1LB2A

Structure of the e. coli alpha c-terminal domain of rna polymerase in complex with cap and dna
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
201
structure length
201
Chain Sequence
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription activation: the CAP-alpha CTD-DNA complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*CP*TP*TP*TP*TP*TP*TP*CP*CP*TP*AP*AP*AP*AP*TP*GP*TP*GP*
total genus 61
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2002-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1lb2A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lb2A01
3EO6A 4PDKA 5E16A 1YW7A 3WGIA 2UY8A 4I3PA 1Y9QA 2OZUA 5HDKA 5I93A 1EV7A 1U12A 4MTDA 2P5LC 3C7JA 4A0XA 2OQRA 1BI1A 2L3DA 2EV5A 4B09A 4ON0A 4ORFA 3BU7A 3V8KA 3HRUA 1W7PB 2O8XA 4H7LA 2M5WA 3JTGA 4AVAA 3ZMVA 2LDUA 1MDMA 5K1YA 1PP8F 3QACA 2OQGA 3ECHA 2KIFA 1AOYA 1MJ9A 4NVPA 4YIIA 3DXJF 1O3RA 4L9JA 2O3FA 2XAFA 4BYYA 1RZ4A 3CO6C 4XSXF 1S8NA 3J80Z 2YR2A 4B8XA 3JZVA 4NQWA 3SCFA 4EWAA 3M1EA 5KK1A 4Z82A 3PQKA 3NRVA 2DTRA 3I54A 4HF0A 4P55A 4I0BA 1ZZ8A 4AXOA 3T8TA 2MD5A 5L3DA 1LDDA 3O14A 4X6RB 4HSJA 3EUHA 2P7CB 1QY4A 1ZH5A 4AQ6A 4Q48A 2L54A 3ES1A 2EB7A 3CLPA 4WZCA 2IXJA 1J3PA 1QPMA 2ESNA 4JTNA 1FY7A 2ELHA 3GX4X 1QXRA 2FNPA 5E8GA 3NW4A 3VB2A 1Y0UA 1SEFA 1SFUA 1RC6A 2FRHA 3L9FA 1KU7A 3BALA 5BMZA 3LQQA 4BAYA 2Y75A 1U2WA 3ZN0A 4UV9A 4XF1A 4IF4A 4M9XA 2QQAA 5H20A 2Q0OA 1ON1A 2ZCWA 2RC4A 4HX7A 4ASNA 1Z9CA 4IEUA 1UIKA 5EEGA 4OIRF 4IEOA 1ZZBA 4LUKA 4A12A 3TNQA 3CO7C 1IF1A 2MHFA 4IEVA 4XF9A 4F8AA 2QM3A 3FM5A 5HLHA 4HN0A 1Y3TA 4B29A 5FLXZ 1YLLA 5FLJA 2HFHA 2EFQA 4IRHA 1E17A 3D0SA 1ZAOA 4XF3A 2A68F 4Q5SF 3QP5A 1ZNPA 4JTOA 3WW2A 5ILUA 2ZFWA 1PUEE 2ZKZA 4KU7A 2GZWA 3RNSA 4RD7A 4LB6B 4ESFA 2AS5F 2V79A 3COAC 1EH7A 2ZMEA 4Z2YA 3OGJA 2XLFA 3WTVC 1ZARA 4A2UA 1YG2A 1DPRA 2JSCA 2KRFA 2LNBA 4ZYGA 3UKNA 5FGMA 3MZHA 5LBQA 3NSTA 2D1HA 4JQFA 1XCBA 1R5HA 3LSTA 2QCSB 3F72A 2ZJ2A 2P7VB 2EJRA 3SHFA 1D8JA 3HUGA 1L0OC 4QX5A 3HSEA 3IHUA 1WRJA 1X8MA 4CGZA 1QZYA 3BDDA 1VTNC 5CADA 5E8IA 2XAHA 3WG9A 5I0TA 1Q5OA 5L3EA 3I71A 2P8TA 4OIOF 4F7ZA 1U5TA 1B9MA 2LF7A 1G3TA 4OINF 4A0ZA 2PN6A 3GFIA 3V7RA 5JHUA 2UXXA 4P96A 4LA2A 2OYZA 3QP6A 5J48A 2B0LA 3F8CA 5HLIA 4MEXF 3H92A 2Y0OA 1IN8A 3I0TA 1MDMB 3RYRA 2D2WA 3FZVA 2PMUA 2CGPA 4XFHA 4MHGA 1OKRA 3HRTA 1R58A 2IA0A 2K02A 3ISPA 5D4RA 1R7JA 1D8KA 2A69F 3BJAA 3KMHA 4IETA 2MPFA 1TNSA 1QXJA 4HZFA 3E5UA 2OD5A 5IT3A 4OMYA 4D7TA 2FF4A 3G3ZA 2O6GE 1Z05A 3WGGA 5C8WA 5FD6A 4IHSA 3KFWX 1W4MA 4HX8A 2RDPA 5K5QA 1FC3A 2FSWA 2GU9A 1XGSA 2JPBA 3K1MA 2DAOA 2VQAA 3SCGA 4XRFA 4YARA 3OF1A 1ZRCA 2K86A 1QQIA 3GVAA 3T8RA 3HT2A 2QBYB 3GZ5A 1ZRDA 1BBYA 3FXRA 1B4AA 2ZXJA 5DEQA 5HS8A 3ACLA 4E70A 3NKTA 5J8CA 1IPKA 3J80K 3K69A 1R22A 4R1HA 3N4MA 5LGNA 1T0FA 1RNLA 3T1BA 4DNCA 1F9NA 2D5HA 5FFZA 3P7NA 1YFYA 2D1VA 5AVPA 2L02A 1OFNA 5E1WA 2Q8KA 4P9GA 3E3VA 2DFIA 4FHTA 3VOEA 5KHJA 4CO8A 1DGWA 1EPZA 2DBBA 2R3SA 5BXXA 2VBXA 3IL2A 4L2NA 3F3XA 3ZP5A 4A5NA 5BOXA 4QGLA 3FHIB 3EYIA 2Q30A 1RI7A 5F6FA 1YS7A 2XGXA 2MLKA 5FDBA 3B02A 3GF2A 1IZ1A 1IXSB 1YLFA 4IEWA 1KU3A 1FYMA 3IDCB 4I09A 4EJTA 4ZU5A 3E6MA 3KLNA 5D5WB 4MQVA 1UCXA 1Q3EA 4XFAA 1KGSA 2VXZA 3U0ZA 4HQMA 2WC2A 3I7DA 4UNOA 1UHMA 5I8TA 4G6QA 4I2OA 3I5UA 4O3MA 4MGKE 4LA3A 4HLYA 1TW3A 4BNCA 5TRDA 2VN2A 1YS6A 1SAXA 2CO5A 2HQNA 5KBFA 3H50A 2ISYA 1R23A 2FNAA 3KZZA 3LAJA 3R60A 1G3SA 2P5VA 3UKTA 2B8MA 4KIGA 2G7HA 1TBXA 4EJVA 4X6QB 5JVTA 2K0GA 2IRFG 2IXIA 4CZZA 4XLPF 4EV0A 5CLSA 1S29A 5ED4A 2H6CA 1XSVA 4E2QA 2V09A 3D5LA 4HMZA 1KU2A 4TV7A 5FLIA 2MH9A 2GC2A 4FAHA 2PHLA 2GQQA 3H3UA 5LHHA 2VE9A 2V1XA 1J1LA 1QZZA 1QNTA 2IP2A 4YNIA 3E6DA 1LQ1A 3KP5A 1O7FA 1R1UA 3ECOA 3VFZA 3AAFA 3ABUA 1MJBA 4N9HA 3ERED 1IN5A 3ULQB 1VR3A 3KP3A 1QGPA 4Y15A 3C3VA 4PIXA 1O7LA 1PP7U 1HW5A 5HOOA 1CAVB 4FT8A 4M9SA 2Q1ZB 1O57A 4YG2F 4QMAA 1FLIA 2DI3A 1OPCA 3UKVA 1ZLJA 3F23A 2XVCA 1DDNA 2PBIA 2YPRA 4MEYF 4UV8A 4XEZA 3ROUA 1BC8C 3M7GA 2RNJA 4AIHA 1EYBA 3SZTA 5AONA 1NXMA 4UVBA 2F4PA 4KWJA 4UBHA 2QYOA 5EZWA 3RJPA 5DD8A 3GBFA 1PM7A 1USTA 2UXNA 2Z99A 4KIFA 5T3NA 3ELKA 4KWLA 1O4TA 1S6LA 2PQQA 3RI4A 1YO5C 1YQAA 1FWZA 2QWWA 1LB2A 3E97A 1ZN2A 3OV8A 1ZG3A 1IUYA 5HLGA 3WW4A 4KU8A 3IIAA 3K1PA 5I0UA 4L18B 3CUOA 3JSPA 4WX9A 1Z7UA 1FZPB 3TNPB 1U5TC 1DP7P 2Y48A 4EWEA 1FOKA 4KFCA 1LR5A 1JE8A 3O2PE 4ESJA 5DDGA 2DO7A 4HAMA 1OYIA 1H0MA 2JT1A 2ZMEB 1UHWA 3SHRA 2EA2A 2BNMA 1SFXA 4A5MA 4O9EA 5HVQC 3ES4A 2CQKA 2GIVA 4JBAA 4HDVA 2EV0A 1T39A 4LFUA 5E17F 1UCRA 2X0LA 5ICCA 1Z6TA 3GO5A 4N0BA 4LGWA 3QPHA 2Q4SA 4ENJA 1TLHB 2DK8A 2H0VA 4E2GA 4EM2A 5BS6A 5F64A 4DQ2A 5L3CA 2KKOA 2P4WA 1R1VA 2VE8A 4IJAA 4MGRA 4R8HA 5DCMB 2DU9A 4U7BA 2DK5A 3ABTA 2J5OA 2BBYA 1MZBA 2VT2A 1G3WA 3U9GA 2A6HF 2MNGA 2QDRA 1XN7A 3WODF 3I59B 4GO1A 1LNWA 4META 4I01A 3P9KA 4KN4X 5J8FA 2XAJA 4EJOA 1ZRRA 2XUBA 1ZG5A 3W6KB 3JW4A 3BP8A 3I59A 3R61A 1CAWB 4IERA 2VBWA 3GFMA 1WGPA 4KA4A 1QWRA 3KGZA 3IRQA 5D5UB 1H1MA 2GA1A 3HTUA 5DUIA 4KN7X 2R7DA 4EJWA 1BC7C 5BY5A 3R0AA 2DT5A 3ZMSA 4MGZE 2UZKA 2ET1A 1HSJA 1I6XA 4XSZF 2GA2A 3HOSA 2BE5F 3V4GA 3TQNA 2CG4A 3TDUC 3H9AA 5DCFA 4KDPA 1Z6RA 3U11A 1XRUA 3C3WA 1STZA 5D1IA 5HI0A 3EETA 4IHTA 2F2EA 2PAEA 3EJKA 5ILVA 1CF7A 1T98A 4WWCA 4RS8A 1UB9A 1BOAA 4WF2A 1FP2A 4GCVA 5ILSA 3GYHX 1ZGAA 2O61A 3P9CA 1BI3A 5HDGA 4CYDA 2VC1A 4BHCA 5L3BA 3L00A 1XGNA 1XE8A 3F22A 1F4KA 2TDXA 3M9AA 1YFXA 3C1DA 2PJPA 2O1QA 2M30A 1X82A 1WKMA 3LA2A 2W25A 4HSLA 2B5HA 3WE2A 1YFHA 5D8KB 3HSFA 3WTSC 1SFEA 3NVCA 1IAWA 2FMYA 3IC7A 4PIYA 1YIOA 4I02A 1X3UA 3EYYA 4LG0B 3FE5A 3OTFA 5BPDA 3KEQA 2STTA 1ZHFA 2FBHA 3CUQA 5LGUA 5E1XA 2BV6A 5LGTA 1IRFA 4XFIA 2JTVA 2VC0A 5FPXA 1G6NA 3GW2A 3CEWA 1KQ9A 2E1NA 2KJCA 1TW2A 4MTEA 1WSUA 4DINB 2FQPA 2PAKA 4OMZA 1B9NA 1J0RA 5J3UA 3BY6A 2A5YB 5I91A 2PEXA 2B9UA 2EAAA 2XKPA 4HW0A 4LG0A 2ZNYA 3WGHA 1I27A 4YIFA 2VBZA 2COMA 3MDPA 1WI9A 3HOTA 4WK8F 4UVCA 1FBQA 1FPQA 3K2ZA 4LB5A 3S2WA 2IXLA 4I98B 4CHUA 1H9GA 1U78A 4KICA 4ZU7A 1LDJA 4PJYA 1J59A 3PVBB 5BPIA 4RB3C 1XSDA 5A2QK 3F8FA 3RYKA 2IA1A 2RVCA 4YRDA 2RV8A 5FQ0A 1REPC 1Q1HA 1BIAA 4Q4ZF 2KIUA 4S05A 3G73A 3WTUC 4OIPF 3GEZA 3MPBA 1BM9A 3DFGA 4O6JA 5H6QA 2E1CA 3T5XA 2WFPA 5I0SA 1H1IA 5K8SA 3R0JA 5A2QZ 2RQPA 2NYXA 4KIBA 5ICFA 5FLHA 1T2KA 3C18A 4FAGA 2WTEA 4AVPA 3U1DA 1U3EM 2O03A 2ZBKA 2MA3A 2MC3A 2D93A 3GWZA 3P9IA 4AD9A 4EWDA 4MUVA 4LK1F 4QM9A 4AVBA 3MEXA 3Q9SA 1UPIA 2VPVA 1RUNA 2GC0A 2W57A 4HX4A 1X7NA 2GAUA 4A0YA 3E6CC 1DGRA 2QQ9A 2FBKA 3F8NA 1EH6A 1T38A 3HIFA 1OYYA 5CVVA 3V8LA 1RUOA 2A3SA 1SQ4A 3MZYA 3ZMZA 4O5VA 1K6OA 5BUVA 2ZO4A 2OAZA 2ZNZA 2QENA 4QLCU 2MLGA 2NAZA 1O3QA 1HKQA 3KP7A 1ON2A 4EM0B 1S3JA 5BPXA 4IEYA 4HBNA 1P92A 2NNNA 4H0EA 3HSRA 2BNNA 3K9TA 3DQVC 3LZZA 2PFBA 4N9IA 4Y17A 2W24A 2GH2A 3RYPA 5DUKA 1L3JA 4GYIA 4RAZA 2PI0A 2FBIA 2IXCA 4M71A 1V4RA 4Q0QA 1EY2A 2E7WA 1LJ9A 1YFWA 1Q43A 2EVXA 1YTYA 5LEJA 3DP7A 3Q5FA 2QVSB 3BPVA 1KYWA 3LWFA 4JV4A 3BPXA 1ONVA 2BGCA 4U0YA 3LWCA 4G6DA 4HF2A 2G7UA 2CWEA 2BNOA 5CU1A 1ZG1A 2DLLA 2W84A 3T0YA 1IXCA 3CTAA 3M8EA 4WXCA 4ZZLA 2NNYA 1USSA 3FM3A 3ELNA 1I1SA 4EGYA 4EROA 5I8YA 1T6SA 4TLFA 2QUFA 1GQGA 2PA7A 3NL1A 4P9UA 3WU0A 3Q9VA 2H6BA 3O6BB 2Z3YA 4HQEA 3I64A 1FSEA 2XHKA 2F5CA 4RGXA 2QLZA 2V6CA 3M3IA 4XFCA 3H3ZA 4XBFA 2Z9OA 3ZMUA 1VP6A 4MNUA 4M73A 5K5RA 5FCCA 2EA4A 1PMIA 3L2CA 3LFKA 1ZLKA 3RZZA 3SQNA 1HW2A 2ESHA 5FPZA 5LRRA 3DEUA 2HDCA 1FP1D 3U10A 4UVAA 2A61A 1R00A 1LVAA 2IW5A 4HVOA 4EMSA 3KEOA 2M8EA 2CAUA 3DKWA 2FXAA 3RIRA 1ZZ9A 5JSOA 3OOPA 1BI0A 3CJXA 2ET7A 5E1ZB 4LULA 2C0ZA 5JSPA 2XIGA 2VOOA 6PAXA 4KL1A 2XAQA 2PAMA 3FMRA 2IXHA 1EH8A 3ZQ7A 1DPUA 4FX0A 1LEAA 2PQ8A 2QVOA 3DPLC 2ATFA 1U8RA 2BEOA 4HYEA 3SXYA 3I58A 4U0VA 4KWKA 1DZRA 5J7MA 5C6CA 4ZH4F 2HR3A 3ML6A 1LEBA 3R4KA 1ZZ6A 4XFBA 1J2XA 1J5YA 2XV4S 4RB1A 3F8MA 5FB2A 4M74A 1F5TA 1HXDA 3M8FA 4HF1A 1J58A 1TQIA 1XDSA 1VJ2A 4HDUA 2V1DA 1I1GA 1IXRC 2EFPA 3N97A 1R5GA 4IESA 4A6DA 3J81Z 1UFMA 2K4JA 1ULYA 2ISZA 1XCVA 4MV2A 2HZTA 5LRSA 5D5XB 4HBLA 3U2RA 3JAMZ 3GXOA 1B1BA 2XLGA 4Q0UA 3H8UA 1ZRFA 2XLAA 2O0YA 3FMSA 4OLLA 2XAGA 3GYDA 5CVJA 1EP0A 5D5VB 4AVCA 4BXUA 4LMYA 4RB0A 4WXHA 2OU2A 3V8JA 4EJUA 1FSHA 3H1YA 3WW1A 1OI6A 4RGSA 1G4DA 1FI2A 2HKXA 1XE7A 1QO0D 1SMTA 4UXNA 4KNYA 4UHTA 3IBMA 3B73A 2GC1A 2D5FA 4MH0E 3CF6E 4IEXA 2Z33A 1I5ZA 1XSXA 3GUDA 1IRGA 5AIPA 4U88A 3ETQA 1GXPA 3HT1A 4U7DA 1W5SA 1JHFA 3RPUA 3BZ6A 2WWYA 2UWMA 5EFUA 3SMHA 3FZ3A 2K9ZA 2IVMA 1Z91A 2FMLA 3TDZC 1DZTA 1NYWA 1RGSA 1XMAA 3EDPA 2DPDA 1XMKA 4KT5C 3GZ6A 4BQAA 2OZJA 3F6VA 2CSOA 4XF0A 5E1RA 3HYIA 5J6XA 2KJBA 2R7FA 3FXUA 1H9TA 1CAUB 1OMIA 2C6YA 3HQXA 2IXKA 2CV6A 4LLNA 4GXOA 4XF4A 3MWMA 4L5IA 4AQ2A 3SZPA 5JAXA 3J81K 1BI2A 4A6EA 4BHPA 3BCWA 3RDIA 1BN5A 3ZPLA 1IN7A 4ENKA 3EHKA 3KGLA 3WTWC 1CX4A 1LRHA 2LF8A 3KE2A 1LKNA 4LJZF 1E2XA 4RB2C 3USSA 5I8SA 2BYVE 4KYWA 2DPUA 2JPCA 4IEPA 1GVJA 2PG4A 2ETEA 2J5PA 2QBYA 4G7HF 3OD0A 3W6JB 5LLQA 1CAUA 3RKXA 4ETSA 3DL3A 1D3YA 4KMUX 4RGUA 2GC3A 4RAYA 3CDHA 3VEPA 3LAPA 4M72A 1TQPA 1NE6A 2LKPA 5K5OA 4AWXB 5L3GA 1P4XA 2GWRA 3ZDSA 2X4HA 4IVNA 5LHGA 4L0YB 4IRGA 1R1TA 4D0PA 4QGMA 5DCMA 4PGHA 4ENMA 2JRTA 1O5LA 3KCCA 4ZYHA 2XL9A 2FA5A 3WTZA 2RN7A 5CVUA 3TO9A 2L4AA 2QQBA 3S7IA 4MGYE 3WW3A 3EQEA 2OZ6A 2CW0F 4PIZA 3QOPA 3RTRA 5LHIA 2XASA 3MYXA 1SD6A 1J3QA 2YU3A 2MH2A 3HHHA 4NHJA 3E5XA 4CDGA 4Q0VA 3E5QA 4Q0SA 2PHDA 5DD4A 4R52A 4QGNA 4ONUA 1C0WA 5JCTA 1FX7A 1WQ2A 4M6XA 3M70A 2HWVA 3PQJA 1O3SA 3SFZA 4IEQA 3ZMDA 1U5TB 3GFJA 4J1WA 4CICA 2M87A 1YFUA 2JZYA 3LA7A 3HRMA 2UYBA 1D5VA 2FOKA 1OR7A 1OD5A 2Q2EA 1HQCA 5JI6A 1YHFA 4Y13A 2P17A 2KXLA 2IJLA 4RGRA 3FF5A 3QU3A 5L3FA 2QNKA 2EA7A 2WV0A 3PNAA 4ENNA 3REOA 2VODA 2FU4A 2QZ8A 1CAXB 4WCGA 3DN7A 2YX7A 1ZREA 1SD4A 5FD5A 1IPJA 3IDBB 3GLXA 3ZN1A 3JTHA 4YFNF 1A04A 1XGMA 3K1NA 2G9WA 5BQTA 2VT3A 1FXZA 2HJIA 3SCHA 1G3YA 4XFGA 2Y0MA 2EFOA 3CJNA 1ZZCA 1LDKB 5FQ0B 2DCTA 1JGSA 4HV6A 2HKOA 2I45A 3EBRA 3CO2A 1V70A 2HYGD 2YX4A 4L11A 3KLOA 4AIKA 1MKMA 4WBBA 3VHRA 2DQLA 4M6YA 4ZU4A 4G7ZF 1CAWA 2EFNA 1XD7A 5LEKA 3IWFA 3KP6A 1QBJA 1HW1A 3IKVA 4PGGA 1W7PA 4EM1A 1YUDA 2IC1A 2Q0AA 5CJ9A 4KUMA 4GULA 2DQRA 4Z07A 3QAHA 1MD0A 5FFXA 3WTXC 4LTAA 5ICGA 5CYVA 4MGIE 4MZUA 2XRNA 3CUQB 2VBYA 1KU9A 2OA2A 1OYWA 3S7EA 2RGVA 5D4SA 3BOQA 3DF8A 1ZX5A 2W85A 4G9YA 4QM8A 1JXSA 1FBSA 5ICEA 1NHAA 3KSCA 3V7SA 4EQQA 2QJVA 1F1ZA 2OBPA 4IPAA 4D7SA 3OCPA 3NQOA 1K79A 2UY9A 2IPQX 5JFRA 1HKTA 5JSRA 3HRSA 3LAGA 4E2SA 3RPQA 3F6OA 1S7OA 4FX4A 4G8XA 2NS0A 4OIQF 1XGOA 4UBGA 2STWA 4L9NA 3H7JA 2M1BA 1TQ5A 3MQ0A 2P6TA 4U0WA 1RTVA 3IWZA 4UXAA 3WU1B 1S7AA 3E6BA 2EK5A 1GHCA 5D6EA 1ZVFA 4PCQA 3FFQA 2VOPA 1WLTA 4LK0F 3F21A 2F5FA 4HVQA 4QWQA 2F5DA 3H1MA 5E20A 2VONA 1SD5A 3GFLA 3ZMTA 3CUQC 4Q29A 4G7OF 2XROA 3BROA 4BH9A 1HKSA 2IT0A 4BHBA 1L3LA 5JR7B 4YFKF 5KHKA 2K4BA 4P9FA 4ZYDA 3LQRA 1ZZ7A 1J9IA 2L01A 3TKYA 2HS5A 3QRFF 3D82A 5FLXK 2HEOA 1ZGJA 4J1XA 1B59A 3TGNA 3ST7A 5ERIA 2D45A 4I7HA 1KYZA 1ODDA 3L7WA 4S04A 2EWNA 4P5OA 3IRRA 2XKOA 4JVAA 2E7XA 3FHZA 3S0MA 4M9ZA 1FNNA 1GQHA 2XL7A 1JUHA 1DUXC 3KP4A 3IKTA 2P5KA 5KVRA 3TOAA 1CAXA 1V3FA 3JSOA 1KQ0A 2H09A 3BJ6A 3FWEA 4HOBA 2K27A 4L0ZB 2M45A 3FJSA 4IRIA 3VODA 5IT9Z 4IEZA 2HTSA 3L09A 2EFWA 3BB6A 2Z69A 1FBUA 3PFIA 4XFFA 2ZKLA 3L2HA 2P6SA 1YWKA 4HN1A 1IW7F 1P2FA 3WE3A 2UYAA 5KHHA 3FXQA 3O3KA 2OA4A 1RIOH 4PZJA 4K8FA 3BJOA 3BWGA 5JR3A 5D8LB 4O9GA 3D0JA 4HVRA 2MBFA 3DV8A 5DV5A 1Z1DA 2ACJA 2D40A 5HDNA 1GXQA 2ETHA 1CF7B 2H94A 1HBXG 1TQMA 3KZYA 2HGCA 4L9TA 1P4WA 1JHHA 2CAVA 4G94A 3I53A 5H6RA 3TO6A 5KHGA 2FEZA 5E18F 2HQRA 3QU6A 3TOBA 3HTSB 1U6GA 4HA8A 3FX3A 4HLTA 1P6RA 4Q0PA 4ZZDA 4UUVA 2FQ3A 1SD7A 5D6FA 1WA4A 4MQ9F 2V1UA 5EEHA 4ESBA 3PLQA 1KA8A 5DYMA 3MFKA 3EQLF 4GYGA 1UW8A 1W7PD 1AWCA 5CVRA 1IN6A 2RKHA 3RKYA 1BIBA 2EV6A 2OPKA 5KHIA 2CFXA 1IN4A 3DPTA 2GXBA 4XETA 4R79A 2CYYA 4LEJA 5AIQA 2V9VA 1K78B 1ZYRF 4K2EA 5TJJA 4WVZA 3J7AO 2A07F 1O3TA 3WTYC 2N7GA 1MGTA 1YW9A 1J7KA 2H27A 1SFNA 5IT9K 4OFGA 5HS7A 1K78A 3NEUA 1WWXA 4BIFA 4EVIA 1MJAA 5BV6A 3WTTC 4YFXF 3TO7A 3H7YA 4IXAA 3CLOA 1CGPA 4CXFA 1O5UA 1RL3A 3LOIA 2AXLA 2HTJA 2KIMA 4ZYEA 4YYOA 2HYFA 2IA2A 4NB5A 3I4PA 2PFWA 2ADUA 4L9VA 4HV5A 1PDNC 1X8EA 2VECA 1BJAA 4LLGF 2LSOA 3BPZA 2E9QA 1TTYA 3K0LA 4LLLA 2PLYA 2O8QA 4OOIA 1J75A 1J3RA 2Z5UA 4YSFA 3H1WA 1CAVA 4LLOA 4JK1X 1B6AA 1FT9A 4WXDA 2PYTA 1NZCA 1HSTA 3MCZA 4I0AA 1XB4A 2PTMA 4L5JA 4QXKA 1W5TA 2K7LA 3RKWA 2DW4A 1P4AA 3JAMK 1K7AA 1XDUA 3KP2A 5CVIA 4KMFA 4FBFA 1FYLA 1TNTA 1FYKA 2L4MA 3R6SA 2HOEA 5HS9A 3NJZA 2GXGA 3V7CA 1R36A 3FMQA 5I0RA 3G7DA 2A6EF 4LUMA 3HHGA 4XLNF 3KETA 1YYVA 4AIJA 1NE4A 3SXWA 2NRAC 1KQ8A 2PMHA 2FE3A 3LA3A 4HLXA 3F8BA 5FO5A 1UIJA 3CL1A 2YSRA 3QPTA 4LD5A 4EGZA 1SMYF 4Q47A 4MX3A 1YW8A 4GGGA 2Z2SB 3MAJA 5F1RA 1UD1A 4OU0A 2F5EA
chains in the Genus database with same CATH superfamily
2ZHKA 3EO6A 4GWMA 1DGRM 5E16A 2XGCA 1BOBA 4I3PA 2QQ8A 5K7ZA 2OZUA 5HDKA 2E7AA 2VCBA 5I93A 4FTSA 1U12A 1F2NA 2DURA 4A0XA 2P3YA 4FPFA 1OUXA 4LHLA 4ORFA 3V8KA 2XB0X 4HSRA 5CFDB 4XC9A 2CWMA 5FLMJ 1MMGA 1AX2A 1SLTA 3JTGA 3VYRB 4DO0A 4JQTA 5A3NA 1MDMA 5F1JA 5K1YA 2QQWA 1L7LA 3OYLA 3ECHA 2KIFA 1UMQA 1AOYA 4RR3A 3AKZA 4NVPA 3DXJF 5F32A 2O3FA 2XAFA 4XSXF 2VI6A 3N9MA 1AYN2 1UAAA 4Z82A 3NRVA 1BVP1 4HF0A 1HN0A 2LTNA 3LOBA 3A0HC 3HNYM 1V0AA 4IL6C 4X6RB 4HSJA 2GH8A 1Y9GA 4AQ6A 4Q48A 4JGZA 3NAPA 4WZCA 5FJHA 2ZSHB 1QPMA 1K4SA 4KGQA 3VBSA 2ESNA 3M8LA 3I9V2 4XABA 1QXRA 3ZN4A 3ZYRA 4AFDA 1XX5A 4L92A 4CCEA 3VB2A 1HQNA 1SFUA 1RC6A 3VYUB 2FRHA 4HKLA 4CSWA 3BALA 4BAYA 2Y75A 1TMF2 2BZDA 1SCRA 4F91B 4FTBA 3NWSA 2Q0OA 4HX7A 2ZXWH 4ASNA 1UIKA 4TYSA 2ZJPF 4IEOA 5FKCA 2GDFA 4A3DJ 1AR61 3CO7C 3NWKA 4IEVA 4XF9A 4BBSJ 2ZABA 3QD6A 1BR2A 4LO4B 1R1A1 5FLJA 4IRHA 3D0SA 4CU9A 3MW3A 1ZNPA 5A3MA 3WW2A 3OG2A 5CG9A 1GNHA 1E5RA 4XRSA 4K7JA 4TWTA 4UOJA 4RD7A 3ZSJA 2D44A 1F4HA 5HXMA 1WMEA 1EH7A 1QF3A 5B4XA 2K3FA 2A6ZA 2XLFA 1LKXA 4LR4A 3VBRC 4A2UA 1UYPA 3THCA 1DPRA 1BXHA 2WT0A 1MQTC 4EEFG 4JQFA 1XCBA 4A42A 4HETA 3F72A 4XQWA 3SHFA 4LBJA 2VKEA 4YM1A 1MBJA 4FETA 1L0OC 4G4FA 3ZFGA 1JZ5A 1WRJA 1QVUA 5FZBA 3BDDA 1WLCA 5CADA 4W50A 2XAHA 3GTOJ 5IW0A 3J7ZI 1Q5OA 5JI9A 2W1WA 2P8TA 4OIOF 1U5TA 5FYZA 4A0ZA 5J37A 3ZMOA 3FBIB 2CW7A 4P96A 4LA2A 2IFRA 2EZLA 3HPNA 5HLIA 1KGYA 3FZVA 3FXOA 1Z21A 3MD2A 4MHGA 2CUZA 3W6VA 2IA0A 4YWAA 2K02A 2YC2A 1R7JA 2ZHNA 1QJU3 3G4SI 1TNSA 1LESA 2V1NA 1Y8QB 4HZFA 2QQUA 4D7TA 4R9BA 4XHXA 5FD6A 1X33A 2BHYA 2RM23 1G9CA 2V9PA 2SBAA 1W4MA 4HX8A 2RDPA 1FC3A 1JKPC 3VD9A 4F83A 2MW8A 3D5RC 2DAOA 2VQAA 2R7WA 2I74A 3I3EA 2IS4A 3HT2A 4AC0A 3I2GA 3GZ5A 1WJDA 3J9SA 4XUOA 3DLAA 5AC91 2ZXJA 4EN7B 3PM1A 3SDGA 5CISA 3FK6A 1UMHA 3RZLA 3NKTA 3J80K 3K69A 3PFYA 4BQYA 4XTMA 1BQPA 1ODMA 4QIWN 1F9NA 5IVBA 2LFBA 5FFZA 3VBHB 1NLSA 1RUH1 1AA7A 3B6AA 5F27A 1UZZA 5ANNA 4BEHB 4Q4V3 4K6BA 4GH4B 5KHJA 3LCPA 2R3SA 2HBUA 4M3CA 4A5NA 2ENRA 1OLME 3POIA 3AYDA 2VGDA 2EXJA 2XGXA 1DQ4A 1WA6X 1WHUA 1ND3B 1IZ1A 1GP4A 4NAOA 2DF7A 1Y6IA 1VBA2 1VQ5I 1YLFA 3HKZN 1FYMA 3INAA 4ZU5A 3KLNA 1Q3EA 1YX3A 3BTYA 2VR4A 3OEBA 3LSPA 2WC2A 5A33B 5GTIC 1AJOA 1YO8A 3OYGA 4O3MA 4MGKE 1F15A 4LA3A 4HLYA 4BLIA 5LBEA 1VBD1 5TRDA 1YNAA 1X9PA 2N8GA 3KIOA 1IUFA 3K48A 2OS2A 2FUG2 2VNVA 4CDUB 4Y5SA 2ZPXA 2YS9A 5CFDC 1XU1A 4OULA 3BG5A 3AZYA 4CDQC 2OW4A 4FPCA 3DPRA 2G7HA 4EJVA 3BR5A 2A70A 4A45A 2PLV1 3JR9A 1RXFA 5JVTA 2IRFG 3DTKA 2B45X 4YZ5A 4CZZA 1X9TA 3I3BA 4ZHNA 1ST8A 4HT1T 5ED4A 2OT7A 1MZ5A 3AKRA 2L0KA 2ZZJA 4E2QA 2ZX1A 4HMZA 3H9JA 3THTA 2MH9A 4A3FJ 3O12A 1FIPA 5HXVA 5LHHA 1IRXA 1J1LA 4JDMA 1LQ1A 4UW4A 1R1UA 3VV1A 3VFZA 1MJBA 2XH6A 3FXLA 1QJY3 1SLBA 1MNDA 4LBQA 1AR62 1VR3A 1EA3A 4HOOA 3MW2A 2ZOEB 1MS3A 1NCQB 5CBLA 4QPIC 5KXDA 1CAVB 2LY1A 1GNZA 4YG2F 1FLIA 2B4KA 3I4MJ 2E33A 1HB1A 3A4UA 3ZMNA 2RG4A 3HNMA 2NOJB 1VAKA 2K9QA 4UV8A 2YPRA 4MEYF 1PVC3 3T4VA 4YW5A 2RNJA 2WZEA 1X2MA 1Z7S2 1O6UA 2D97A 5EZWA 3RJPA 2ORXA 5DD8A 5DG2A 3IH4A 3OBRA 1USTA 2BW8A 3ELKA 4DYQA 4KWLA 3N05A 3RI4A 3I2DA 1GZTA 1FWZA 2WB1N 1XC6A 3GLLA 5ACA1 1ZN2A 3OV8A 5BNNC 1IUYA 4NC8A 4WVMB 4FTEA 4K21A 1TNRA 5I0UA 4BE1A 3O1PA 4JKLA 2R7XA 3TNPB 4B44A 3C2UA 3WD5A 1NK3P 1FOKA 4KFCA 1LR5A 2L7KA 3O2PE 4KG8A 4HAMA 1H2LA 1OYIA 1ALYA 5F7UA 2JT1A 2ZMEB 3JRDA 3TN92 2XPUA 3EUAA 2EA2A 2WN2A 3OPZA 3ZFEB 2ZJRF 1AX1A 1VRH2 2A7AA 3PIJA 1HCRA 2L5QA 4UUSA 2CQKA 2DCJA 5FYVA 4JBAA 2CGOA 4WVMA 4UUTA 4LFUA 1YRNB 5E17F 1PX3A 2X0LA 3GO5A 3CLQA 2JDUA 2XB6C 1TLHB 5J1UA 3DTIA 2H0VA 5BS6A 5F64A 1YRNA 3S6PA 1GU3A 1R1VA 2VE8A 4IJAA 3P5JA 2GMMA 3PUIA 3OWTA 2J5OA 3BG3A 2A6HF 1XN7A 3I59B 4Z2AA 5KXEA 2VQTA 1R091 2VKHA 2A6WA 4OI2A 4IHYA 1W8WA 2XUBA 2VQCA 4FVVA 3GCXA 1UG2A 2LRPA 4IERA 4N53A 4QKNA 1M1EB 2DFEA 3KGZA 3AP9A 2VC9A 1ETQA 1XB9A 2GA1A 3HTUA 2CNAA 1QH7A 4GRIA 4DGWB 1K4TA 4EJWA 4UF0B 5BY5A 3R0AA 4IZZA 2DT5A 3CKHA 1TWFJ 5ANQA 1I6XA 1HV1A 3HOSA 2BE5F 1P7IA 4PFOA 2Q1MA 3TQNA 1RUE1 1PK6C 3AX4A 1N1YA 5LA1A 3C2BA 4KDPA 4OHWA 3VD3A 3ZIXA 3EPZA 5D8AB 1LGBA 1FNZA 4FQ4A 4YGBA 5HI0A 5HCHA 3VHPA 2F2EA 3P1IA 3HL2A 4IHXA 4WM7A 5ILVA 1CF7A 5IFPA 4YM3A 4RS8A 1D0HA 1BOAA 2DA6A 4P5HA 2DV9A 2RMU2 5ILSA 4IXLA 4IV3A 3CCMI 2J1RA 5J98B 3TBDA 3WUCA 4CYDA 2B63J 2Q1FA 2VZTA 3JD73 5DMYA 3I2HA 4NC7A 2ZZQA 2WNVA 5LWBA 2DA3A 4EN9B 2R1BA 1OQDA 3LA2A 1R64A 4C3HJ 2VKDA 4HSLA 3KYCB 2ZGMA 5D8KB 2XONA 4Z2WA 1SFEA 3NVCA 4FI9A 1AVBA 3RWKX 4QX0A 4D8MA 1APLC 3FE5A 2RDNA 3OTFA 1VQLI 1GOFA 3CUQA 5LGUA 1UOBA 3JB8A 5E1XA 2BV6A 5LGTA 3BT9A 3HJRA 5SV8A 3C2GA 2Y9ZA 5FPXA 4TTGA 2BJSA 1VPHA 1C8M2 5FYSA 3ZSKA 4CDQB 3CIHA 3HXLA 3V65A 4DINB 3IDAA 3R0RA 3I3LA 4Q4V2 5J3UA 3BY6A 3HJEA 1XYNA 2PEXA 2B9UA 5FYTA 4HW0A 3MBWA 3OYFA 1DP0A 1YYNA 3WGHA 2XBO3 4GH4A 4PSXA 1BCXA 3RGBA 4YIFA 2VBZA 3RRDA 5M3MJ 3HOTA 4WK8F 3S17J 4UVCA 1FPQA 3BKZA 2K85A 4I98B 1H9GA 5C9AA 4XILA 2D3PA 1YJ9I 4Y5Z0 3MKLA 4QT6A 3PVBB 3RI8A 4DYCA 5BPIA 4NHLA 2DUOA 5FPAA 3RYKA 2VBDA 3O7OA 4CA9A 3QYFA 3BTLA 3WP4A 3QH7A 4FP2A 1REPC 2R071 1HXS2 4DEQA 1GFF2 5E79C 2VNRA 1W0TA 3G73A 5FZIA 1LTEA 1ASJ1 1DYOA 5FY0A 4B1MA 2MSYA 5H6QA 4IOCF 4C1XA 5K8SA 5A2QZ 5FK8A 2NYXA 5ICFA 5BNOA 4AVPA 1MQTA 4ZKTB 1K45A 1WJ5A 2MC3A 2C4XA 2D93A 2IS2A 1SLCA 4LK1F 4QM9A 1Y1VJ 3MEXA 3Q9SA 1G8WA 3HN3A 5DAWA 2QQLA 1F8VA 5KNLA 2GC0A 2WNVC 2ZJQF 1X7NA 4A0YA 2R4GA 1X1CA 3HAGA 1RMU3 3F8NA 4P9XA 4WV8A 2G4IA 2GOXB 5EYYA 3VBUB 5FMCA 1RUOA 1A6CA 1SQ4A 1S0BA 3ZYPA 3LEGA 2GMPA 3ZMZA 4O5VA 1VE0A 3C8XA 3B6CA 1J83A 2G0EA 1W8NA 3GBWA 3ZN6A 2F4LA 1YHQI 3VHNA 2UURA 3DCFA 2MLGA 2NAZA 3A0NA 2HWB3 2YY1A 5J1XA 2VW0A 1UYZA 5BPXA 4K3UA 4AI8A 1FOXA 3Q9OA 4HBNA 4IEYA 3JRFA 1RUC1 2GN7A 3B7MA 3K9TA 3DQVC 1BMV2 3FHAA 3GF6A 5ACA3 4Y17A 5J4YA 2A75A 5IFTA 1TT0A 1EUTA 3RYPA 1R6RA 2ME6A 2HPMA 2PI0A 1EJ9A 4Q0QA 3J7AY 1VRBA 1UXZA 1F5JA 3KZIC 1I5PA 3S3MA 1MACA 1PZ7A 2E7TA 3WQBA 3ZIWA 1RVF1 3BPXA 4U0YA 1IS6A 2G7UA 5KXBA 2GLOA 3T0YA 4CP9A 1W9WA 4WXCA 3KQRA 2J42A 4XLFA 3LKJA 1USSA 3FM3A 4Y7NJ 4EGYA 4TLFA 3NL1A 3CD6I 2OC6A 3WU0A 4KT6A 4AUXA 3O6BB 1GNYA 3I64A 2WV1A 5IVJA 5FZ1A 3RZOJ 3O0VA 2WA4A 3ABMH 4AOCA 2GN3A 2XF6A 4XBFA 2Z9OA 4PJLA 5IVFA 4XDPA 3MUZ1 2DA5A 5FCCA 1K61A 2YPDA 2ID6A 3DEUA 3U10A 1UZWA 1OUSA 2A61A 1KEXA 1LVAA 5B1AH 3KEOA 1ZELA 1AX0A 3BUCA 3OOPA 2VU9A 2YFUA 1WLWA 1FOD1 3KV6A 3FUOA 4BQ2A 1RHI2 3CP8A 1BZWA 3AP6A 2AREA 1YIJI 1YI9A 3PIPF 4KL1A 3PUFA 2FQ4A 4CXXA 3FMRA 3DXUA 2O14A 5C70A 1LEAA 1K83J 3DYOA 2QVOA 2O8KA 3IAS2 2VUAA 3I58A 4KWKA 1YJNI 5FY1A 2JMWA 1M06G 2JX9A 4QQHA 5C44J 3ML6A 3R4KA 3FBYA 4XFBA 3HR9A 3POFA 1HKDA 1J5YA 4BJTA 4AI9A 3H8OA 4DXTA 1HXDA 3M8FA 4HF1A 1C57A 2HWF2 5A6QA 1VJ2A 5FBZA 2Y60A 5B66C 4HDUA 4SBVA 2FZ2A 1YIFA 1UYYA 1QKQA 1JTXA 1R5GA 2KZGA 3NAUA 3WUDA 2K4JA 2I8DA 3ZQLA 4DRVA 5D5XB 4F55A 3H3LA 2X5IB 4NR1A 2YC0A 4HBLA 4QXBA 2J7MA 1QOTA 4LPLA 1ZRFA 3CQZJ 1UQXA 1DBNA 5L7OA 3GYDA 5CVJA 2IVJA 4CE8A 5D5VB 3K4CA 1C28A 3LF7A 1JT0A 2VCMA 2E19A 2VZ3A 2OU2A 3VBOC 1T2XA 5D2AA 4RGSA 1G4DA 1FI2A 4UXNA 3K77A 3JQWA 3ZXLA 4PK4A 1JGGA 2VZVA 5LK7B 2AZ5A 3CF6E 2DODA 1F43A 1XSXA 2KP6A 4GJZA 2HWF3 5AIPA 4DBQA 2BOJA 3ETQA 2D3SA 1RKWA 1MEC3 2A1XA 4UWDA 5L73A 1RRJA 3RPUA 3BZ6A 3IN9A 5EFUA 2PHUA 3BIWE 3ACGA 1VMHA 1NG0A 1G2HA 2YB7A 5K0UB 1Z91A 2HVRA 5EDNA 2BGOA 2R043 1XMKA 2CSOA 4ZPIA 2NPIA 3HYIA 2HXIA 5E1RA 1J09A 3FLTA 3BZCA 3K6GA 1CAUB 1OMIA 2C6YA 4NJ4A 3HQXA 3VKNA 2CV6A 4GXOA 3SZPA 2XVGA 2QKLB 4BHPA 2HWE1 3RDIA 2NXNB 1LECA 3VKFC 2HBTA 2X6YA 4AFMA 3VBFC 2ZACA 4S2DA 5DZGA 3JCIA 4RB2C 5DDJ3 4CDWC 1ETYA 4KYWA 4M3BA 3N35A 2PG4A 4CP0A 3PNYA 2R042 2OCEA 1ULDA 4MHRA 3N7KA 1IO2A 2GNDA 2GC3A 2YG0A 3AZXA 1MVEA 2Y38A 5K7FA 4AWXB 1JU3A 5EWSA 4XK4A 1ETOA 4L0YB 2RS11 1W06A 2ZSIB 4XUTA 4D0PA 3A21A 1FATA 2P1BA 3KCCA 3PURA 3TMOA 5EJ3A 3HM5A 1Q56A 2HWC2 5J09A 2F48A 5CVUA 2L4AA 1GZWA 2GNTA 3O1SA 4PFPA 3LSMA 2CUFA 2OZ6A 2YYOA 2JA2A 4QQ2A 4PIZA 3QOPA 1VAVA 4XUPA 5FWJA 1JTYA 5LHIA 4AI0A 2LALA 1UX7A 2YU3A 3WLUA 3E5XA 3CCEI 3E5QA 4BE0A 4YZ2A 5C5TA 4YVWC 4Q27A 2VOXA 5C71A 5DD4A 4ZY9A 4OVEA 4QGNA 5KAIC 2PHRA 5JCTA 3ZQQA 4M6XA 4OQ9A 2LC2A 2W9XA 2B9SA 1CONA 3POWA 1U5TB 4CEYC 3GFJA 5LCWL 4J1WA 1W3VA 4C0HA 3TL4X 4QDSA 4FFIA 2UYBA 1WJCA 5CNAA 5T5LA 2JUCA 1YHFA 5FZOA 1QQP1 2J1EA 5C9AB 1EV11 3FF5A 3WP6A 2DA7A 2D6KA 2L2OA 1YQ5A 2VODA 4AAPA 2NVYJ 2QZ8A 1ZREA 4OUMA 4AAXA 1OQ1A 4G9SB 3ZN1A 4MXWA 4L0PA 5IYCJ 4Y20A 1KITA 1A04A 4AEMA 3K1NA 5BQTA 3WP3A 2WWUA 5BNPC 1KJRA 2HJIA 3SCHA 2Y0SA 1VQPI 1W36C 2Y0MA 1XE0A 3VBUC 2W52A 2FCTA 3MKWB 2DCTA 1OJLA 3TEDA 2XGDA 1L7RA 3WF1A 3AKPA 5C8CA 3JRGA 1MMDA 2HYGD 2DT7B 3ACHA 4L11A 2UU8A 3V0AA 4CPBD 5JIUA 3BZKA 4G7ZF 2EFNA 1OKOA 2BP6A 1QBJA 3CF5F 3ZQGA 1HV0A 2XWJB 2Z42A 3IKVA 4B4PA 5G04L 4EM1A 2DOAA 4Z07A 4YG0A 5JOWA 1LPQA 2DA4A 1G9FA 2B7YA 4GKYA 5FZFA 2AQEA 5FFXA 2UUZA 2XWBB 4P9LA 4MZUA 5DZEA 1IG7A 4NN0A 5KAFC 2VBYA 1NCRB 5LASA 1OYWA 5FIXA 4QX8A 3T30A 2TNFA 4LKDA 1MZFA 2R16A 2YROA 3ZSLA 3KYLA 4YVWA 5DAPA 5FYCA 3DGTA 5ICEA 1REDA 1NHAA 3V64A 3N7LA 3UK9A 2COBA 2QJVA 5ABJB 1F1ZA 2OBPA 5A7SA 3RZMA 4GJYA 4D7SA 3H0DA 4A6SA 3ACIA 4BBRJ 1BW5A 5CQGA 2G19A 5BNNA 3HRSA 4YELA 2AR6A 3K4BA 5FYYA 3D5OA 1DF0A 2JG9C 2RS32 4NPRA 4E2SA 5DAQA 3VD7A 4AM3A 4CCLA 4FX4A 1AR72 3MW4A 2Q8EA 3UKGA 2QQPA 3H7JA 2M1BA 1TQ5A 3MQ0A 4CDUA 1C3HA 5A1AA 2J1SA 3JBG1 2GP5A 3R4SA 2EK5A 1W03A 5F8PA 2J1TA 2KRHA 3T4HB 1MS4A 4CDXC 4XMIA 3F21A 3Q8EA 4COUA 1YC61 2R5YA 5E20A 1R4MB 2VONA 1QJEA 1SD5A 4ZTFA 5JMCA 2XROA 1GZWB 1VBA3 5D8AA 2IT0A 4BHBA 5BNOC 1RUE3 2R5ZA 5KHKA 4ZYDA 5GLVA 1J9IA 4COZA 1D1AA 2L01A 4IGOA 2HS5A 3WG4A 1PIV3 5BNQA 2RV9A 3TN91 5C8CC 5FYMA 3WNOA 2JIJA 1GOGA 4CYCB 3IAQA 2AACA 2D45A 4I7HA 1KYZA 2BU9A 2R041 1CPNA 4P5OA 2VBBA 4M9ZA 2P81A 1I3QJ 1JUHA 2WS93 3LFIA 3PNTA 4F52A 5TSWA 3TOAA 4UW6A 2RS12 2J1AA 4JAAA 1GZ9A 2ILMA 4HOBA 4LT5A 1DLLA 4L0ZB 5E3NA 3LIGA 1MBHA 1I39A 1SLLA 1GT0C 2DTWA 4AVVA 3L09A 1H89C 1HDKA 2CQXA 2IZWA 2VBPA 1T0FC 4X8NA 2UYAA 1YEWA 3FXQA 4Y22B 3O3KA 4BMEA 3LDRA 4PZJA 5IHRA 1E3OC 3TEYA 3K2AA 5JR3A 5D8LB 4O9GA 3D0JA 1W2TA 2DU0A 3DV8A 5FRMA 3L2VA 2JA7J 3KCYA 1ZQ3P 4BACA 1TQMA 2E5NA 3KZYA 2HGCA 4L9TA 1NTCA 1B8IB 3NO8A 3PMSA 2FEZA 2XGEA 3MV11 3TOBA 2NVQJ 1U6GA 5ISLA 4Y33A 4HLTA 4KMQA 4XJZA 5FPUA 2DFHA 3BCBA 3VD5A 4ET7A 4X8PA 4Q0PA 4Y1VA 4ZZDA 4EJRA 2FQ3A 1V6IA 3QPSA 2V1UA 4RS5B 3PLQA 1KA8A 1HB2A 3Q8AA 4PCRA 4ATEA 1JUIA 3APBA 2BVVA 4F3JA 1IDYA 3MKZA 1W7PD 1AWCA 5CVRA 1H8TB 2A3YA 2EV6A 3JRAA 1IN4A 1G59A 4B43A 4LBLA 1K78B 3W59A 3O1TA 5KXCA 2H27A 2E71A 3I3DA 1SFNA 3T0AA 3H5AA 5BNNB 4BIFA 2C1FA 2GALA 1IV8A 1PGW2 4GFBA 1D5YA 4MADA 4ZYEA 5FP3A 4NHKA 2YU9J 2HYFA 2IA2A 2HWC3 3I4PA 4AHWA 2PFWA 2ADUA 1PDNC 4LLGF 2DMTA 2E9QA 2ZGLA 4LLLA 3ZVXA 4JX5A 1J75A 3H1WA 1CAVA 4ZS3A 4ASLA 1GVDA 1B6AA 4WXDA 3PUHA 4OQ8A 1PM4A 2ORZA 2W48A 1XB4A 2AYHA 4Y26A 4OZOA 3CCVI 4DXZA 5FTTC 1OFSA 2M8GX 2LVSA 2ZB9A 1Z7LA 2QEXI 3MIDA 1O4YA 4BXXJ 4YVSB 4NHYA 2HEWF 1FYLA 1TNTA 1BKZA 3R6SA 2HOEA 2WNOA 2E35A 3VZMA 4YZ1A 2DCKA 1QNWA 2DCYA 3KYDB 5FKNA 5I0RA 2A6EF 4K40A 2NRAC 2EPFA 1KQ8A 1OF3A 2IGOA 2PMHA 2FE3A 3LA3A 2R49A 2OKXA 4HLXA 3QPLA 4M3DA 5L7OC 3CL1A 4Z1VA 3ZOIA 3S2HJ 2VMEA 2D3RA 1YOVB 2KT0A 4FSJA 5FP7A 5B4NA 3GJAA 3LEKA 4LE4A 1E3PA 4OU0A 2NLRA 2RM21 2HOSA 2BY1A 3M07A 4MXWB 1Y4WA 3S3NA 4IHVA 1ZTRA 3POGA 4C0BA 1ULPA 1NXD1 1EV7A 1UZCA 3K46A 3OYAA 1BI1A 2L3DA 2VOTA 2EV5A 1XQNA 3BU7A 3HRUA 2O8XA 2PXJA 2Y0IA 4H7LA 1PK6B 5FMOS 1PVC2 3A1YA 2LDUA 2EZIA 4AIDA 2OQGA 3AKTA 3J4UH 5IP9J 4YIIA 2VTFA 3CO6C 1ZR2A 3I3QA 1UYXA 4NIAA 2Y26A 4B8XA 3AZWA 4IO9F 2VCAA 4PF5A 1K3IA 3U4XA 1TME3 3I54A 4P55A 2BTVC 4AXOA 3T8TA 4UY8I 1MIJA 5L3DA 2VUDA 3S2DJ 5K4LA 1BBT1 1HX6A 1QY4A 1ZH5A 3OYBA 3OY8A 3ES1A 3CLPA 3W20A 4JHTA 4YW4A 2BXYA 4A41A 1GBGA 1IGOA 4PQ9A 4YRVA 4HK8A 2X8KA 2D43A 2Y0SN 1NKGA 2QBXA 5BMZA 4DBRA 3HEIA 4A3CJ 2X09A 3ZN0A 3NJYA 4M9XA 3RZJA 1VRH3 4JDOA 1ON1A 1W8ZA 2ZCWA 4UUSB 1XSRA 2W2IA 2DCEA 1Z9CA 1XJAA 1ZZBA 2X1CA 4LUKA 3KS7A 2VOKA 1RUI2 2R7ZJ 3DKQA 1IF1A 2MHFA 4B29A 4A3MJ 4K1YA 1H8AC 1YLLA 4UAPA 2NQYA 1E17A 4UB6C 2IS6A 1MR5A 2JKBA 3QP5A 3VKLA 4JTOA 1D1CA 2JVGA 5A3TA 2R061 1PUEE 2ZKZA 1Y0NA 4PI2A 2GZWA 3RNSA 1H2MA 3VLBB 2DYSH 2V79A 1W0PA 3OYWA 2ZMEA 4Z2YA 2XBO2 2PX9A 3MI8A 4IDZA 2VXDA 2ZEWA 4RGKA 2KRFA 2LNBA 1K5MA 3UKNA 3S15J 1ZYBA 4LO6B 2D1HA 3LSTA 2WO7A 4B47A 1LHOA 2FJ1A 5IK8A 3HUGA 1PVC1 5F39A 3IHUA 2P6CA 1FMWA 5A7OA 1X8MA 4FQGA 1IJWC 3MIGA 1OCCH 3S1NJ 3N9LA 1OA2A 5L3EA 5LW9A 3I71A 3J8F1 2LF7A 1E5HA 4CCOA 3OBTA 5EJCA 4CPBA 4IKFA 3D1NI 3LE0A 2UXXA 4W4ZA 2KMUA 2FDKA 3W2VA 2VB6A 2Y0OA 3I0TA 3D3AA 4BB3A 3RYRA 4CA0A 5EHDA 2OCCH 1UOJA 2IEKA 4RA2A 4LBQB 1OKRA 2K9NA 4HNVA 1UX6A 5D4RA 2A69F 3ZR5A 1CZSA 4IETA 1BEV2 4NOTA 2MPFA 3RS6A 3VB9A 4BE2A 5IT3A 3VBUA 4OMYA 3L2QA 3WGGA 1W8FA 2HYXA 5C8WA 4XOTA 5CFCB 3OUJA 3WDTA 3USUA 4IHSA 1IOAA 4BQ3A 1CVNA 1W2NA 2GU9A 5TGTA 3SCGA 4XTPA 4XRFA 1RUH3 4LIVA 3CDZB 1ZRCA 2K86A 3RWNA 1QQIA 3GVAA 5BNGA 1JZ3A 1TWAJ 5FUPA 3H36A 5F3EA 5EGOB 4GB33 2VY0A 5LA9A 5DEQA 3MHZA 5CKNA 5HS8A 1IKQA 4N4OB 5EJ1B 1KQRA 2WZPP 1IS3A 1IPKA 1STMA 3N4MA 5AFBA 3S32A 2LROA 1QJU2 3OYHA 3FHNA 1OA3A 2HWC1 2L02A 2XPJA 1OFNA 5E1WA 3CJRB 2Q8KA 4P9GA 3JUUA 4H3WA 1PX4A 1AR81 1NZIA 1DGWA 4AL9A 5ABJA 2Q2EB 2DBBA 5EGOA 4C91A 2CYFA 4DJAA 1VQOI 5BXXA 2O8OA 4L2NA 3EYIA 2Q30A 5F6FA 2GOMA 1YS7A 3GZTB 4QHOA 5A80A 4A3ZA 4GZ9A 3SH3A 3ZQCA 2L9LA 1XS9A 3IKWA 3B02A 2CV1A 1R081 2W91A 3GF2A 4HL0A 4LO7A 5CEHA 3OPTA 4IEWA 1KU3A 1QIQA 2Y9YA 4EJTA 1A3KA 4BXSV 2HDDA 3VBFA 1W6NA 4ABZA 5D5WB 1KGSA 5FROA 1KDKA 5JZGC 5FZ0A 4AVTA 3ORJA 4HQMA 4RQPB 1UHMA 3X2QH 3I5UA 1H8TC 1T33A 4LHKA 4U87A 1TW3A 4BNCA 2VQGA 1WFXA 2M3AA 2X6WA 2CO5A 1Q8PA 3H50A 2Y6LA 2OTLI 2FX0A 1R23A 1ASJ2 2XJUA 1F36A 3LAJA 1G3SA 2X85A 2VL4A 3O8GA 2ZA9A 4EQVA 1IQDC 3PUBA 1TBXA 4X6QB 4NIGA 5LB6A 1DIWA 4PDWB 1LHVA 1DQ2A 5FXXA 5CLSA 3AMQA 1O91A 3ATGA 2VTXA 1XSVA 2NS7A 2V09A 3D5LA 4TV7A 2RDQA 3M1HA 4X1EA 4PBPA 2B7EA 4FAHA 3H3UA 1W8TA 4HFSA 5FKBA 2BVMA 4LBOA 3E6DA 1VI0A 1O7FA 4KQ7A 3ABUA 2Y69H 1UOGA 4N9HA 4XN0A 3ERED 4P9WA 3ULQB 4E7ZA 2P3KA 3KP3A 1QGPA 1R49A 2BDRA 1IPSA 1O7LA 1PP7U 2R0QC 2ELKA 1RIRA 1ZBA1 2TCTA 1BBT3 2Q1ZB 2P34A 4QMAA 4COYA 4IX7A 1BJQA 2NS8A 2Q8OA 1ZLJA 3S3OA 5C3OA 3CJQB 3AKQA 2EILH 1DDNA 3B9CA 1Z7S1 4IL7A 3ZX7A 4QSHA 3M7GA 2DN0A 4HPKB 2JWTA 1Y8RB 5K7PA 4YEJA 4UVBA 2F4PA 3VDDC 2E63A 3W9AA 3CP2A 4QWNA 1R1A3 2HDWA 1PM7A 3GBFA 1HB4A 2XUEA 4QU1A 2UXNA 5A7QA 2DDBA 2Z99A 3HBKA 2WUHA 1B35A 1QJY2 2QWWA 1LB2A 3E97A 1FOD2 1DCSA 3T08A 1ZG3A 1JOJA 2YPJA 2XC7A 3K1PA 3CQOA 2R92J 1Z7UA 5B2GB 2Y48A 2R063 3H8XA 2VL8A 1POV1 2WSVA 1F35A 2R1DA 3SYTA 3HC7A 4ESJA 1IC8A 2X48A 5IVCA 4DUXA 3E0JB 1H0MA 2WL1A 4LQRA 1UHWA 4CEWC 2ZMLA 2BNMA 2OPTA 1GUIA 4O9EA 3VSKA 2WFF2 4NE9A 4E7LA 2ME0A 3ES4A 1Q1VA 4V2VA 4AI1A 3OOUA 2GIVA 4HDVA 1W3XA 4IV1A 4DPNA 3ZKYA 1T39A 5ICCA 1Z6TA 3OUHA 4N0BA 5CKQA 4LGWA 2M4GA 3AG1H 1YJKA 4R4ZA 4B3AA 1DLCA 1W1WE 2PLV3 5L3CA 3P3PA 5C33A 2RNGA 4P02B 4YW7A 5DCMB 2DU9A 3TP0A 3JD72 2PN5A 2LM3A 1MZBA 4LE3A 1G3WA 1ZRIA 3WODF 4GO1A 3GTPJ 1N1SA 1PHMA 4I01A 3OY9A 3P9KA 5J8FA 4FCYA 4EJOA 4CCMA 1NA1C 3R61A 2QZ2A 3B01A 1MW7A 4QHZA 3RI9A 2X5IA 1BK1A 2R0HA 2JG9A 2VBWA 3RMXA 1WGPA 3DLLF 1OXCA 1QWRA 2OQ6A 1WMXA 5D5UB 1MBGA 1IS5A 1H1MA 1VBC3 4RFRB 2BWAA 2YUEA 3ASIA 2WAQA 2NN8A 4AK3A 5C3EJ 2R7DA 4GMP1 3TBIA 4BKXA 4UYBA 4CDXA 5LZ6A 4XVHA 3LSDA 5DCFA 1Z6RA 1UO9A 2R7QA 3LD8A 3BQYA 4II2A 3EETA 4IHTA 1RXGA 3ZSMA 4BISA 1T8IA 3NNLA 4URAA 4CZSA 4WF2A 1FP2A 1BEV3 1I9RA 1WLDA 2O61A 3NJXA 3GHMA 3CJIA 5JXIA 2VC1A 4H2AA 2LW8A 3F22A 1NY71 1LVKA 4C90A 1V54H 1YFXA 3SH5A 2PJPA 2O1QA 1QU0A 5FLVA 4XLAA 1OSGA 4RHV2 1WKMA 4FPJA 2XAUA 3RZKA 3LOCA 3OYNA 3OYMA 3WTSC 1VMJA 3PJRA 4E7JA 3HOBA 3IC7A 3DKXA 4PIYA 1WD3A 4I02A 3UNPA 5BPDA 1W6OB 1WH5A 2STTA 5FZLA 3T2PA 2FBHA 1SFYA 1Q8QA 5FPBA 4LOTA 2EIGA 2H1LA 3BN6A 4MGQA 1WWYA 2JTVA 2VC0A 2JN6A 1UWWA 2ZXQA 1G6NA 1XNDA 2MG4A 3OBAA 1KQ9A 4AGRA 2KJCA 2VW1A 1TW2A 4MTEA 1BR4A 2PAKA 4Q4Y3 1XNTA 1S2BA 4LITA 1B9NA 5FZOB 4C30A 4XOGA 1YI7A 2XKPA 1YQ8A 1JKRC 2ZNYA 3O1RA 1HOMA 1I27A 1G8XA 5K7HA 1WI9A 1UELB 2JG8A 3OS1A 4YPJA 1S7EA 2FMDA 4CP9B 4CHUA 3N9NA 5EZHA 2WZR3 3AG3H 2A73B 4ZU7A 3VD4A 3PU3A 1HJGA 5CYYA 1KXGA 5A2QK 3F8FA 2HWB1 2RVCA 2WZ8A 4YRDA 5FKKA 1QOOA 4ASKA 4QPQA 1Y56A 2VKVA 1HLCA 3UJQA 1S72I 1A36A 1RR7A 1GWKA 1BIAA 4AQSA 3J7MA 5JVVA 2E53A 4LIUA 4OIPF 5GAHJ 2WS91 3DFGA 5EEAA 3WT3A 1LFBA 5I0SA 1S0EA 2K9LA 3R0JA 2WT2A 1T2KA 4IEJA 4JRLA 3LSEA 5FZ7A 1WW5A 2ZBKA 3KWVA 4H7MA 2NMNA 2W47A 3GWZA 3WF3A 4DQAA 3U14A 3P9IA 4AD9A 2RS33 4MUVA 4XDQA 4AVBA 3CJIC 3K4MA 2F5VA 1RUNA 3ZR8X 4QHBA 3KF5A 3CZJA 5G05L 1JMUB 4LBNA 2WA3A 4S2GA 1XC5A 2QQ9A 4II3A 3IIIA 2RDSA 5HV0A 1OYYA 5CVVA 1HIXA 3HPHA 4FPOB 5IYBJ 1HA8A 1OISA 1PUFA 1K6OA 3GZEA 1W8OA 2DVBA 1POGA 5BUVA 3ZXSA 2TEPA 2QENA 4HG2A 1HRI3 2A05A 1MQTB 1FAYA 2VM9A 2LMDA 3LSHA 3KB5A 3ZO0B 1HKQA 1ON2A 4EM0B 3OMYA 2E2JJ 2NNNA 5B3SH 3HSRA 2BNNA 2LY9A 3LZZA 2YHJA 4XJUA 4K20A 5M0TA 1BBT2 4CYCA 1L3JA 4GYIA 1TWGJ 1DQUA 3N7JA 2IXCA 4M71A 3AP4A 2E7WA 1LJ9A 2HH9A 1ENXA 1Q43A 3PVNA 1DQ0A 2YU2A 3UV9A 5LEJA 1WVRA 3DP7A 3Q5FA 2OQ7A 3SKJE 3LWCA 5IUQA 1V55H 5CU1A 2L9SA 5J96B 1ZG1A 2DLLA 1SC7A 4PLMA 5A32A 1OQYA 1HRV2 2NNYA 4OHVA 5FAXA 1R1A2 1H4HA 4IE0A 4UW3A 4XAEA 4GQ7A 3OOXA 1ND3A 2QUFA 1GQGA 2PA7A 5F37A 4LXLA 4G12A 1TT5B 3Q9VA 1IRZA 2Z3YA 1POQA 1W6MA 1FSEA 3UR3C 4UT5A 4RGXA 4RAFA 3SEQA 2CUEA 2QLZA 2V6CA 4ZDLA 2R062 4OUSA 4INDA 4MNUA 4M73A 3VL9A 2M34A 4HG6B 4RS5A 3L2CA 3LFKA 2D98A 3N3HA 3VBHA 1QOSA 2ESHA 5IAVA 2ZGUA 5DAVA 2XQXA 2YBKA 4M4PA 4EMSA 2M8EA 2CAUA 1GICA 1XSQA 5JMOA 2FXAA 3RIRA 1RUG2 4KISA 2W1QA 1BI0A 3CJXA 1W04A 1HRV3 2LUWA 5E1ZB 3KHCA 3ZKUA 1URXA 2C0ZA 2XAQA 2QSGX 1EH8A 5JHFA 3ZQ7A 1DPUA 2VJ5A 2PLV2 1C1FA 2IGNA 1Z67A 3I2IA 2PQ8A 3HGYA 4AWDA 5HNHA 2W08A 3DPLC 1U8RA 4HYEA 4JGZB 4LBQD 1JT6A 2LLKA 1H8TA 3J7YJ 4CDWA 5C6CA 4N53B 2HWF1 4FCAA 2GBYA 1ZZ6A 4FFFA 1J2XA 5C7GA 4RB1A 3F8MA 5FB2A 3DPUA 5F3GA 3N9OA 1T08B 3WNKA 1J58A 3AJYA 4BK5A 1TQIA 2VW2A 2G9GA 2V1DA 3C7EA 2PHXA 2HOTA 3CNAA 1RVF2 4N7IA 3I2FA 5JPNB 4ES8A 1OD3A 5A6XA 4HANA 5LRSA 2Y31A 2WNUC 1CQTA 1GZCA 2XLGA 4Q0UA 4Y24A 1K5MB 2XLAA 5C4XJ 4WM7B 3FMSA 1MPXA 5GZDA 3AVRA 2R7RA 4EN0A 5IY5H 2UWCA 4QPYA 4BXUA 1P9QC 3H1YA 3MEPA 3OS2A 1ZR4A 2HKXA 1QO0D 1JKOC 3WQ7A 5F6LB 1VZ0A 2D5FA 2XJVA 1LU1A 4A3EJ 3WNMA 3FK7A 4IEXA 2Z33A 3VZKA 3GUDA 1W2OA 4G6TB 3K75B 2W7NA 1IRGA 4U88A 1LAJA 1JHFA 1H30A 4GDFA 2FCUA 2C6SA 4BMBA 2WWYA 2JDPA 2UWMA 5EYXA 1RJ8A 3H35A 1DU3D 1DZTA 3TDZC 2A6VA 3EDPA 2G9FA 2DPDA 4V1PA 5TISC 4KT5C 3GZ6A 3ZXEA 3F6VA 5LBFA 4XF0A 3GTGJ 3LMMA 4C9YA 1U5ZA 3K3NA 2JB8A 4GALA 1GOHA 1RHI1 3BCAA 3GTMJ 4HEA2 3WF4A 3CMGA 3MWMA 3IDEA 5JAXA 1BI2A 1RR8C 2F6CA 3T1LA 4RDUA 2CSGA 3N7MA 3EHKA 4XM3A 5FY4A 4GKXA 1NG7A 3WTWC 4FE7A 2ECCA 3HBLA 3LEMA 1LRHA 2LF8A 5LA2A 2R7TA 5F2WA 4F92B 4JGYA 4X0GA 2JPCA 4IEPA 2DFFA 4KGGA 4HSTA 2QBYA 4G7HF 5FWEA 3GGLA 1FIAA 3OD0A 3QOEA 1CAUA 3PO2J 3RKXA 4ETSA 1D3YA 3AMHA 4RGUA 3CCYA 1NE6A 5DUWA 5FZ6A 4BY1J 3RQIA 5K5OA 1IV6A 1DU0A 2D7FA 2W87A 1SEUA 2R5ZB 5LHGA 5LATA 2Z5WA 3HB9A 1R1TA 3OY8B 2VZQA 2QSFX 4QGMA 1W28A 4PGHA 3S93A 1W39A 4NHMA 2QQVA 4JDNA 3BG6A 4XXPA 3WTZA 1LE8A 2RN7A 4Y4RA 4NPMA 2D6OX 2QQBA 3D4KA 3WW3A 2EZKA 1PVEA 3EQEA 1I50J 2JA6J 3G1OA 2WLQA 3JQXA 4BQ4A 4Q8KA 2XASA 1W36D 4FPKA 1AL0G 4B1RA 2MH2A 4N7UA 1NCQA 3VBSB 1QQP3 1MBFA 1LEMA 1W6QA 1WQ2A 2HWVA 4WVVA 4FO9A 3CCUI 4LMFA 2KPMA 2RHPA 2PMZA 4YVSA 4CICA 2M87A 2GNMA 1GSLA 4YG3A 3WX5A 4BS9A 3HRMA 1XNBA 2P4EA 5FKLA 3CC4I 1OD5A 2Q2EA 1YE9A 1VBB2 3EXUA 2IJLA 4E4DX 4RGRA 2X29A 5L3FA 1NCRC 2WV0A 4A44A 3PNAA 4XUQA 1SCSA 2XF5A 4BQOA 2O0OA 3RMYA 4HNTA 1CAXB 3DN7A 2YX7A 3Q3SA 5FD5A 1IPJA 4KG0A 1W9FA 4Q2FA 3CJIB 2W68A 4YFNF 1GP5A 3OUIA 3GCMA 2LRDA 2VT3A 4IE6A 2V5DA 4XFGA 1DQ1A 2E7QA 3CJNA 5EPAA 4JYKA 1JGSA 1SFOJ 5DABA 2LH9A 4ATFA 3U21A 4DIQA 4RM3A 1OH3A 2W1SA 4AIKA 3TW7A 2DQLA 4O61A 5HV4A 4M6YA 3T09A 2JRMA 1XD7A 3IWFA 4AR2A 3WF2A 1OLRA 4N53C 4WZFA 4M3EA 1WJFA 2IC1A 2Q0AA 3WHBA 5FY9A 2R7VA 4CCJA 3AP5A 1VF9A 5HLTA 3SJMA 1LHUA 1MD0A 5CQEA 5A6YA 2DU1A 5CYVA 4FOVA 3CMMA 2XRNA 3UT0A 2DXIA 3L1PA 2LS6A 1BLZA 2CGNA 4D94A 1KONA 3PTYA 4YW3A 3K4ZA 3AVSA 2Y2ZA 3DF8A 5L19A 2HQAA 3G1LA 4UF0A 5FXZA 3ABZA 2W46A 2W85A 4QM8A 1YQCA 1JXSA 3KQ4B 4Q1PA 3J7NA 2OTJI 2QSHX 3WDVA 4XJWA 3LFUA 3OYEA 3OCPA 3NQOA 3KV9A 2DA2A 3I4NJ 3D8CA 1D1BA 3Q0VA 3S1QJ 2W1OA 4NPLA 2NOGA 2L9NA 3RPQA 2ZXHA 3F6OA 4FPLA 1QNYA 2ZGPA 3Q8CA 3ZFFC 4G8XA 3AXDA 3IAPA 2HNHA 4OIQF 4UBGA 5DS9A 2W3JA 1T95A 3S1RJ 3WQ1A 1Z0HA 1RUC3 3IWZA 3HVDA 3WU1B 2JA8J 1RPWA 1S7AA 3E6BA 5E3LA 4KH9A 1GHCA 5D6EA 1QZEA 1VMFA 2VOPA 3KPHA 5ABJC 3JREA 4RR3C 4O7XA 5KWRA 4QWQA 4R9CA 4UB8C 3GFLA 2VXRA 4Q29A 4KI5M 5IATA 1GLHA 3KT7A 2VUMJ 2I10A 5GLZA 3HOWJ 4UFJA 1S1AA 1RVF3 2Y64A 2UWBA 1GKBA 3O5SA 2VMGA 1MNMC 5JR7B 3H9GA 1P7JA 4RFT0 3LQRA 1WZXA 5JLWA 4B7KA 2Z16A 3TKYA 5DN2A 4JGZC 2QQIA 5JZGA 3D82A 4GIQA 2QDNA 2HEOA 3GBGA 2XJTA 4J1XA 3TGNA 1AR73 3W58A 1AUYA 1FMVA 4S04A 2E7XA 2EIMH 4D6SA 3S0MA 3EMRA 2WAEA 3RKQA 1DUXC 1D4M3 1WCUA 1KZHA 2ZGNA 3JSOA 2H09A 2O9LA 2WT1A 3FWEA 1MH4A 1ETVA 2R7UA 4IQ4A 3PVOA 1DG6A 4FASD 1V6NA 5GPAA 3CMEI 1RESA 4J01A 3BB6A 1RUI1 2Z69A 2VZSA 1ENHA 1U5YA 1FBUA 5JDBA 3OYJA 3CF2A 2ZKLA 3L2HA 1YWKA 1IW7F 1P2FA 3R4DB 2Z79A 2OA4A 1RIOH 2DUQA 4OHZA 1PK6A 1OVPA 3E1SA 3VBOA 2XHNA 2BVLA 1RUH2 3VDDA 1IKPA 2ACJA 4YGEA 3BI3A 1GXQA 1C5HA 5BNOB 2RDRA 3ILRA 2GP3A 1S55A 2XBO1 3U75A 1BW6A 3I53A 4KNCA 2WNVB 2WS92 3TO6A 1TEIA 5KHGA 5E18F 3ZXDA 5H9QA 1PNGA 1ND3C 4IV3C 4L5EA 1P6RA 3QCWA 1ENQA 4UUVA 3V0BA 5D6FA 3NV4A 4MSVA 5FPVA 4E9KA 3ZFGC 4MQ9F 3GDBA 3GZUC 3ILFA 5F6KA 4GYGA 4M0HA 3OL3A 1UW8A 5IYDJ 1IN6A 4Y1XA 3MIEA 4BA6A 1Y39A 4P00B 5KHIA 3DPTA 2WZR1 3RFRA 2CYYA 4AZZA 5FK7A 5M5YJ 1ZYRF 2NYYA 4K2EA 2IVIB 4WVZA 2A07F 1O3TA 3WTYC 2JDZA 2JDMA 5FZDA 4E4SA 1MMSA 4FPHA 2P0WA 2WLPA 5HS7A 4YG6A 1ND2B 1N77A 1WZ2A 5BV6A 5FY7A 4ISRA 2A3XA 3WTTC 1MH3A 5CFCA 3H7YA 4AVSA 1O5UA 3LOIA 3KEYA 2HTJA 4IGQA 1GP6A 3THPA 2ZKNA 1PGL1 3TP3A 5JWPA 4LNVA 4HV5A 1ONAA 4ARXA 2LSOA 2CS3A 1D0GA 2XB5A 3K0LA 4PSWA 3ZOBA 1R4NB 5GP9A 4OOIA 4YSFA 3C7HA 2Z5UA 4LLOA 4KWUA 3OYWB 1NZCA 1HSTA 4L5JA 4IHWA 2CDOA 3GZAA 3CC2I 1P4AA 4QX2A 2H0BA 2XPVA 3L9JT 2F17A 4XCBA 3KX2A 3B5LB 4CUAA 2KIQA 5HS9A 2AUYA 5FMBA 1AXYA 3HG9A 1JH5A 1COV2 3CCLI 1IGNA 3F8BA 4AI2A 1LEDA 1UIJA 2YSRA 1FV2A 3QPTA 2VMFA 4D6RA 4N43B 3BU0A 2VIXA 4Q47A 4AEKA 4MX3A 3ZFFB 3MAJA 2EXHA 2F5EA 4DY3A 2FCVA 3I4IA 3LNQA 4K1ZA 3LEIA 4PDKA 5B1BH 2WINB 3WGIA 3DEEA 2X5IC 1Y9QA 1CX1A 3POYA 5E3MA 1FPN2 2ICWG 4UW5A 3JRCA 3AM2A 2YZ4A 2P5LC 3K4DA 1A6QA 4ON0A 3LPFA 1CQ9A 1W7PB 1WW4A 2M5WA 2ZX3A 3B93A 1X1AA 1R9TJ 3KD4A 3DCQA 4XQDA 4MIMA 1VIWB 2XR4A 3VYTB 4OI0A 3AYEA 2WIIB 1WD4A 1RZ4A 1S8NA 2YR2A 5CG8A 4CCDA 1N3QA 4B1LA 4EWAA 4NQWA 2BVBA 5KK1A 4QX1A 1H9WA 3I2OA 3AK0A 3S16J 3PQKA 1F31A 2DTRA 3GTJJ 1UY3A 5EXOA 3BIEA 2MD5A 4LK7A 2MD0A 1LDDA 5C4JJ 3O14A 1FOD3 3MIHA 3EUHA 1RINA 1VRH1 4E8CA 2IXJA 1J3PA 1AHSA 4LLFA 1CWPA 1LFPA 2ELHA 2FNPA 3WG7H 2M0MA 1H9PA 3NW4A 1CJDA 2W95A 3WOGA 1FJLA 2WY7Q 1SEFA 3UETA 1KU7A 5T5PA 3LQQA 2HU9A 5FZMA 1U2WA 3BODA 4UV9A 4XF1A 4IF4A 2QQAA 5H20A 2DWRA 4XMYA 2YUSA 4JZRA 2HXOA 2RC4A 1RETA 1HN1A 5EEGA 1OLTA 4BQXA 1OURA 1T6BX 3WDWA 2JXAA 4AHZA 4HRIA 1DGRN 3TNQA 3LL7A 4F8AA 3FM5A 5HLHA 4HN0A 3BTAA 1N3PA 4XF3A 2A68F 4MO3M 3A03A 5CKMA 1DP3A 2ZFWA 4CXYA 2WBKA 3C7GA 3DYMA 4KU7A 3NJVA 4QQLA 4LB6B 2AS5F 1X1BA 4DUWA 2EZHA 3W21A 1U9OA 4IV3B 3OGJA 2Y6KA 4DOZA 3WTVC 1YG2A 1HRI1 1XYOA 2JSCA 3J8F3 4D7NA 5FGMA 1JTZX 4AHYA 3MZHA 1QVTA 1E3HA 4OAZA 3NSTA 3C7FA 2CQNA 1R5HA 5A32B 2QCSB 5A33A 2P7VB 4CDWB 2V7FA 2EJRA 4GB32 2EXIA 3B69A 1ETXA 5FYIA 1RUI3 4GWNA 4W6WA 2ES3A 1QZYA 1VTNC 3PVEA 5E8IA 3WG9A 5M5XJ 3HBZA 3ZLIA 1TMF3 3V0BB 1OOPC 3MFAA 4F7ZA 3VL8A 1G3TA 1CJPA 4OINF 2PN6A 3GFIA 4RQPA 1MSFC 1X19A 3JBG2 4LKEA 2OYZA 1AZDA 5C4WC 3F8CA 4MEXF 1W0NA 3LSIA 1IN8A 1QA6A 4XLHA 2DTYA 3AFHA 5JR2A 2PMUA 2CGPA 1US3A 4XFHA 5L9RA 3ISPA 3S30A 2EIBA 3KMHA 3TYJA 1TVGA 1E5SA 1WI3A 1QJFA 1QXJA 5CIRA 3E5UA 4U36A 1A6IA 2FF4A 3H9QA 2A3WA 1N3OA 1Z05A 2CUJA 3ZQFA 1BMV1 1WJEA 1A8DA 1S0FA 1VNDA 2CL2A 3KFWX 1XPWA 5K5QA 2FSWA 4HONA 2CFOA 1HRI2 4YARA 3CBNA 1FV3A 1SLAA 3PHMA 1AR83 1BBYA 3FXRA 1GR3A 4HK9A 3QBQA 1JYCA 3A01A 4OUEA 2JB4A 1SVLA 4E70A 3KVAA 4LJHA 5J8CA 1MBKA 4BEHA 5FZHA 3H5RA 3QQAA 3NV2A 5LGNA 1T0FA 5EP9A 2D5HA 1R083 3O0WA 3WSOA 2IWGB 4W65A 4BJ0A 2D1VA 5LD2C 3UGGA 2X51A 4XE9A 3E3VA 2DFIA 4FHTA 3VOEA 1XNKA 4PDWC 4YIRX 3S8PA 2WN3A 3BVCA 2VBXA 4XJAA 5BOXA 2JE7A 1RI7A 3CHXA 1FEXA 2ZGKA 2PMZN 1R1ZA 3E7LA 3BOWA 5JXHA 2L9VA 3ZPYA 3F2ZA 2MLKA 5F3CA 1WUVA 2ZX0A 4QQOA 1IXSB 3CESA 4I09A 1WGXA 1I1EA 2X53S 1AR82 2ZX4A 4MQVA 1UCXA 2ZMNA 3IMMA 4NIIA 4XDOA 4B3NA 3U0ZA 4D9JA 3I7DA 4UNOA 1AR71 3OGVA 3ZFFA 1GMMA 2BY3A 5LY1A 3FFZA 1SVMA 2JDYA 3WCSA 1R082 2VN2A 2V4JC 3KLSA 2HQNA 1ZBA3 4EYUA 5KBFA 1X4PA 2MABA 3IB3A 4W1UA 3W3CA 1W5CC 5E3OA 3KZZA 2JA5J 3ZN5A 2KDOA 3CC7I 3R60A 1UN1A 2RJ2A 2P5VA 3UKTA 4KIGA 1VBD2 1VQMI 2HYKA 1AF9A 2IXIA 5E88A 3ABLH 2K40A 3KCXA 4I0WB 5A7PA 2H6CA 4QPGA 3CCQI 1SDDB 2GMEA 1QGLA 1KU2A 4FE4A 2GC2A 1JJ6C 2E2HJ 1T6GC 2PHLA 2TUNA 2V1XA 3RQ4A 4BDZA 1NT0A 1QZZA 2IP2A 4NDLA 1BEV1 3HNBM 4YNIA 5FZKA 4EN6B 3KP5A 1GANA 1ZA4A 5FP4A 3ECOA 2QUOA 4QPOA 3AAFA 3IZOA 1A34A 3S14J 1POV3 1JZ4A 5DUUA 2BBAA 2V4VA 2X6OA 3ONQA 3DEMA 3C3VA 4PIXA 4M4RA 4AYBA 4CVUA 5FPLA 3RSNA 3ZCOA 1FPN3 3O1VA 5FY8A 2RVAA 2AC1A 4PLOA 1OPCA 1I3AA 3ENRA 2EINH 3QH6A 1V6OA 1JZ2A 3H0OA 1W9SA 4RLFA 2XVCA 2ZAAA 2XDVA 3AKSA 4XEZA 1BC8C 5IWFA 1AR93 3HKZA 3K70C 1IHMA 1LOCA 4AIHA 1Z77A 2VZUA 3VKOA 4UBHA 2YC4A 4Q4Y1 1QJY1 4KIFA 2OPWA 4RGAA 5T3NA 2MEV2 1O4TA 1S6LA 2ZEZA 2HEVF 3OL4A 1YQAA 3IP4B 4CEYA 1MEC2 2VVEA 3WW4A 2IAIA 2J22A 4JCKA 4L18B 3CUOA 4KBBA 5C5UA 4C3JJ 1DP7P 1QH6A 2E1MB 1O8PA 2WA0A 1JE8A 5DXDA 2PJRA 2DO7A 4AYBN 5FY5A 2XG3A 1JS9A 3FXMA 1ZBE3 3A4CA 4ZONA 1NQDA 2E6VA 1BL0A 1DGWY 1SBEA 2BOIA 1UY2A 4B48A 2NVTJ 2V73A 2EV0A 4E27A 2KM2A 2IS1A 1A8MA 1UZVA 1UCRA 3C7OA 4FP3A 4B8EA 2AH2A 3NNGA 3QPHA 2Q4SA 4ENJA 3ON7A 1V9U3 2DK8A 1YJWI 2ZEXA 4EM2A 3KT1A 4DQ2A 2WBMA 3S57A 5KC6A 3CZ6A 1OCRH 4IUGA 3DBRB 1LFUP 2VE1A 3WNLA 4MGRA 4U7BA 4FXKB 2KRCA 5M3FJ 3I3MA 2BBYA 3WHUA 3PIOF 2MNGA 3AYAA 2QDRA 1OCPA 1LNWA 3URFA 4B4QA 2IBDA 2XAJA 2BW3A 1V6JA 2FDGA 2A5WA 3B9IA 3VBOB 3JW4A 3DPRB 3BP8A 3VHOA 3AMMA 3GFMA 1UMIA 2VQ0A 3OYIA 2EAKA 4AFAA 3B00A 1QXPA 5A3WA 5IP6A 3K3OA 5DUIA 5FR3A 1YQ2A 1BC7C 5GLTA 4F3QA 4MGZE 1OR7C 2UZKA 1HSJA 1UAIA 1FOWA 2GA2A 2RREA 3OS0A 2YXSA 4Q4Y2 3V4GA 4BJ6C 2CG4A 3RJ2X 3VBRB 3TDUC 3H9AA 5A3LA 4H55A 2M4KA 4NBQA 4Y1ZA 1XRUA 1STZA 1OKQA 2ADEA 3TW6A 2JE8A 2DDUA 4FFHA 4D1QA 3SLIA 2EF6A 2EH3A 2DVAA 2PAEA 3EJKA 1VQ6I 2M7AA 2LYCA 3OJBA 4N4NB 4WWCA 1IG0A 3VYSB 4DEVA 1UB9A 2Q8DA 1OF4A 4IGPA 4M3CB 1ZGAA 3P9CA 1HLVA 3BTXA 3AXEA 4B7EA 4BHCA 5L3BA 2WZR2 4LBKA 2CU7A 3M8JA 1OOPB 4AFCA 3C1DA 1RUF2 1MSEC 3MUY1 1X82A 3MVPA 2LBFA 5T54A 3WG1A 4A4AA 2WR9A 2HVSA 3LFMA 1R5ID 2IGKA 2W25A 4XLCA 4QXHA 3KM5A 1HDDC 3RQ0A 3POSA 1IAWA 4V19K 3W5NA 1YIOA 2Q8CA 3K51A 1X3UA 3EYYA 4LG0B 3AB0A 2JENA 3KEQA 2GIZA 5T5OA 2DTZA 2BPA2 5A70A 3JCUC 4A3IJ 5DZFA 1IRFA 4XFIA 2H8WA 3OPWA 3KZ4C 1LODA 4DZJA 2E1NA 2K5CA 5C3QA 4NNJA 4RLQA 5BNPA 2FQPA 4E7SA 3H5NA 4H4KC 4ZDPA 3OIOA 2ZFUA 4DOUA 2R32A 3O1MA 2A5YB 2CJJA 4M00A 1WW7A 4LG0A 1W6NB 1RUF3 2RJLA 4RMNA 1MS8A 4R9AA 4FTHA 4XAAA 4FPYA 3MDPA 1H0BA 2I07B 2VD7A 3WHTA 3BG9A 1FBQA 3K2ZA 1SLIA 4LB5A 3S2WA 2IXLA 5HNFA 3BR6A 4I6ZA 5EV7A 5FREA 1VB2A 4KICA 1JYNA 5FZGA 1LGNA 1J59A 5T52A 4RBOA 4RB3C 1AXKA 3LSKA 2VJJA 5IYYA 2KZVA 5FQ0A 1EUUA 4A6OA 4FQZA 3OYKA 4XN3A 3Q8FA 2RS31 4IW3A 5JOZA 1Q1HA 2TBVA 5HPOA 4S05A 5H9RA 3WTUC 2BZTA 3OR1C 2DJNA 3GEZA 1TP4A 3VDBA 3ZDVA 1BM9A 5GM0A 2QCOA 3T5XA 2WFPA 1H1IA 3ZXGA 3D6EA 1F9KA 4FAGA 3C18A 4MGSA 2E1MC 1OHFA 4EWDA 3N36A 2FBEA 3F95A 1UPIA 3ERMA 3I8TA 2VPVA 5K0UA 5IT6A 4ZXKA 2DDAA 2W57A 4HX4A 3E6CC 1DGRA 2QTWB 2FBKA 1EH6A 5M5WJ 3HIFA 1JYIA 4KBZA 1RUC2 1SANA 2XRLA 4B4RA 4CXWA 5FMOL 3MZYA 3EB7A 4H14A 1XTAA 2Z1DA 2DVGA 2QQNA 5CFDA 2OAZA 4QLCU 4NRPA 5FKOA 4JX0A 1FYUA 1JJ8C 2FDJA 1O3QA 1W99A 1S3JA 2ZC2A 5EZGA 4AQTA 1UOFA 1RITA 2VUCA 3Q0UA 1UZYA 2QGUA 4RSUA 4P5YA 4PT6A 4N9IA 3MGUA 3B3QE 2W24A 4BPZA 3OIPA 4I76A