1LB2A

Structure of the e. coli alpha c-terminal domain of rna polymerase in complex with cap and dna
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
201
structure length
201
Chain Sequence
PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription activation: the CAP-alpha CTD-DNA complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords 5'-D(*CP*TP*TP*TP*TP*TP*TP*CP*CP*TP*AP*AP*AP*AP*TP*GP*TP*GP*
total genus 61
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2002-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
A PF13545 HTH_Crp_2 Crp-like helix-turn-helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1lb2A02
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lb2A01
1KQ9A 2HR3A 4BIFA 2G9WA 3UKNA 1RGSA 1PUEE 3N97A 2OD5A 5KHKA 4CICA 5FLJA 5K5OA 3GBFA 4Q0QA 3DP7A 2M45A 5CU1A 4KIGA 1P6RA 4OLLA 4TLFA 1SAXA 4KNYA 1NXMA 3ERED 1BI2A 1R1TA 5E1ZB 5LHHA 1ZG1A 1HBXG 5D8KB 1LEAA 2YX4A 3PFIA 3BOQA 3HUGA 1SFEA 1P2FA 1FNNA 1P4AA 4ZZLA 5D5VB 4KWLA 3KETA 1XSXA 3FM5A 3TO6A 3J7AO 1EPZA 3FHIB 2H6CA 3CF6E 4CGZA 2J5PA 1WLTA 1J3PA 3M8EA 1CAUA 2CG4A 4KU8A 2XLGA 1QGPA 1ZREA 1LNWA 2KJBA 5D8LB 5CVUA 4WK8F 3B02A 2VONA 1HW1A 1HQCA 3Q9SA 1YTYA 4UHTA 4LG0B 1D8JA 1HXDA 4U7DA 4M9SA 4A0XA 2B9UA 4M6YA 3CUOA 4BHBA 2QQ9A 5KBFA 2O8QA 2KIFA 4U0YA 4LLLA 1U12A 1ZN2A 3FXRA 5HLHA 1X3UA 3MZYA 4O5VA 3S0MA 5BUVA 3NRVA 4IRGA 2K27A 5EEGA 1UCRA 1LVAA 1SFXA 4G7ZF 3MYXA 3DV8A 4YIIA 5HS9A 2XHKA 3JAMK 5LEKA 2VE8A 4QGMA 2ZKZA 2MHFA 4GGGA 3KP2A 3CL1A 1ULYA 2FU4A 4XSZF 5E1RA 1SD4A 2H0VA 2Z69A 3DQVC 2E1NA 4N9HA 2IXIA 3H3UA 4R1HA 3VHRA 1U8RA 2DI3A 4YFKF 1KQ8A 2HTJA 1IAWA 4P9GA 3HT1A 3VEPA 2QJVA 4A12A 3PNAA 4QGNA 4FAHA 3OD0A 2J5OA 1J3RA 3LA2A 3TO7A 4EJUA 2F5EA 3QOPA 2IXKA 1CGPA 3OGJA 4AIJA 3G3ZA 4N0BA 2L3DA 3FHZA 1IF1A 4HSLA 1J9IA 5JSRA 1ON1A 3IRRA 1BN5A 2A3SA 4M71A 5J6XA 3WW1A 4IEWA 5E16A 2UXXA 3K0LA 4IVNA 4KN7X 1F9NA 4LA3A 4QXKA 1HKQA 2HWVA 3IL2A 5HDNA 2A6HF 5J8CA 2DAOA 3QU3A 4U88A 4EM1A 2K9ZA 4QLCU 5JHUA 4ENMA 4LLGF 1E17A 1T39A 5HI0A 1L0OC 4OOIA 2MD5A 5IT9Z 3GFJA 1DGRA 3NKTA 3CO7C 2FRHA 5K1YA 4FHTA 1ZH5A 3LZZA 4XF3A 1CF7A 4L5IA 1ZZBA 2RVCA 3J81Z 4A5NA 1OYYA 3MFKA 3HSFA 1ZRRA 1KU2A 1WSUA 1JGSA 1T6SA 3SCFA 4ZU4A 2G7HA 3BALA 1LDDA 1UB9A 4Y15A 1RZ4A 2BEOA 5A2QZ 3PVBB 3PQKA 5HVQC 4M9ZA 1YG2A 3RIRA 4EM0B 2ZO4A 2CAUA 2H27A 1FP2A 4G9YA 2P7VB 1FWZA 3ELNA 2DQRA 3WU1B 1MKMA 3KE2A 3MAJA 3NL1A 3E3VA 4L9JA 2OYZA 2JPBA 5ILUA 2ET1A 1O3SA 1FLIA 2YU3A 4HSJA 1DP7P 2UZKA 1J0RA 3DF8A 3P7NA 3G7DA 1Y9QA 3H1WA 1V3FA 4HX4A 4CO8A 2VBYA 2P4WA 3ZMTA 2LDUA 3GFMA 3ULQB 3RKYA 3DEUA 4L9VA 1FC3A 5AVPA 2YSRA 1NE4A 4QX5A 2OU2A 2EFNA 2QZ8A 2VBWA 1EYBA 3WTYC 4I09A 4LG0A 1YO5C 3ZN1A 4IHTA 3T8RA 1WI9A 4D0PA 1USTA 2A07F 1S8NA 2FNPA 2MBFA 3TNPB 5L3BA 3LWCA 1J5YA 2WC2A 4NQWA 1BM9A 4LLOA 2FQPA 1YW9A 2GAUA 5L3GA 2Q0OA 3LAGA 2EV6A 3F22A 2FBKA 5BPXA 2EFPA 2LF7A 1IXSB 3LWFA 5KHGA 2OAZA 4U0VA 4WX9A 2VT3A 2BNMA 5JCTA 3VODA 4GCVA 4AWXB 2PHDA 1B59A 5DCMB 3ZMZA 4IEUA 2PBIA 2D5HA 2P5KA 2VXZA 4HX8A 3AAFA 3WG9A 3DXJF 3QP6A 3E5QA 4XFGA 5ICEA 4FBFA 1RC6A 4RAYA 1GQGA 1OD5A 5FLHA 4LEJA 3OF1A 2HQNA 2ESNA 5KHJA 2IP2A 5I0SA 5FB2A 1UW8A 3T5XA 3FWEA 2GQQA 2DK5A 2EA7A 4IERA 3CJNA 4HVOA 2XRNA 1LDJA 1O57A 4LUMA 5L3EA 3JW4A 3UKVA 3QPTA 3JSOA 5BY5A 2FMLA 4RGSA 3CUQB 2EFQA 3EYIA 4MGKE 1JUHA 3EJKA 2P6TA 4JBAA 4ESBA 1D5VA 2V9VA 3IDCB 2OQRA 3SXYA 4YFXF 1A04A 2BNOA 4UNOA 3VFZA 2GIVA 2PN6A 2F2EA 3HOSA 3ZMSA 2A61A 1Y3TA 1B4AA 2UXNA 4PGGA 2H09A 2MA3A 1ZRCA 4HW0A 3SZPA 4RB0A 1ZRDA 2DCTA 3OCPA 1IXRC 5DYMA 4X6RB 4Q29A 1BOAA 1TW3A 1J2XA 3RKXA 3G73A 3I7DA 3BDDA 4MGZE 1XD7A 5LGUA 4M73A 1U5TB 1FP1D 3FE5A 3RYRA 3U9GA 2XL7A 2GU9A 3KEQA 4WCGA 5D5WB 2PMHA 1I1SA 1FT9A 5C6CA 1EH6A 1FYMA 3I58A 4J1XA 3CUQC 5ILVA 3CO2A 1U5TA 5K5QA 3J81K 3BB6A 2FBHA 1USSA 1XSVA 3LA3A 3F72A 3VB2A 3LAJA 4AQ2A 4IEZA 4KMUX 4LD5A 4YRDA 2IRFG 1PP8F 2Y0OA 2MC3A 3W6JB 2HJIA 5KHHA 3T8TA 4EM2A 4RB2C 1W5TA 1DPUA 4LK1F 4HA8A 4RGRA 3QRFF 2P6SA 3HRUA 4HVQA 4HBLA 2L54A 3LQQA 2R7FA 1R22A 2HEOA 2VT2A 5H20A 4HQEA 2BNNA 4RD7A 2HYGD 4XFBA 3WE2A 4XRFA 5E18F 3CEWA 3COAC 4KICA 3CO6C 2HKOA 5FPXA 3IKVA 4KWJA 5FFZA 1IN6A 1U78A 2F5CA 2ZBKA 5BOXA 2FBIA 1R5HA 4ON0A 2K7LA 4BHCA 1YYVA 3KSCA 4E70A 2FOKA 4EWDA 3LA7A 3V7RA 1YLLA 1UHWA 4ENNA 3S7IA 2YPRA 5FD6A 1KQ0A 5T3NA 5BPDA 2CGPA 3H92A 4MGIE 2L01A 3MPBA 2PFWA 3F3XA 2O0YA 2M1BA 1SQ4A 1B1BA 2PFBA 2XAFA 2FEZA 4RB3C 4IESA 4ESJA 1CAXA 3HHHA 4WXCA 2V1UA 4HLTA 4IRIA 2VOPA 1TTYA 1TLHB 1OFNA 2FNAA 4XF0A 1ZHFA 2PI0A 3I5UA 1ZZCA 2CYYA 1CX4A 2HYFA 4B09A 2GC1A 3JTGA 3GUDA 4BXUA 1BIAA 4O9EA 3KMHA 4HDUA 2O8XA 2LKPA 5ED4A 1FYLA 5I8SA 2Z3YA 2Z2SB 1S3JA 4IJAA 3S2WA 4XFHA 1CAVA 5LRRA 4KUMA 5L3CA 1U6GA 2B8MA 5TRDA 4LLNA 2QLZA 2QBYB 2DT5A 4P55A 4HX7A 2FA5A 4XFFA 1DPRA 4R8HA 3ES1A 1DDNA 4JTNA 3M1EA 1L3JA 2IC1A 3L2HA 1Q1HA 2CFXA 4HOBA 1SFNA 4ZZDA 5ILSA 3WGHA 5LBQA 2UY9A 1IW7F 1GXQA 1Q43A 5ICCA 2RGVA 3R61A 3RYPA 3V4GA 3H1MA 2XAHA 2QNKA 2D93A 2Q30A 4OMZA 4P5OA 2X0LA 4OIRF 4XF4A 3R0AA 3SHRA 1P4XA 4HF0A 4KIBA 3L2CA 3U1DA 2TDXA 3I59A 1IRFA 2QBYA 3FF5A 3DN7A 4HDVA 1IN5A 4N9IA 1D8KA 4ESFA 2IW5A 1I5ZA 4NVPA 4PIYA 1J7KA 3GZ5A 4OMYA 2FF4A 2NNYA 3ZMVA 3M8FA 3F21A 4ZYEA 2IXJA 2XKPA 5D1IA 4J1WA 1ODDA 4I98B 1G4DA 1KA8A 1O7FA 1UD1A 1T98A 2ADUA 2YX7A 3NVCA 4GO1A 4HYEA 3SCGA 3J80K 2O61A 1ZRFA 3C18A 1O5UA 4MX3A 1HW5A 4XLNF 3U11A 2ZCWA 5DEQA 2Y75A 4ZU7A 3EO6A 4BNCA 5LRSA 2H94A 4A2UA 2JTVA 3F8NA 4H7LA 1AOYA 3RTRA 3HRMA 2ELHA 3FXUA 2ZFWA 2STTA 2WWYA 1I27A 2E7XA 4IRHA 1O3QA 2PAEA 4Q0UA 3EHKA 4OINF 3DKWA 2HKXA 4Z2YA 3ZPLA 2KXLA 2Q0AA 2EFWA 2XLAA 3F8FA 1X8MA 2ZKLA 1ZAOA 1LR5A 1DZTA 3BU7A 4D7SA 1RL3A 1TNTA 5CLSA 1KGSA 2VOOA 4XFAA 3C3VA 1YFHA 4S05A 3GYHX 1IRGA 5HDGA 1R58A 2P5LC 3WU0A 3MQ0A 2RQPA 4I01A 1FXZA 1VP6A 3HTSB 2ISZA 2Y48A 2E1CA 4ZU5A 5I91A 2PLYA 3F6OA 3NEUA 4K2EA 1TBXA 1WRJA 2BGCA 2NYXA 1R00A 1O3TA 2KIMA 4E2SA 4G8XA 2GA1A 1FZPB 1PM7A 3V7CA 1XMKA 1GHCA 1Z1DA 2ZJ2A 1ZZ7A 4E2QA 3GLXA 4WXHA 3EDPA 4O9GA 1RI7A 1W7PB 1TQ5A 3KP5A 4IHSA 1FI2A 3ES4A 2HFHA 5CVIA 3ZN0A 1O5LA 4WXDA 4FAGA 2P5VA 4ZYDA 3FZ3A 1PP7U 4KN4X 4MTEA 3LFKA 2DPUA 1SMYF 3KP4A 3ABUA 5DD8A 2OA2A 1LQ1A 1KYZA 3FJSA 2MH2A 5HLGA 3WTZA 5HDKA 1DZRA 2BYVE 4YFNF 2B0LA 5FGMA 1VJ2A 4L2NA 5D4SA 5FO5A 4AQ6A 2OZ6A 4KL1A 4EJVA 4MEYF 3HRSA 1HW2A 3HSRA 3WW4A 1XMAA 1S29A 1JE8A 1TNSA 5L3FA 4K8FA 1ONVA 3EUHA 3U10A 4HV6A 3V7SA 3KZYA 4G7OF 5E1WA 3WE3A 5FQ0B 1WKMA 3SZTA 5HLIA 1CF7B 1IN4A 2P8TA 4RGXA 3LQRA 3FXQA 2MLKA 4EJWA 3E97A 2Q1ZB 4KFCA 2FXAA 2BBYA 1UCXA 3BZ6A 3DPTA 3I0TA 2V1XA 3USSA 3WTVC 5H6RA 3TOBA 2D1VA 2W57A 2VC1A 4PZJA 1QZYA 4DQ2A 5LHGA 2EV5A 1MJBA 4PJYA 1U2WA 3CJXA 1D3YA 5FLIA 1R23A 3J80Z 2PAKA 3KEOA 1YS7A 3K1PA 2WFPA 5ICFA 2XVCA 2RC4A 2FSWA 1UIKA 1MGTA 1YW7A 1SD5A 1XB4A 2JPCA 3BPZA 1MJ9A 3GEZA 4TV7A 2JRTA 2EAAA 1BJAA 4I0BA 2B5HA 3GWZA 1OYIA 1YHFA 4UVAA 3CLOA 3MDPA 2RN7A 4UUVA 4ENKA 4HN0A 1YWKA 2V6CA 3ZDSA 4KDPA 1QO0D 4XFCA 2RNJA 4H0EA 1DGWA 2VN2A 4IF4A 3RPQA 5KHIA 1GVJA 2XL9A 3IIAA 2ATFA 4MGYE 2ACJA 1R1UA 2FQ3A 2Q8KA 3IWZA 1CAWA 5I8TA 3V8JA 4B8XA 3RZZA 3R6SA 2VBZA 3WTUC 1RUOA 1W4MA 4L11A 4A5MA 1JHFA 3GX4X 1EV7A 3D0JA 3IHUA 3IC7A 1XE7A 4HVRA 2ZMEA 3OV8A 2OZUA 2MNGA 3Q9VA 5I0UA 3RI4A 3IDBB 2C0ZA 1XE8A 1Z6TA 2LSOA 5AIPA 2GC0A 1V70A 2XLFA 1FSEA 2Q4SA 1W5SA 1XSDA 2XGXA 5DUKA 5KVRA 5I0RA 1J3QA 1OKRA 2D5FA 4OIPF 5BXXA 2CQKA 2XIGA 2V79A 2A68F 3U0ZA 2RDPA 4XF9A 1MZBA 2ZNZA 4ONUA 4YARA 1REPC 2DU9A 3TO9A 3F6VA 4KMFA 6PAXA 2GXGA 1AWCA 3NSTA 1XGNA 2R7DA 3ZQ7A 5J8FA 4XBFA 1X82A 3E5UA 3MCZA 2FMYA 1XGSA 3ZP5A 3E6DA 4JVAA 2HQRA 1JHHA 2K4JA 4LTAA 3K9TA 3BPVA 4OIOF 1QQIA 4EWEA 1Z05A 1F1ZA 5CJ9A 2DBBA 2EA2A 3O3KA 4IEOA 2JT1A 5FCCA 5CVJA 3LSTA 3VOEA 1S7OA 2X4HA 3REOA 4DINB 2MH9A 3RJPA 1IPKA 3NQOA 2DQLA 3E6BA 3M9AA 3BY6A 2F5DA 4XFIA 5J48A 1B9MA 2F5FA 1P92A 5JFRA 2VODA 4P9UA 2D40A 3RNSA 4ZYGA 4Z07A 4UV9A 2HOEA 4MH0E 2EWNA 4ASNA 3T0YA 4EWAA 2EK5A 2F4PA 1Q3EA 2PQQA 2BV6A 1ZGAA 1V4RA 3KFWX 2NNNA 4IEXA 4KA4A 3WW2A 1FBSA 2NAZA 3GXOA 3ZMDA 2H6BA 1SD7A 3T1BA 1ZGJA 2KIUA 5E17F 1JXSA 1H1MA 1HSJA 3L00A 3FFQA 4I2OA 2EFOA 1B9NA 1H9TA 4EJOA 5IT3A 2K0GA 2PAMA 5FLXZ 2XROA 2KRFA 2DW4A 3RKWA 3PLQA 4YSFA 3HQXA 1BC8C 1NZCA 1C0WA 1I6XA 1Y0UA 1OI6A 3F23A 3KP3A 2CO5A 3FMSA 2M5WA 1MDMB 3WGIA 3GO5A 1U3EM 4MZUA 5TJJA 3U2RA 4G6QA 2IA0A 4AVAA 1S6LA 4IEYA 3MWMA 4M74A 5IT9K 3I54A 3TOAA 2QUFA 2MPFA 3QP5A 1OYWA 3F8MA 2ETHA 1XDUA 3P9IA 2HGCA 1Z6RA 2JSCA 4QM8A 1K78A 4IEVA 4BQAA 4A0YA 3FX3A 4A6DA 1Z9CA 4CYDA 1QWRA 2A69F 5DV5A 2M87A 1R7JA 2M30A 3E6CC 4PGHA 3ECHA 4LJZF 3D0SA 3SMHA 3IKTA 5LGTA 1R1VA 4Q0VA 3SXWA 2XAQA 4JTOA 1YQAA 1R5GA 4XF1A 4QWQA 2E9QA 1I1GA 2HS5A 2Z33A 2Z99A 2DTRA 3FMQA 1FBQA 1W7PD 5HS7A 4LMYA 5FPZA 3GYDA 4L18B 1WGPA 2ESHA 1YW8A 4PIXA 1O7LA 2QWWA 4O3MA 1LDKB 1IN7A 2Z5UA 4AVCA 4NB5A 4HF2A 2E7WA 1QY4A 1YFXA 2XKOA 2GZWA 4GXOA 4LUKA 1YLFA 4UBHA 2CSOA 1G3YA 1KU3A 2QVOA 5BMZA 2L4AA 3F8CA 4RGUA 3NW4A 2N7GA 2IJLA 2V09A 5F64A 4IETA 4O6JA 1G3WA 4ETSA 5C8WA 4XSXF 4I0AA 3W6KB 2ZNYA 3TKYA 4OU0A 3GVAA 4A0ZA 4EGZA 3GW2A 1ZX5A 5H6QA 2Z9OA 5E8IA 5JSPA 5ERIA 5LGNA 2IA1A 1UIJA 3KP7A 4AVPA 2VQAA 1ZG5A 2VECA 1TW2A 1BIBA 3FMRA 5CYVA 3H8UA 4GULA 4E2GA 4WBBA 3OTFA 4XETA 5LHIA 1L3LA 1RUNA 3EQLF 5J3UA 2COMA 1QXRA 4WZCA 4AXOA 4YNIA 4LB6B 2D45A 5FFXA 5FQ0A 2OBPA 3L09A 3D82A 3GF2A 2PTMA 1XN7A 3C7JA 4S04A 1NYWA 1IZ1A 4EV0A 1RNLA 3EETA 1XGMA 3R60A 2O3FA 2WV0A 3RYKA 4I02A 2HDCA 2EB7A 3KCCA 3HOTA 4BYYA 4Q47A 3EBRA 1HKSA 4BH9A 2PHLA 1ZZ6A 1T38A 1NHAA 1F4KA 3DL3A 4MEXF 2I45A 3DPLC 2DK8A 5JAXA 5FLXK 2DPDA 2HTSA 1FX7A 4DNCA 2CAVA 4LULA 3ELKA 2GH2A 3C1DA 4UV8A 2W84A 4RS8A 1P4WA 3WODF 4LGWA 1EP0A 1CAVB 3QACA 4G94A 3SCHA 1X7NA 1IPJA 3SFZA 4BAYA 2HZTA 1KYWA 1ZVFA 2D1HA 3HRTA 5AIQA 2QVSB 1RTVA 3KP6A 1FYKA 3FM3A 2YR2A 4MUVA 3OOPA 5DCFA 1ZNPA 3BJ6A 1G6NA 5E1XA 3C3WA 1YS6A 3NJZA 5JR3A 4UXAA 4AVBA 2CWEA 5BV6A 4MTDA 4Q0PA 4D7TA 4HZFA 2LNBA 5JVTA 3I4PA 1NE6A 4CZZA 1Z91A 2O6GE 3H7JA 4CXFA 4PIZA 1O3RA 4XLPF 5CADA 2ET7A 4KT5C 4A6EA 4Q5SF 4OIQF 2Y0MA 2L02A 2G7UA 1OMIA 1BI0A 2IXHA 3CTAA 5I8YA 3CUQA 3IBMA 2A5YB 4F7ZA 2OA4A 2VE9A 5I0TA 2GA2A 1T0FA 2XASA 2UY8A 4GYGA 1R36A 1KU9A 1YUDA 1QNTA 3KLNA 4Y13A 4HF1A 1YFYA 4MQ9F 3KLOA 5A2QK 4I7HA 1PMIA 1B6AA 1K7AA 4KWKA 1ZG3A 2W25A 5HOOA 4JQFA 3WGGA 1YFWA 4JK1X 1LKNA 2KKOA 3BWGA 1MJAA 3K69A 2GWRA 4NHJA 4Q0SA 3M3IA 1ON2A 2LF8A 2V1DA 1XGOA 1LEBA 5BPIA 3TDZC 4CDGA 3QAHA 3HIFA 3KGLA 2RV8A 1H1IA 2VBXA 4U7BA 1FOKA 3WTWC 3WTXC 3TNQA 4HV5A 5AONA 4P96A 1HSTA 3K1NA 4PDKA 3JZVA 1OR7A 4UVCA 1FBUA 2AS5F 3RDIA 1QPMA 3H50A 5FDBA 3M70A 3CLPA 2PG4A 4JV4A 1UHMA 4KIFA 1HKTA 2QQBA 4ORFA 4QM9A 4KYWA 4IEPA 1QBJA 4MNUA 5BQTA 2OQGA 3KZZA 2L4MA 4EJTA 2RKHA 3H1YA 2CV6A 1FPQA 2PJPA 2PYTA 5DDGA 3O6BB 1YFUA 2P17A 4LB5A 1BI1A 2W24A 4FX0A 1UPIA 3R0JA 1RIOH 1ZZ9A 3CDHA 3QU6A 2EVXA 2DFIA 1PDNC 1OPCA 2PQ8A 2PEXA 1GXPA 5D5UB 2ZMEB 4WF2A 4UBGA 3BP8A 4CHUA 3ROUA 3SHFA 4LA2A 3BCWA 4YYOA 2QM3A 1SD6A 4LK0F 4HN1A 3K1MA 3TDUC 3ZMUA 3R4KA 5E8GA 4Q4ZF 2ETEA 4GYIA 4AIHA 3I59B 2D2WA 3B73A 1W7PA 2UWMA 4AD9A 1CAWB 4L5JA 3I53A 3H7YA 2JZYA 4M6XA 3ACLA 2DLLA 1X8EA 2K4BA 5EEHA 1EH7A 1VTNC 5L3DA 4M72A 1H9GA 4EQQA 4LFUA 2XV4S 5K8SA 2VPVA 3BPXA 2QCSB 3HTUA 4Z82A 1VR3A 3RPUA 1T2KA 3IWFA 2NS0A 4HQMA 4MV2A 2P7CB 4WVZA 3QPHA 1XDSA 3EYYA 5D5XB 1Q5OA 4I3PA 1LRHA 3JAMZ 2STWA 5ICGA 3D5LA 3GZ6A 3BROA 3LOIA 5JI6A 1K79A 1WA4A 3E5XA 5D4RA 3N4MA 4R79A 2UYBA 5LLQA 1CAUB 3H9AA 1U5TC 3MEXA 3HYIA 1ZARA 3GFLA 3WTTC 2IVMA 4EVIA 4MQVA 1FY7A 3L7WA 1KU7A 5BS6A 3PQJA 3LAPA 3O14A 4L0YB 5LEJA 3ECOA 2NRAC 2GC3A 1IXCA 4RAZA 2EV0A 1STZA 2PA7A 5DCMA 1BI3A 3BJAA 3HHGA 5KK1A 3GFIA 4KU7A 2QDRA 1QXJA 2DO7A 3P9KA 4UXNA 3KGZA 1YIOA 3ML6A 1IUYA 1Z7UA 4MGRA 1G3SA 4PCQA 1WQ2A 4L9TA 2OZJA 4EGYA 2W85A 5J7MA 1FSHA 1CAXB 3FZVA 1SFUA 3HSEA 4ZYHA 2XAJA 5JSOA 4P9FA 3MZHA 1F5TA 3EQEA 4OFGA 3WW3A 2IPQX 1ZZ8A 1TQPA 2XAGA 4HMZA 2A6EF 4R52A 4YG2F 4Y17A 5E20A 5JR7B 3H3ZA 2IA2A 4EMSA 3ABTA 5K5RA 4FX4A 4G7HF 2ZXJA 3K2ZA 3L9FA 2K02A 1SMTA 3WTSC 1ZYRF 5CVVA 5EZWA 3Q5FA 1G3TA 2QQAA 4L0ZB 4L9NA 3ETQA 2EA4A 2C6YA 4U0WA 4YIFA 4EROA 1UFMA 4X6QB 2OPKA 3S7EA 1MD0A 3IRQA 3O2PE 1BC7C 1ZLJA 5DUIA 1J75A 4WWCA 2UYAA 4HLXA 3I71A 4F8AA 5I93A 1XRUA 5D6EA 1TQIA 1E2XA 2QENA 3JSPA 5DD4A 2FE3A 2AXLA 2GXBA 5HS8A 2BE5F 3M7GA 4B29A 2CW0F 4BHPA 2GC2A 2O1QA 4HBNA 4FT8A 1MDMA 1GQHA 5F1RA 3TGNA 4META 4XEZA 2R3SA 1J58A 1K78B 2Q2EA 3F8BA 3V8KA 1EY2A 3V8LA 4G6DA 1S7AA 4IPAA 3E6MA 4ZH4F 1LB2A 1H0MA 5EFUA 2QYOA 2IT0A 2KJCA 1EH8A 1LJ9A 2EJRA 5D6FA 3P9CA 1J59A 2IXCA 4ENJA 2ISYA 3BJOA 3SQNA 1ZLKA 1TQMA 1WWXA 4Q48A 1IN8A 2O03A 2K86A 1O4TA 1XCVA 4IXAA 2IXLA 4AIKA 1K6OA 1J1LA 4HLYA 4RB1A 1BBYA 4HAMA 2XUBA 4MHGA 3DFGA 4UVBA 1SEFA 4QMAA 2WTEA 5CVRA 1XCBA 2M8EA 4QGLA 2PMUA 3UKTA 2MLGA 1QZZA 1DUXC 5F6FA 3TQNA 3HT2A 2VC0A 4IEQA 3JTHA 4M9XA 3I64A 3ST7A 5FD5A 3ISPA
chains in the Genus database with same CATH superfamily
2VTXA 2KRCA 1KQ9A 5CKQA 4QPIC 4BIFA 3SEEA 2R0QC 5KHKA 1PO12 4JKMA 1ZK8A 3GBFA 3BVCA 3OYWA 4KMQA 3OYHA 5CQEA 2ZAHA 1Z3YA 2LG4A 2LY1A 4KIGA 4OLLA 2WO7A 4KNYA 1BI2A 4QPWA 3W59A 3FXOA 2IVJA 4MLOA 5FMCA 1W9WA 5D8KB 4MOAA 1XX5A 3ZQHA 3J26N 1SFEA 5T52A 4ZZLA 2FD8A 4BQYA 3UK9A 1XSXA 3J4UH 3DUIA 1WH5A 2M4KA 3LSJA 1CESA 1IS3A 3A22A 1QOOA 4KBZA 4KU8A 5A6XA 4Y5TA 1QGPA 3EB7A 1POGA 5D8LB 2VU9A 1HLCA 4AYBN 2CV1A 5L7OB 1S2KA 1WW4A 4WK8F 2VONA 1US2A 3WG2A 1FOYA 2CUFA 3ZQCA 4BJ6C 1BR1A 4C90A 2WBMA 4LG0B 1HXDA 2WAFA 2WNUB 5CQGA 4U7DA 1LUJB 2B9UA 2JD9A 3O1VA 1Z3XA 3DF0A 2QQ9A 5DZGA 1WW5A 5F39A 3PVEA 1X3UA 3IAQA 4M00A 2ZAAA 3HEFA 3ZXGA 4IRGA 2K27A 3DEMA 1OA2A 1G59A 1LVAA 4YZ1A 1SFXA 3A4UA 1YXWA 1OLQA 4COZA 1A6CA 3VDDC 5T5JA 3VBRB 3AP5A 5LEKA 4QQLA 4QDQA 4QGMA 4JCKA 2MHFA 3KP2A 3CL1A 2D97A 3RQ4A 2WB1A 4PJNA 4B43A 2Z69A 4HPKA 3T0AA 3BR6A 3H3UA 3SLIA 1I1EA 2DI3A 3SH3A 4RN5A 4LIVA 4P9GA 5IOYA 4UYBA 2VOTA 2JVGA 3VEPA 4PSWA 3N7MA 3G6JB 1K12A 2IXKA 4QPIA 1AL22 1VBA2 3FHZA 1PMJX 2ZJCA 2OS2A 2GN7A 2HNHA 5KR7A 4HSLA 5ANQA 1ENRA 3ZN6A 4ES8A 4EN0A 2A3SA 2GALA 3ILRA 1OPMA 3J7AY 4KN7X 1R5ID 1F9NA 3VZLA 5F5QA 4LA3A 2CRGA 3LIHA 4QXKA 4F3JA 1FOD2 1STMA 2HWVA 1PGL2 2M9HA 5FZFA 2JDUA 2Z79A 4U88A 2OPWA 2AQFA 1ODNA 5JHUA 4LLGF 5HI0A 2WZR2 1P7IA 1HA8A 1ZH5A 4XF3A 1WCDJ 3DECA 2RVCA 4J6GA 3HSFA 4KQ7A 4FTHA 1UYPA 3SJMA 4YVSB 5GLWA 4ZU4A 4LO6B 3A1YA 4D0QA 3O8GA 1RZ4A 2BEOA 2HWE2 5JZGC 2D6NA 4YVWA 4BQNA 2VMIA 2A75A 1FMD1 1YRNA 4RLFA 5CZKA 2V6EA 4M3CB 4CTEA 2H27A 1DYKA 2P7VB 1FWZA 1EPWA 3KZIC 5J4VA 1NCQC 1UG2A 3NL1A 3N7JA 1ULEA 4QPGA 2Y0SN 2JPBA 3RKQA 4KGQA 1UY3A 1O3SA 2LRPA 4N90A 3O1SA 2KT0A 1R1A1 3DF8A 2Y33A 3PVOA 1Y9QA 2CQNA 1J09A 2B7YA 1SPPA 4E7SA 4JDNA 5FIXA 1YHQI 2VC9A 5FP9A 2JWPA 3K4ZA 4CU8A 2VBYA 2VZRA 3N9QA 1JZ4A 1SBFA 2FX0A 2QKLB 4QX5A 3RZLA 4BMEA 4AC0A 2JECA 4IE5A 2XSJC 2VZVA 3PU8A 1A36A 2VBWA 1EYBA 4LG0A 2X6YA 1BBT3 4FP2A 5JDBA 3AP9A 1S0GA 3ASIA 5F6LB 5C70A 5C33A 2XB5A 2A07F 3AVSA 3MUZ1 4D5CA 3VBHB 2MBFA 1UQXA 4CDWB 4BEHB 4BQ1A 3BIEA 1YRNB 3CJIA 5FOBB 4AWDA 4JGZC 4IHWA 4RA0A 1JYIA 1QJX2 1TNFA 2VL8A 3FLRA 1OKOA 2R93J 2FBKA 2CWMA 2EFPA 1R091 5BPXA 2LF7A 1IXSB 2IGKA 5JIAA 1LFUP 1WCUA 2BNMA 3I8TA 3VODA 5FLMJ 2EXKA 2DFHA 4YW6A 1WLCA 5DCMB 2PBIA 2IXSA 4D5FA 2QZ2A 4HX8A 4XW3A 3RI9A 3CP8A 5M5XJ 2PELA 2JEMA 3Q8EA 3QP6A 2RAEA 2ZGQA 1MMDA 1F9KA 4XFGA 5ICEA 3MKLA 5F2WA 4FBFA 1RC6A 4RAYA 1U5XA 1OD5A 4IL7A 3OF1A 4XKVA 2ESNA 1JKOC 2VVDA 5KHJA 4OYUA 3HPNA 1UW8A 3FWEA 1D1BA 3OOXA 5FMDA 5FYBA 3CJNA 4HVOA 3ABKH 5LBBA 1LDJA 2WDBA 3OGSA 5DAQA 2AHQA 4LUMA 3HOYJ 4YVSC 2ZB9A 4XDPA 1L7RA 2FMLA 2L7MP 3O1OA 3ZYGA 4FQ4A 2VB6A 3EYIA 1YC61 3NNFA 4MGKE 3EJKA 2XWBB 4GXLA 1VAVA 1D5VA 2WS91 1TME3 1RKWA 5A3OA 3IAPA 4COWA 5EJCA 5FZ0A 2GIVA 1US3A 3THTA 2F2EA 3ZMSA 5EG0A 2UXNA 4PGGA 1DBNA 4A3XA 1ZRCA 1RMU3 4BQOA 4HW0A 3J8F2 2DCTA 2XF5A 1PZ9A 1OLME 4X6RB 4XQFA 4Q29A 3IM0A 4FVVA 3ZDVA 1AYM1 3ZFEA 3RKXA 2P81A 3BDDA 1XD7A 4Q4Y1 3ZKYA 3FISA 3RYRA 5LA0A 2X5IA 2XL7A 4TN7A 4B4PA 3KEQA 2O14A 3AXDA 1O8PA 1SAUA 5D5WB 2I2SA 5GPCA 3AKPA 2QSFX 4RM2A 3NJVA 2DYCA 1RVF3 1B35C 3RRDA 2YY1A 3IP4B 3F72A 4JQRA 1JGGA 4LD5A 4YRDA 3IMNA 1GQPA 1FNZA 5FMBA 3ZPOA 4BISA 5BNNA 3JD72 5H9PA 4M4PA 2VZTA 4LK1F 4ET7A 2PLV2 3QRFF 1BKZA 4HVQA 2E2IJ 2XHNA 2R7FA 1ZBA3 5H20A 4RD7A 2XGDA 2HYGD 3CEWA 3COAC 4KICA 2Y6KA 2HKOA 5GLZA 1IN6A 3P3PA 4AI2A 2F5CA 5L7OC 1QQP1 4DPNA 1LAJA 4BHCA 1GSLA 1OR7C 3LA7A 5IUQA 1SDWA 2YC4A 4BQ3A 4ENNA 2BV4A 1OQYA 4ZZ5A 2XPVA 1ENXA 1K83J 3H92A 5IVYA 2BVMA 3IMMA 1PNFA 2NVTJ 3IN9A 1B1BA 2XAFA 4RB3C 1E3OC 4WXCA 4TSVA 3CMAI 2ZHNA 4COYA 1ZHFA 2E71A 1G9CA 3OSGA 1CX4A 4JC1A 3B5LB 2XVLA 1LULA 4LBQB 3OYNA 3BIWE 4HDUA 4GB32 2VKDA 1FYLA 1UXZA 1S3JA 1WMEA 3S2WA 1Y9MA 2JQ7A 4YM1A 3D1NI 3PUHA 5LRRA 1XPXA 4KUMA 3IT8A 1U6GA 2B8MA 2R043 2QLZA 2QBYB 1UU6A 1GP5A 4XFFA 3KIOA 3CDIA 3MFCA 1W6QA 3M1EA 2IC1A 2RJ2A 3JD73 2CFXA 1SFNA 4ZZDA 3WNKA 2VQGA 2PJRA 3WGHA 5LBQA 1Q43A 5ICCA 1YIFA 2VCBA 3RYPA 4V2WA 3V4GA 3H1MA 2QNKA 1H8VA 4IV3B 3JU9A 3WDXA 2YPDA 1XXNA 1UWWA 4P08A 1W9TA 4Q4W2 4KIBA 3L2CA 3HKZN 3U1DA 2E53A 1R49A 3DN7A 1Y43B 4CXWA 1BLZA 3JB8A 1NLRA 1RB8G 1IN5A 4N9IA 3KS7A 4ESFA 4NVPA 4PIYA 4GJYA 3GZ5A 1ORKA 2FF4A 2QQ8A 2WLPA 1UU5A 3ZMVA 1BXHA 5LASA 2IXJA 2XKPA 1QJEA 4BUPA 1G4DA 2ZX0A 4XRSA 3HJRA 3K3NA 2Z42A 4WM7C 5E89A 3NVCA 1RESA 1ZKGA 4FPKA 4HYEA 4LBQD 4AEKA 2K46A 3C18A 3HNYM 1HW5A 4HG6B 2Y75A 3S14J 4BNCA 1Y56A 3MF6A 3MN2A 4CYCB 1U0AA 4UB8C 1AOYA 1UYZA 2GNMA 3WNPA 3HRMA 2WIIB 2XJPA 2ELHA 2RS32 2HBUA 2Y26A 4C91A 2HKXA 2LC2A 3JRIA 4Q2FA 4ZS2A 3RG0A 5T5PA 5E8AA 5FKLA 4B1LA 2D3PA 4R9CA 1JKRC 2VJ4A 5IVCA 1TNTA 5CLSA 5SV5A 1KGSA 2OKXA 3IKWA 4XFAA 4DXSA 4XACA 3H5AA 3L2RA 4WZFA 5CAZA 3MQ0A 1VP6A 2K2SA 3S17J 1UOJA 3F6OA 1PGW1 4K2EA 3T09A 3OPWA 1WRJA 1W0UA 4LJHA 1O3TA 4QQHA 2R92J 2HXIA 4AUXA 5GZDA 1Z0XA 2BBVA 2ZJ2A 3MBWA 5GTHC 2EIKH 1JZ8A 4WXHA 4XIDA 4O9GA 1VBE1 2VQTA 1W7PB 2LBFA 1VQ9I 3ES4A 2HFHA 4C3IJ 3ZN0A 3VDCA 2LD5A 4ZYDA 1GOFA 3MKZA 3FZ3A 4AFAA 1F43A 4KN4X 3KD4A 4MTEA 5DQ0A 3D4KA 1V6JA 2K9LA 4B8EA 5DD8A 1YJKA 1KYZA 4BDYA 3HWJA 3T3YA 1RKTA 4A45A 2P4EA 3WG7H 1OCCH 3PDQA 1AA7A 2XQXA 2BYVE 2QF7A 5FGMA 1VJ2A 3K2AA 1GICA 5FZOB 4AQ6A 1D2SA 4KL1A 2PMZN 1MNDA 3ZXKA 4EJVA 1IKQA 4LMFA 2ECCA 1HW2A 2BW3B 3WW4A 2JA2A 3ZN5A 1CQ9A 1TNSA 3ZXFA 4K8FA 4BACA 1C4RA 4AOCA 3U10A 1XE0A 1X58A 3WE3A 2VNOA 3J7MA 1HIXA 2YYOA 1NX9A 1WKMA 2CGOA 4XILA 4AF9A 3UGGA 4XKWA 1GVDA 1LECA 2Q1ZB 4EJWA 2EXHA 2HQAA 4KFCA 1BBT1 2J22A 3FBMA 3KWVA 4YGBA 3I0TA 4RSUA 2D1VA 1QZYA 5E3MA 1H8TB 2EV5A 1MJBA 1H4GA 2NMOA 1D3YA 5E3LA 1R23A 2PAKA 3LSDA 1YS7A 3K1PA 5FRAA 4Y1UA 4PLMA 3MLJA 1X4OA 1A78A 3QYFA 3OL3A 2AGSA 3WNXA 4HETA 3OUHA 3K4BA 3ITQA 2WNVC 2CV0A 2P3KA 4TV7A 2B5HA 4AYBA 3ZIXA 1HRI2 4PDWA 5EV7A 2IGNA 1XSQA 1NLSA 4ENKA 2ARBA 1UELB 4UFKA 3BTXA 2B9SA 1FYUA 4OZXA 4IQJA 4NQWB 2P5BA 1ND2C 4XFCA 2RNJA 1DGWA 4P9JA 4XLHA 4U87A 1GVJA 1GANA 2E6VA 4PT6A 4P9LA 1CAWA 5FXZA 5LA1A 3D5SC 5JXJA 3LIGA 1AL23 2GSYA 3R6SA 2VBZA 1JHFA 2VPRA 2X9DA 2V4JC 1VIWB 3GZUC 5FZAA 3IC7A 4H3WA 5FO9B 4DZPA 3I3BA 5HV4A 1OLTA 2OZUA 4QPYA 2CJJA 5I0UA 2DVFA 1W2OA 1N78A 1QH6A 4XPVA 5JIUA 2CU7A 3PMEA 2DBNA 2XGXA 3CDLA 4CUAA 1J3QA 4HSRA 1W6MA 4S2DA 3A01A 2XIGA 2A68F 3RSNA 3U0ZA 3K4KA 4B48A 1AR82 3UJOA 4PFOA 2RDPA 4XF9A 4TXWA 4N43A 5GALA 1GZTA 4JDOA 5IJRA 1W8UA 3FMGA 1LKXA 4KMFA 5IP6A 2OW4A 5GADJ 2HQRA 3S15J 2L9SA 2YBKA 3BPVA 3GM8A 4M3FA 4NC8A 4OIOF 3Q8CA 1F1ZA 4X1EA 1E0EA 1BEV2 3SDBA 3HB9A 3O3KA 5EQUA 2VD7A 1RUC2 2WNVA 3NJYA 3LSTA 1GU3A 1F2NA 1S7OA 3REOA 5JXIA 3RJPA 3KV9A 2RDQA 2DQLA 1UYYA 1HRI3 1VI0A 3E6BA 1ZTRA 3HNMA 2F5DA 1EJ9A 1B9MA 3OL4A 2ZX3A 4P9UA 3VBUA 3K4LA 4UV9A 2DDUA 3AFHA 2EWNA 4EWAA 3KVBA 5FY1A 3C7HA 1MIJA 4HONA 4H4KC 4HKLA 2OUJA 2BV6A 3FBYA 1ZGAA 1Z7S2 2YS9A 3VKOA 3WW2A 2NAZA 1ITYA 3T1BA 2XF6A 2QQLA 1ZGJA 5E17F 1HSJA 4WVMA 2XQRA 1GT0C 3GF6A 4EJOA 4UFHA 5IT3A 2K0GA 2PAMA 4IW3A 1FNYA 2DWRA 3RKWA 3PLQA 1ND3A 4HKOA 1DU0A 3OS1A 4QDSA 1QPIA 1H4HA 2ZMEC 3OWTA 1AYN1 4CEWB 1MW7A 3SEQA 3WGIA 5B3SH 4CCLA 1B35A 5HCBA 5FYZA 1NCRC 3U2RA 4G6QA 4N4OB 1PHMA 2MPFA 4YZ5A 2GP3A 3C2HA 4COVA 1M4WA 3V0BB 2PXJA 1IV6A 4Z1VA 1PVEA 5DZFA 1QJY2 2HGCA 3W9AA 4QM8A 4IEVA 2WAOA 3J7ZI 4YVWC 1CN1A 4A6DA 1Z9CA 2VULA 5FWJA 2FDJA 2YFZA 4QAWA 3OY8A 1ONAA 3H5NA 3MLLA 3CCUI 5H9RA 3D0SA 3SMHA 2D98A 1R1VA 4RAFA 4E7KA 2JG8C 4Q0VA 2BHYA 3WF3A 1D0XA 3ZFGA 4RR3B 1YQAA 4XF1A 4QWQA 2R071 5LA2A 4CZCA 3AYCA 4ATEA 1FIPA 3FMQA 3DLAA 2YGMA 1W7PD 4GH4A 5HS7A 5FPZA 3ZQFA 3D3AA 1W6NA 3GYDA 4DZJA 3RQ0A 3QCWA 2WA0A 2FDIA 4IX7A 4PIXA 4AGVA 2XVKA 3JBG3 4O3MA 4NB5A 1G9BA 4NIGA 1SFKA 1MBJA 5KXBA 2XKOA 4M0HA 2CSOA 1QQP2 1KU3A 3B9IA 2HWD1 3DCFA 4RGUA 3NW4A 1OVSA 1F5JA 4ETSA 1VBD1 1OCZH 3ACGA 1OQDA 1C8NA 2E19A 2XBO1 4OU0A 2TRTA 3H8OA 3O5SA 3GVAA 5B1AH 1U8BA 4FPJA 2WWUA 4RL7A 1ZX5A 2VOXA 3HOZJ 2ZC2A 3BTLA 3LFMA 3SFIA 4C9YA 3LCPA 1R083 1IGOA 4U36A 1UKGA 5BNGA 4ZTFA 1JT6A 4XETA 3KEYA 2HBTA 1L3LA 4AVTA 2XONA 4COUA 5J3UA 5FZBA 4WZCA 4LBKA 5FYSA 4UW4A 1AKHA 5C9AC 3HNBM 1LENA 2AREA 2D45A 5FZ9A 2OBPA 1DP0A 2DVBA 1P9QC 3B01A 4D6QA 4S04A 1SLAA 2M7BA 5KWRA 5A7SA 4LHSA 2HDCA 1AYM2 3KCCA 1WD4A 1MBEA 3VL8A 2TCTA 4Q47A 3EBRA 1HKSA 4RA2A 2CNAA 3DL3A 4RFT0 4NWVA 4Q4V1 4O7XA 4R4XA 2HTSA 4FFIA 3U14A 4LULA 3ELKA 5M3FJ 3AMMA 4GIQA 4RS8A 1EP0A 5IHRA 1RYYA 5C8CB 4DGWB 4G94A 4IHYA 1X7NA 1IPJA 4DQAA 2HVQA 2HZTA 3U75A 2FDKA 1JTYA 3HRTA 4XOGA 5AIQA 1SCRA 1NG0A 3FM3A 2D3RA 1HCRA 1ZNPA 3BJ6A 1A8DA 1HN0A 4IV1A 2X1EA 1MQTA 1OURA 3FDYA 4AVBA 3J7HA 4BK5A 3O1RA 5ACA2 4Y1YA 2NQYA 3VD4A 1NE6A 2R6QA 3H7JA 2R7RA 1KQRA 4PIZA 5KAFC 2VQLA 1O3RA 3SKVA 4A6EA 3NNJA 4OIQF 1QJY3 2L02A 2J1SA 4PJ0C 1APLC 3NNLA 1HV0A 2OA4A 4YPJA 1BEV3 3SZGA 2XASA 2WO2A 2UY8A 1QNTA 2V72A 2E1MB 2EXIA 4HF1A 3CCRI 5FPLA 1CJPA 3KLOA 4Q4V3 4QB1A 1W1WE 1K7AA 3QH7A 1ZG3A 1QJU2 1Y8QB 1YFWA 4JK1X 1LKNA 4XKBA 2WT1A 4MXWB 5T55A 4CXYA 2LH9A 5FY9A 2VL4A 4MGTA 4NHJA 4S0HB 3M3IA 4OI1A 2V1DA 1LEBA 1V6OA 3TDZC 4A7ZA 3PUIA 3KGLA 4D9JA 3CBNA 1POV3 2VBXA 1FOKA 3WTWC 2RQQA 4P96A 1HSTA 4BJTA 1TG7A 4XM3A 4RHV1 2PG4A 4F93B 5FY0A 3DU5A 1WJBA 3AFGA 2BOJA 4MNUA 2H1KA 3KYCB 1AR92 3KZZA 3A0HC 3GLLA 1KXGA 1WWYA 2OV7A 5DDGA 1YFUA 3CQZJ 3JRFA 2P17A 4YGEA 3POSA 4FPFA 1MZ5A 4FX0A 5DXDA 2K5CA 1UMQA 4L99A 1WCSA 1RIOH 3QU6A 2PQ8A 2ZMEB 2QBXA 3Q3SA 2HVRA 2CY6A 3ROUA 1TWHJ 3BCWA 1PM4A 4LK0F 1TMF1 4K6BA 5BNPA 2ETEA 4GYIA 4E7ZA 1DIWA 4LK7A 4BQ5A 2HWE1 1CAWB 2LREA 4GAZA 4L5JA 3I53A 4OCTA 4NE9A 2JZYA 4M6XA 1MACA 1X8EA 3VDAA 1EH7A 2VNGA 1VTNC 5L3DA 5FZLA 3VGIA 4LFUA 4LBLA 4XORA 2XV4S 5K8SA 1AR83 4GJZA 3VPRA 2BDRA 3AP6A 1BMV1 2QQIA 2L7ZA 5L9BA 1VNDA 3MW3A 3H5RA 3C2BA 1Q5OA 3HGGA 5CIRA 2E1OA 2ZJRF 1FEXA 1SFYA 1MS4A 4NHMA 1AR71 3JR9A 5TSWA 3AVRA 1XMXA 1ND3B 4DB5A 3HOXJ 2F48A 1BMV2 5JI6A 1K79A 2X09A 2Q8DA 1IDZA 2UYBA 4GKXA 1U5TC 1ZARA 4CDUB 3ABZA 3L7WA 1KU7A 5BS6A 2Y6HA 1WZXA 4L0YB 5JVGF 3H1CA 2GC3A 2ADEA 1STZA 2PA7A 4E7IA 3BJAA 5KK1A 2P34A 3CJQB 3PFYA 3T30A 4CUBA 5IP9J 1OKQA 2FCUA 3RPUD 1JOJA 1G3SA 4PCQA 1OD3A 2OZJA 3MF9A 1RITA 5J7MA 3OYJA 3BT9A 3ZXDA 1VBC2 4LR4A 3TEXA 4CCEA 3RZGA 5JI7A 3BC8A 1TQPA 3WHBA 2W0XA 1Z0HA 4D94A 2R49A 2UWBA 4NOTA 4AI0A 2A6EF 4R52A 1MEC2 4QX7A 4CP1A 4FP3A 3ZR8X 2BOLA 2IA2A 5K5RA 4FX4A 4A3ZA 2VJ5A 2W00A 2Y34A 2A6TA 3GCWA 3L9FA 3RQIA 4JHZA 3Q5FA 1G3TA 2LTNA 4XJ9A 4L0ZB 5FWEA 4OHWA 4U0WA 4X6QB 4L92A 1ZA7A 3KT1A 3V0AB 1RUI3 2EIBA 3O2PE 5DM7F 2A3WA 4CEYB 5H2FC 1OOPB 5FZ4A 2OCCH 1Z7S1 4WWCA 3RJ2X 1RUJ2 5D6EA 1TQIA 2QENA 1QOTA 3I49A 1W04A 3K4NA 4LBNA 4HBNA 1GQHA 5F1RA 1XNKA 2QQVA 1K78B 1SHWB 3IV5A 2JDHA 2LS6A 4Q8LA 2IZWA 4JZRA 5KXEA 3K48A 5LATA 3D6EA 3LEMA 4IOAF 1ACCA 5HXMA 3FLPA 2JJ6A 2WNOA 5D6FA 5SV8A 4A3IJ 1ETWA 3P9CA 2IXCA 4QB2A 2ISYA 1OCTC 5F2SA 4NN0A 2A7AA 1TQMA 2VH9A 5CFDA 3CMYA 1O4TA 1VRBA 1X36A 3DBHB 1KDKA 1K6OA 2VAUA 1J1LA 4HLYA 5ACA1 1PO11 4RB1A 2ZGSA 4J00A 3FIWA 3DFGA 3C7EA 3WNOA 4NHXA 3M07A 2GNDA 1H9WA 3PTRB 2M8EA 2PMUA 2MLGA 1QZZA 3TQNA 1POV1 2P6CA 3OD4A 1UF2C 3I64A 4KU7A 3ME2A 1IO2A 2HR3A 4EQVA 1X3ZB 3UKNA 2R063 4P14A 4CP2A 3N97A 3O1PA 4CICA 2VZUA 5K5OA 3I3DA 3DP7A 3DBRB 2X85A 1H89C 4URAA 3ESWB 4ZKTB 3PIGA 3DCQA 2EBIA 2AXTC 4I30A 3ERED 1R1TA 5E1ZB 1LEAA 4I3GA 5K4LA 3VHOA 1P2FA 2ZABA 4LBOA 5D5VB 1CR7A 4KWLA 1JZ7A 3I4MJ 5LB6A 1LU1A 4PBOA 3VZKA 3KETA 3WDYA 4V19K 2WSVA 4D7MA 2J5PA 1WLTA 2VG9A 1J3PA 9ANTA 3AMHA 2ZOEB 1LTEA 2JENA 2XLGA 1ZREA 1LNWA 4W6WA 5JZGA 3B02A 1TWGJ 3VZJA 4H14A 1SLIA 3WXPA 3OEBA 2GNTA 2WAQA 3N7KA 4MYEA 2L9VA 2ZXIA 3AC0A 3NWKA 4W65A 4CDXC 1NA1C 4F92B 2O8QA 1FMVA 1RUG2 2RJLA 2CDPA 2JXAA 2V5YA 3FXRA 4N8MA 2PN5A 1VBB3 3S0MA 3NRVA 1FPN3 1UCRA 2FQ4A 2JN6A 3OBAA 1IPSA 1UPSA 4QPGC 3MYXA 2PHFA 5L7OA 4ASMB 1O4XA 1UY4A 5J1XA 2KD7A 5DDJ1 3SKJE 5BNOA 2VE8A 2ZXWH 3QYEA 1HQWA 5HCHA 1W8TA 4EJRA 4RM3A 4NRPA 2WZPP 5E1RA 2O8KA 3S1QJ 2VTFA 4R1HA 3VHRA 2NVXJ 2G19A 1G86A 5C71A 2BPA2 1KQ8A 2HTJA 3HT1A 5C5UA 2V4VA 3I2JA 2E33A 4QGNA 4FAHA 1DQ0A 2J5OA 4K20A 3BQZA 3QOPA 3I3EA 3IH3A 3G3ZA 4N0BA 2A05A 3VL9A 1KJLA 3VBFB 1J9IA 1W99A 4NBQA 3OYWB 3IRRA 3ZOIA 4JX4A 4M71A 5CFCC 3AP7A 5D8AC 5E16A 2UXXA 2RM21 1F4HA 3IL2A 2A6HF 1W0NA 5J8CA 2DAOA 1K61A 3Q8AA 3USUB 4RQPC 2K9ZA 4QLCU 4ENMA 3BPSA 5IT9Z 1AR61 2PHUA 1IRXA 1QJY1 4RFRB 2WJSA 3KV4A 1K5JA 2JDKA 1ZRRA 1X1PA 1KU2A 2ZGMA 4CU6A 1T6SA 3X2QH 3SCFA 4P1WA 4ZHNA 2FZ2A 2ZHLA 2CDOA 1UB9A 5FMOL 4RLQA 1QDOA 3LSRA 5EYYA 3PQKA 2Y9ZA 1YG2A 2KDZA 2XWJB 3B3QE 4ZJZA 1DLLA 2ARCA 4K21A 3DU6A 3OYMA 1IG0A 4BJ0A 3WINE 2DBIA 3ENRA 2WQ4A 1WJAA 2DQRA 2WLQA 1MKMA 4M3DA 3S30A 3POYA 2JA6J 3E3VA 4L9JA 1JJ6C 3LSHA 4WM7A 4HG2A 1SZBA 3PNYA 4YW2A 5FJHA 2YU3A 3VBRA 5DMYA 2BTVC 4HSJA 4XUPA 1PVC2 2VQUA 2X51A 5LD2C 4YW7A 1J0RA 4F3QA 2W1QA 5E3NA 3G7DA 2MEV2 4FOYA 4Q4X1 3T2OA 1Q8OA 4CO8A 2V5DA 4AI9A 2LDUA 3GFMA 3ULQB 3RKYA 1V0AA 2CUEA 1FC3A 4YW4A 2YSRA 3OYAA 3LF7A 1T95A 2OU2A 2QZ8A 2J42A 2WNUA 3WTYC 3OPZA 3ZQGA 4C8DA 5LK7B 2DCJA 1WI9A 4XAAA 4XNFA 3NWSA 2R32A 5FZ7A 2A70A 2NN8A 4MGSA 1GP6A 5L3BA 3GALA 2IS1A 2D6MA 4XDQA 4YIRX 1BM9A 5BNQA 4LLOA 2FQPA 2K3FA 3N9PA 1XPWA 2GAUA 3MO4A 3F22A 3AJYA 2RR12 2JK3A 2QDNA 2DU0A 1V9U1 3LWFA 2OAZA 4WX9A 5EWSA 1AZDA 2K3PA 3DPRA 3ZMZA 4IEUA 2P5KA 5FZ8A 4Y7NJ 3AAFA 2HWB1 3WG1A 3KZ4C 3AZZA 2IFWA 2ZGLA 3CNAA 2JDNA 2GOXB 4CA9A 5FLHA 4FE7A 3J7NA 2HQNA 3OUJA 5A1LA 3TEYA 4X8PA 2Q8OA 2Y6GA 4UT5A 2HDDA 1W90A 2ADDA 3B93A 5C3PA 3UKVA 5L3EA 3JW4A 2WUHA 3VUOA 1ETKA 3RZDJ 3N36A 3JSOA 5FROA 1VBA3 4RGSA 1MBKA 1W3VA 2VUJA 2P6TA 1VLNA 2V9VA 5F08A 2YU2A 2OQRA 1F4AA 1OF3A 5CNAA 2BNOA 4ATFA 4A4AA 2P3JA 3V42A 3VFZA 2BGOA 1Y3TA 4PJMA 2MA3A 1AF9A 4UB6C 2RDRA 3MVPA 1ZRDA 3SH4A 2EXJA 2J1EA 2VZSA 3PIPF 3MKWB 1IXRC 1HRI1 1G7YA 2F17A 3G73A 1W6PB 3FXKA 2WRAA 3ABMH 1ZBE1 1HKDA 1ZA4A 4XABA 3FE5A 1AXZA 1TC3C 3LOBA 3U9GA 2GU9A 5ABJA 2DODA 2W46A 5J40A 4GWJA 4UUSB 1VB2A 5B2GB 5C6CA 4B1RA 1FYMA 4CH7A 3I58A 2ZBJA 4FCAA 3U1KA 4DO0A 4XKCA 1OC1A 5K5QA 3TEWA 1USSA 2XJQA 3LA3A 4XQWA 2ZA9A 2EIJH 3LAJA 2NP0A 4IEZA 4KMUX 4C2UA 2VCMA 1BBT2 1CZVA 1YI2I 2Y0OA 2MC3A 2NOGA 3P5JA 3T8TA 3EMRA 2CTVA 4DUWA 3B94A 4RB2C 4LIUA 4PUSA 3KX2A 1YO8A 4ZY9A 4FTBA 4RGAA 4HBLA 2IVIB 5AC91 3UKGA 3K77A 3LQQA 2IEKA 1R22A 4Y33A 2HEOA 2VT2A 2RMU3 4PLNA 4HQEA 5FKBA 4M3GA 5F0FA 2K9NA 1Y0NA 3CO6C 3CC2I 1KDMA 2JG9C 1ULDA 4Y4YA 2FBIA 1W2NA 1X19A 2K7LA 5HPOA 5JXHA 2OIIA 4YVSA 3J7YJ 2ARXA 3ZFFA 1R4NB 1YLLA 4IXLA 3S7IA 1EF4A 5T3NA 3AKQA 5A3NA 2CGPA 2L01A 3T0BA 5GLUA 2O0YA 3ZN6B 3M4FA 3DXUA 5A7QA 2FEZA 2QFEA 1ERDA 3AYAA 2DFBA 4BU2A 1CAXA 1S0EA 4XAEA 5C3OA 5LA9A 1LGBA 1QGLA 1TLHB 3KF3A 4XF0A 2PI0A 1ZZCA 4IHVA 1KONA 1DQ6A 2A3XA 4B09A 3B9CA 3WG4A 3H0OA 5E3OA 3JTGA 4ES9A 3FXMA 3W5MA 2GMMA 4BXUA 1PGW2 4BE1A 3KMHA 3UNGC 3IIIA 5ED4A 2BY0A 2Z2SB 5JOWA 2BJSA 4Y24A 4XFHA 2GLOA 4QKFA 4DUVA 5TRDA 4LLNA 3B69A 1VRH3 1S0BA 5J1RA 2NLRA 4HX7A 2ZFUA 3WG3A 4Z2AA 2J1RA 3ES1A 3L2HA 1Q1HA 4HOBA 4G9SB 1VQ8I 1F36A 1CZTA 4BXFA 3KV5A 1WD3A 1NCQB 2P1BA 3GGLA 3K6GA 2UY9A 3BTJA 1IW7F 2XPJA 2GOMA 1IG3A 1NAEA 5ABJB 4OIRF 5C3EJ 2EILH 4GB33 4LG3A 4IE6A 1K6YA 2PQSA 3BZKA 5JZGB 4GDFA 3HJEA 4XCBA 4FPOB 2TDXA 1IRFA 3ZSJA 3FF5A 3N35A 2DURA 4XL9A 4NDLA 4LLFA 1D8KA 2IW5A 1I5ZA 1J7KA 2LVSA 2X29A 1JUIA 2NNYA 3WP6A 5GLVA 3AM2A 4J1WA 5FPUA 4AEDA 1O7FA 2W1SA 2LROA 4GO1A 1RUJ1 3DYMA 1ZRFA 1O5UA 4MX3A 1R081 3W21A 4E9KA 5EP9A 3VN4A 5JVVA 5DAPA 4MHRA 3F8NA 1MBHA 4H7LA 4Y22A 1BZWA 1PK6A 5LY2A 4YG6A 1I27A 2ZMLA 2E7XA 2R5YB 3K51A 1X4PA 1AXYA 4TTGA 5TISC 4CCDA 2PAEA 3WNNA 3DKWA 4Z2YA 2CH0A 5T5LA 4Y1VA 3VKNA 2A73B 2Q0AA 1PO21 2EICA 1X8MA 1ZAOA 4GKYA 3CIHA 1DZTA 3BU7A 3AJZA 2YZ4A 3I97A 4BPZA 4D7SA 1R1A2 2W52A 1JMUB 2L7FP 3HGYA 3DEWA 1NH3A 1LHOA 2WKKA 2EZHA 1YFHA 3U4SA 4S05A 1SFPA 3GYHX 1JZ5A 2HWF3 2P5LC 5FRNA 3OY9A 3OYCA 4I01A 4LT5A 3HTSB 2ISZA 2Y48A 5F37A 5EZHA 1GV2A 4N7UA 4ZU5A 3VDDB 4D6RA 2PLYA 3ZYHA 1ODMA 3M3QA 1EV11 1Q8SA 1X2MA 4DOZA 1R00A 4G8XA 3S93A 1NY72 2QQJA 3OMYA 2YBSA 3UETA 4GH4C 1GHCA 2ZEXA 3OS2A 1T2XA 5DPNA 2DJNA 4E2QA 3GLXA 4M01A 1RUJ3 5CFDB 3EDPA 4B3NA 2QKMB 2XG3A 1RI7A 4IHSA 4ARXA 1FI2A 2PX9A 1SVLA 1O5LA 2P5VA 4WM7B 4PLOA 5FKKA 5JI9A 4TYSA 3M3EA 5E79C 3OSFA 2WL1A 2DPUA 1SMYF 2EPFA 2HU9A 1YJNI 1AR72 1S4CA 1URXA 3WF1A 2VKEA 3S6PA 5EJ3A 5A3MA 2MH2A 1N1TA 2D6LX 3WX5A 5HLGA 1QEXA 3WTZA 4YFNF 2EAKA 2EIEA 3E1SA 4OQ9A 2OZ6A 5JLVA 3INAA 3MICA 5GKAC 1GNYA 1Q8VA 3THDA 4M3CE 1POQA 4BIOA 1OFSA 4XHXA 4BQQA 1TMF2 2VVFA 1QHGA 3F95A 4NJ4A 3SZTA 1MMSA 1JXNA 2LLKA 3LQRA 1QOSA 2MLKA 3E97A 3K46A 1RINA 5C4WB 1UCXA 5FZ6A 3BZ6A 4WVMB 1ASJ1 3O0WA 5H6RA 2W57A 2JA7J 4DQ2A 3K4CA 5LHGA 3CJXA 5LFAA 2YFUA 4YW3A 3J80Z 1SLTA 2VMDA 1UZWA 4E4ZA 2WFPA 3MIEA 2XVCA 4NHYA 1W3XA 4NWWA 5DZEA 3TEZA 1H2MA 2ICWG 1UIKA 1DDLA 5T50A 1SD5A 1XB4A 2DMUA 4IGOA 2NZ9A 4KG8A 3BPZA 2JRTA 1VQKI 1BJAA 4B4QA 4QX3A 1YHFA 4UI9L 4UVAA 3UL2A 4OULA 3CLOA 4AYUA 3J8F1 1UKRA 5FP7A 4AVSA 5FUNA 2RN7A 4XMAA 2ZS6B 3GCXA 3I9V2 1Z78A 4JDMA 1JHNA 1H6XA 3RCOA 3LSEA 2XDVA 4NRQA 1RXGA 1E5RA 3MW4A 1UJ8A 1GV9A 2L9NA 1S2EA 4DBRA 1H2KA 1SVOA 2Q8KA 3IWZA 2UUZA 5K0UA 3KLSA 4YW5A 3WTUC 2RS51 3ZFFC 5GAGJ 3GX4X 4YEJA 2L0KA 3Q0WA 1XNCA 3TRSB 3IHUA 2RNGA 5CFCB 1V6IA 2L9LA 3UGFA 2E63A 1Y8RB 4IZZA 3H9JA 3VBFC 3FBNB 4A3GJ 1HB1A 1JUMA 2LSOA 5AIPA 1EV12 1T0FC 1W5SA 1XSDA 3HD8B 5LW9A 1UZCA 3ZFGB 5I0RA 3EUHC 1QJX3 5A1AA 3DTKA 2EQRA 3ZMOA 3C7FA 2V79A 2ZNZA 4ONUA 2MSYA 2R5ZB 3RGBA 1VFCA 4YARA 4S2GA 2CS3A 6PAXA 4OI2A 3NSTA 4Z92B 1XGNA 3ZQ7A 3ZXSA 5J8FA 4XBFA 1HC8A 2HWF2 4XQ4A 2CQ7A 4QPOA 1RUE1 2BFUL 2C6SA 2VXJA 1XGSA 4JVAA 4FFHA 4I99C 4P9XA 2K4JA 5C5TA 1COV2 3M1HA 4ZZ8A 1D4M1 1QQIA 2BBAA 4EWEA 2A6WA 3LB9A 4HK8A 1LU2A 5DS9A 2DBBA 5A33B 3SH5A 3PNVA 1R082 4IEOA 1GNHA 1JTXA 4A7KA 5FCCA 1FV3A 1RPWA 2BUKA 2X4HA 1CD3G 4XVHA 3MKYB 1FATA 1VALA 3G1MA 5AC93 3M9AA 1VQMI 3BY6A 5JFRA 1P92A 2R7TA 1QNWA 3RNSA 5FY5A 4Z07A 2HOEA 4XXPA 4V2VA 4AHZA 3T0YA 1LPQA 1N1SA 1Q3EA 4CXXA 3EPZA 1UO9A 1UU4A 2VOVA 1V4RA 4IEXA 3IB3A 3CCLI 3GXOA 2H6BA 2H8RA 2KIUA 1H1MA 2HWE3 3USUA 1RETA 2G9FA 4Z8BA 2ZX2A 2AYHA 4YM0A 4BY1J 4BL0B 1JHJA 3TL4X 2XROA 2E5NA 2KRFA 1Z77A 1DHKB 3WHUA 4RQPA 3AKRA 1C0WA 3FHAA 1FOWA 1LODA 1I6XA 2GM4A 3ZN4A 3KV6A 1Y0UA 4MADA 3FMSA 1PK6C 2M5WA 2AENA 4XTMA 1U3EM 3O12A 4MZUA 1HRV2 5FAXA 1ZR2A 5TJJA 1LGCA 3LFUA 3L2UA 1S6LA 4ABZA 4IEYA 4M74A 2LRDA 1RIRA 3AG2H 1GLNA 3TOAA 1D0GA 1OYWA 1XDUA 3HOWJ 1I3QJ 2BHZA 1Z6RA 4BXSV 1K78A 4BQAA 4AI1A 4BMBA 4JGZB 2JICA 2UWCA 2A69F 5IFTA 3T0DA 1QRYA 3CCEI 3JCIA 4RYDA 5G04L 2CV2A 2JA5J 2EINH 3MI8A 2M30A 3E6CC 2VZPA 4IQ4A 4PGHA 4BGDA 4TLGA 1UZ0A 1NCQA 5FPBA 2IWGB 4IHXA 5F1JA 3O0XA 3P3NA 2K9SA 1LFBA 2HS5A 5AFEA 2BGPA 2QQNA 4N53B 3GZEA 1U0JA 3OSDA 4QKDA 1WGPA 2ESHA 3R4DB 1O91A 5K7ZA 2R073 2OVUA 1YFXA 2GZWA 4LUKA 4UBHA 3VDDA 3U1XA 1G3YA 2BZDA 1PYVA 5BMZA 5FUIA 2L4AA 2HWC2 4WM8A 2M2EA 5C4WC 3CCJI 4BQXA 2E35A 2DYSH 2ZGRA 2VZ1A 4JOMA 1AYN2 4I0AA 3AMNA 3ZYFA 3W6KB 3TKYA 4QXCA 3I55I 5DDJ3 3NWTA 3TMOA 2FDFA 5JSPA 3UR3C 4W1UA 1UIJA 4KNCA 2W91A 3KHCA 1DU3D 2VMEA 2OC6A 5I0DA 4E4SA 1TW2A 3JUUA 1HQLA 3H8UA 2DT6A 5FTTC 4GULA 3WU2C 1TZLA 4NO4A 4G4FA 4BS9A 5LHIA 2VUCA 2DXIA 1QVUA 3AK0A 3EQLF 1JYNA 5FK8A 2COMA 1GMMA 1QZEA 2IS4A 4YNIA 5FQ0A 3GTKJ 3ZSKA 2KP6A 1XN7A 2V9PA 4BK4A 3T4HB 1IZ1A 1ZBE2 1SACA 2EH3A 1RNLA 3EETA 3BI3A 3EXUA 3RYKA 4I02A 1TZOA 3HOTA 4BYYA 5TGTA 4XJUA 1OJLA 2BVVA 5A3UA 1T38A 2HWD3 1F4KA 5J3LA 3GTOJ 3TN92 4DBQA 2I45A 3HC7A 4CDUC 4CU7A 2DPDA 5EGOB 2EALA 2CAVA 2E34A 1NKGA 2HYKA 5FPVA 2W84A 3O1TA 4AU7A 2XOMA 4LGWA 3WSOA 4BOWA 1CAVB 4Q4W3 2ECBA 1HV1A 4AVZA 1ZRIA 2DA2A 2X6OA 1OQEA 3MGUA 4BAYA 3W3CA 3AZWA 1KYWA 2D1HA 1LFPA 2QVSB 1SBEA 3MFAA 2G1MA 2GMEA 4DY5A 3KP6A 3HDDA 4YGDA 4A3EJ 5E1XA 3C3WA 3M8LA 2HEWF 3VBRC 2GXAA 5JR3A 3MUY1 4UXAA 2CWEA 3ZFEC 4JRAA 1H2NA 2W87A 4P9IA 5JVTA 1REFA 4D8MA 5EG0B 4EATA 3AL5A 3AL0C 3VSLA 3UESA 5FXVA 3I2GA 4CXFA 1DU6A 3BR0A 4LKEA 3ZYBA 4XLPF 3CKHA 1VQLI 2YV8A 2HWB2 5CADA 4MXVA 2XRLA 4KJZA 1OSGA 4HPQA 1BI0A 5ERLA 1Q1VA 1V6NA 2TEPA 4AR2A 2WNUC 2A5YB 1HN1A 2ARAA 2Y31A 1V9U2 5I0TA 2GA2A 3LEGA 1ZELA 2Y64A 3BU0A 1YUDA 5KXCA 1YFYA 3PUQA 5A2QK 4I7HA 5C3RA 1PMIA 1B6AA 5HOOA 3WGGA 2ZHMA 2BRTA 4L97A 2KKOA 4CDXA 4ZC3A 2R0HA 1LOEA 1MJAA 3K69A 5FR3A 2HLEA 4Q0SA 4A3LJ 4CDQA 1XGOA 2D6KA 3QAHA 2W1UA 4RS5A 1PIV3 1HXS1 3HIFA 1UL9A 3RWKX 2RV8A 1H1IA 1FTTA 4DZGA 3OBZA 3OUIA 5A3LA 3FLTA 3PJYA 3LQCA 3WTXC 2DCZA 3POJA 3TNQA 2ZKNA 4PQ9A 5H9SA 5AONA 2X53S 2A6XA 2A6ZA 3ZSLA 2DF7A 4PDKA 4UVCA 1FBUA 3TW7A 1DYPA 3RDIA 1QPMA 1UMZA 2OX0A 3H50A 3L9JT 4AI8A 1S72I 5C3QA 2QQBA 4ORFA 4Q4X2 3BOPA 2L4MA 1PVC1 2CV6A 1FPQA 3X29B 3Q0VA 2AR6A 2WA3A 3S1NJ 4AEDB 1ZQ3P 2FBEA 2XB0X 4LB5A 4XK4A 4BCUA 3ZQLA 2NVQJ 1UPIA 5A1FA 4XN3A 1ZZ9A 4O61A 3CDHA 2JJ7A 2EVXA 5A3TA 2DFIA 1OPCA 1XC5A 5D5UB 3BR2A 1OCOH 2XF7A 2A3YA 5IT6A 4LHLA 1LOFC 1AXKA 4LA2A 4QX8A 4YYOA 2QM3A 1SD6A 5J36A 5J96B 2HOTA 1QJZA 3TDUC 3R4KA 4Q4ZF 2ZPXA 2RV9A 3L1PA 4AIHA 4LXLA 3I59B 1JW6A 3WT3A 1HJGA 2UWMA 4AD9A 2QZ3A 3WNMA 3VD7A 5ISLA 3HN3A 2K4BA 2WS93 4MHUA 4EQQA 4EZ4A 4AE2A 1N1YA 4JX5A 2VPVA 3NAPA 3BPXA 4B7KA 3OGVA 3BCAA 3HTUA 3RPUA 1N25A 3IWFA 3IPVB 4CEWA 3SEPA 3OBTA 1WH7A 2K9MA 1K4TA 1MR5A 3AB0A 4MV2A 3OYFA 4WVZA 1MS3A 5D5XB 4I3PA 3O0VA 2QA4I 1YQ6A 2AACA 2STWA 5C8CC 3GZ6A 4AG4A 1ZR4A 3H8XA 3T2QA 1VRH1 5JXGA 4P9WA 3MEXA 2ZACA 3GFLA 3WTTC 4EVIA 2ZGNA 3LAPA 3CD6I 1WMFA 4JAAA 4M0NA 5L9RA 5HCAA 1RHI3 4I6ZA 4JHTA 2EV0A 5ANNA 2B9VA 3HHGA 3GFIA 5L9VA 2QDRA 2YC0A 3S2DJ 2DO7A 3S16J 2UU8A 3P9KA 2UV1A 4TZDA 3KGZA 1IQAA 1YIOA 1AR93 4MGRA 1AUYA 1LHVA 5FYYA 2EZIA 3NV3A 5IY5H 2DOEA 2QQOA 1JU3A 3FZVA 1SFUA 3HSEA 2XAJA 4AI3A 3WHTA 4P9FA 2V4AA 3K4DA 4LO5B 3ASOH 2RHPA 3EQEA 1FOD3 1DQUA 3ZSMA 3MIHA 4OHZA 2XSDC 4YG2F 5E20A 3WCRA 2B46X 4C3JJ 2ENRA 3ABLH 1Q56A 2M4GA 1GBGA 1YI9A 4Y4RA 1SEUA 5EZWA 1RUG1 5J4YA 2EA4A 2C6YA 4YIFA 1GZCA 3VBHA 4XDOA 4A69C 2OPKA 1MD0A 1R71A 1JYXA 3VBSC 5FO8B 1BC7C 1XQNA 2VCAA 1U9NA 5IOZA 2VW1A 4R4ZA 4HLXA 3FKIJ 1V9U3 2NYYA 3JSPA 1NZIA 2BE5F 2NVUB 3M7GA 5FKMA 1MZ6A 1RUI1 2D5VA 5EJZB 4D1QA 3H8RA 3BTYA 2M8GX 2R3SA 1DG6A 4DYCA 2WWJA 5FZGA 1Z7S3 4B4RA 2VJIA 3S32A 1W6QB 2Q2EA 3W2WA 3F8BA 2VVEA 1X9TA 1UG0A 3CCYA 1BJQA 2YB7A 3ALQA 5IWFA 5CKTA 3A0KA 4ZH4F 1NG6A 1AVBA 5L36A 2ZGUA 1H0MA 1IV8A 5EFUA 5IYDJ 1TWAJ 5HBAA 1D4M2 1J59A 1LJ9A 1TME2 2EJRA 3ASNH 5L73A 3BJOA 2LOOA 3SQNA 2DA6A 1WWXA 4Q48A 4HSTA 2E7TA 2O03A 3FC0A 4IXAA 2FCVA 2W47A 3I4NJ 2D6PA 2JUGA 1AX1A 5IAVA 1BBYA 1NTCA 5F5CA 1SEFA 1CX1A 3BZCA 2WTEA 3QPLA 2B45X 1XCBA 3I2FA 2VQ0A 4Y20A 3POGA 3HT2A 3HMYA 1PZ7A 5CVVA 3ISPA 1TWFJ 1NCRB 2G9WA 4ZDOA 1RGSA 1PUEE 3D5OA 3HOUJ 2OD5A 3FUQA 2SLIA 4F55A 5FLJA 2VCCA 4Q5OA 4Q0QA 4RHV3 1AL0G 5CU1A 5C3SA 4XRSG 4TLFA 1JYTA 1SAXA 2P3IA 1NXMA 3TBDA 2WZR3 2X5IC 1HBXG 1IGNA 3PFIA 2R7UA 4JX0A 2JSPA 2QCOA 3HUGA 3KQRA 2C24A 2ZMKA 5FYCA 2DTWA 3U37A 3OG2A 3FM5A 2PLV3 1WJ5A 2H6CA 3CF6E 4CGZA 1PVXA 1TMF3 5EDNA 3M8EA 2CG4A 1JBCA 3SDGA 3JREA 1C8M2 2KJBA 4PHZA 1WHUA 2W39A 4XBLA 4NNJA 1IS5A 2DOFA 4II3A 3Q9SA 4W97A 1YTYA 4UHTA 4W50A 1I50J 1OOPC 2DN0A 4M9SA 4A0XA 1HOMA 4CEYC 2VMFA 1W8ZA 4JGYB 4BHBA 4CDWA 4U0YA 4LLLA 1ZN2A 1W6MB 4HNVA 3DWLE 4DXTA 5HLHA 2OUMA 3MZYA 3HOVJ 5BUVA 2JG9A 1HRV3 3K4AA 4AHYA 5EEGA 4G7ZF 2WYSA 4XONA 4TWTA 4YIIA 5HS9A 3LSMA 2XHKA 3S3NA 3JAMK 2WB1N 1HQNA 3VZMA 1YQ8A 4BB3A 3WY6A 2ELKA 5M3MJ 3DYOA 2FU4A 5K0UC 4KG0A 4AQTA 1SD4A 2NVYJ 2P37A 2IXIA 3A0NA 3CC4I 4YFKF 4FQGA 4UAPA 3I2KA 4RQPB 3K4JA 3OIQA 1IZ3A 2QJVA 1U5IA 3PNAA 1P8JA 5C4XJ 2TNFA 3OD0A 2WO3A 1J3RA 2RDSA 3WP4A 3ON7A 1CGPA 1LNSA 4AIJA 2L3DA 1ON1A 2R1BA 3GCMA 3WCSA 3NRUA 5J6XA 3R0RA 4B7EA 2ERFA 4UUTA 3LSKA 3PURA 3K0LA 2V9KA 1RUC3 3DTEA 1IOAA 5HDNA 4MSVA 3QU3A 2CWSA 1C1FA 3CCMI 1LOBA 4EM1A 1QVTA 1OUXA 2VO5A 3NKTA 4OOIA 1DGRA 3AL6A 3CO7C 1D0YA 1D1AA 2FRHA 2VE1A 5K1YA 3VDBA 4UW3A 4FHTA 3LZZA 1COV3 2RDNA 4L5IA 4CUGA 1S0JA 3J81Z 3JRCA 1OYYA 1Y9GA 1W8NA 3RI8A 3DPRB 3G2BA 2KR2A 4A3KJ 2ORXA 1WSUA 2DTYA 1JGSA 2G7HA 5DUVA 4Y15A 2W08A 3S3MA 1S5LC 4CDUA 5A2QZ 4ITCA 3PVBB 5HVQC 4M9ZA 1A35A 2V26A 2A71A 4PBPA 4DRVA 2WNVB 2R7WA 1NA1B 2CAUA 1FP2A 4G9YA 5F32A 1HDDC 3ELNA 3WU1B 2RG4A 3OEAA 1A8MA 3KE2A 3MAJA 5BNNB 4ASKA 4K40A 1FMD3 2WZEA 3I2OA 2OYZA 1GOGA 3PJRA 3BG5A 4OVEA 5ILUA 2ET1A 1ZYBA 4INDA 1GV5A 4QX1A 1WI3A 1A3KA 3BTIA 1DP7P 4N4NB 4GALA 3P7NA 5JPMB 1R092 1JZ2A 3W2AA 3UGHA 1H0BA 4PK4A 1WW6A 1ZBA1 1PO22 2FOWA 3VB9A 3PL8A 1V3FA 4HX4A 1RUD2 5ACA3 3ZMTA 3URFA 1WBLA 2FJ1A 3DEUA 4L9VA 4QHBA 5AVPA 4JGYA 3ILFA 2R7VA 4CZSA 5CA6A 1R1A3 2EFNA 2KIQA 4I09A 3O7OA 1YO5C 3ZN1A 4IHTA 1VQ4I 4M3EA 4JRLA 1NXD1 1PO23 2VBPA 1B8IA 2DYRH 4DXZA 2R061 1A6QA 4D0PA 1USTA 2XJRA 1S8NA 2FNPA 1LJ7A 3TNPB 4P5YA 1J5YA 2WC2A 4NQWA 2E5ZA 2JA8J 3ZSEA 2XR4A 5L3GA 4P02B 2E1MC 1FPN1 5F0CA 5KHGA 4U0VA 4QX0A 5JCTA 3TEDA 5BNNC 5EXOA 5AFBA 5D2AA 1V5GA 4ITVA 1W6OA 2D5HA 3I4IA 4RS5B 2VXZA 1VQNI 3VBSB 4F91B 2KZVA 3DXJF 1VBE3 4XZPA 1GQGA 4LEJA 4OQ8A 5C44J 5I0SA 3HN1A 3T5XA 2DK5A 1ETXA 1UAIA 4MGQA 2XAUA 1SG3A 2XRNA 5FBJA 1W0PA 4EN9B 2WY7Q 3CZJA 2DA4A 5C4JJ 1SBDA 1X3WB 2W94A 2EFQA 1ULFA 4LOCA 1JUHA 3T2TA 4JBAA 5IYBJ 4ESBA 1LOFA 4AQSA 5FLVA 1JYCA 4JP0A 1NQDA 5CB7A 3SXYA 1SVMA 2Y6LA 4NMIA 1XNBA 3WR0A 2J1UA 3L2QA 3HEIA 5IVEA 3HOSA 2A61A 1B4AA 1FOD1 1NK3P 4Q26A 4FASD 4QQ2A 1S1AA 2ZZQA 3H9QA 4RB0A 4L8QA 4BEHA 5A7WA 4GA9A 2I07B 2M0MA 3OIOA 1FTZA 5DYMA 1BOAA 1TW3A 4MFDA 1NOVA 3I7DA 4MGZE 4DW6A 5LGUA 4M73A 3JBG2 1FP1D 1TWCJ 4UFLA 2DFFA 4XOTA 1RMU1 1X1CA 4CSWA 2X1CA 1RUG3 2H8WA 3CP2A 1L7QA 5EF6A 3GZAA 1FT9A 3AG3H 3VLBB 4RBOA 1LE8A 4XIOA 1DZQA 2JKXA 1R9TJ 5F8PA 3ZM8A 1J1TA 3CUQC 3P1IA 4B3AA 5ILVA 4XE9A 3ACFA 2PJRB 3BB6A 2FBHA 2XJSA 3LGRA 5FZHA 2IRFG 1PP8F 5KC6A 1YEWA 3N9NA 5A7OA 3CCVI 2HJIA 3T1MA 1VQ5I 5KHHA 3HPHA 4EM2A 2ID3A 4Y5Z0 1W5TA 1DPUA 2DTZA 1C5IA 3ZVXA 4RGRA 2P6SA 3HG9A 3HPGA 1POV0 5M0TA 1VBD2 1K5MA 1C28A 3K2OA 4XFBA 5E18F 3DKXA 3IKVA 2VLAA 1CONA 5FFZA 4YFZA 2Z5WA 4AEDC 5BOXA 4C0HA 4LOTA 1KRIA 4JX6A 1R5HA 1VB4A 1K45A 2VW2A 2KL4A 3KSCA 4E70A 2FOKA 1SFOJ 3V7RA 2KDOA 4M4RA 4ZXKA 2WY8Q 4AFMA 5JLXA 3A7QA 5FD6A 1KQ0A 5BPDA 2W82A 4WV8A 2DMPA 2PFWA 3F3XA 3ZQIA 2M1BA 1SQ4A 2NOJB 2R072 1D5YA 5K7HA 4UF0B 5A7PA 5M5YJ 2VOPA 4EN7B 2ME6A 1OFNA 2FNAA 3I5UA 2CYYA 2G0EA 2H0BA 2WT2A 3A03A 3AG4H 1MZFA 4YZ3A 2GC1A 3KVAA 5FXWA 1BIAA 4O9EA 3LD8A 5FRMA 5H9QA 2O8XA 3VSKA 2OT7A 5FO7B 1DGRN 4C30A 5I8SA 4LBMA 4OUSA 2GDFA 1CAVA 1XBFA 1S55A 5L3CA 3I2DA 1RUE3 4XXAA 3OR1C 4JTNA 1L3JA 1LVKA 3F0CA 4D6SA 3NNGA 4HANA 3N7LA 3IPVA 1TT5B 5ILSA 1H1AA 4F52A 3VD5A 5J1YA 4CCOA 2XAHA 1T33A 3LPFA 1JKPC 4OMZA 4P5OA 2X0LA 4KITB 1TME1 3SHRA 2H1LA 1W9FA 2Y2ZA 1PIV1 1W8HA 3ZFEB 2PHWA 4QD2A 4BE2A 1XNAA 4II2A 1KGYA 1KFUL 3QD6A 4KT6A 3M8FA 4OHYA 3RZOJ 1GWMA 5F3EA 5D1IA 1ODDA 4I98B 1KA8A 1UD1A 2KQRA 4BQ4A 2EIDA 3WEZA 5HODA 3SCGA 1OH4A 2O61A 2YXSA 3PM1A 4ZPIA 3CZ6A 1SDDB 2W68A 3WQ1A 1JYVA 4XLNF 3U11A 3CU7A 5DEQA 4ZU7A 1WW7A 4CPBD 5LRSA 1BJZA 5GZFA 4NPLA 4CDQB 2H94A 1PX4A 2JTVA 3RTRA 2BERA 3FXUA 2ZFWA 2STTA 2WWYA 4IRHA 1O3QA 3RFRA 4Q0UA 3EHKA 3KM5A 4OINF 3ZPLA 2WFF2 2LP0A 2UURA 2KXLA 4ZS3A 2XLAA 3F8FA 3FK7A 4XYXA 1LR5A 2MEV1 2WAQN 2F4IA 3VBSA 5KC5A 4HOOA 4LE4A 2VOOA 3CJIB 2J1VA 2KA3A 3C3VA 2CSGA 1AR81 4ZYAA 4I76A 2V73A 5FYVA 1IRGA 1PZ8A 3QOEA 4XLAA 3WU0A 4A41A 4YRVA 4W4ZA 5I91A 3NEUA 1TBXA 1LCLA 1QU0A 2BGCA 1QH7A 2NYXA 4E2SA 2OPTA 3PSIA 1FZPB 3C8XA 4PFPA 1PM7A 4B3XA 1Y4WA 4KBBA 1ZZ7A 1OCRH 1S7EA 2LR8A 1WGXA 3MIGA 2AC1A 1ND2A 2PHXA 3KP5A 3AYEA 3M7AA 1X1BA 2B4KA 5CEHA 4WXDA 4FAGA 2CU5A 2CL2A 3NAUA 3KP4A 2LKXA 3ABUA 5FZOA 2BOIA 2OA2A 1LQ1A 3PUAA 1AR62 5FMOS 4RMNA 4RAGA 1ND2B 5EGOA 4A3CJ 1VQ6I 4UY8I 1DZRA 1JKQC 4M3CA 3WDWA 2R0FA 1JOPA 2BP6A 5CPRB 3VBHC 4CPBA 2PHRA 1I9RA 2AEYA 3BTZA 1MZEA 5CFCA 2ID4A 1REDA 4MEYF 3I3QA 4ZDPA 3L2WA 4OAZA 3HSRA 3C7GA 4XC9A 2L9RA 1XMAA 1Y6IA 1S29A 4UFMA 5L3FA 2XPWA 1UNBA 1ONVA 2X6WA 4MIMA 3EUHA 3HBKA 4P9YA 1W6PA 2DOAA 3AMQA 3M2MA 1UY2A 1CF7B 2OUHA 2FXAA 2KFDA 2BBYA 1B72A 3I56I 2V1XA 4R9BA 3USSA 1DGWY 4MG2A 4N7IA 4GMP3 2VC1A 4PZJA 1RRJA 4MFEA 3MEPA 2BFUS 1KITA 5HNHA 4PDWB 3T4VA 5FLIA 3AYDA 3KEOA 2MD0A 1PK6B 5ICFA 4QHOA 1VPHA 1ENHA 4AZZA 2RC4A 3BOWA 2C26A 3GMEA 4XJAA 4NUBA 2FSWA 1OA4A 1UMIA 5LCWL 1R6RA 3B7MA 1O8SA 1MJ9A 3GEZA 2EAAA 3GWZA 5EJ1B 2AO9A 1OYIA 1YI7A 4Q8KA 5A6ZA 2QE3A 1UOFA 1HXS2 3MDPA 1BW5A 1R64A 2Q8EA 1DQ4A 4HL0A 3EUAA 2YU9J 1N3PA 4HN0A 1YWKA