 2FCTA 1TMF1 3N9NA 4Q4V1 1XRUA 3I2OA 2ID6A 1FOYA 2ES3A 2DMUA 1L7QA 1YFXA 3V42A 3HN1A 5DQ0A 1ULPA 3SCHA 2KP6A 3EUAA 1B72A 2BYVE 4JKLA 2HOSA 2BVVA 3GEZA 4UBGA 5CISA 3QOEA 3H8UA 3DKXA 3C2HA 4XIKA 4CDQB 1N1VA 2UWMA 2WAOA 3S1MJ 2E51A 5C71A 3KV5A 4R4XA 1BI2A 4XAEA 2ZX3A 3F23A 4JGYB 3WINE 3POBA 3IH2A 2VLAA 3NAPB 1YEWA 1WSUA 1ZREA 1O59A 2X48A 1WW7A 2DA5A 2JA5J 2HNHA 5GTHC 2IUWA 2F5CA 1MD0A 2BV4A 4O65A 1OUXA 4AVTA 1BEV2 1UOJA 2XJRA 1OFSA 2JMWA 3ZFFC 4XKWA 1QNWA 3K2AA 1R9TJ 2Q30A 2IGMA 3M07A 1FPN2 5GAEJ 3OF1A 3CL1A 1QNYA 1SEUA 4LMFA 2PMUA 3DEWA 1MS3A 3LEIA 1C8M1 1LECA 2L01A 2OPWA 2WAEA 4IV3B 2BZDA 4S0HB 2HWD3 3BTIA 5LWBA 1DUXC 1ND3A 1V5EA 4EM0B 3D5RC 2LY1A 1GOFA 2VY0A 1W6OB 2VZQA 5ERIA 3LSDA 5IOYA 3H5RA 2BGOA 3J8F3 3MIBA 4EN0A 1EUUA 4MXWB 1Z91A 3KT4A 1L0OC 2OT7A 4MGKE 1MS9A 2OC6A 4AYUA 2PN5A 5LBBA 4II3A 5LZ6A 2XQXA 4Q2FA 1S6LA 1JUPA 2XKOA 4A41A 3RZMA 4FOVA 4FISA 3H36A 1FOKA 3URFA 2O1QA 4KMFA 2DFFA 1RUI2 1DU0A 1YO5C 1VQ6I 3GW2A 4GXLA 3JRFA 3ETPA 3ISPA 4ZKTB 1PJRA 2CWSA 4GQ7A 4IEUA 5EEAA 1A34A 4FBFA 4HSTA 2IGNA 1A36A 4HNTA 5KC5A 3H1YA 3WE2A 2E9QA 2PHLA 1SPPB 5CFDB 2WNEA 2DA2A 2KJBA 4YYOA 4BY1J 1OH3A 3GTJJ 5DCMB 2STWA 3DU6A 4H0EA 1MBFA 1UG0A 4FQGA 1TWCJ 2L5QA 2E7WA 2LD5A 3MCZA 2ZX2A 5FZBA 4E7LA 3EJKA 1MSFC 2FD8A 4Q26A 2LK2A 5KXBA 4MFDA 3WCSA 3ZYIB 3WGHA 4AXOA 3A01A 3BC8A 5FB2A 1W9SA 3T8TA 5FKKA 3ZSMA 1RUJ3 1ZR2A 1ULYA 2Z5WA 4L8QA 4D5CA 5H6RA 1HRV2 3OYFA 2DURA 2XVGA 2RMU1 2I10A 5JUVA 4ES8A 4EROA 4M01A 2O7OA 1RMU1 2ARBA 4B1MA 3V8JA 2ACJA 2ZBJA 3MI8A 4AQ6A 3AZZA 2B5HA 1VI0A 2MD5A 3OYJA 1U9NA 2Z33A 4E7KA 4FO9A 4AVAA 4CP9A 3CMAI 1K5JA 1UPSA 4QX0A 1X1DA 5BYNA 3AG1H 1U8BA 3MKLA 4RR3B 1XGMA 5GZCA 5F37A 3HPNA 2M0CA 2HGCA 4BJ6C 1SFKA 1QDCA 4NN0A 4DY3A 4O6JA 3I2JA 4GB32 2ESNA 3FE5A 4LITA 4Q0PA 1A8MA 4ZDPA 4HKLA 4MADA 3EYPA 3VYTB 1MS8A 2YMZA 3U0ZA 1HDDC 1YX5A 5J1XA 2VKHA 1JZ3A 4D7MA 5C70A 3IMNA 1XCBA 3A0BC 1NHAA 1O3QA 2I45A 4DXTA 5A3UA 4WVZA 1VF9A 1DLLA 1FV2A 2A5WA 5DUUA 1UJ8A 2V79A 4RHV2 3H3UA 1JXNA 2QSFX 1FEXA 2HXOA 2X6XA 4YGEA 5HXMA 3GNEA 2JG8B 3E5XA 2QJVA 2V4AA 4R8HA 3O5SA 2XBO3 5F1RA 3HGYA 5ANNA 2PEXA 5F27A 1E3PA 2JTVA 5D8AC 4INDA 4KYWA 4XHXA 3NRUA 3HUGB 2HPIA 2O8KA 4NIHA 2RS51 5ICFA 1DGRN 1DCSA 1LDDA 1GANA 1QQP3 4XE9A 2OUHA 1ZAOA 1L3LA 2JDYA 5B4XA 3RGBA 3CU7A 1QZEA 2ZXHA 3FXUA 3CC2I 2FDHA 4NAMA 2DUQA 1MJ9A 3MDPA 2FBKA 4MGIE 4I0BA 1MDMA 3UGGA 1UY0A 1SG3A 3BUCA 1Q1VA 3W6VA 1OD5A 1SZBA 1Y1VJ 2DN0A 1EV11 3UKNA 2VE8A 1GV2A 2Z99A 4OLLA 2WZEA 3CMEI 4GDFA 3RZKA 5H9SA 5JXIA 3V0AA 1W2NA 2BFUS 1LJ7A 3CCEI 5FZ8A 4F93B 3KV9A 2R5ZA 2VH9A 2BVLA 2FDFA 2HKOA 1XNKA 2JQ7A 4PSXA 3MVPA 5D6FA 2ZMEC 2VBYA 2Y0SA 2EPFA 2P7VB 2M4GA 3F8FA 4JQRA 4LHNA 2FQ4A 4E7JA 2L9LA 4XMYA 2AQEA 2EFOA 3GFMA 1EAH3 2L9VA 1WFXA 1PVEA 3ULQB 4XRSA 3WU0A 3M7GA 4BWOA 2WIIB 4IF4A 3HNYM 2HWB2 4CCEA 2E31A 1LHOA 3V7SA 2O3FA 1FSHA 1YS6A 3OCPA 2ORXA 2A1XA 5FYSA 2NP0A 5FYHA 2EILH 4LBMA 4IEWA 4XEZA 2NS0A 2ZX0A 5CKTA 3H0DA 3JBG3 4ZS2A 3VB9A 3KP7A 2PAMA 4I0AA 3W6KB 2AEZA 4C2TA 4DRVA 3ZLIA 3R4UA 2D93A 2CUFA 1F9NA 2VZSA 3E6BA 2PJRA 1CESA 1ZBE2 4MFEA 1VBA1 2H8WA 3PO2J 4Q1PA 4FPOB 1N3QA 1W36C 3I71A 4LJHA 1SVOA 3DTKA 2LBFA 4K40A 2DYRH 4QX3A 3PVEA 1R081 2VZ3A 5L3CA 1W5SA 1FBQA 5IK8A 4HBNA 2LS6A 2W94A 1MBJA 4QQLA 1MNMC 3WLUA 3HOUJ 1XXNA 3FM3A 1PK6A 2H0VA 3RSNA 2K9MA 5FYBA 1PIV2 3PVOA 4MGYE 2OAZA 4MGQA 1XTAA 2VKVA 1QOTA 1TNTA 1PP8F 4MVTA 1H4GA 1IW7F 1UXXX 1MW7A 3BLYA 3O1OA 3KP5A 3DCFA 1UOGA 3PTYA 1YX3A 1YQ8A 2L7ZA 3BJAA 3WG4A 3IDBB 4W50A 1EY2A 2IJLA 2CUZA 3J7AY 4ZONA 3ABMH 4W6WA 2HOAA 1T95A 3IIAA 1FMD1 4AI9A 5L7OC 3D0SA 2ADDA 3AM2A 2W52A 1JUHA 4IEXA 3OUHA 4EVIA 3C1DA 4AWXB 3VHRA 1ZN2A 4LT5A 3BIWE 4RFRB 4DPNA 1P7IA 3FM5A 1IKPA 1D2QA 1WMXA 1ODNA 4IJAA 4NWVA 2ZKNA 2BGCA 3AVRA 2IXLA 1R58A 1G3WA 3HD8B 2XGDA 1KFUL 5A7OA 4KITB 2P3YA 2ADUA 2ET1A 4PBOA 4RGGA 3NO8A 1AUYA 2ZXQA 4GWNA 2JZYA 5LCWL 5H2FC 1LEAA 2XAFA 4XRSG 2M1BA 1PDNC 2AQFA 2DYSH 3FHAA 2FOWA 1NG6A 3BDDA 2K86A 1FV3A 2PTMA 1NA1A 4P9GA 2L4AA 3OGGA 1OFCX 2LP0A 4LHKA 1PO23 1JOPA 1JYNA 3TOJA 4Q4V2 4RQPC 4YVWC 2W46A 1D4VB 2K2SA 1M06G 1T2KA 1P4WA 3F6OA 5JI6A 2MBFA 3GZAA 1KQ8A 1LOFA 2JDZA 3ZPOA 2NOGA 4AU7A 4A3BJ 2E6VA 1Q8VA 3KP3A 5D6EA 4ZH4F 5EJ3A 2VUJA 1JTYA 3SZTA 2Y31A 3W21A 3MV01 3CCLI 5LB6A 4KU7A 4ZDOA 3T5XA 5FZ3A 3ACFA 2ECBA 5HCBA 4XLCA 1HB4A 2JG9A 1AR82 4IETA 3HRSA 5BY5A 2A6YA 5F3EA 4TSVA 3KF3A 2EXHA 2JG9B 4XBLA 1IN7A 4OUMA 4SLIA 3F72A 2BW3B 3JCUC 3ERMA 4BE0A 2MFZA 1HDPA 4PZJA 1VNDA 1ENSA 4D3WA 2A5YB 4XFBA 3E0JB 3LOCA 3UV9A 4QD2A 3OR2C 3W2VA 3VKOA 2MA3A 5L9VA 4XBFA 4QPWA 4DQAA 1T6BX 5L19A 3OPWA 4W4ZA 3C8XA 5TSWA 2E2JJ 3CP8A 4YELA 2Z69A 1C8M2 5K7FA 1JI6A 1UMHA 5H20A 1XMAA 2DA1A 2JJ7A 4IUGA 4UHTA 5HS9A 1BVVA 5BS6A 1R091 2NMOA 1Z7S2 2RDPA 2TCTA 1UIKA 5JWPA 5L73A 3I3DA 1HW5A 2GDFA 3CMGA 4CO8A 1H9TA 2Y60A 1BBT3 1XNCA 3DPRC 4XFCA 1W39A 2XPJA 4OCTA 4FTSA 5FJ8J 2BV6A 2X0LA 3R4SA 3I2IA 5A3TA 2VPVA 4G6DA 1QJFA 3Q9OA 2FDKA 4QPIC 1YW7A 3V7RA 1E3HA 3WTSC 1D3YA 5FOBB 3C2BA 1IV8A 3OYKA 1DQ1A 4LLLA 1YQCA 4AI8A 2UYAA 3VHPA 3S30A 2BVBA 1LQ1A 2C9KA 2XB5A 1CPNA 5CKNA 3UNPA 1SMVA 1J59A 3HKZA 4BHPA 1HRI3 4OUSA 2XB6C 5FRMA 5L36A 2RQPA 4PSWA 2DQLA 3EPZA 2PELA 3MIGA 1W9TA 4EMSA 3DF8A 5FP8A 3IPVB 5FLJA 1UU5A 3EQEA 4FPHA 5AONA 3HIFA 3ME2A 1ETKA 1RNLA 3LA2A 2FQ3A 3X2QH 3WW2A 1A35A 5E89A 5J37A 1R1A3 2F2EA 3E97A 1K6YA 1UYZA 2JEMA 4CZZA 3C3WA 2RMU2 4UI9L 5FP7A 2Z9OA 1RMU2 4AEMA 2VJ4A 4E8DA 4NPMA 2AH2A 3TL4X 2B9VA 3R05A 1IPJA 3FUOA 3SEPA 3FISA 3UESA 1JYVA 1WJCA 1EV7A 2QQIA 3HQRA 4XYXA 3KMHA 2FHRA 2R7FA 2WNVB 5F3GA 4IV1C 2WNOA 5GP9A 2BBVA 2DTRA 5FJHA 2O8QA 4XXAA 3RWKX 1ND2B 3G2BA 4NPRA 4R52A 3K1NA 2XJQA 1X2MA 4L5IA 5FMBA 3S6PA 1X50A 2Y0OA 4HPQA 4RA0A 2DI3A 4AC0A 1DQ5A 1ZRIA 3HOVJ 3F3XA 4Q8KA 3G1MA 4XF9A 1ASJ1 4CEYB 5FXXA 1H89C 2DUOA 1U5TC 4UFLA 3RI8A 4IE4A 4BHBA 1D7PM 4OQ9A 2O03A 4X8NA 5CYVA 2XV4S 3ZQHA 1JUSA 2WNUB 4KBBA 4J25A 1O4XA 1CVNA 1PGSA 4ZYDA 3VDDB 5BQTA 4DOUA 3MLLA 2J5PA 3KM5A 3QACA 2RS52 4G9SB 5JZGC 3WDWA 1UX7A 5HLTA 3K3NA 1S2EA 4Z2AA 2DVAA 5IVYA 3DKWA 2QNKA 2VC9A 4PT6A 2XKPA 2ENRA 4CU9A 1X9TA 1K5MC 4GMP3 3NWTA 4BJ0A 5T5LA 3ZYBA 3B6CA 4AVVA 1O91A 2DCJA 2DFEA 3HOXJ 1FLIA 1BMV1 3S2WA 1US3A 2P6TA 4C0HA 1EV12 5HPOA 4A5MA 1SQ4A 2Y30A 2FEZA 1UU6A 5K7PA 1GNHA 2O0YA 1AYN2 2X6YA 1LOCA 2ZEZA 3H8RA 2CQKA 4GH4A 4I6ZA 5DM7F 1V9U2 3I3LA 2LG4A 3SHRA 2UURA 1GUIA 4D6QA 1X82A 5FY9A 4URTA 3U1XA 4HX7A 4H7MA 1C5IA 1MMNA 2VBDA 3JU9A 3GFIA 1O4ZA 3ZSJA 5JIAA 4U88A 4I3GA 4K8RB 1RUD1 3H42B 5FZ1A 5JFRA 5JVTA 3HC7A 2DODA 5F5IA 3W9AA 5FXZA 1VE0A 5IYDJ 1YNAA 2Y8KA 2YY1A 3JAMZ 1SLIA 3POFA 5H9QA 1LDJA 1UX6A 1T33A 2EIKH 3B7MA 4YSFA 4LE3A 2CGPA 1UD1A 1FP1D 1GICA 2EIGA 3NKTA 1XNAA 1FAYA 2M2EA 3FKJA 3W5MA 3WTVC 3FHIB 4M71A 2R3SA 1C4RA 5LD2C 3BYWA 1XS9A 4M3DA 1R082 5BV6A 2TBVA 1ERDA 5D8KB 2JDNA 1VBB1 2VTXJ 4NRMA 1RUOA 4CEWA 1BEV3 3IM0A 5CU1A 2VZTA 4W6XA 2HDWA 2RHPA 3CDZB 5FZIA 4XFIA 4FT8A 2GH8A 2MYSA 2QQMA 2CV1A 1GOGA 3O0XA 2R49A 3LQQA 1FPN3 2UUZA 1YITI 1ZRRA 1WZXA 1H1MA 3C3VA 1W90A 4XN3A 5BNPA 5IP9J 3ZX7A 4KWLA 1RRJA 1T0FA 2R6QA 4OHZA 2W85A 3GZEA 1XSDA 5DZFA 3T09A 1E5SA 1SC7A 3W2WA 1UZ0A 1AOYA 1OYIA 2FCVA 3AXEA 1R1UA 1KU3A 3TW7A 2RAEA 1W9FA 3Q3SA 4JAAA 1VBC1 4I2OA 4KU8A 3HOBA 2RVCA 3T1MA 4XJAA 1RGSA 2BEOA 2F4LA 5J1UA 2ECCA 1EPZA 3RJ2X 3V4GA 1V3FA 2WAQA 1YFHA 1YRZA 1CAVA 3SZGA 1NLRA 2BDRA 2N7GA 2B42B 5FUNA 3K2ZA 1RUI3 3VSLA 2PFBA 1RINA 2R7WA 2R7DA 4M9XA 3NW4A 4QB1A 2B7YA 2MW8A 3M3IA 2VJ5A 2KIMA 1OCPA 2D97A 4MQVA 4Y20A 2K3PA 1IOAA 3O0WA 1TZLA 2GWRA 4W6YA 2COBA 2WQ8A 4LA2A 1B9MA 3LCPA 1W8TA 2C6SA 2JECA 2O8XA 2ZSIB 2HJIA 3PUQA 1R71A 1PGW1 2WFF1 1YRNA 4LMYA 3MKZA 3OD0A 2V9KA 2HLEA 4H7LA 5I0SA 1CGPA 5DZEA 3VD7A 4HSLA 1SMTA 3DPUA 3MF6A 4L5JA 2BWAA 2L9SA 3T0BA 3VKFC 2IRFG 3L7WA 4Q1RA 3OUIA 3DWLE 1HRV3 5APAA 1NCQC 2QSHX 5CVIA 2UY8A 3A2KA 4H3WA 3ACHA 5LRSA 3KHBA 4XABA 3PDQA 3S8PA 4HPKB 3BPXA 2FA5A 2QF7A 5EIYB 1VALA 3S16J 2EAAA 4WVMA 5G04L 4QKBA 1RR7A 3TBDA 2OCCH 9ANTA 1X7NA 5AC92 1OI6A 3NQHA 2LKSA 5KHHA 3P6BA 4D0QA 2LFBA 1YE9A 2D3PA 2KL4A 1BR1A 3S0MA 2FD5A 4V2WA 3E7LA 5EPAA 2E7XA 1V6IA 3R0AA 4CDQC 4Y26A 2W5FA 4PGHA 1HW2A 5HLHA 4GB33 3RG0A 1IQDC 4LO6B 2CY6A 2ELHA 1VQ8I 2VO5A 4ARXA 4JGYC 4RL7A 2LY2A 2CJJA 4XLHA 5FR3A 4M6YA 1LESA 1X8MA 1R092 2DMTA 1S0BA 4XURA 3A0NA 3BG9A 1OPCA 1ULFA 4YLZA 3L1PA 4XXPA 1HB2A 4OMCA 3FF5A 3JRIA 4DEQA 4LKFA 4RHV3 3AX4A 1W6NA 1WMFA 1ENRA 1GZ9A 4YM1A 1T98A 5FQ0A 1SLBA 5A6QA 2QGUA 3UNGC 4Y4RA 3MO4A 3WUCA 4WM8B 2XPWA 3AKTA 4IV3C 5LK7B 5DXDA 2C6YA 5FZ9A 2VQAA 4YFXF 4A5NA 2PQQA 5KHKA 3JR9A 3JB8A 2KRCA 2Y6HA 1JYWA 4KMQA 1LFPA 3CDIA 3ZR5A 1LUJB 2YV8A 2L7FP 2D6KA 1Q8OA 2ZJPF 2FBHA 1RUH1 4RS5B 5T5OA 3O8GA 5K4LA 1H1AA 1X8EA 1QJU3 1S3JA 3VD4A 3CCQI 1I27A 5FLXK 4CDGA 1FX7A 4XFAA 3R61A 1R36A 5ICEA 3VZNA 3T2QA 2GC0A 2WBMA 5JHUA 4AIJA 2VMDA 2KLOA 4NIDA 1WJBA 1AX1A 2WY7Q 4IGPA 4KWKA 2K85A 3NMBA 4L5EA 2JA6J 3GX4X 1W8ZA 2R061 3IKWA 3N35A 4XMAA 2Y6KA 3JZVA 4BM8A 4IRIA 2KA3A 2VCAA 4PDWA 2CNAA 3QYEA 3F22A 5IVEA 5L3DA 4P9LA 5FP9A 4JX0A 1OC1A 2X5IB 1ZRDA 2DK8A 2ELKA 2Y48A 5EGOB 4XW3A 2GBYA 2CYYA 5FRNA 4WK8F 4IL7A 2HVQA 2R7VA 4XQFA 5TRDA 4P00B 3TN93 3I59A 4HAMA 1WKMA 2RJLA 4FPJA 1YUDA 2XJVA 2H1KA 1W6PA 3D0JA 3BR0A 1ETQA 1R7JA 1AVBA 4S2FA 2HPMA 3AL5A 3I2FA 1FBUA 4BU2A 2HWB3 1S2KA 3WHCA 3DF0A 3SJMA 4D7YA 3AMPA 4A0XA 2Z1DA 3HTUA 2UXNA 2WA4A 5JSRA 2V9VA 3ZQFA 1O4TA 3SITA 4YZ2A 4K8FA 2O6GE 4RLFA 2EXIA 5LY2A 4EJUA 4CXYA 3ZXSA 3KPHA 4A12A 2H0BA 2BGPA 5C5TA 1OA4A 2WT1A 3EXUA 2LREA 1SLTA 2F5DA 3I0TA 1ZBE3 1KQRA 4OIRF 3BGAA 4BS9A 4BA6A 2HDDA 1ULCA 1QNTA 1ASJ2 3H35A 1HQWA 4UB8C 1NK3P 3SH4A 5IYYA 1U6GA 4JTOA 3GTOJ 2F5VA 2QQ8A 4F3QA 1ZVFA 3KCYA 3CJRB 3C2GA 5FY1A 1Q43A 3BWGA 2OV7A 2A71A 2GQQA 1XNBA 3OYIA 1H4HA 1PX4A 5T50A 4KA4A 1F5JA 3J9SA 1UPIA 1D0GA 2NAZA 5FD6A 1RKWA 3THTA 1JE8A 4AVSA 3TB0A 4C3JJ 3WTXC 5LLQA 3TRSB 2DOFA 5I0UA 2HTJA 3S1NJ 3IC7A 2B0LA 4IHSA 2CV0A 4M3CE 3HGGA 1V0AA 2YX7A 5BNOA 2PX9A 2E7QA 5FY7A 3WQ1A 1LTEA 1AR93 4EE2A 3RPUA 4AQSA 2PJPA 2FZ2A 3ECQA 4LE4A 1IG0A 1XQNA 1KZHA 1PO11 3I64A 1MBEA 3S14J 1H6YA 2Y6FA 2D98A 5E6HA 4V2FA 1OD3A 5ABJA 2J1TA 2P4WA 3ZYPA 2I5UA 2JE9A 2CAVA 4IEYA 4NWWA 4CXWA 4LBJA 5FYUA 1W7PB 1CN1A 3J7LA 4TXWA 2HU9A 2OCEA 1JUMA 3DBLB 3K4NA 1PVC1 3WGGA 4QXCA 1L3JA 3ROUA 2VJXA 3C7FA 4FTHA 4GD4A 5FYVA 5DG2A 1W36D 1UZYA 2YX4A 2HWC1 3L09A 3PUHA 3WTUC 1MGTA 2XGXA 5CEHA 1JU4A 1FI2A 3GZUC 4DQ2A 5C33A 2M4KA 2Q1FA 1VBD1 1YO8A 2E36A 3RS6A 4KDPA 2BOJA 3N9MA 5F1JA 4Q8LA 4Y22B 2XVLA 4UAPA 5FZMA 1MZEA 5K5RA 5KAFC 1V6KA 3T0DA 5GM0A 1RUD2 4YW1A 1UQXA 2QWWA 4B3AA 1VB4A 4G8XA 2X05A 2VODA 5FZCA 2E1MC 4RB3C 1D0HA 2MPFA 2MEV1 2DT5A 3LSTA 2A07F 1HCRA 4DXZA 4KMUX 1U78A 2ZS6B 4AVPA 4LOTA 3VBRB 1X2NA 3CUOA 4Q4V3 3WV6A 4XORA 1VTNC 5LBEA 1SFXA 3VEPA 3K4BA 1WCMJ 5M0TA 3BOQA 1JMUB 1IS3A 4BOWA 4BB3A 5F5QA 4QQHA 3WW4A 4BQ5A 3WG9A 1JTZX 4KIBA 3VBHB 4UB6C 4Q4Y2 5KXDA 1YJKA 1FOD2 3DN7A 2XG3A 1F9KA 1UMIA 2IXSA 1AR83 4CA9A 1UYXA 4P5YA 1ZA7A 4BDVB 1VBB2 2VBXA 1UY3A 4G9YA 2ZX1A 1ONAA 4LO4B 4ENJA 2VW1A 2PLV1 3EHKA 1JS9A 2D6PA 5ANQA 3G71I 3KCCA 3MICA 3WNNA 2D5VA 1C8M3 2VOKA 5IVFA 1I3HA 3CJTB 1SDDB 5E8IA 4BMBA 1ODMA 1AYM3 5C8CA 2XSJC 1JH5A 5F3IA 1Z7S3 1YW8A 2CHHA 1T56A 3TO9A 2OUJA 5JIUA 2EIBA 3FXLA 2J1VA 1VBC2 5B1AH 2ZZQA 2P6SA 4PDKA 4WM7B 1LGNA 1CQTA 3HVDA 5JSOA 2EAKA 3I49A 2B7EA 2IA0A 1Y9GA 2RS12 1S5LC 2J22A 1B1BA 3QP5A 2X9DA 1H8TB 1UYPA 4PIYA 2MNGA 1I6XA 1MEC1 1NCRA 2LDUA 5LBCA 3ZYRA 4CYDA 3CCSI 4C30A 1DU3D 4FPYA 4CRQA 4FOQA 1MNDA 3CZUA 3KYLA 2HEOA 4MGSA 3KVAA 1RUE1 4UF0A 1QWRA 1EH7A 1K42A 4NAOA 1U8RA 3R6SA 3RYRA 4MYEA 1J3RA 5FYTA 3PHMA 2OIIA 2VBPA 4ABZA 2VD7A 1PGW2 2BJSA 2WFF2 3ASIA 4CP0A 2G1MA 2W91A 1ZELA 3K51A 5EG0B 2A6ZA 4MEXF 2GMMA 2ZZJA 4LBOA 5FUPA 5LHHA 3B01A 1XGNA 2QQAA 2VCCA 3ATGA 1YS7A 2DA4A 4JDNA 3D8CA 2X10A 3FX3A 4QMAA 1MZ6A 4YWAA 2LM3A 3H9QA 1MS1A 1KU9A 1LOEA 1FATA 5A1AA 1RL3A 4P55A 4AFCA 1XC5A 1QU0A 2KDOA 4LGWA 1NA1C 2EA4A 1HKSA 2XJSA 1NKGA 1HV1A 2JUGA 1K3IA 4KWUA 1A04A 1S0GA 3VYUB 2JDPA 3GYHX 1LOFC 1SDWA 2MLKA 5FZ4A 1RVF1 2TRTA 2ZJ2A 4OOIA 2BHZA 3MF9A 2WN3A 2XVKA 3EUHC 3WG2A 4NHYA 1MMAA 3IV5A 6PAXA 2O5RA 5F5AA 5C4WB 4PK4A 3LE0A 4YW3A 3G73A 4RD7A 3BI3A 4TTGA 3MHZA 4XBNA 2XJPA 2JDHA 2JG9C 3MW2A 3KVBA 1APNA 3IBMA 4M3CF 3ZGKA 2PG4A 1XU2A 1STMA 1MKMA 2A70A 5LEJA 2E5NA 4UV9A 1QPMA 4IE0A 2HWE1 2BOLA 4RGAA 2F4IA 2UXXA 2ZFWA 3DCQA 3BZKA 3KHCA 3J7MA 2D2WA 1MZFA 5CG9A 3WZ1A 3I4PA 2AYHA 1R6RA 4MUVA 2W87A 2LYCA 2V1NA 4Z07A 2P4EA 3HMYA 5IAXA 2VBBA 1QOOA 2XLFA 5B2GB 4XJ9A 4Y1ZA 1Q8QA 1GU3A 3QP6A 1Z1DA 3NV1A 1Y0NA 3A1YA 2OQGA 5J4YA 5IK7A 4CXFA 2IVIB 2UWBA 3LZZA 1W6QB 4PLMA 5IPAA 4FAGA 3WU2C 3V64A 4IEOA 1RUH2 5H6QA 1K45A 5JXJA 2R071 1VQ9I 2O14A 3AKSA 3U75A 1U2WA 4BGDA 2FDJA 4N4OB 4OHVA 3SDBA 5D8AA 4A3DJ 2OTLI 3FN9A 2EZHA 4QX8A 1V6LA 2W1UA 1VJ2A 4V2VA 2YROA 1AJKA 1EV13 5CZKA 4RB0A 1FMVA 4LK6A 4LA3A 1T2XA 2R062 4HONA 3QCWA 3VBSA 1AYN3 2WINB 3HXLA 1I5ZA 3D5SC 3H0OA 4WXHA 1DQ4A 1V9U3 4FPFA 1IZ1A 2P5KA 4FPCA 2H27A 3LSPA 1OKQA 5JSPA 1OJLA 1WLCA 3ZR6A 2JB8A 5FGMA 2LH9A 2KHMA 3D5LA 2EFPA 2QQPA 4FFFA 3F8CA 2B46X 3IDAA 3MIDA 2ZPXA 2IPQX 1GXQA 4HSRA 4DO0A 1JHHA 1COV1 1ZM1A 2Q8KA 2BP6A 3VBFB 3RDIA 2Y33A 5LW9A 4MSVA 2XHNA 1P4XA 3VBOB 1WW5A 2XC7A 2YYOA 2ETHA 2HFHA 1GDTA 1RJ8A 3TAYA 3S32A 3BP8A 3RQ4A 3LAPA 1X33A 3WG7H 1O57A 3DUIA 1HV0A 1O8SA 5BNGA 1EH8A 1T08B 3JW4A 1DGWX 4HZFA 3LL7A 1OQYA 4P02B 1O7LA 3E5QA 2LF8A 3EYYA 1H2KA 2XXZA 5A3PA 2YBKA 2QKLB 3WE3A 4C2UA 3OYLA 3AFHA 1WLTA 4HG2A 2QVOA 3WHBA 4LNVA 3U14A 4BPZA 2ZMLA 3PUIA 2R32A 4MZUA 4L9JA 2BY1A 4S2GA 3OY8B 2R0HA 3FJSA 1OA2A 3AP6A 3SXYA 4C90A 3C7JA 2EV0A 2DVBA 5F7UA 4XJUA 4KNCA 2A68F 4CVUA 3VKMA 4CEYC 2WR9A 1IKQA 1DYOA 2RDRA 2CQ7A 2J1EA 4P9YA 1CIWA 3TQNA 2DVDA 3EUKL 4ZYGA 1USTA 3MWMA 3RZZA 5LBQA 2WNUC 4NC8A 2JDMA 1CZSA 2XPUA 4R1HA 4BY7J 4DIQA 4RGRA 1JGGA 3C7HA 1POV1 4V1PA 3NARA 3RZDJ 3OYWB 2QZ2A 1F43A 4GA9A 4W8JA 4Y17A 1REDA 5FZAA 3IAPA 2YPJA 1NE6A 2FSWA 4ZYHA 1ETYA 4QTRA 5DS9A 4AQTA 4HN0A 1LKXA 3N3HA 1ENXA 3TEZA 1AU7A 2P37A 2XUMA 3VD3A 3WTZA 5FTTC 2EFWA 2HKXA 3OOXA 4R9AA 5IVJA 4UXAA 5FZHA 4FTEA 2HWC2 3LAJA 4LHLA 1DGWY 2XF6A 5F0CA 5FOJB 2YBSA 4KL1A 2UU8A 5L7OA 2PHWA 3U9GA 4W1UA 3MKWB 2TNFA 1W0TA 5JCTA 2W08A 3A03A 3FKIJ 2R1BA 3S2DJ 1ST8A 5KK1A 3MFAA 3NEUA 4ZTFA 4PF5A 4ZZ8A 4Z2WA 2DUPA 1RUG1 2LRPA 2MEV2 2XRNA 2Z42A 4ES9A 3SISA 3SFIA 3RYPA 1JU3A 4BQAA 2G9FA 1QHDA 4LB6B 4LOSA 1UIJA 4META 4QKDA 5A3WA 5KHGA 3KZZA 2FX0A 2D43A 2EIDA 5CNAA 2EWNA 4L92A 3M1EA 3K4ZA 2W47A 3N97A 2A3YA 3M8FA 1AR62 4TN7A 3LGRA 4YGDA 4R9DA 4RBOA 1G3YA 2DMNA 3KLNA 1T6SA 5LATA 1E0EA 1OF4A 5FBJA 4BQYA 3VZLA 3POSA 3CO7C 3CESA 4J00A 3BG6A 1SANA 3ASNH 2V4JC 2HQAA 4RQPA 4YVWA 5AC93 4G94A 1W5TA 3CJIB 4YIRX 2NYXA 4N43A 4QPGB 5M5WJ 5BNQA 1OOPA 3PUSA 3NL1A 2BY3A 1LE8B 1RB8G 2WS93 1KU2A 2PLV2 4OHWA 2IW5A 1O7FA 1C5HA 1H1IA 2ISYA 3VBUB 4JK1X 2P1BA 3WHTA 1CIYA 2QQOA 4KICA 2OU2A 3ILFA 3FLRA 4JYKA 5F32A 4A45A 3NQOA 3HBKA 1UU4A 5FLXZ 3HSEA 1R093 5IFPA 3UYJA 2ICWG 5JOWA 4XOGA 5FKCA 2CW7A 4CEWC 2FDIA 1LHWA 3OGVA 2NVUB 5C7GA 3CCYA 3AKPA 4XETA 2WZR1 2PYTA 3OS0A 2JD4A 4B4QA 1HB1A 4Y5SA 5A32B 2SLIA 2DYCA 4CYCA 1JYCA 2IVMA 2DAOA 2QQUA 4CYCB 2L3DA 2W95A 5EEHA 2F4MB 1T0FC 2I74A 1F15A 2QBYB 1QOSA 1SVLA 3S5QA 1PYVA 2ZAAA 4ESBA 4N7IA 1JZ8A 1KDKA 5T5PA 1JKOC 4LK1F 1MEC2 2QFEA 1G8XA 1TQIA 2Y6GA 2YC4A 2LSOA 2MD0A 3H1WA 5FP3A 2K7LA 1RUE2 5ACA1 1WCKA 4UFJA 4DUWA 5ILSA 4DEVA 4GJYA 4AYBN 3JD71 4BLIA 2C4XA 3KP2A 5LK5A 3IRQA 3FBIB 2CW0F 3BCWA 4RAZA 1HXDA 4HKWA 3PQKA 3PU3A 2DT6A 4QPIA 2P81A 1DP7P 4LTAA 4AFMA 5HCAA 4XQWA 1BOAA 2J1RA 2VUAA 4ZU4A 3KWVA 5B66C 4B8XA 4YRDA 1E5HA 3TNQA 1PZ7A 2R7OA 4DZJA 1O5LA 3MUY1 5CKQA 4AL9A 4JX4A 2WABA 5K7HA 4ESFA 2ISZA 3IAM2 4PGGA 2WC2A 1JZ4A 4H14A 2DCEA 3JUUA 4YG0A 4IQPA 1BI1A 3IDEA 1TWAJ 5LA0A 1ZZBA 5JVVA 2VZRA 4LLNA 3LDKA 4LB5A 5C3QA 3BKZA 3HEIA 3LEKA 3GFJA 2A61A 4IHVA 4R9CA 4B3NA 1CWPA 2Y6JA 1RVF2 4ET7A 1WH5A 4LIUA 2GALA 4OYUA 3ZXEA 2M8GX 4EZ4A 5CFCB 1GUUA 1JXSA 3ERED 2ZGKA 4ZZDA 2NMNA 4GALA 2H6BA 2WFPA 5DV5A 4P1WA 1WA6X 4EWDA 1YOVB 2VZVA 4NB5A 1BC8C 2HDCA 2A73B 5JOYA 2CU7A 1RZ4A 3BR5A 2CL2A 2JENA 3M8EA 1ASJ3 1Q8PA 4LK7A 4YEJA 3ZN6B 1W0UA 5L3BA 4P9XA 2VTXA 5C9AA 2CWEA 4AAXA 1U5IA 1R22A 4RB1A 2LF7A 3K9TA 2VMIA 2ZGRA 2W25A 4CSWA 3U1KA 3OYDA 1J9IA 5H9PA 3UGFA 3OOPA 1T8IA 4FHTA 1MIJA 3GHNA 5J09A 5FROA 4YW5A 3L2YA 4A69C 3C18A 3HAGA 5FZ0A 3AB0A 4EATA 5FMCA 2D6OX 3I7DA 2LALA 3TEDA 1RIRA 1APLC 1J7KA 4WM8C 3TGNA 4X6RB 3OOUA 1V54H 2R072 5BNNB 4U2AA 3AFKA 3F8NA 4L9TA 4EN6B 4RM3A 5HS8A 2EVXA 2RM21 4E4SA 2VB6A 1WRJA 3CCVI 1FX5A 2ATFA 3PMSA 1MJAA 1E2XA 3WD5A 1NTCA 2YPDA 1AR71 3GBWA 3ENRA 3NNJA 4CUCA 4RS5C 1UAAA 3EYIA 2NRAC 2V6EA 2WZPP 2VASA 3D82A 1MQTB 4G6QA 1KQ0A 4OVEA 2VU9A 1W6MB 5HBAA 3KS7A 1TWHJ 1JW6A 5E88A 4PFOA 1LB2A 1SEFA 3KF5A 1RUJ1 1SAXA 5GZEA 3BPSA 1REPC 5FPLA 1YHFA 2IVJA 1R5ID 5HV4A 4CDUB 2WQZC 1LJ9A 4R79A 1COV2 3VD9A 1VRBA 4EZHA 1EA3A 3K77A 3HNBM 1RUD3 2X5IC 4KG8A 2PI0A 4IEJA 5I8TA 4YW2A 3ZFEA 1YXWA 3DXJF 3OV8A 5TJJA 5KXCA 3WW1A 3ZFEB 1JJ8C 4H55A 3APBA 2YC2A 4B7EA 1DDNA 1K83J 5EP9A 5IVVA 4XF3A 4DBRA 3CIHA 4QDSA 3SNMA 1QPIA 2HR3A 3MEXA 1PM7A 3A7QA 5LA9A 4Z6YA 4QU1A 1S8NA 5KC6A 2PHTA 2XAHA 2JUCA 4Q4Y3 1FOD3 1UCRA 3MW4A 4XVHA 3KCXA 5K7ZA 1OA3A 1UELB 2ZABA 1G9CA 1VQKI 2HOEA 4E8CA 5E3OA 4FP3A 4AZZA 4NVPA 4BIFA 3AG3H 5FZ7A 4FXGB 3IP4B 2QENA 1LVAA 1NUKA 1TTYA 4K2EA 1S0IA 4AGGA 3GALA 2LRDA 2GNMA 2ZJQF 5EEGA 2VQLA 5HXVA 2JA2A 4CP2A 2OZUA 4CCCA 4OZOA 4YZ3A 2UV1A 3DECA 3I4IA 4RYDA 1DGRM 1GWKA 1VQNI 4ZXKA 3CUQB 5GAGJ 5LHIA 5IVCA 1G3TA 2IEKA 1D0ZA 1MMSA 1GNZA 1QQP1 3RTRA 4XJZA 1GVJA 2IA1A 1TZOA 2NZ9A 3CO6C 1VBC3 5FYCA 1NAEA 4PCRA 4NHLA 5J3UA 2P2KA 1V6OA 1GBGA 2YXSA 2FXAA 2RS13 1MBHA 1SFEA 4JKKA 3BIEA 2IWGB 3BROA 3AKRA 2LNBA 4BEHA 1XE8A 2EIEA 2IXKA 3IT8A 4MO7A 2WYSA 1R00A 4OIOF 3O7OA 2KKOA 3DBRB 4CDWA 3L2VA 4LG0B 3QD6A 1JHNA 1TME1 1OXCA 2L2OA 2HVSA 1OSGA 3KQ4B 4AD9A 5DG1A 4LO8A 4RSUA 5FMDA 2XB0X 5ABJC 1AJOA 3HL2A 4XKVA 5LRRA 4AQ2A 3MMYB 1JOJA 2R5YB 3WF4A 4BDYA 4DY5A 4TZDA 1EAH1 2IA2A 1RUG2 1MZ5A 2GNDA 3LA3A 3PIGA 3GYDA 2DA6A 2WFF3 5KR7A 3Q9SA 4NMIA 4M9ZA 4I3PA 4WZCA 2V26A 4FXKB 4KIFA 4TV7A 2VOVA 1NE4A 4UFMA 2HQNA 1UMQA 4HXCA 3BVCA 1CQ9A 1HXS1 1WBFA 1X3WB 3IWFA 4F91B 2OS2A 5A70A 4EN8B 2VOOA 1LU2A 2Y0SN 2QLZA 3RKYA 4L97A 2O61A 1Y9QA 1IRXA 3OSGA 1LNWA 2HWF2 4JC1A 4E4DX 2CV2A 3LFMA 2K9LA 1GR3A 4BIOA 5DAPA 1LVKA 2XMLA 1E3OC 1BLZA 4M3CB 1PMIA 5FJKA 1YJLA 3ZFFB 1ITYA 2C0ZA 1A78A 3EMRA 5GZDA 2Q8OA 2EIMH 4ZYEA 3VBHC 1MS5A 1YIJI 2ZMKA 3CHXA 2P0WA 2VQCA 2VT3A 3WODF 1B59A 3AL0B 3MZ8A 3SDGA 4HV6A 4XUTA 1V5FA 2B63J 3O1PA 4K1YA 4EN7B 1YC61 3U78A 1FY7A 2XF5A 3GJAA 3L9JT 3ZMNA 2CGOA 3SH3A 3BJ6A 4XKCA 4C1XA 2OPTA 2RC4A 4UW4A 2JVGA 4LORA 1CAUB 2WA3A 3PNTA 4QQ2A 4CDQA 2CRGA 4DW6A 2KM2A 4IO9F 1YW9A 4PLOA 4DXSA 4QM9A 2WZR2 2A3WA 1V5GA 4XDOA 4JGYA 4B1LA 1IGOA 3NAPA 5IJRA 1JI8A 3GF2A 4PLNA 2M7BA 1UY1A 2VQGA 3AG4H 3QYBA 3VD5A 2M0MA 1KJLA 1URXA 4FFHA 2RDNA 1G3SA 1J83A 5C8CC 2PHFA