1LB2B

Structure of the e. coli alpha c-terminal domain of rna polymerase in complex with cap and dna
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
72
structure length
72
Chain Sequence
DPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*CP*TP*TP*TP*TP*TP*TP*CP*CP*TP*AP*AP*AP*AP*TP*GP*TP*GP*
publication title Structural basis of transcription activation: the CAP-alpha CTD-DNA complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 23
structure length 72
sequence length 72
chains with identical sequence E
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2002-04-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 1lb2B00
1ZQYA 5KG3A 5DB9A 1T3NA 9ICPA 3TI0A 4F5RA 2F1IA 4ED7A 5J0WA 4DQRA 1U48A 3JPSA 1DOQA 4KN7A 1SKSA 4KLJA 1S0VA 2FMSA 2ZUBA 1KTQA 2IBKA 4ECXA 4IRCA 5DBAA 1HUZA 3MR6A 5IIMA 4O3SA 2W9MA 4GLXA 1ZQKA 1D8LA 4B9TA 2ZJAA 4EZ6A 3K75D 5KT3A 3ISDA 2BPFA 4F5NA 2VANA 3H8WA 3Q8KA 1XSNA 2IA6A 4UB5A 5J2IA 5DGAA 4I2CA 8ICGA 1NK7A 2P6RA 7ICMA 3OHBA 7ICFA 3LWLA 4CCHA 2V4RA 4B9UA 1JMSA 2HVHA 4DWIA 1S97A 2ASJA 4RNNA 3SV4A 4C8KA 4BXOB 4C8NA 3Q8RB 4DL4A 4QZFA 4I2HA 5DG8A 3UXPA 1JXLA 1BGXT 3GV7B 5KFVA 2W8KA 1CUKA 5TZVA 4ED0A 4PGYA 4PH5A 4R65A 3TARA 4DL2A 4IQWA 3RJGA 1TAUA 5DBCA 2J6UA 1QSYA 4RQ6A 3T3FA 3GIJA 3ZDBA 2JEGA 8ICAA 3MABA 4YMNA 4RQ8A 4FO6A 3RRHA 4DSLA 3PX0A 1T7PA 4YD1A 5J2KA 1BPDA 3GV8B 3V6HA 2BGWA 3MDCA 8ICHA 1KFTA 5HHIA 4UAZA 3Q8LA 1JIHA 8ICEA 2HHXA 3OSPA 1Z00B 2C28A 2AGQA 1ZQSA 4K4HA 3ZDAA 4DL6A 2PFPA 3PR4A 3PW0A 4C8MA 5J2FA 4KMUA 4M47A 4ECUA 4J9RA 4YD2A 7ICEA 7ICHA 3HPOA 4K4GA 2BR0A 3C23A 4F91B 1MSWD 2KZZA 7ICRA 4RT3A 3KHLA 3Q8MA 3GQCA 4RQ1A 2HVIA 3G6XA 9ICHA 2BCQA 5J2GA 4YN4A 4F4XA 3PV8A 1B22A 2AQ0A 1UT8A 4M6WA 5JUMA 3RB0A 4F93B 5CJ7A 4DF4A 1K1SA 1ZQCA 3RBEA 1JX4A 4ECTA 2ZTDA 9ICBA 2MUTA 2UVWA 4JV0A 2I9GA 5HHHA 1T8EA 2IHMA 2ZTEA 5KG2A 1SL1A 5D46A 5DB8A 5KT7A 1X9MA 1NOMA 2R8KA 4M9LA 4TQRA 7ICPA 5F9NA 5J0YA 5KT4A 4DFKA 4RQ3A 1U47A 2XGQA 4ED1A 3K4GA 4JK1A 4FBUA 4QWEA 2XCPA 1ZQNA 3M9MB 5DLGA 3GIMA 3SZ2A 3RH5A 2ATLA 9ICRA 4QZ8A 4NM2A 3AU2A 3M8SA 4EEYA 4DLEA 2XY7A 1N48A 2BCSA 5KFBA 4TUPA 3LK9A 4F4KA 1JXEA 5L1IA 3B0XA 2NRXA 4KN4A 3FDSA 1TV9A 4P4MA 4QZDA 4QWDA 1NKBA 1BPXA 1S76D 3ORYA 2LYHA 5KFQA 2NRZA 3MR3A 2J6TA 3MFIA 5DDYA 4UB3A 5HP4A 2ISOA 3N4MB 2Y1IA 3RJJA 5EWGA 5CP2A 4DO9A 2OWOA 2KZMA 9ICGA 3V6KA 2ASDA 4KLUA 2UVVA 2XC9A 5KFZA 5J29A 5KT2A 2ZJ5A 1ZQUA 3Q8SB 4DFPA 3KHHA 8ICRA 1NJXA 5KFXA 2HHWA 4O3QA 3EPIA 4NY8A 5KFUA 3HT3A 4MFFA 5J2AA 1L5UA 1ZQIA 2VA2A 3Q8PB 5IINA 3RRGA 8ICPA 2IHNA 4EBDA 5KFSA 1NK9A 5J0UA 4UBCA 3RH4A 5DBBA 3GDXA 4UBBA 8ICTA 5KT6A 4ECWA 3PMLA 4NLKA 8ICOA 2VA3A 8ICYA 4NM1A 4F8RA 1BPZA 5DLFA 2XGPA 1QSLA 4JWNA 4P4OA 4YR3A 4F5PA 4M9GA 4KLTA 3ZDEA 2BQRA 4UQGA 1Z3EB 3ETLA 3C5FA 3C5GA 2AJQA 2HHTA 5DDMA 4KLQA 9ICVA 3H4DA 1ZJNA 3RR7A 5KFAA 4DS5A 4YFKA 2AQ4A 1Y88A 2A1JA 4Z6CA 4I29A 1UT5A 9ICJA 1KLNA 2BKEA 3E2EA 3JPPA 1ZQXA 4MFAA 3TFSA 1ZQWA 4ED2A 3KTQA 4ED3A 4LZDA 2W9CB 1TFRA 4QZIA 4F2SA 4O9MA 3PY8A 1D9DA 3C2KA 5KG4A 3OJSA 2V9WA 7ICGA 2PFQA 4JV2A 2XY5A 3IM1A 5HNKA 3HX0A 2PFOA 4R8UA 8ICMA 3FYHA 5KFKA 4EYIB 4M9NA 1SZPA 2HW3A 2FPMA 4O3RA 3PVXA 1ZQBA 5L1KA 3UQ0A 4MF8A 3QEAZ 1TK8A 2HHSA 1A76A 4DOBA 3H7IA 3V72A 3HWTA 8ICZA 1WCLA 4O3NA 3RB3A 4TUSA 3RH6A 5CHGA 4F4ZA 3RAQA 4KLDA 5CR0A 3ISCA 4YMOA 3KHRA 2UVRA 4M2YA 2BCUA 1ZETA 4BWJA 5DGBA 3PW2A 2IMWP 2KTQA 1KRPA 2ZUCA 4KLSA 4B9SA 2C2DA 1L3VA 2I1QA 2AGPA 9ICQA 4DS4A 1V9PA 5J0PA 4O3PA 4DF8A 3UXNA 4F4WA 9ICMA 3JPOA 1UA1A 4Z6FA 4F5OA 2FMQA 3GIKA 5DQHA 2XO7A 4K4IA 1TAQA 4ECSA 3Q8QB 5J0TA 1S10A 3QZ8A 4J9MA 4I2BA 3BJYA 5KFOA 2R8GA 3N97B 4J9SA 4IQTA 2W9BB 4ED6A 4F3OA 7ICIA 8ICSA 8ICLA 1LB2B 3PMNA 1NJWA 1X9WA 4DSEA 4Q8EA 4DSFA 3PX6A 1ZQRA 1TK0A 9ICKA 3TAPA 4UAYA 2BQ3A 1BPYA 1XSPA 5F9LA 4DL5A 3M9NB 3TAQA 4C8OA 1IXRA 3UXOA 3H4BA 2GWSA 2B21A 5KG6A 4RT2A 2VA8A 4PHPA 3M8RA 3G6VA 4J9KA 4FS1A 1ZQJA 5KFLA 8ICFA 4RUCA 2F1HA 5J0XA 3PNCA 4GXKA 1BVSA 4DFMA 4M0AA 1ZQTA 5EWFA 4Z6EA 1ZQFA 4QZBA 2KFNA 1S0NA 4PPXA 3MDAA 3MR5A 5KFEA 1NKCA 3ZDCA 1B43A 4QZAA 2JEJA 2NRVA 3H8SA 5J2DA 3H8JA 3V7KA 1ZQGA 3QEBZ 1XWLA 4I2AA 2NRWA 5KFHA 3ISBA 3C2LA 5DQIA 2UVUA 5J2JA 2J6SA 9ICWA 4J9QA 4DOAA 5IIKA 4QWCA 3MR2A 1MC8A 1ZQDA 4DSJA 4P2HA 3LWMA 5J0QA 1NK8A 4BXOA 5IIIA 1S77D 4UAWA 4O3OA 1SL2A 2FLNA 4DEZA 2DFLA 2KZ3A 4RPYA 2JZBB 3PW4A 3RJKA 3TQ1A 5IIJA 4KLIA 9ICSA 2FLPA 4KITB 3BQTA 1BPEA 4KLLA 2Y1JA 2W9AA 5KFNA 4UB2A 1CEZA 3EYZA 3HP6A 3KHGA 3PW5A 2BDPA 2FPLA 2ZTCA 5EOZA 2XCAA 8ICXA 4GC7A 1ZQOA 3C1YA 3RTVA 4DQIA 3NGDA 3T5LA 4R64A 4ELVA 1S0MA 4I2FA 1L3TA 2ISPA 5BOMA 2RDIA 1RXWA 4ELTA 4QW8A 4I2GA 5J2CA 4PHDA 3PO4A 1NK6A 1Z00A 4YVZA 1D9FA 5BOLA 4KLEA 8ICIA 5L1JA 5KFWA 4P4PA 3OGUA 4I2DA 4RPXA 3V6JA 1XU4A 4YG2A 4QZGA 2C2EA 4DSIA 1WCNA 1T4GA 4IR9A 9ICUA 1RYSA 4Q44A 3GV5B 2W8LA 3T5KA 4QZEA 3PX4A 2R8JA 4EZ9A 4QWAA 4YCXA 1NK5A 9ICEA 3GFKB 5KFJA 5KFGA 1NK4A 3RJEA 4RUAA 4RQ7A 5J0SA 3V7LA 3AUOA 2V4QA 2ZJ8A 3RBDA 3THVA 2HHVA 3M9OB 4ECQA 4QWBA 5J2EA 3LDAA 3OSNA 4YR2A 5KFYA 4I27A 4UB4A 4FBTA 2C22A 2FMPA 4F2RA 2ASLA 4JWMA 1ZQVA 7ICLA 1NJYA 4RQ2A 3G6YA 2P6UA 2R8HA 4TURA 8ICNA 4GXIA 3EWAA 2Q0ZX 4KLFA 4R63A 3EPGA 5KG0A 4R66A 3TANA 5KFDA 8ICBA 3HW8A 2F1JA 5KFTA 5KFPA 3QE9Y 3BQ2A 1K1QA 2PI5A 4RQ5A 4O5KA 4M6WB 4NLZA 4O0IA 7ICUA 3RR8A 4EBEA 4YP3A 1XO1A 2MUTB 1L3UA 4TUQA 1SKRA 5KT5A 1IM4A 4IQVA 2HHQA 4YQWA 5KFFA 4BGDA 4QZ9A 4F4YA 1DGSA 5J2HA 2DPIA 4KLMA 4NXZA 4B9VA 5J0RA 3GIIA 3UQ2A 2JZBA 4F5QA 3EW9A 1XS9D 4PHEA 2R8IA 4XUSA 1MQ3A 9ICCA 4QZHA 3SV3A 3NTUA 4MFCA 1U49A 1KSPA 1BPBA 4GC6A 4IRDA 3MBYA 7ICJA 5KG7A 4DL3A 1KFSA 5J2BA 4EYHB 4F50A 4B9LA 8ICUA 3MGHA 3T5HA 5C5JA 3JPQA 9ICOA 5HMMA 5L9XA 5DG9A 5KFMA 5J0OA 2DPJA 2NRTA 9ICLA 2JEFA 1KFDA 4QZCA 4FS2A 4XRHA 7ICSA 5IIOA 1JN3A 4DOCA 4RPZA 2BHNA 7ICOA 3OHAA 1ZQLA 4BWMA 4TQSA 5L1LA 1LV5A 1HUOA 4M04A 8ICQA 4EBCA 2PXIA 2AGOA 5DB7A 5KG1A 4YR0A 4NLNA 4JUZA 1COOA 2MAXA 4X5VA 5HMLA 1QSSA 5KFCA 2BCRA 8ICWA 9ICNA 2KN7A 1S9FA 1NK0A 4I2EA 5D4BA 4KLGA 1QTMA 3BDPA 8ICVA 5KFRA 1TKDA 5D49A 3QZ7A 3C21A 5BPCA 5KG5A 3BQ0A 4IQUA 3PR5B 2M9NA 4I2JA 2BPCA 4YMMA 2W9CA 3MFHA 4J9NA 7ICTA 1ZJMA 4RNOA 4IR1A 1ZQAA 4XQ8A 5IILA 4B9MA 1PZNA 1AROP 5KFIA 3TFRA 3PW7A 1ZQEA 1U45A 3UPQA 1H38A 1A77A 3MGIA 4E0DA 4GXJA 3ZD9A 4O5EA 7ICKA 2PI4A 9ICFA 2A1JB 4PHAA 1HJPA 2AU0A 4Q8FA 1L3SA 1ZQMA 4ED8A 4I28A 2KFZA 1QLNA 5CB1A 4J9PA 3B0YA 1KEJA 4ECYA 1XSLA 2BCVA 1UA0A 4DLGA 2FPKA 1ZQPA 1NKEA 9ICTA 5EWEA 4ECZA 1RXVA 9ICIA 4J9LA 4ECVA 2JEIA 2PFNA 4KLHA 4LVSA 1TK5A 3C2MA 2C2RA 4R8UB 3PO5A 2H5XA 5CA7A 4RQ4A 4M9HA 4I2IA 2RDJA 5DKWA 5CWRA 8ICKA 4XA5A 4O5CA 4Q45A 3H40A 4DSKA 1RZTA 4KTQA 8ICCA 4G3IA 2BPGA 1U4BA 4RQ0A 3SI8A 4HYKA 3RB6A 1RPLA 5DQGA 4MEYA 3JPTA 1KDHA 4NLGA 3RJIA 8ICJA 2ALZA 3GILA 1RYRA 2P66A 4B9NA 4BDPA 2FLLA 2W9BA 3BQ1A 4RU9A 4DFJA 3C1ZA 4DL7A 1XC9A 1MQ2A 4RNMA 3OJUA 1X9SA 5DG7A 4LZGA 4Q43A 3JPNA 5DB6A 1ZQQA 4DQPA 3SYZA 3JPRA 4QW9A 2ZUDA 3RJFA 4F92B 2XY6A 1D8YA 1ZQZA 1N56A 4MEXA 4IRKA 1U9LA 1ZYQA 4Z6DA 2HHUA 4M9JA 1SKWA 1C7YA 4UB1A 1EXNA 3EZ5A 4KLOA 5KTQA 3IHQB 3RAXA 1NJZA 1S0OA 1SL0A 7ICVA 3RJHA 1X2IA 3RB4A 4DQQA 1ZQHA 3T5JA 2BQUA 4PGXA 2WTFA 3V7JA 4DQSA 4MF2A 9ICXA 4ELUA 1TVAA 4PGQA 7ICNA 4C8LA 9ICAA 7ICQA 4J9OA 3ZD8A 4ECRA 3AU6A 4JV1A 4RZRA 3ZDDA 4ZH4A 4YXMA 4YXJA
chains in the Genus database with same CATH superfamily
1ZQYA 1T3NA 9ICPA 2F1IA 4KLJA 1DOQA 4NL9A 3TKAA 5AI8A 1HUZA 2G09A 3MR6A 4GLXA 2VKQA 4Y2YA 4B9TA 4P0PA 2WB1C 4CF5A 3KZIU 3Q8KA 2A3VA 3WKAA 4I2CA 2KE7A 2QARA 1NK7A 7ICFA 4CCHA 4B9UA 2ASJA 4C8NA 1X40A 4DL4A 3GV7B 5TZVA 4R65A 1TAUA 3TARA 2DKZA 5DBCA 1QSYA 3GIJA 2W3RA 4NWIA 4RQ8A 1T7PA 2Z7JA 4UAZA 3KOOA 3UMGA 4K4HA 2AGQA 1JALA 3PR4A 4C8MA 1QQ7A 4ECUA 4YD2A 3TADA 3HPOA 2BR0A 2KZZA 1F0MA 2RRDA 3KHLA 3Q8MA 1FFUA 4P0QA 2KKVA 3WK4A 9ICHA 5J2GA 2B6GA 1QQ5A 2ES6A 3IN5A 3PV8A 2AQ0A 4M6WA 5JUMA 2E5SA 1PK1B 4DF4A 1JX4A 1T8EA 5KG2A 1O03A 1X9MA 2R8KA 2HOQA 1J97A 2XGQA 3K4GA 2XCPA 3M9MB 3SZ2A 3AU2A 4EEYA 4DLEA 3BZKA 5AKKA 2HBKA 5AI9A 4KN4A 1TV9A 2Y0SC 1ZXIA 1PVRA 2J6TA 4NJ8A 5DDYA 5HP4A 1ZRMA 2CPRA 4DO9A 2KZMA 5ALWA 1UCVA 2WAQF 1B4FA 5J29A 5KT2A 2ZJ5A 1HEKA 5KFUA 2VA2A 1ZQIA 3Q8PB 5J0UA 5DBBA 8ICTA 1QH9A 3PMLA 2VA3A 2NO4A 1BPZA 5DLFA 4M9GA 4YR3A 4F5PA 3ZDEA 3ETLA 2KEYA 3SQIA 2DGZA 4KLQA 2F44A 3H4DA 1PK1A 1KBUA 4Z6CA 1SV0C 2BKEA 1ZQWA 4ED3A 4CGZA 3CP8A 3QU5A 3HX0A 8ICMA 3FYHA 3CW2C 4O3RA 1PUZA 2DBYA 4DOBA 2LPEA 4O3NA 4TUSA 3RH6A 3AMZA 3RAQA 3KHRA 2M0NA 4YMOA 1ZETA 5DGBA 1SWWA 4KLSA 1L3VA 2I1QA 2OCEA 1V9PA 2MSNA 2ZXHA 3M6KA 1TAMA 3C29A 2XO7A 5AM1A 3Q8QB 2G08A 1S10A 4US8A 4I2BA 2EQYA 4J9SA 2W9BB 1X9WA 2MU2A 5J8YC 1ZQRA 4FE3A 5GTHU 1XSPA 5GTIU 1RG6A 2JH7A 2NV3A 3UXOA 2GWSA 5KG6A 2LKYA 4RT2A 4FFDA 3F5EA 2F1HA 5J0XA 4DFMA 4BJQA 5CRXA 4PPXA 3MDAA 3ZDCA 2JEJA 4PZNA 5AM5A 1ZQGA 3QEBZ 1XWLA 2UVUA 5AKGA 5J2JA 2J6SA 1JROA 9ICWA 4DSJA 3LWMA 4OJOA 2CRXA 1RYUA 3UMCA 4DEZA 2KP7A 2KZ3A 3PW4A 3RJKA 5IIJA 5ALRA 1Q46A 2WF6A 2Y1JA 4DCCA 5KFNA 3BQ7A 3EYZA 5EOZA 5ALEA 3C28A 3T5LA 4I2FA 1L3TA 2ISPA 1RXWA 1Z1VA 5J2CA 3PO4A 3IRUA 1Z00A 2LM1A 4YVZA 1D9FA 5KFWA 4P4PA 3OGUA 1T4GA 5AKZA 5EE3A 1RYSA 2W8LA 4QZEA 3AM9A 1NK4A 3RJEA 2HHVA 2Y9UA 4QWBA 4YR2A 2WB1F 4UB4A 2W55A 4FBTA 2C22A 4JWMA 1ZQVA 3EWAA 3TANA 5KFDA 3NRWA 3HW8A 1N61A 3FM9A 4RQ5A 4C4TA 3RR8A 1Q3UA 5B66U 1SKRA 4IQVA 2HHQA 3NVWA 3SD7A 2MA1A 1DGSA 2WF8A 4C4RA 3UQ2A 4F5QA 2R8IA 1MQ3A 4C7ZA 4QZHA 1KKXA 3SMVA 4US9A 1BPBA 5ALGA 3H0MB 5J2BA 3MGHA 5DG9A 5KFMA 9ICLA 4XRHA 3MC1A 4DOCA 4RPZA 1NI3A 2BHNA 3AL0B 4CDGA 4X5VA 5HMLA 2LBOA 5H2FU 2E8PA 1S9FA 4PL1A 3KD3A 3WK5A 5BPCA 2A1AA 4YMMA 2W9CA 7ICTA 1L8LA 5ALHA 3AEVA 4G9BA 1ZQEA 1AROP 2YY6A 2Y0SF 2FI1A 4E0DA 2HBMA 3ZD9A 4O5EA 7ICKA 4EELA 4Q8FA 4I28A 5CB1A 1KEJA 4ECYA 1XSLA 1COKA 1RXVA 9ICIA 2JEIA 1BNPA 3C2MA 4R8UB 5ALLA 4Y2XA 4I2IA 1QQ6A 5DKWA 4DSKA 8ICCA 4G3IA 1U4BA 4RQ0A 1RPLA 5JU5A 1KDHA 3RJIA 1RYRA 1KW4A 3C1ZA 2EANA 2F77X 1X9SA 1YZ7A 2VJ5A 2KJ9A 4QW9A 3BZCA 4IRKA 1U9LA 2JXJA 1C7YA 4UB1A 1EXNA 1Z19A 1S0OA 5ALQA 3PSIA 3RB4A 3V7JA 1Q8KA 4C8LA 9ICAA 4F72A 3ZD8A 3NVVA 4OJ5A 1ZD3A 4JV1A 3ZDDA 4ZH4A 1DK3A 2EDUA 5KG3A 4ED7A 1KTQA 5KNIA 4IRCA 1ZQKA 3CRXA 1D8LA 4O3MA 2ZJAA 4JB3A 3ISDA 2BPFA 2EZXA 3H8WA 1IIPA 2YMQA 3SEIA 1FFVA 4UB5A 5J2IA 8ICGA 7ICMA 3WK6A 3LWLA 1JMSA 3QUCA 5AK6A 2YTUA 1Q3VA 5DG8A 1N5WA 5AK4A 2W8KA 4IQWA 3I28A 3F2CA 1ZD4A 4RQ6A 3F53A 3ZDBA 2DQNB 3MABA 3RRHA 8ICHA 1KFTA 2BGWA 3MDCA 1X6JA 8ICEA 3OSPA 5KL1B 4DL6A 2PFPA 4M47A 4J9RA 3K1ZA 4K4GA 2WHEA 3C23A 5AI0A 3KKAC 4RT3A 3E0FA 4B6JA 3GQCA 1UQVA 2FJ6A 2HVIA 2HOFA 1J2MA 2ZIXB 3RB0A 3D2SA 9ICBA 4ECTA 2UVWA 2I9GA 4RQMA 5D46A 5DB8A 5KT7A 1NOMA 1IG6A 7ICPA 2OH2A 1U47A 4FBUA 5ALXA 4QWEA 5DLGA 5KL8B 2ATLA 9ICRA 4NM2A 1WG8A 1N48A 4TUPA 3LK9A 4F4KA 1JXEA 1K5OA 3ORYA 3MR3A 3QU4A 4UB3A 3F2BA 3RJJA 4ICAA 2KSOB 1RQNA 9ICGA 1LVHA 3MGVA 2W11A 2NYVA 4KLUA 3SENA 2XC9A 1CI4A 2HHWA 3HT3A 5J2AA 3CYMA 3IG8A 3RRGA 8ICPA 2IHNA 4EBDA 4UBCA 3GDXA 3IP4B 3EUB2 8ICOA 4NM1A 4F8RA 2KG5A 4JWNA 2BQRA 2EAPA 1Z3EB 4UATA 2ZIXA 5DDMA 9ICVA 2WFAA 4YFKA 2AQ4A 1XO0A 4MHVA 2PMZF 1KLNA 3RFAA 4MFAA 3TFSA 4ED2A 1Z1BA 3QUQA 4QZIA 4HAIA 3PY8A 5KG4A 3OJSA 2PFQA 4JV2A 2PFOA 1F5SA 5KFKA 3WKBA 1SZPA 1ZQBA 3QEAZ 1TK8A 1A76A 3HWTA 5CHGA 4M2YA 1X9XA 3M6ZA 4BWJA 2IMWP 2GH1A 2KSOA 4DS4A 4O3PA 2OHFA 9ICMA 3HJEA 2FMQA 4Z6FA 4F5OA 2JMGA 2KIWA 3QZ8A 2DWQA 1MA7A 3BJYA 2R8GA 2YB4A 3N97B 4IQTA 4F3OA 7ICIA 8ICLA 2L5YA 5CEHA 4DSEA 5ALPA 3PX6A 1TK0A 1NZBA 1JUDA 3M9NB 3AN1A 2EAOA 3H4BA 2E8OA 3VC8A 2B21A 3G6VA 4FS1A 3ONNA 3PNCA 2KNJA 1BVSA 2P35A 4M0AA 1ZQFA 2KFNA 5AM2A 5KFEA 2HDOA 1B43A 4QZAA 4Y2SA 4OJLA 5AM0A 3V7KA 1VLBA 4I2AA 3E58A 4UARA 1MC8A 4P2HA 2W04A 5J0QA 2G06A 4AYBC 1NK8A 5IIIA 4UAWA 4EEKA 2DFLA 5AKHA 4RPYA 1M6YA 3WKDA 4Y2JA 5AI4A 1SIJA 4KLIA 1SGGA 9ICSA 4Y2QA 2Q4TA 3BQTA 4KLLA 2FPLA 2ZTCA 1ZQOA 2IOHA 3NGDA 1S0MA 2RDIA 4ELTA 1NK6A 1KN5A 4Y2RA 5BOLA 4KLEA 5AIAA 4RPXA 1XU4A 2QLTA 4YG2A 4IR9A 9ICUA 4Q44A 4YCXA 3GFKB 4RUAA 3V7LA 3AUOA 2V4QA 5KAFU 5J2EA 4F2RA 2ASLA 1T94A 1NJYA 2KJ8A 2R8HA 2P6UA 8ICNA 5HR7A 1V38A 3K1RB 2Q0ZX 5EE1A 4GXIA 3EPGA 4R66A 1RDFA 2F1JA 3QE9Y 3BQ2A 3UMBA 4BUGA 5FP0A 2H3FA 2A19A 4YP3A 1F44A 2MUTB 5AKYA 1IM4A 5KT5A 4YQWA 3AQFA 3IDWA 4QZ9A 1A6SA 1XS9D 4PHEA 3DV9A 3SV3A 3SR6A 3N7PD 2YMPA 4DL3A 1KFSA 4PZOA 3JPQA 9ICOA 5HMMA 5L9XA 1J2NA 2DPJA 4QZCA 4FS2A 1JN3A 3PSPA 7ICOA 1B0XA 4TQSA 8ICQA 4M04A 1N62A 4Y2TA 1ZQ1C 5DB7A 4JUZA 2E1FA 1COOA 2MAXA 1OXJA 3D6JA 8ICWA 9ICNA 3L5KA 1NK0A 4UB6U 4KLGA 2W03A 5KFRA 1ZD2P 3QZ7A 5KG5A 2M9NA 4GIBA 3H0RB 5ALFA 5AKLA 5IILA 1PZNA 3PW7A 2VJ4A 2MRLA 3QUBA 2A1JB 4PHAA 1HJPA 4OCZA 4ED8A 2KFZA 1QLNA 1PVQA 2BCVA 1NKEA 2F8LA 4ECZA 1SV0A 2QB0B 4KLHA 4CF3A 1TK5A 2H5XA 4M9HA 5CWRA 4O5CA 3H40A 4KTQA 1RZTA 4HYKA 3JPTA 4MEYA 4J03A 4KX3A 4B9NA 2FLLA 2W9BA 3BQ1A 4RU9A 3CNHA 1XC9A 1MQ2A 4RNMA 2DUYA 4C0ZA 2IOFA 3L4PA 5DG7A 4Q43A 3JPNA 4DQPA 2KICA 3JPRA 2ZUDA 4QNLA 1WYGA 2XY6A 4MEXA 2F3NA 4Z6DA 4M9JA 2ESEA 1NJZA 3TACB 2KV2A 1X2IA 4DQQA 1ZQHA 2BQUA 4PGXA 9ICXA 4USAA 4J9OA 5J8YA 4F71A 4YXJA 4NLZA 1VDVA 3FAHA 4FZNA 3IG5A 1U48A 1H38A 5J0WA 3E2EA 1S0VA 4KN7A 2IBKA 4ECXA 4O3SA 5IIMA 2W9MA 2GO7A 5G5HA 1SWVA 4EZ6A 3K75D 5KT3A 2QB0A 4F5NA 2PMZC 2IA6A 3RF9A 3GU3A 5DGAA 2P6RA 3OHBA 2JV3A 2HVHA 1S97A 2KMDA 4RQNA 4RNNA 4BXOB 3Q8RB 4QZFA 1JXLA 1BGXT 1FEZA 3ED5A 2CN1A 4PH5A 4DL2A 5ALJA 4OJPA 2J6UA 3T3FA 8ICAA 4YMNA 5KAIU 3PX0A 5J2KA 1JIHA 2C28A 1ZQSA 1VJ5A 2H3VA 2W7PA 3PW0A 4KMUA 7ICHA 7ICEA 1S8OA 4F91B 3QU9A 2H3QA 4RQ1A 4EX6A 3G6XA 4YN4A 5ALMA 4AYBF 4F4XA 1B22A 1UT8A 3LVVA 4F93B 5CJ7A 2N1RA 2K8AA 1SL1A 4M9LA 5KT4A 2ZIVB 3L3FX 1NNLA 4RQ3A 3HKZC 4ED1A 1ZQNA 3RH5A 5K4LA 4QZ8A 3M8SA 3QX7A 1XNSA 2BCSA 5ALZA 3DEEA 5L1IA 1N60A 2NRXA 1BPXA 4QZDA 1S76D 5KFQA 2NRZA 3MFIA 3N4MB 3NVZA 5EWGA 1N5XA 2LMRA 2OM6A 2UVVA 1L7PA 3Q8SB 1MN8A 2DF4B 1NJXA 1L5UA 1SXEA 5AKEA 2FE9A 1NK9A 3HILA 3RH4A 1HIWA 5KT6A 4ECWA 4NLKA 8ICYA 2XGPA 2K4PA 4P4OA 1LKYB 4KLTA 2QKQA 2JH1A 3C5GA 3C5FA 2CXYA 2JR5A 4PL2A 5ALOA 2ZXIA 1ZJNA 3RR7A 3NRZA 5KFAA 4DS5A 2PKEA 3JPPA 4LZDA 4F2SA 1TFRA 4O9MA 1D9DA 2HI0A 3KZXA 4R8UA 1X6IA 1SZHA 2JRZA 4UAUA 4MF8A 3DDHA 3S6JA 2G5HB 4GFJA 1L6NA 3RB3A 4OO1J 2XI9A 2RLTA 3GZFA 2UVRA 1ZOLA 2BCUA 2KTQA 1KRPA 4B9SA 3I1YA 2ZIUB 5J0PA 4DF8A 3UXNA 4F4WA 1AQ6A 3JPOA 2E1EA 5ALUA 3GIKA 3O0FA 5DQHA 2LYBA 4K4IA 5J0TA 4J9MA 5TISU 5KFOA 2WF5A 4ED6A 1LB2B 3PMNA 1NJWA 4Q8EA 4AP9A 9ICKA 3QU7A 4Y2PA 2LM4A 1BPYA 2KJ5A 4DL5A 4C8OA 1IXRA 3N7RC 1V97A 4NL9C 2VA8A 4PHPA 4J9KA 3HRDD 1ZQJA 2KD1A 5B5EU 4GXKA 1ZQTA 1Z4NA 1X42A 2AXTU 2HMXA 3H8JA 4JMUA 4C80A 3F5AA 1TE2A 2NRWA 3C2LA 5DQIA 3NUQA 1DK2A 4J9QA 2DKXA 4DOAA 5IIKA 4QWCA 1ZQDA 2AH5A 1S77D 4O3OA 2F76X 1SL2A 2FLNA 4P0PB 3KBBA 3TQ1A 1FO4A 2FLPA 4KITB 2JHDA 5AI6A 2QARB 3A0BU 3KHGA 2BDPA 8ICXA 3C1YA 4ELVA 1L8OA 4KX5A 3TADC 1OW5A 4PHDA 1SV4A 2OEHA 1ZD5A 4C7YA 8ICIA 5L1JA 5C0YA 4I2DA 3V6JA 4QZGA 2C2EA 4DSIA 1WCNA 1UHUA 3T5KA 2R18A 3PX4A 3QXGA 5KFJA 1RM6C 2H3ZA 4RQ7A 2ZJ8A 3RBDA 3THVA 3LDAA 3OSNA 5KFYA 4I27A 2FMPA 2HBJA 7ICLA 2KK0A 4RQ2A 2B0CA 2OXOA 3G6YA 1X66A 3QNMA 4KLFA 5KG0A 2WF9A 8ICBA 1T3QA 1WWUA 5KFPA 5KFTA 3KKAA 2PI5A 3A0HU 4M6WB 4O0IA 1CRXA 7ICUA 4EBEA 1XO1A 4UASA 5KFFA 4F4YA 5J2HA 4NXZA 5J0RA 9ICCA 3D2QA 1KSPA 3FC4A 7ICJA 5KG7A 4UB8U 2E3TA 2K4HA 3BS5B 4F50A 2HSZA 1WUDA 5C5JA 4QJFB 4NLCA 2JEFA 2K4IA 7ICSA 5IIOA 4IS7A 3OHAA 2AHOB 4BWMA 5L1LA 1LV5A 3IV6A 5JRTA 4EBCA 2PXIA 2AGOA 4NLNA 2W43A 2HOIA 2ZIWB 2KN7A 5AKJA 2KOBA 3HKZF 3BDPA 8ICVA 1TKDA 5D49A 3C21A 2G0AA 4IQUA 4I2JA 4ZOHC 2BPCA 1RQLA 4U6PA 3MFHA 4J9NA 3PSTA 4IL6U 1ZJMA 4IR1A 1ZQAA 9ICEA 1S5LU 5KFIA 1U45A 1A77A 3MGIA 4GXJA 2D3DA 9ICFA 2QB1A 2XIDA 2GLEA 4J9PA 3B0YA 1UA0A 9ICTA 4CNQA 2XICA 5EWEA 4J9LA 4ECVA 2F2AB 5ALNA 2Y9TA 5CA7A 4RQ4A 2RDJA 8ICKA 4Q45A 2EZZA 1L7NA 3BS5A 5DQGA 4NLGA 2LHTA 2ALZA 3GILA 1YZ6A 2BZFA 2P66A 4LZGA 5DB6A 3SYZA 2YB1A 1D8YA 2YN4A 3PZPA 4KMOB 3EZ5A 5ALSA 3LYSA 4FZMA 4KLOA 2ZIWA 3IHQB 3RAXA 2BDUA 1SL0A 3WK8A 4CF4A 2FDRA 5AKXA 5HR6A 2WTFA 3LVWA 4DQSA 1N63A 2O6KA 2HCFA 4PGQA 3T79A 4ELUA 5AM4A 7ICQA 4ECRA 3VCBA 4YXMA 5DB9A 4CE6A 3TI0A 4F5RA 4DQRA 1SKSA 3JPSA 4EX7A 4ACOA 2FMSA 2ZUBA 5DBAA 5ALVA 3N7SC 5A0LA 2GOLA 5ALYA 2VANA 1XSNA 4Y2VA 2WF7A 3SAFA 2V4RA 5AK5A 2G07A 4DWIA 3SV4A 4C8KA 3H8MA 4I2HA 3UXPA 1KQQA 5KFVA 1CUKA 4ED0A 4PGYA 3RJGA 5EE9A 3QUTA 5F3XB 2JEGA 4DSLA 4FO6A 3BS7A 4YD1A 3V6HA 1BPDA 3GV8B 2K8BB 5HHIA 3Q8LA 2HHXA 1Z00B 2ZG6A 3ZDAA 2OYYA 5J2FA 4Y2UA 2DL0A 1OUQA 7ICRA 1V85A 1MSWD 2BCQA 1ZRNA 2LI6A 1WWVA 1ZQCA 1K1SA 3RBEA 2ZTDA 4U7CA 2MUTA 4JV0A 5HHHA 2IHMA 2ZTEA 4A8EA 4TQRA 5F9NA 5J0YA 4DFKA 4UW9A 4JK1A 3GIMA 4OD0A 4CRXA 2XY7A 5KFBA 3B0XA 3FDSA 4P4MA 4QWDA 1NKBA 1FIQA 3NS1A 2EH9A 2LYHA 4LJXA 1NZPA 2ISOA 2Y1IA 5CP2A 2OWOA 1L7OA 3V6KA 2ASDA 3QYPA 2W7OA 2KHQA 5KFZA 3QU2A 4PJ0U 1ZQUA 4DFPA 3KHHA 8ICRA 5KFXA 4O3QA 3EPIA 4NY8A 4MFFA 1Z4OA 4QIWC 5IINA 1SXDA 2HBLA 5KFSA 4UBBA 1ECWA 1QSLA 2EAMA 4UQGA 3ALRA 2D8CA 2AJQA 2HHTA 5AIBA 1Y88A 2A1JA 4I29A 1UT5A 9ICJA 1ZQXA 3KTQA 1IV8A 2W9CB 2IOFK 2YMMA 3C2KA 2V9WA 2D6FC 7ICGA 4EENA 3OTQA 2XY5A 3IM1A 5HNKA 4EYIB 4M9NA 2HW3A 2FPMA 3PVXA 2HHSA 5L1KA 3UQ0A 3H7IA 3V72A 8ICZA 1WCLA 4F4ZA 2EZYA 2K60A 5CR0A 3SAGA 3ISCA 4KLDA 3I76A 3PW2A 2ZUCA 2C2DA 4DFDA 2KHVA 2AGPA 9ICQA 3KFUF 5E79U 1UA1A 5ALIA 3WK7A 1DGJA 1TAQA 5ALTA 4ECSA 8ICSA 2XVTA 1O08A 2I5HA 2W54A 4DSFA 3WKEA 3TAPA 4UAYA 3ETRA 2BQ3A 2VIXA 5F9LA 3PSFA 2KVCA 3TAQA 5AICA 3M8RA 5KFLA 8ICFA 4RUCA 5EWFA 4Z6EA 2E8NA 4QZBA 1S0NA 4IC9A 3MR5A 1NKCA 2NRVA 3H8SA 5J2DA 3ICXA 3ISBA 5KFHA 1D8BA 2YX8A 3MR2A 2K8CB 2JGAA 3ZI4A 1DXSA 4BXOA 2E8MA 5EE0A 1N2XA 2JZBB 1BPEA 1URJA 2W9AA 4UB2A 1CEZA 3HP6A 2F8KA 3PW5A 2XCAA 1KL9A 4GC7A 3RTVA 5T14A 4DQIA 4R64A 5BOMA 4QW8A 4I2GA 5L1MA 3F2DA 3B9JA 3GV5B 4EZ9A 2R8JA 4QWAA 1NK5A 5KFGA 5J0SA 5AKIA 3M9OB 4ECQA 3N28A 3WU2U 1YT3A 2WAQC 2W3SA 4TURA 4R63A 2KVSA 5ALDA 2ZIVA 5JTIA 1K1QA 4O5KA 4UAVA 1L3UA 4TUQA 5AI5A 1ED1A 3SAHA 4BGDA 2DPIA 4KLMA 4B9VA 3M7DA 5AK3A 3GIIA 2JZBA 3OPXA 3EW9A 4XUSA 5AM3A 3NTUA 4MFCA 1U49A 2YMLA 1SB3C 4GC6A 4IRDA 3MBYA 3M1YA 2NO5A 4NLBA 4EYHB 2K4EA 4B9LA 8ICUA 3T5HA 5J0OA 2NRTA 1KFDA 2RP5A 2LYAA 1BNOA 1ZQLA 1L7MA 3NVYA 1HUOA 4OJ6A 4YR0A 1A0PA 5KG1A 1LKYA 2KKPA 1C20A 1QSSA 5KFCA 2BCRA 2RHFA 4I2EA 5ALKA 5D4BA 1QTMA 4WJ3B 3BQ0A 3PR5B 4RNOA 1PVPA 4XQ8A 4B9MA 3TFRA 3D2NA 3UPQA 2ODGA 2PI4A 2AU0A 4FZLA 1L3SA 4BX9C 5AHXA 1ZQMA 3H0LB 2RQ5A 1DRGA 3AQEA 1ZQPA 4DLGA 2FPKA 1P7DA 2KIVA 2I6XA 3WKCA 2PFNA 4LVSA 2C2RA 3PO5A 2ZIUA 1JI7A 4QIWF 4XA5A 2BPGA 3SI8A 3RB6A 3WK9A 8ICJA 2K89A 4BDPA 3J81j 4DFJA 4DL7A 1PK3A 3OJUA 2YQEA 1ZQQA 3RJFA 2G5IB 5G5GA 3NASA 4F92B 1JRPA 1QCKA 1ZQZA 1N56A 1ZYQA 1UPHA 2HHUA 1SKWA 5KTQA 7ICVA 4C4SA 3RJHA 3R9KA 3T5JA 4MF2A 4P0QB 1TVAA 3U26A 7ICNA 4NV0A 3UM9A 1GO3F 3AU6A 4RZRA 2H3IA
chains in the Genus database with same CATH topology
1ZQYA 5KG3A 5DB9A 1T3NA 9ICPA 3TI0A 4F5RA 2F1IA 4ED7A 5J0WA 4DQRA 1U48A 3JPSA 1DOQA 4KN7A 1SKSA 4KLJA 1S0VA 2FMSA 2ZUBA 1KTQA 2IBKA 4ECXA 4IRCA 5DBAA 1HUZA 3MR6A 5IIMA 4O3SA 2W9MA 4GLXA 1ZQKA 1D8LA 4B9TA 2ZJAA 4EZ6A 3K75D 5KT3A 3ISDA 2BPFA 4F5NA 2VANA 3H8WA 3Q8KA 1XSNA 2IA6A 4UB5A 5J2IA 5DGAA 4I2CA 8ICGA 1NK7A 2P6RA 7ICMA 3OHBA 7ICFA 3LWLA 4CCHA 2V4RA 4B9UA 1JMSA 2HVHA 4DWIA 1S97A 2ASJA 4RNNA 3SV4A 4C8KA 4BXOB 4C8NA 3Q8RB 4DL4A 4QZFA 4I2HA 5DG8A 3UXPA 1JXLA 1BGXT 3GV7B 5KFVA 2W8KA 1CUKA 5TZVA 4ED0A 4PGYA 4PH5A 4R65A 3TARA 4DL2A 4IQWA 3RJGA 1TAUA 5DBCA 2J6UA 1QSYA 4RQ6A 3T3FA 3GIJA 3ZDBA 2JEGA 8ICAA 3MABA 4YMNA 4RQ8A 4FO6A 3RRHA 4DSLA 3PX0A 1T7PA 4YD1A 5J2KA 1BPDA 3GV8B 3V6HA 2BGWA 3MDCA 8ICHA 1KFTA 5HHIA 4UAZA 3Q8LA 1JIHA 8ICEA 2HHXA 3OSPA 1Z00B 2C28A 2AGQA 1ZQSA 4K4HA 3ZDAA 4DL6A 2PFPA 3PR4A 3PW0A 4C8MA 5J2FA 4KMUA 4M47A 4ECUA 4J9RA 4YD2A 7ICEA 7ICHA 3HPOA 4K4GA 2BR0A 3C23A 4F91B 1MSWD 2KZZA 7ICRA 4RT3A 3KHLA 3Q8MA 3GQCA 4RQ1A 2HVIA 3G6XA 9ICHA 2BCQA 5J2GA 4YN4A 4F4XA 3PV8A 1B22A 2AQ0A 1UT8A 4M6WA 5JUMA 3RB0A 4F93B 5CJ7A 4DF4A 1K1SA 1ZQCA 3RBEA 1JX4A 4ECTA 2ZTDA 9ICBA 2MUTA 2UVWA 4JV0A 2I9GA 5HHHA 1T8EA 2IHMA 2ZTEA 5KG2A 1SL1A 5D46A 5DB8A 5KT7A 1X9MA 1NOMA 2R8KA 4M9LA 4TQRA 7ICPA 5F9NA 5J0YA 5KT4A 4DFKA 4RQ3A 1U47A 2XGQA 4ED1A 3K4GA 4JK1A 4FBUA 4QWEA 2XCPA 1ZQNA 3M9MB 5DLGA 3GIMA 3SZ2A 3RH5A 2ATLA 9ICRA 4QZ8A 4NM2A 3AU2A 3M8SA 4EEYA 4DLEA 2XY7A 1N48A 2BCSA 5KFBA 4TUPA 3LK9A 4F4KA 1JXEA 5L1IA 3B0XA 2NRXA 4KN4A 3FDSA 1TV9A 4P4MA 4QZDA 4QWDA 1NKBA 1BPXA 1S76D 3ORYA 2LYHA 5KFQA 2NRZA 3MR3A 2J6TA 3MFIA 5DDYA 4UB3A 5HP4A 2ISOA 3N4MB 2Y1IA 3RJJA 5EWGA 5CP2A 4DO9A 2OWOA 2KZMA 9ICGA 3V6KA 2ASDA 4KLUA 2UVVA 2XC9A 5KFZA 5J29A 5KT2A 2ZJ5A 1ZQUA 3Q8SB 4DFPA 3KHHA 8ICRA 1NJXA 5KFXA 2HHWA 4O3QA 3EPIA 4NY8A 5KFUA 3HT3A 4MFFA 5J2AA 1L5UA 1ZQIA 2VA2A 3Q8PB 5IINA 3RRGA 8ICPA 2IHNA 4EBDA 5KFSA 1NK9A 5J0UA 4UBCA 3RH4A 5DBBA 3GDXA 4UBBA 8ICTA 5KT6A 4ECWA 3PMLA 4NLKA 8ICOA 2VA3A 8ICYA 4NM1A 4F8RA 1BPZA 5DLFA 2XGPA 1QSLA 4JWNA 4P4OA 4YR3A 4F5PA 4M9GA 4KLTA 3ZDEA 2BQRA 4UQGA 1Z3EB 3ETLA 3C5FA 3C5GA 2AJQA 2HHTA 5DDMA 4KLQA 9ICVA 3H4DA 1ZJNA 3RR7A 5KFAA 4DS5A 4YFKA 2AQ4A 1Y88A 2A1JA 4Z6CA 4I29A 1UT5A 9ICJA 1KLNA 2BKEA 3E2EA 3JPPA 1ZQXA 4MFAA 3TFSA 1ZQWA 4ED2A 3KTQA 4ED3A 4LZDA 2W9CB 1TFRA 4QZIA 4F2SA 4O9MA 3PY8A 1D9DA 3C2KA 5KG4A 3OJSA 2V9WA 7ICGA 2PFQA 4JV2A 2XY5A 3IM1A 5HNKA 3HX0A 2PFOA 4R8UA 8ICMA 3FYHA 5KFKA 4EYIB 4M9NA 1SZPA 2HW3A 2FPMA 4O3RA 3PVXA 1ZQBA 5L1KA 3UQ0A 4MF8A 3QEAZ 1TK8A 2HHSA 1A76A 4DOBA 3H7IA 3V72A 3HWTA 8ICZA 1WCLA 4O3NA 3RB3A 4TUSA 3RH6A 5CHGA 4F4ZA 3RAQA 4KLDA 5CR0A 3ISCA 4YMOA 3KHRA 2UVRA 4M2YA 2BCUA 1ZETA 4BWJA 5DGBA 3PW2A 2IMWP 2KTQA 1KRPA 2ZUCA 4KLSA 4B9SA 2C2DA 1L3VA 2I1QA 2AGPA 9ICQA 4DS4A 1V9PA 5J0PA 4O3PA 4DF8A 3UXNA 4F4WA 9ICMA 3JPOA 1UA1A 4Z6FA 4F5OA 2FMQA 3GIKA 5DQHA 2XO7A 4K4IA 1TAQA 4ECSA 3Q8QB 5J0TA 1S10A 3QZ8A 4J9MA 4I2BA 3BJYA 5KFOA 2R8GA 3N97B 4J9SA 4IQTA 2W9BB 4ED6A 4F3OA 7ICIA 8ICSA 8ICLA 1LB2B 3PMNA 1NJWA 1X9WA 4DSEA 4Q8EA 4DSFA 3PX6A 1ZQRA 1TK0A 9ICKA 3TAPA 4UAYA 2BQ3A 1BPYA 1XSPA 5F9LA 4DL5A 3M9NB 3TAQA 4C8OA 1IXRA 3UXOA 3H4BA 2GWSA 2B21A 5KG6A 4RT2A 2VA8A 4PHPA 3M8RA 3G6VA 4J9KA 4FS1A 1ZQJA 5KFLA 8ICFA 4RUCA 2F1HA 5J0XA 3PNCA 4GXKA 1BVSA 4DFMA 4M0AA 1ZQTA 5EWFA 4Z6EA 1ZQFA 4QZBA 2KFNA 1S0NA 4PPXA 3MDAA 3MR5A 5KFEA 1NKCA 3ZDCA 1B43A 4QZAA 2JEJA 2NRVA 3H8SA 5J2DA 3H8JA 3V7KA 1ZQGA 3QEBZ 1XWLA 4I2AA 2NRWA 5KFHA 3ISBA 3C2LA 5DQIA 2UVUA 5J2JA 2J6SA 9ICWA 4J9QA 4DOAA 5IIKA 4QWCA 3MR2A 1MC8A 1ZQDA 4DSJA 4P2HA 3LWMA 5J0QA 1NK8A 4BXOA 5IIIA 1S77D 4UAWA 4O3OA 1SL2A 2FLNA 4DEZA 2DFLA 2KZ3A 4RPYA 2JZBB 3PW4A 3RJKA 3TQ1A 5IIJA 4KLIA 9ICSA 2FLPA 4KITB 3BQTA 1BPEA 4KLLA 2Y1JA 2W9AA 5KFNA 4UB2A 1CEZA 3EYZA 3HP6A 3KHGA 3PW5A 2BDPA 2FPLA 2ZTCA 5EOZA 2XCAA 8ICXA 4GC7A 1ZQOA 3C1YA 3RTVA 4DQIA 3NGDA 3T5LA 4R64A 4ELVA 1S0MA 4I2FA 1L3TA 2ISPA 5BOMA 2RDIA 1RXWA 4ELTA 4QW8A 4I2GA 5J2CA 4PHDA 3PO4A 1NK6A 1Z00A 4YVZA 1D9FA 5BOLA 4KLEA 8ICIA 5L1JA 5KFWA 4P4PA 3OGUA 4I2DA 4RPXA 3V6JA 1XU4A 4YG2A 4QZGA 2C2EA 4DSIA 1WCNA 1T4GA 4IR9A 9ICUA 1RYSA 4Q44A 3GV5B 2W8LA 3T5KA 4QZEA 3PX4A 2R8JA 4EZ9A 4QWAA 4YCXA 1NK5A 9ICEA 3GFKB 5KFJA 5KFGA 1NK4A 3RJEA 4RUAA 4RQ7A 5J0SA 3V7LA 3AUOA 2V4QA 2ZJ8A 3RBDA 3THVA 2HHVA 3M9OB 4ECQA 4QWBA 5J2EA 3LDAA 3OSNA 4YR2A 5KFYA 4I27A 4UB4A 4FBTA 2C22A 2FMPA 4F2RA 2ASLA 4JWMA 1ZQVA 7ICLA 1NJYA 4RQ2A 3G6YA 2P6UA 2R8HA 4TURA 8ICNA 4GXIA 3EWAA 2Q0ZX 4KLFA 4R63A 3EPGA 5KG0A 4R66A 3TANA 5KFDA 8ICBA 3HW8A 2F1JA 5KFTA 5KFPA 3QE9Y 3BQ2A 1K1QA 2PI5A 4RQ5A 4O5KA 4M6WB 4NLZA 4O0IA 7ICUA 3RR8A 4EBEA 4YP3A 1XO1A 2MUTB 1L3UA 4TUQA 1SKRA 5KT5A 1IM4A 4IQVA 2HHQA 4YQWA 5KFFA 4BGDA 4QZ9A 4F4YA 1DGSA 5J2HA 2DPIA 4KLMA 4NXZA 4B9VA 5J0RA 3GIIA 3UQ2A 2JZBA 4F5QA 3EW9A 1XS9D 4PHEA 2R8IA 4XUSA 1MQ3A 9ICCA 4QZHA 3SV3A 3NTUA 4MFCA 1U49A 1KSPA 1BPBA 4GC6A 4IRDA 3MBYA 7ICJA 5KG7A 4DL3A 1KFSA 5J2BA 4EYHB 4F50A 4B9LA 8ICUA 3MGHA 3T5HA 5C5JA 3JPQA 9ICOA 5HMMA 5L9XA 5DG9A 5KFMA 5J0OA 2DPJA 2NRTA 9ICLA 2JEFA 1KFDA 4QZCA 4FS2A 4XRHA 7ICSA 5IIOA 1JN3A 4DOCA 4RPZA 2BHNA 7ICOA 3OHAA 1ZQLA 4BWMA 4TQSA 5L1LA 1LV5A 1HUOA 4M04A 8ICQA 4EBCA 2PXIA 2AGOA 5DB7A 5KG1A 4YR0A 4NLNA 4JUZA 1COOA 2MAXA 4X5VA 5HMLA 1QSSA 5KFCA 2BCRA 8ICWA 9ICNA 2KN7A 1S9FA 1NK0A 4I2EA 5D4BA 4KLGA 1QTMA 3BDPA 8ICVA 5KFRA 1TKDA 5D49A 3QZ7A 3C21A 5BPCA 5KG5A 3BQ0A 4IQUA 3PR5B 2M9NA 4I2JA 2BPCA 4YMMA 2W9CA 3MFHA 4J9NA 7ICTA 1ZJMA 4RNOA 4IR1A 1ZQAA 4XQ8A 5IILA 4B9MA 1PZNA 1AROP 5KFIA 3TFRA 3PW7A 1ZQEA 1U45A 3UPQA 1H38A 1A77A 3MGIA 4E0DA 4GXJA 3ZD9A 4O5EA 7ICKA 2PI4A 9ICFA 2A1JB 4PHAA 1HJPA 2AU0A 4Q8FA 1L3SA 1ZQMA 4ED8A 4I28A 2KFZA 1QLNA 5CB1A 4J9PA 3B0YA 1KEJA 4ECYA 1XSLA 2BCVA 1UA0A 4DLGA 2FPKA 1ZQPA 1NKEA 9ICTA 5EWEA 4ECZA 1RXVA 9ICIA 4J9LA 4ECVA 2JEIA 2PFNA 4KLHA 4LVSA 1TK5A 3C2MA 2C2RA 4R8UB 3PO5A 2H5XA 5CA7A 4RQ4A 4M9HA 4I2IA 2RDJA 5DKWA 5CWRA 8ICKA 4XA5A 4O5CA 4Q45A 3H40A 4DSKA 1RZTA 4KTQA 8ICCA 4G3IA 2BPGA 1U4BA 4RQ0A 3SI8A 4HYKA 3RB6A 1RPLA 5DQGA 4MEYA 3JPTA 1KDHA 4NLGA 3RJIA 8ICJA 2ALZA 3GILA 1RYRA 2P66A 4B9NA 4BDPA 2FLLA 2W9BA 3BQ1A 4RU9A 4DFJA 3C1ZA 4DL7A 1XC9A 1MQ2A 4RNMA 3OJUA 1X9SA 5DG7A 4LZGA 4Q43A 3JPNA 5DB6A 1ZQQA 4DQPA 3SYZA 3JPRA 4QW9A 2ZUDA 3RJFA 4F92B 2XY6A 1D8YA 1ZQZA 1N56A 4MEXA 4IRKA 1U9LA 1ZYQA 4Z6DA 2HHUA 4M9JA 1SKWA 1C7YA 4UB1A 1EXNA 3EZ5A 4KLOA 5KTQA 3IHQB 3RAXA 1NJZA 1S0OA 1SL0A 7ICVA 3RJHA 1X2IA 3RB4A 4DQQA 1ZQHA 3T5JA 2BQUA 4PGXA 2WTFA 3V7JA 4DQSA 4MF2A 9ICXA 4ELUA 1TVAA 4PGQA 7ICNA 4C8LA 9ICAA 7ICQA 4J9OA 3ZD8A 4ECRA 3AU6A 4JV1A 4RZRA 3ZDDA 4ZH4A 4YXMA 4YXJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQY A;  5KG3 A;  5DB9 A;  1T3N A;  9ICP A;  3TI0 A;  4F5R A;  2F1I A;  4ED7 A;  5J0W A;  4DQR A;  1U48 A;  3JPS A;  1DOQ A;  4KN7 A;  1SKS A;  4KLJ A;  1S0V A;  2FMS A;  2ZUB A;  1KTQ A;  2IBK A;  4ECX A;  4IRC A;  5DBA A;  1HUZ A;  3MR6 A;  5IIM A;  4O3S A;  2W9M A;  4GLX A;  1ZQK A;  1D8L A;  4B9T A;  2ZJA A;  4EZ6 A;  3K75 D;  5KT3 A;  3ISD A;  2BPF A;  4F5N A;  2VAN A;  3H8W A;  3Q8K A;  1XSN A;  2IA6 A;  4UB5 A;  5J2I A;  5DGA A;  4I2C A;  8ICG A;  1NK7 A;  2P6R A;  7ICM A;  3OHB A;  7ICF A;  3LWL A;  4CCH A;  2V4R A;  4B9U A;  1JMS A;  2HVH A;  4DWI A;  1S97 A;  2ASJ A;  4RNN A;  3SV4 A;  4C8K A;  4BXO B;  4C8N A;  3Q8R B;  4DL4 A;  4QZF A;  4I2H A;  5DG8 A;  3UXP A;  1JXL A;  1BGX T;  3GV7 B;  5KFV A;  2W8K A;  1CUK A;  5TZV A;  4ED0 A;  4PGY A;  4PH5 A;  4R65 A;  3TAR A;  4DL2 A;  4IQW A;  3RJG A;  1TAU A;  5DBC A;  2J6U A;  1QSY A;  4RQ6 A;  3T3F A;  3GIJ A;  3ZDB A;  2JEG A;  8ICA A;  3MAB A;  4YMN A;  4RQ8 A;  4FO6 A;  3RRH A;  4DSL A;  3PX0 A;  1T7P A;  4YD1 A;  5J2K A;  1BPD A;  3GV8 B;  3V6H A;  2BGW A;  3MDC A;  8ICH A;  1KFT A;  5HHI A;  4UAZ A;  3Q8L A;  1JIH A;  8ICE A;  2HHX A;  3OSP A;  1Z00 B;  2C28 A;  2AGQ A;  1ZQS A;  4K4H A;  3ZDA A;  4DL6 A;  2PFP A;  3PR4 A;  3PW0 A;  4C8M A;  5J2F A;  4KMU A;  4M47 A;  4ECU A;  4J9R A;  4YD2 A;  7ICE A;  7ICH A;  3HPO A;  4K4G A;  2BR0 A;  3C23 A;  4F91 B;  1MSW D;  2KZZ A;  7ICR A;  4RT3 A;  3KHL A;  3Q8M A;  3GQC A;  4RQ1 A;  2HVI A;  3G6X A;  9ICH A;  2BCQ A;  5J2G A;  4YN4 A;  4F4X A;  3PV8 A;  1B22 A;  2AQ0 A;  1UT8 A;  4M6W A;  5JUM A;  3RB0 A;  4F93 B;  5CJ7 A;  4DF4 A;  1K1S A;  1ZQC A;  3RBE A;  1JX4 A;  4ECT A;  2ZTD A;  9ICB A;  2MUT A;  2UVW A;  4JV0 A;  2I9G A;  5HHH A;  1T8E A;  2IHM A;  2ZTE A;  5KG2 A;  1SL1 A;  5D46 A;  5DB8 A;  5KT7 A;  1X9M A;  1NOM A;  2R8K A;  4M9L A;  4TQR A;  7ICP A;  5F9N A;  5J0Y A;  5KT4 A;  4DFK A;  4RQ3 A;  1U47 A;  2XGQ A;  4ED1 A;  3K4G A;  4JK1 A;  4FBU A;  4QWE A;  2XCP A;  1ZQN A;  3M9M B;  5DLG A;  3GIM A;  3SZ2 A;  3RH5 A;  2ATL A;  9ICR A;  4QZ8 A;  4NM2 A;  3AU2 A;  3M8S A;  4EEY A;  4DLE A;  2XY7 A;  1N48 A;  2BCS A;  5KFB A;  4TUP A;  3LK9 A;  4F4K A;  1JXE A;  5L1I A;  3B0X A;  2NRX A;  4KN4 A;  3FDS A;  1TV9 A;  4P4M A;  4QZD A;  4QWD A;  1NKB A;  1BPX A;  1S76 D;  3ORY A;  2LYH A;  5KFQ A;  2NRZ A;  3MR3 A;  2J6T A;  3MFI A;  5DDY A;  4UB3 A;  5HP4 A;  2ISO A;  3N4M B;  2Y1I A;  3RJJ A;  5EWG A;  5CP2 A;  4DO9 A;  2OWO A;  2KZM A;  9ICG A;  3V6K A;  2ASD A;  4KLU A;  2UVV A;  2XC9 A;  5KFZ A;  5J29 A;  5KT2 A;  2ZJ5 A;  1ZQU A;  3Q8S B;  4DFP A;  3KHH A;  8ICR A;  1NJX A;  5KFX A;  2HHW A;  4O3Q A;  3EPI A;  4NY8 A;  5KFU A;  3HT3 A;  4MFF A;  5J2A A;  1L5U A;  1ZQI A;  2VA2 A;  3Q8P B;  5IIN A;  3RRG A;  8ICP A;  2IHN A;  4EBD A;  5KFS A;  1NK9 A;  5J0U A;  4UBC A;  3RH4 A;  5DBB A;  3GDX A;  4UBB A;  8ICT A;  5KT6 A;  4ECW A;  3PML A;  4NLK A;  8ICO A;  2VA3 A;  8ICY A;  4NM1 A;  4F8R A;  1BPZ A;  5DLF A;  2XGP A;  1QSL A;  4JWN A;  4P4O A;  4YR3 A;  4F5P A;  4M9G A;  4KLT A;  3ZDE A;  2BQR A;  4UQG A;  1Z3E B;  3ETL A;  3C5F A;  3C5G A;  2AJQ A;  2HHT A;  5DDM A;  4KLQ A;  9ICV A;  3H4D A;  1ZJN A;  3RR7 A;  5KFA A;  4DS5 A;  4YFK A;  2AQ4 A;  1Y88 A;  2A1J A;  4Z6C A;  4I29 A;  1UT5 A;  9ICJ A;  1KLN A;  2BKE A;  3E2E A;  3JPP A;  1ZQX A;  4MFA A;  3TFS A;  1ZQW A;  4ED2 A;  3KTQ A;  4ED3 A;  4LZD A;  2W9C B;  1TFR A;  4QZI A;  4F2S A;  4O9M A;  3PY8 A;  1D9D A;  3C2K A;  5KG4 A;  3OJS A;  2V9W A;  7ICG A;  2PFQ A;  4JV2 A;  2XY5 A;  3IM1 A;  5HNK A;  3HX0 A;  2PFO A;  4R8U A;  8ICM A;  3FYH A;  5KFK A;  4EYI B;  4M9N A;  1SZP A;  2HW3 A;  2FPM A;  4O3R A;  3PVX A;  1ZQB A;  5L1K A;  3UQ0 A;  4MF8 A;  3QEA Z;  1TK8 A;  2HHS A;  1A76 A;  4DOB A;  3H7I A;  3V72 A;  3HWT A;  8ICZ A;  1WCL A;  4O3N A;  3RB3 A;  4TUS A;  3RH6 A;  5CHG A;  4F4Z A;  3RAQ A;  4KLD A;  5CR0 A;  3ISC A;  4YMO A;  3KHR A;  2UVR A;  4M2Y A;  2BCU A;  1ZET A;  4BWJ A;  5DGB A;  3PW2 A;  2IMW P;  2KTQ A;  1KRP A;  2ZUC A;  4KLS A;  4B9S A;  2C2D A;  1L3V A;  2I1Q A;  2AGP A;  9ICQ A;  4DS4 A;  1V9P A;  5J0P A;  4O3P A;  4DF8 A;  3UXN A;  4F4W A;  9ICM A;  3JPO A;  1UA1 A;  4Z6F A;  4F5O A;  2FMQ A;  3GIK A;  5DQH A;  2XO7 A;  4K4I A;  1TAQ A;  4ECS A;  3Q8Q B;  5J0T A;  1S10 A;  3QZ8 A;  4J9M A;  4I2B A;  3BJY A;  5KFO A;  2R8G A;  3N97 B;  4J9S A;  4IQT A;  2W9B B;  4ED6 A;  4F3O A;  7ICI A;  8ICS A;  8ICL A;  1LB2 B;  3PMN A;  1NJW A;  1X9W A;  4DSE A;  4Q8E A;  4DSF A;  3PX6 A;  1ZQR A;  1TK0 A;  9ICK A;  3TAP A;  4UAY A;  2BQ3 A;  1BPY A;  1XSP A;  5F9L A;  4DL5 A;  3M9N B;  3TAQ A;  4C8O A;  1IXR A;  3UXO A;  3H4B A;  2GWS A;  2B21 A;  5KG6 A;  4RT2 A;  2VA8 A;  4PHP A;  3M8R A;  3G6V A;  4J9K A;  4FS1 A;  1ZQJ A;  5KFL A;  8ICF A;  4RUC A;  2F1H A;  5J0X A;  3PNC A;  4GXK A;  1BVS A;  4DFM A;  4M0A A;  1ZQT A;  5EWF A;  4Z6E A;  1ZQF A;  4QZB A;  2KFN A;  1S0N A;  4PPX A;  3MDA A;  3MR5 A;  5KFE A;  1NKC A;  3ZDC A;  1B43 A;  4QZA A;  2JEJ A;  2NRV A;  3H8S A;  5J2D A;  3H8J A;  3V7K A;  1ZQG A;  3QEB Z;  1XWL A;  4I2A A;  2NRW A;  5KFH A;  3ISB A;  3C2L A;  5DQI A;  2UVU A;  5J2J A;  2J6S A;  9ICW A;  4J9Q A;  4DOA A;  5IIK A;  4QWC A;  3MR2 A;  1MC8 A;  1ZQD A;  4DSJ A;  4P2H A;  3LWM A;  5J0Q A;  1NK8 A;  4BXO A;  5III A;  1S77 D;  4UAW A;  4O3O A;  1SL2 A;  2FLN A;  4DEZ A;  2DFL A;  2KZ3 A;  4RPY A;  2JZB B;  3PW4 A;  3RJK A;  3TQ1 A;  5IIJ A;  4KLI A;  9ICS A;  2FLP A;  4KIT B;  3BQT A;  1BPE A;  4KLL A;  2Y1J A;  2W9A A;  5KFN A;  4UB2 A;  1CEZ A;  3EYZ A;  3HP6 A;  3KHG A;  3PW5 A;  2BDP A;  2FPL A;  2ZTC A;  5EOZ A;  2XCA A;  8ICX A;  4GC7 A;  1ZQO A;  3C1Y A;  3RTV A;  4DQI A;  3NGD A;  3T5L A;  4R64 A;  4ELV A;  1S0M A;  4I2F A;  1L3T A;  2ISP A;  5BOM A;  2RDI A;  1RXW A;  4ELT A;  4QW8 A;  4I2G A;  5J2C A;  4PHD A;  3PO4 A;  1NK6 A;  1Z00 A;  4YVZ A;  1D9F A;  5BOL A;  4KLE A;  8ICI A;  5L1J A;  5KFW A;  4P4P A;  3OGU A;  4I2D A;  4RPX A;  3V6J A;  1XU4 A;  4YG2 A;  4QZG A;  2C2E A;  4DSI A;  1WCN A;  1T4G A;  4IR9 A;  9ICU A;  1RYS A;  4Q44 A;  3GV5 B;  2W8L A;  3T5K A;  4QZE A;  3PX4 A;  2R8J A;  4EZ9 A;  4QWA A;  4YCX A;  1NK5 A;  9ICE A;  3GFK B;  5KFJ A;  5KFG A;  1NK4 A;  3RJE A;  4RUA A;  4RQ7 A;  5J0S A;  3V7L A;  3AUO A;  2V4Q A;  2ZJ8 A;  3RBD A;  3THV A;  2HHV A;  3M9O B;  4ECQ A;  4QWB A;  5J2E A;  3LDA A;  3OSN A;  4YR2 A;  5KFY A;  4I27 A;  4UB4 A;  4FBT A;  2C22 A;  2FMP A;  4F2R A;  2ASL A;  4JWM A;  1ZQV A;  7ICL A;  1NJY A;  4RQ2 A;  3G6Y A;  2P6U A;  2R8H A;  4TUR A;  8ICN A;  4GXI A;  3EWA A;  2Q0Z X;  4KLF A;  4R63 A;  3EPG A;  5KG0 A;  4R66 A;  3TAN A;  5KFD A;  8ICB A;  3HW8 A;  2F1J A;  5KFT A;  5KFP A;  3QE9 Y;  3BQ2 A;  1K1Q A;  2PI5 A;  4RQ5 A;  4O5K A;  4M6W B;  4NLZ A;  4O0I A;  7ICU A;  3RR8 A;  4EBE A;  4YP3 A;  1XO1 A;  2MUT B;  1L3U A;  4TUQ A;  1SKR A;  5KT5 A;  1IM4 A;  4IQV A;  2HHQ A;  4YQW A;  5KFF A;  4BGD A;  4QZ9 A;  4F4Y A;  1DGS A;  5J2H A;  2DPI A;  4KLM A;  4NXZ A;  4B9V A;  5J0R A;  3GII A;  3UQ2 A;  2JZB A;  4F5Q A;  3EW9 A;  1XS9 D;  4PHE A;  2R8I A;  4XUS A;  1MQ3 A;  9ICC A;  4QZH A;  3SV3 A;  3NTU A;  4MFC A;  1U49 A;  1KSP A;  1BPB A;  4GC6 A;  4IRD A;  3MBY A;  7ICJ A;  5KG7 A;  4DL3 A;  1KFS A;  5J2B A;  4EYH B;  4F50 A;  4B9L A;  8ICU A;  3MGH A;  3T5H A;  5C5J A;  3JPQ A;  9ICO A;  5HMM A;  5L9X A;  5DG9 A;  5KFM A;  5J0O A;  2DPJ A;  2NRT A;  9ICL A;  2JEF A;  1KFD A;  4QZC A;  4FS2 A;  4XRH A;  7ICS A;  5IIO A;  1JN3 A;  4DOC A;  4RPZ A;  2BHN A;  7ICO A;  3OHA A;  1ZQL A;  4BWM A;  4TQS A;  5L1L A;  1LV5 A;  1HUO A;  4M04 A;  8ICQ A;  4EBC A;  2PXI A;  2AGO A;  5DB7 A;  5KG1 A;  4YR0 A;  4NLN A;  4JUZ A;  1COO A;  2MAX A;  4X5V A;  5HML A;  1QSS A;  5KFC A;  2BCR A;  8ICW A;  9ICN A;  2KN7 A;  1S9F A;  1NK0 A;  4I2E A;  5D4B A;  4KLG A;  1QTM A;  3BDP A;  8ICV A;  5KFR A;  1TKD A;  5D49 A;  3QZ7 A;  3C21 A;  5BPC A;  5KG5 A;  3BQ0 A;  4IQU A;  3PR5 B;  2M9N A;  4I2J A;  2BPC A;  4YMM A;  2W9C A;  3MFH A;  4J9N A;  7ICT A;  1ZJM A;  4RNO A;  4IR1 A;  1ZQA A;  4XQ8 A;  5IIL A;  4B9M A;  1PZN A;  1ARO P;  5KFI A;  3TFR A;  3PW7 A;  1ZQE A;  1U45 A;  3UPQ A;  1H38 A;  1A77 A;  3MGI A;  4E0D A;  4GXJ A;  3ZD9 A;  4O5E A;  7ICK A;  2PI4 A;  9ICF A;  2A1J B;  4PHA A;  1HJP A;  2AU0 A;  4Q8F A;  1L3S A;  1ZQM A;  4ED8 A;  4I28 A;  2KFZ A;  1QLN A;  5CB1 A;  4J9P A;  3B0Y A;  1KEJ A;  4ECY A;  1XSL A;  2BCV A;  1UA0 A;  4DLG A;  2FPK A;  1ZQP A;  1NKE A;  9ICT A;  5EWE A;  4ECZ A;  1RXV A;  9ICI A;  4J9L A;  4ECV A;  2JEI A;  2PFN A;  4KLH A;  4LVS A;  1TK5 A;  3C2M A;  2C2R A;  4R8U B;  3PO5 A;  2H5X A;  5CA7 A;  4RQ4 A;  4M9H A;  4I2I A;  2RDJ A;  5DKW A;  5CWR A;  8ICK A;  4XA5 A;  4O5C A;  4Q45 A;  3H40 A;  4DSK A;  1RZT A;  4KTQ A;  8ICC A;  4G3I A;  2BPG A;  1U4B A;  4RQ0 A;  3SI8 A;  4HYK A;  3RB6 A;  1RPL A;  5DQG A;  4MEY A;  3JPT A;  1KDH A;  4NLG A;  3RJI A;  8ICJ A;  2ALZ A;  3GIL A;  1RYR A;  2P66 A;  4B9N A;  4BDP A;  2FLL A;  2W9B A;  3BQ1 A;  4RU9 A;  4DFJ A;  3C1Z A;  4DL7 A;  1XC9 A;  1MQ2 A;  4RNM A;  3OJU A;  1X9S A;  5DG7 A;  4LZG A;  4Q43 A;  3JPN A;  5DB6 A;  1ZQQ A;  4DQP A;  3SYZ A;  3JPR A;  4QW9 A;  2ZUD A;  3RJF A;  4F92 B;  2XY6 A;  1D8Y A;  1ZQZ A;  1N56 A;  4MEX A;  4IRK A;  1U9L A;  1ZYQ A;  4Z6D A;  2HHU A;  4M9J A;  1SKW A;  1C7Y A;  4UB1 A;  1EXN A;  3EZ5 A;  4KLO A;  5KTQ A;  3IHQ B;  3RAX A;  1NJZ A;  1S0O A;  1SL0 A;  7ICV A;  3RJH A;  1X2I A;  3RB4 A;  4DQQ A;  1ZQH A;  3T5J A;  2BQU A;  4PGX A;  2WTF A;  3V7J A;  4DQS A;  4MF2 A;  9ICX A;  4ELU A;  1TVA A;  4PGQ A;  7ICN A;  4C8L A;  9ICA A;  7ICQ A;  4J9O A;  3ZD8 A;  4ECR A;  3AU6 A;  4JV1 A;  4RZR A;  3ZDD A;  4ZH4 A;  4YXM A;  4YXJ A; 
#chains in the Genus database with same CATH topology
 1ZQY A;  1T3N A;  9ICP A;  2F1I A;  4KLJ A;  1DOQ A;  4NL9 A;  3TKA A;  5AI8 A;  1HUZ A;  2G09 A;  3MR6 A;  4GLX A;  2VKQ A;  4Y2Y A;  4B9T A;  4P0P A;  2WB1 C;  4CF5 A;  3KZI U;  3Q8K A;  2A3V A;  3WKA A;  4I2C A;  2KE7 A;  2QAR A;  1NK7 A;  7ICF A;  4CCH A;  4B9U A;  2ASJ A;  4C8N A;  1X40 A;  4DL4 A;  3GV7 B;  5TZV A;  4R65 A;  1TAU A;  3TAR A;  2DKZ A;  5DBC A;  1QSY A;  3GIJ A;  2W3R A;  4NWI A;  4RQ8 A;  1T7P A;  2Z7J A;  4UAZ A;  3KOO A;  3UMG A;  4K4H A;  2AGQ A;  1JAL A;  3PR4 A;  4C8M A;  1QQ7 A;  4ECU A;  4YD2 A;  3TAD A;  3HPO A;  2BR0 A;  2KZZ A;  1F0M A;  2RRD A;  3KHL A;  3Q8M A;  1FFU A;  4P0Q A;  2KKV A;  3WK4 A;  9ICH A;  5J2G A;  2B6G A;  1QQ5 A;  2ES6 A;  3IN5 A;  3PV8 A;  2AQ0 A;  4M6W A;  5JUM A;  2E5S A;  1PK1 B;  4DF4 A;  1JX4 A;  1T8E A;  5KG2 A;  1O03 A;  1X9M A;  2R8K A;  2HOQ A;  1J97 A;  2XGQ A;  3K4G A;  2XCP A;  3M9M B;  3SZ2 A;  3AU2 A;  4EEY A;  4DLE A;  3BZK A;  5AKK A;  2HBK A;  5AI9 A;  4KN4 A;  1TV9 A;  2Y0S C;  1ZXI A;  1PVR A;  2J6T A;  4NJ8 A;  5DDY A;  5HP4 A;  1ZRM A;  2CPR A;  4DO9 A;  2KZM A;  5ALW A;  1UCV A;  2WAQ F;  1B4F A;  5J29 A;  5KT2 A;  2ZJ5 A;  1HEK A;  5KFU A;  2VA2 A;  1ZQI A;  3Q8P B;  5J0U A;  5DBB A;  8ICT A;  1QH9 A;  3PML A;  2VA3 A;  2NO4 A;  1BPZ A;  5DLF A;  4M9G A;  4YR3 A;  4F5P A;  3ZDE A;  3ETL A;  2KEY A;  3SQI A;  2DGZ A;  4KLQ A;  2F44 A;  3H4D A;  1PK1 A;  1KBU A;  4Z6C A;  1SV0 C;  2BKE A;  1ZQW A;  4ED3 A;  4CGZ A;  3CP8 A;  3QU5 A;  3HX0 A;  8ICM A;  3FYH A;  3CW2 C;  4O3R A;  1PUZ A;  2DBY A;  4DOB A;  2LPE A;  4O3N A;  4TUS A;  3RH6 A;  3AMZ A;  3RAQ A;  3KHR A;  2M0N A;  4YMO A;  1ZET A;  5DGB A;  1SWW A;  4KLS A;  1L3V A;  2I1Q A;  2OCE A;  1V9P A;  2MSN A;  2ZXH A;  3M6K A;  1TAM A;  3C29 A;  2XO7 A;  5AM1 A;  3Q8Q B;  2G08 A;  1S10 A;  4US8 A;  4I2B A;  2EQY A;  4J9S A;  2W9B B;  1X9W A;  2MU2 A;  5J8Y C;  1ZQR A;  4FE3 A;  5GTH U;  1XSP A;  5GTI U;  1RG6 A;  2JH7 A;  2NV3 A;  3UXO A;  2GWS A;  5KG6 A;  2LKY A;  4RT2 A;  4FFD A;  3F5E A;  2F1H A;  5J0X A;  4DFM A;  4BJQ A;  5CRX A;  4PPX A;  3MDA A;  3ZDC A;  2JEJ A;  4PZN A;  5AM5 A;  1ZQG A;  3QEB Z;  1XWL A;  2UVU A;  5AKG A;  5J2J A;  2J6S A;  1JRO A;  9ICW A;  4DSJ A;  3LWM A;  4OJO A;  2CRX A;  1RYU A;  3UMC A;  4DEZ A;  2KP7 A;  2KZ3 A;  3PW4 A;  3RJK A;  5IIJ A;  5ALR A;  1Q46 A;  2WF6 A;  2Y1J A;  4DCC A;  5KFN A;  3BQ7 A;  3EYZ A;  5EOZ A;  5ALE A;  3C28 A;  3T5L A;  4I2F A;  1L3T A;  2ISP A;  1RXW A;  1Z1V A;  5J2C A;  3PO4 A;  3IRU A;  1Z00 A;  2LM1 A;  4YVZ A;  1D9F A;  5KFW A;  4P4P A;  3OGU A;  1T4G A;  5AKZ A;  5EE3 A;  1RYS A;  2W8L A;  4QZE A;  3AM9 A;  1NK4 A;  3RJE A;  2HHV A;  2Y9U A;  4QWB A;  4YR2 A;  2WB1 F;  4UB4 A;  2W55 A;  4FBT A;  2C22 A;  4JWM A;  1ZQV A;  3EWA A;  3TAN A;  5KFD A;  3NRW A;  3HW8 A;  1N61 A;  3FM9 A;  4RQ5 A;  4C4T A;  3RR8 A;  1Q3U A;  5B66 U;  1SKR A;  4IQV A;  2HHQ A;  3NVW A;  3SD7 A;  2MA1 A;  1DGS A;  2WF8 A;  4C4R A;  3UQ2 A;  4F5Q A;  2R8I A;  1MQ3 A;  4C7Z A;  4QZH A;  1KKX A;  3SMV A;  4US9 A;  1BPB A;  5ALG A;  3H0M B;  5J2B A;  3MGH A;  5DG9 A;  5KFM A;  9ICL A;  4XRH A;  3MC1 A;  4DOC A;  4RPZ A;  1NI3 A;  2BHN A;  3AL0 B;  4CDG A;  4X5V A;  5HML A;  2LBO A;  5H2F U;  2E8P A;  1S9F A;  4PL1 A;  3KD3 A;  3WK5 A;  5BPC A;  2A1A A;  4YMM A;  2W9C A;  7ICT A;  1L8L A;  5ALH A;  3AEV A;  4G9B A;  1ZQE A;  1ARO P;  2YY6 A;  2Y0S F;  2FI1 A;  4E0D A;  2HBM A;  3ZD9 A;  4O5E A;  7ICK A;  4EEL A;  4Q8F A;  4I28 A;  5CB1 A;  1KEJ A;  4ECY A;  1XSL A;  1COK A;  1RXV A;  9ICI A;  2JEI A;  1BNP A;  3C2M A;  4R8U B;  5ALL A;  4Y2X A;  4I2I A;  1QQ6 A;  5DKW A;  4DSK A;  8ICC A;  4G3I A;  1U4B A;  4RQ0 A;  1RPL A;  5JU5 A;  1KDH A;  3RJI A;  1RYR A;  1KW4 A;  3C1Z A;  2EAN A;  2F77 X;  1X9S A;  1YZ7 A;  2VJ5 A;  2KJ9 A;  4QW9 A;  3BZC A;  4IRK A;  1U9L A;  2JXJ A;  1C7Y A;  4UB1 A;  1EXN A;  1Z19 A;  1S0O A;  5ALQ A;  3PSI A;  3RB4 A;  3V7J A;  1Q8K A;  4C8L A;  9ICA A;  4F72 A;  3ZD8 A;  3NVV A;  4OJ5 A;  1ZD3 A;  4JV1 A;  3ZDD A;  4ZH4 A;  1DK3 A;  2EDU A;  5KG3 A;  4ED7 A;  1KTQ A;  5KNI A;  4IRC A;  1ZQK A;  3CRX A;  1D8L A;  4O3M A;  2ZJA A;  4JB3 A;  3ISD A;  2BPF A;  2EZX A;  3H8W A;  1IIP A;  2YMQ A;  3SEI A;  1FFV A;  4UB5 A;  5J2I A;  8ICG A;  7ICM A;  3WK6 A;  3LWL A;  1JMS A;  3QUC A;  5AK6 A;  2YTU A;  1Q3V A;  5DG8 A;  1N5W A;  5AK4 A;  2W8K A;  4IQW A;  3I28 A;  3F2C A;  1ZD4 A;  4RQ6 A;  3F53 A;  3ZDB A;  2DQN B;  3MAB A;  3RRH A;  8ICH A;  1KFT A;  2BGW A;  3MDC A;  1X6J A;  8ICE A;  3OSP A;  5KL1 B;  4DL6 A;  2PFP A;  4M47 A;  4J9R A;  3K1Z A;  4K4G A;  2WHE A;  3C23 A;  5AI0 A;  3KKA C;  4RT3 A;  3E0F A;  4B6J A;  3GQC A;  1UQV A;  2FJ6 A;  2HVI A;  2HOF A;  1J2M A;  2ZIX B;  3RB0 A;  3D2S A;  9ICB A;  4ECT A;  2UVW A;  2I9G A;  4RQM A;  5D46 A;  5DB8 A;  5KT7 A;  1NOM A;  1IG6 A;  7ICP A;  2OH2 A;  1U47 A;  4FBU A;  5ALX A;  4QWE A;  5DLG A;  5KL8 B;  2ATL A;  9ICR A;  4NM2 A;  1WG8 A;  1N48 A;  4TUP A;  3LK9 A;  4F4K A;  1JXE A;  1K5O A;  3ORY A;  3MR3 A;  3QU4 A;  4UB3 A;  3F2B A;  3RJJ A;  4ICA A;  2KSO B;  1RQN A;  9ICG A;  1LVH A;  3MGV A;  2W11 A;  2NYV A;  4KLU A;  3SEN A;  2XC9 A;  1CI4 A;  2HHW A;  3HT3 A;  5J2A A;  3CYM A;  3IG8 A;  3RRG A;  8ICP A;  2IHN A;  4EBD A;  4UBC A;  3GDX A;  3IP4 B;  3EUB 2;  8ICO A;  4NM1 A;  4F8R A;  2KG5 A;  4JWN A;  2BQR A;  2EAP A;  1Z3E B;  4UAT A;  2ZIX A;  5DDM A;  9ICV A;  2WFA A;  4YFK A;  2AQ4 A;  1XO0 A;  4MHV A;  2PMZ F;  1KLN A;  3RFA A;  4MFA A;  3TFS A;  4ED2 A;  1Z1B A;  3QUQ A;  4QZI A;  4HAI A;  3PY8 A;  5KG4 A;  3OJS A;  2PFQ A;  4JV2 A;  2PFO A;  1F5S A;  5KFK A;  3WKB A;  1SZP A;  1ZQB A;  3QEA Z;  1TK8 A;  1A76 A;  3HWT A;  5CHG A;  4M2Y A;  1X9X A;  3M6Z A;  4BWJ A;  2IMW P;  2GH1 A;  2KSO A;  4DS4 A;  4O3P A;  2OHF A;  9ICM A;  3HJE A;  2FMQ A;  4Z6F A;  4F5O A;  2JMG A;  2KIW A;  3QZ8 A;  2DWQ A;  1MA7 A;  3BJY A;  2R8G A;  2YB4 A;  3N97 B;  4IQT A;  4F3O A;  7ICI A;  8ICL A;  2L5Y A;  5CEH A;  4DSE A;  5ALP A;  3PX6 A;  1TK0 A;  1NZB A;  1JUD A;  3M9N B;  3AN1 A;  2EAO A;  3H4B A;  2E8O A;  3VC8 A;  2B21 A;  3G6V A;  4FS1 A;  3ONN A;  3PNC A;  2KNJ A;  1BVS A;  2P35 A;  4M0A A;  1ZQF A;  2KFN A;  5AM2 A;  5KFE A;  2HDO A;  1B43 A;  4QZA A;  4Y2S A;  4OJL A;  5AM0 A;  3V7K A;  1VLB A;  4I2A A;  3E58 A;  4UAR A;  1MC8 A;  4P2H A;  2W04 A;  5J0Q A;  2G06 A;  4AYB C;  1NK8 A;  5III A;  4UAW A;  4EEK A;  2DFL A;  5AKH A;  4RPY A;  1M6Y A;  3WKD A;  4Y2J A;  5AI4 A;  1SIJ A;  4KLI A;  1SGG A;  9ICS A;  4Y2Q A;  2Q4T A;  3BQT A;  4KLL A;  2FPL A;  2ZTC A;  1ZQO A;  2IOH A;  3NGD A;  1S0M A;  2RDI A;  4ELT A;  1NK6 A;  1KN5 A;  4Y2R A;  5BOL A;  4KLE A;  5AIA A;  4RPX A;  1XU4 A;  2QLT A;  4YG2 A;  4IR9 A;  9ICU A;  4Q44 A;  4YCX A;  3GFK B;  4RUA A;  3V7L A;  3AUO A;  2V4Q A;  5KAF U;  5J2E A;  4F2R A;  2ASL A;  1T94 A;  1NJY A;  2KJ8 A;  2R8H A;  2P6U A;  8ICN A;  5HR7 A;  1V38 A;  3K1R B;  2Q0Z X;  5EE1 A;  4GXI A;  3EPG A;  4R66 A;  1RDF A;  2F1J A;  3QE9 Y;  3BQ2 A;  3UMB A;  4BUG A;  5FP0 A;  2H3F A;  2A19 A;  4YP3 A;  1F44 A;  2MUT B;  5AKY A;  1IM4 A;  5KT5 A;  4YQW A;  3AQF A;  3IDW A;  4QZ9 A;  1A6S A;  1XS9 D;  4PHE A;  3DV9 A;  3SV3 A;  3SR6 A;  3N7P D;  2YMP A;  4DL3 A;  1KFS A;  4PZO A;  3JPQ A;  9ICO A;  5HMM A;  5L9X A;  1J2N A;  2DPJ A;  4QZC A;  4FS2 A;  1JN3 A;  3PSP A;  7ICO A;  1B0X A;  4TQS A;  8ICQ A;  4M04 A;  1N62 A;  4Y2T A;  1ZQ1 C;  5DB7 A;  4JUZ A;  2E1F A;  1COO A;  2MAX A;  1OXJ A;  3D6J A;  8ICW A;  9ICN A;  3L5K A;  1NK0 A;  4UB6 U;  4KLG A;  2W03 A;  5KFR A;  1ZD2 P;  3QZ7 A;  5KG5 A;  2M9N A;  4GIB A;  3H0R B;  5ALF A;  5AKL A;  5IIL A;  1PZN A;  3PW7 A;  2VJ4 A;  2MRL A;  3QUB A;  2A1J B;  4PHA A;  1HJP A;  4OCZ A;  4ED8 A;  2KFZ A;  1QLN A;  1PVQ A;  2BCV A;  1NKE A;  2F8L A;  4ECZ A;  1SV0 A;  2QB0 B;  4KLH A;  4CF3 A;  1TK5 A;  2H5X A;  4M9H A;  5CWR A;  4O5C A;  3H40 A;  4KTQ A;  1RZT A;  4HYK A;  3JPT A;  4MEY A;  4J03 A;  4KX3 A;  4B9N A;  2FLL A;  2W9B A;  3BQ1 A;  4RU9 A;  3CNH A;  1XC9 A;  1MQ2 A;  4RNM A;  2DUY A;  4C0Z A;  2IOF A;  3L4P A;  5DG7 A;  4Q43 A;  3JPN A;  4DQP A;  2KIC A;  3JPR A;  2ZUD A;  4QNL A;  1WYG A;  2XY6 A;  4MEX A;  2F3N A;  4Z6D A;  4M9J A;  2ESE A;  1NJZ A;  3TAC B;  2KV2 A;  1X2I A;  4DQQ A;  1ZQH A;  2BQU A;  4PGX A;  9ICX A;  4USA A;  4J9O A;  5J8Y A;  4F71 A;  4YXJ A;  4NLZ A;  1VDV A;  3FAH A;  4FZN A;  3IG5 A;  1U48 A;  1H38 A;  5J0W A;  3E2E A;  1S0V A;  4KN7 A;  2IBK A;  4ECX A;  4O3S A;  5IIM A;  2W9M A;  2GO7 A;  5G5H A;  1SWV A;  4EZ6 A;  3K75 D;  5KT3 A;  2QB0 A;  4F5N A;  2PMZ C;  2IA6 A;  3RF9 A;  3GU3 A;  5DGA A;  2P6R A;  3OHB A;  2JV3 A;  2HVH A;  1S97 A;  2KMD A;  4RQN A;  4RNN A;  4BXO B;  3Q8R B;  4QZF A;  1JXL A;  1BGX T;  1FEZ A;  3ED5 A;  2CN1 A;  4PH5 A;  4DL2 A;  5ALJ A;  4OJP A;  2J6U A;  3T3F A;  8ICA A;  4YMN A;  5KAI U;  3PX0 A;  5J2K A;  1JIH A;  2C28 A;  1ZQS A;  1VJ5 A;  2H3V A;  2W7P A;  3PW0 A;  4KMU A;  7ICH A;  7ICE A;  1S8O A;  4F91 B;  3QU9 A;  2H3Q A;  4RQ1 A;  4EX6 A;  3G6X A;  4YN4 A;  5ALM A;  4AYB F;  4F4X A;  1B22 A;  1UT8 A;  3LVV A;  4F93 B;  5CJ7 A;  2N1R A;  2K8A A;  1SL1 A;  4M9L A;  5KT4 A;  2ZIV B;  3L3F X;  1NNL A;  4RQ3 A;  3HKZ C;  4ED1 A;  1ZQN A;  3RH5 A;  5K4L A;  4QZ8 A;  3M8S A;  3QX7 A;  1XNS A;  2BCS A;  5ALZ A;  3DEE A;  5L1I A;  1N60 A;  2NRX A;  1BPX A;  4QZD A;  1S76 D;  5KFQ A;  2NRZ A;  3MFI A;  3N4M B;  3NVZ A;  5EWG A;  1N5X A;  2LMR A;  2OM6 A;  2UVV A;  1L7P A;  3Q8S B;  1MN8 A;  2DF4 B;  1NJX A;  1L5U A;  1SXE A;  5AKE A;  2FE9 A;  1NK9 A;  3HIL A;  3RH4 A;  1HIW A;  5KT6 A;  4ECW A;  4NLK A;  8ICY A;  2XGP A;  2K4P A;  4P4O A;  1LKY B;  4KLT A;  2QKQ A;  2JH1 A;  3C5G A;  3C5F A;  2CXY A;  2JR5 A;  4PL2 A;  5ALO A;  2ZXI A;  1ZJN A;  3RR7 A;  3NRZ A;  5KFA A;  4DS5 A;  2PKE A;  3JPP A;  4LZD A;  4F2S A;  1TFR A;  4O9M A;  1D9D A;  2HI0 A;  3KZX A;  4R8U A;  1X6I A;  1SZH A;  2JRZ A;  4UAU A;  4MF8 A;  3DDH A;  3S6J A;  2G5H B;  4GFJ A;  1L6N A;  3RB3 A;  4OO1 J;  2XI9 A;  2RLT A;  3GZF A;  2UVR A;  1ZOL A;  2BCU A;  2KTQ A;  1KRP A;  4B9S A;  3I1Y A;  2ZIU B;  5J0P A;  4DF8 A;  3UXN A;  4F4W A;  1AQ6 A;  3JPO A;  2E1E A;  5ALU A;  3GIK A;  3O0F A;  5DQH A;  2LYB A;  4K4I A;  5J0T A;  4J9M A;  5TIS U;  5KFO A;  2WF5 A;  4ED6 A;  1LB2 B;  3PMN A;  1NJW A;  4Q8E A;  4AP9 A;  9ICK A;  3QU7 A;  4Y2P A;  2LM4 A;  1BPY A;  2KJ5 A;  4DL5 A;  4C8O A;  1IXR A;  3N7R C;  1V97 A;  4NL9 C;  2VA8 A;  4PHP A;  4J9K A;  3HRD D;  1ZQJ A;  2KD1 A;  5B5E U;  4GXK A;  1ZQT A;  1Z4N A;  1X42 A;  2AXT U;  2HMX A;  3H8J A;  4JMU A;  4C80 A;  3F5A A;  1TE2 A;  2NRW A;  3C2L A;  5DQI A;  3NUQ A;  1DK2 A;  4J9Q A;  2DKX A;  4DOA A;  5IIK A;  4QWC A;  1ZQD A;  2AH5 A;  1S77 D;  4O3O A;  2F76 X;  1SL2 A;  2FLN A;  4P0P B;  3KBB A;  3TQ1 A;  1FO4 A;  2FLP A;  4KIT B;  2JHD A;  5AI6 A;  2QAR B;  3A0B U;  3KHG A;  2BDP A;  8ICX A;  3C1Y A;  4ELV A;  1L8O A;  4KX5 A;  3TAD C;  1OW5 A;  4PHD A;  1SV4 A;  2OEH A;  1ZD5 A;  4C7Y A;  8ICI A;  5L1J A;  5C0Y A;  4I2D A;  3V6J A;  4QZG A;  2C2E A;  4DSI A;  1WCN A;  1UHU A;  3T5K A;  2R18 A;  3PX4 A;  3QXG A;  5KFJ A;  1RM6 C;  2H3Z A;  4RQ7 A;  2ZJ8 A;  3RBD A;  3THV A;  3LDA A;  3OSN A;  5KFY A;  4I27 A;  2FMP A;  2HBJ A;  7ICL A;  2KK0 A;  4RQ2 A;  2B0C A;  2OXO A;  3G6Y A;  1X66 A;  3QNM A;  4KLF A;  5KG0 A;  2WF9 A;  8ICB A;  1T3Q A;  1WWU A;  5KFP A;  5KFT A;  3KKA A;  2PI5 A;  3A0H U;  4M6W B;  4O0I A;  1CRX A;  7ICU A;  4EBE A;  1XO1 A;  4UAS A;  5KFF A;  4F4Y A;  5J2H A;  4NXZ A;  5J0R A;  9ICC A;  3D2Q A;  1KSP A;  3FC4 A;  7ICJ A;  5KG7 A;  4UB8 U;  2E3T A;  2K4H A;  3BS5 B;  4F50 A;  2HSZ A;  1WUD A;  5C5J A;  4QJF B;  4NLC A;  2JEF A;  2K4I A;  7ICS A;  5IIO A;  4IS7 A;  3OHA A;  2AHO B;  4BWM A;  5L1L A;  1LV5 A;  3IV6 A;  5JRT A;  4EBC A;  2PXI A;  2AGO A;  4NLN A;  2W43 A;  2HOI A;  2ZIW B;  2KN7 A;  5AKJ A;  2KOB A;  3HKZ F;  3BDP A;  8ICV A;  1TKD A;  5D49 A;  3C21 A;  2G0A A;  4IQU A;  4I2J A;  4ZOH C;  2BPC A;  1RQL A;  4U6P A;  3MFH A;  4J9N A;  3PST A;  4IL6 U;  1ZJM A;  4IR1 A;  1ZQA A;  9ICE A;  1S5L U;  5KFI A;  1U45 A;  1A77 A;  3MGI A;  4GXJ A;  2D3D A;  9ICF A;  2QB1 A;  2XID A;  2GLE A;  4J9P A;  3B0Y A;  1UA0 A;  9ICT A;  4CNQ A;  2XIC A;  5EWE A;  4J9L A;  4ECV A;  2F2A B;  5ALN A;  2Y9T A;  5CA7 A;  4RQ4 A;  2RDJ A;  8ICK A;  4Q45 A;  2EZZ A;  1L7N A;  3BS5 A;  5DQG A;  4NLG A;  2LHT A;  2ALZ A;  3GIL A;  1YZ6 A;  2BZF A;  2P66 A;  4LZG A;  5DB6 A;  3SYZ A;  2YB1 A;  1D8Y A;  2YN4 A;  3PZP A;  4KMO B;  3EZ5 A;  5ALS A;  3LYS A;  4FZM A;  4KLO A;  2ZIW A;  3IHQ B;  3RAX A;  2BDU A;  1SL0 A;  3WK8 A;  4CF4 A;  2FDR A;  5AKX A;  5HR6 A;  2WTF A;  3LVW A;  4DQS A;  1N63 A;  2O6K A;  2HCF A;  4PGQ A;  3T79 A;  4ELU A;  5AM4 A;  7ICQ A;  4ECR A;  3VCB A;  4YXM A;  5DB9 A;  4CE6 A;  3TI0 A;  4F5R A;  4DQR A;  1SKS A;  3JPS A;  4EX7 A;  4ACO A;  2FMS A;  2ZUB A;  5DBA A;  5ALV A;  3N7S C;  5A0L A;  2GOL A;  5ALY A;  2VAN A;  1XSN A;  4Y2V A;  2WF7 A;  3SAF A;  2V4R A;  5AK5 A;  2G07 A;  4DWI A;  3SV4 A;  4C8K A;  3H8M A;  4I2H A;  3UXP A;  1KQQ A;  5KFV A;  1CUK A;  4ED0 A;  4PGY A;  3RJG A;  5EE9 A;  3QUT A;  5F3X B;  2JEG A;  4DSL A;  4FO6 A;  3BS7 A;  4YD1 A;  3V6H A;  1BPD A;  3GV8 B;  2K8B B;  5HHI A;  3Q8L A;  2HHX A;  1Z00 B;  2ZG6 A;  3ZDA A;  2OYY A;  5J2F A;  4Y2U A;  2DL0 A;  1OUQ A;  7ICR A;  1V85 A;  1MSW D;  2BCQ A;  1ZRN A;  2LI6 A;  1WWV A;  1ZQC A;  1K1S A;  3RBE A;  2ZTD A;  4U7C A;  2MUT A;  4JV0 A;  5HHH A;  2IHM A;  2ZTE A;  4A8E A;  4TQR A;  5F9N A;  5J0Y A;  4DFK A;  4UW9 A;  4JK1 A;  3GIM A;  4OD0 A;  4CRX A;  2XY7 A;  5KFB A;  3B0X A;  3FDS A;  4P4M A;  4QWD A;  1NKB A;  1FIQ A;  3NS1 A;  2EH9 A;  2LYH A;  4LJX A;  1NZP A;  2ISO A;  2Y1I A;  5CP2 A;  2OWO A;  1L7O A;  3V6K A;  2ASD A;  3QYP A;  2W7O A;  2KHQ A;  5KFZ A;  3QU2 A;  4PJ0 U;  1ZQU A;  4DFP A;  3KHH A;  8ICR A;  5KFX A;  4O3Q A;  3EPI A;  4NY8 A;  4MFF A;  1Z4O A;  4QIW C;  5IIN A;  1SXD A;  2HBL A;  5KFS A;  4UBB A;  1ECW A;  1QSL A;  2EAM A;  4UQG A;  3ALR A;  2D8C A;  2AJQ A;  2HHT A;  5AIB A;  1Y88 A;  2A1J A;  4I29 A;  1UT5 A;  9ICJ A;  1ZQX A;  3KTQ A;  1IV8 A;  2W9C B;  2IOF K;  2YMM A;  3C2K A;  2V9W A;  2D6F C;  7ICG A;  4EEN A;  3OTQ A;  2XY5 A;  3IM1 A;  5HNK A;  4EYI B;  4M9N A;  2HW3 A;  2FPM A;  3PVX A;  2HHS A;  5L1K A;  3UQ0 A;  3H7I A;  3V72 A;  8ICZ A;  1WCL A;  4F4Z A;  2EZY A;  2K60 A;  5CR0 A;  3SAG A;  3ISC A;  4KLD A;  3I76 A;  3PW2 A;  2ZUC A;  2C2D A;  4DFD A;  2KHV A;  2AGP A;  9ICQ A;  3KFU F;  5E79 U;  1UA1 A;  5ALI A;  3WK7 A;  1DGJ A;  1TAQ A;  5ALT A;  4ECS A;  8ICS A;  2XVT A;  1O08 A;  2I5H A;  2W54 A;  4DSF A;  3WKE A;  3TAP A;  4UAY A;  3ETR A;  2BQ3 A;  2VIX A;  5F9L A;  3PSF A;  2KVC A;  3TAQ A;  5AIC A;  3M8R A;  5KFL A;  8ICF A;  4RUC A;  5EWF A;  4Z6E A;  2E8N A;  4QZB A;  1S0N A;  4IC9 A;  3MR5 A;  1NKC A;  2NRV A;  3H8S A;  5J2D A;  3ICX A;  3ISB A;  5KFH A;  1D8B A;  2YX8 A;  3MR2 A;  2K8C B;  2JGA A;  3ZI4 A;  1DXS A;  4BXO A;  2E8M A;  5EE0 A;  1N2X A;  2JZB B;  1BPE A;  1URJ A;  2W9A A;  4UB2 A;  1CEZ A;  3HP6 A;  2F8K A;  3PW5 A;  2XCA A;  1KL9 A;  4GC7 A;  3RTV A;  5T14 A;  4DQI A;  4R64 A;  5BOM A;  4QW8 A;  4I2G A;  5L1M A;  3F2D A;  3B9J A;  3GV5 B;  4EZ9 A;  2R8J A;  4QWA A;  1NK5 A;  5KFG A;  5J0S A;  5AKI A;  3M9O B;  4ECQ A;  3N28 A;  3WU2 U;  1YT3 A;  2WAQ C;  2W3S A;  4TUR A;  4R63 A;  2KVS A;  5ALD A;  2ZIV A;  5JTI A;  1K1Q A;  4O5K A;  4UAV A;  1L3U A;  4TUQ A;  5AI5 A;  1ED1 A;  3SAH A;  4BGD A;  2DPI A;  4KLM A;  4B9V A;  3M7D A;  5AK3 A;  3GII A;  2JZB A;  3OPX A;  3EW9 A;  4XUS A;  5AM3 A;  3NTU A;  4MFC A;  1U49 A;  2YML A;  1SB3 C;  4GC6 A;  4IRD A;  3MBY A;  3M1Y A;  2NO5 A;  4NLB A;  4EYH B;  2K4E A;  4B9L A;  8ICU A;  3T5H A;  5J0O A;  2NRT A;  1KFD A;  2RP5 A;  2LYA A;  1BNO A;  1ZQL A;  1L7M A;  3NVY A;  1HUO A;  4OJ6 A;  4YR0 A;  1A0P A;  5KG1 A;  1LKY A;  2KKP A;  1C20 A;  1QSS A;  5KFC A;  2BCR A;  2RHF A;  4I2E A;  5ALK A;  5D4B A;  1QTM A;  4WJ3 B;  3BQ0 A;  3PR5 B;  4RNO A;  1PVP A;  4XQ8 A;  4B9M A;  3TFR A;  3D2N A;  3UPQ A;  2ODG A;  2PI4 A;  2AU0 A;  4FZL A;  1L3S A;  4BX9 C;  5AHX A;  1ZQM A;  3H0L B;  2RQ5 A;  1DRG A;  3AQE A;  1ZQP A;  4DLG A;  2FPK A;  1P7D A;  2KIV A;  2I6X A;  3WKC A;  2PFN A;  4LVS A;  2C2R A;  3PO5 A;  2ZIU A;  1JI7 A;  4QIW F;  4XA5 A;  2BPG A;  3SI8 A;  3RB6 A;  3WK9 A;  8ICJ A;  2K89 A;  4BDP A;  3J81 j;  4DFJ A;  4DL7 A;  1PK3 A;  3OJU A;  2YQE A;  1ZQQ A;  3RJF A;  2G5I B;  5G5G A;  3NAS A;  4F92 B;  1JRP A;  1QCK A;  1ZQZ A;  1N56 A;  1ZYQ A;  1UPH A;  2HHU A;  1SKW A;  5KTQ A;  7ICV A;  4C4S A;  3RJH A;  3R9K A;  3T5J A;  4MF2 A;  4P0Q B;  1TVA A;  3U26 A;  7ICN A;  4NV0 A;  3UM9 A;  1GO3 F;  3AU6 A;  4RZR A;  2H3I A; 
#chains in the Genus database with same CATH homology
 1ZQY A;  5KG3 A;  5DB9 A;  1T3N A;  9ICP A;  3TI0 A;  4F5R A;  2F1I A;  4ED7 A;  5J0W A;  4DQR A;  1U48 A;  3JPS A;  1DOQ A;  4KN7 A;  1SKS A;  4KLJ A;  1S0V A;  2FMS A;  2ZUB A;  1KTQ A;  2IBK A;  4ECX A;  4IRC A;  5DBA A;  1HUZ A;  3MR6 A;  5IIM A;  4O3S A;  2W9M A;  4GLX A;  1ZQK A;  1D8L A;  4B9T A;  2ZJA A;  4EZ6 A;  3K75 D;  5KT3 A;  3ISD A;  2BPF A;  4F5N A;  2VAN A;  3H8W A;  3Q8K A;  1XSN A;  2IA6 A;  4UB5 A;  5J2I A;  5DGA A;  4I2C A;  8ICG A;  1NK7 A;  2P6R A;  7ICM A;  3OHB A;  7ICF A;  3LWL A;  4CCH A;  2V4R A;  4B9U A;  1JMS A;  2HVH A;  4DWI A;  1S97 A;  2ASJ A;  4RNN A;  3SV4 A;  4C8K A;  4BXO B;  4C8N A;  3Q8R B;  4DL4 A;  4QZF A;  4I2H A;  5DG8 A;  3UXP A;  1JXL A;  1BGX T;  3GV7 B;  5KFV A;  2W8K A;  1CUK A;  5TZV A;  4ED0 A;  4PGY A;  4PH5 A;  4R65 A;  3TAR A;  4DL2 A;  4IQW A;  3RJG A;  1TAU A;  5DBC A;  2J6U A;  1QSY A;  4RQ6 A;  3T3F A;  3GIJ A;  3ZDB A;  2JEG A;  8ICA A;  3MAB A;  4YMN A;  4RQ8 A;  4FO6 A;  3RRH A;  4DSL A;  3PX0 A;  1T7P A;  4YD1 A;  5J2K A;  1BPD A;  3GV8 B;  3V6H A;  2BGW A;  3MDC A;  8ICH A;  1KFT A;  5HHI A;  4UAZ A;  3Q8L A;  1JIH A;  8ICE A;  2HHX A;  3OSP A;  1Z00 B;  2C28 A;  2AGQ A;  1ZQS A;  4K4H A;  3ZDA A;  4DL6 A;  2PFP A;  3PR4 A;  3PW0 A;  4C8M A;  5J2F A;  4KMU A;  4M47 A;  4ECU A;  4J9R A;  4YD2 A;  7ICE A;  7ICH A;  3HPO A;  4K4G A;  2BR0 A;  3C23 A;  4F91 B;  1MSW D;  2KZZ A;  7ICR A;  4RT3 A;  3KHL A;  3Q8M A;  3GQC A;  4RQ1 A;  2HVI A;  3G6X A;  9ICH A;  2BCQ A;  5J2G A;  4YN4 A;  4F4X A;  3PV8 A;  1B22 A;  2AQ0 A;  1UT8 A;  4M6W A;  5JUM A;  3RB0 A;  4F93 B;  5CJ7 A;  4DF4 A;  1K1S A;  1ZQC A;  3RBE A;  1JX4 A;  4ECT A;  2ZTD A;  9ICB A;  2MUT A;  2UVW A;  4JV0 A;  2I9G A;  5HHH A;  1T8E A;  2IHM A;  2ZTE A;  5KG2 A;  1SL1 A;  5D46 A;  5DB8 A;  5KT7 A;  1X9M A;  1NOM A;  2R8K A;  4M9L A;  4TQR A;  7ICP A;  5F9N A;  5J0Y A;  5KT4 A;  4DFK A;  4RQ3 A;  1U47 A;  2XGQ A;  4ED1 A;  3K4G A;  4JK1 A;  4FBU A;  4QWE A;  2XCP A;  1ZQN A;  3M9M B;  5DLG A;  3GIM A;  3SZ2 A;  3RH5 A;  2ATL A;  9ICR A;  4QZ8 A;  4NM2 A;  3AU2 A;  3M8S A;  4EEY A;  4DLE A;  2XY7 A;  1N48 A;  2BCS A;  5KFB A;  4TUP A;  3LK9 A;  4F4K A;  1JXE A;  5L1I A;  3B0X A;  2NRX A;  4KN4 A;  3FDS A;  1TV9 A;  4P4M A;  4QZD A;  4QWD A;  1NKB A;  1BPX A;  1S76 D;  3ORY A;  2LYH A;  5KFQ A;  2NRZ A;  3MR3 A;  2J6T A;  3MFI A;  5DDY A;  4UB3 A;  5HP4 A;  2ISO A;  3N4M B;  2Y1I A;  3RJJ A;  5EWG A;  5CP2 A;  4DO9 A;  2OWO A;  2KZM A;  9ICG A;  3V6K A;  2ASD A;  4KLU A;  2UVV A;  2XC9 A;  5KFZ A;  5J29 A;  5KT2 A;  2ZJ5 A;  1ZQU A;  3Q8S B;  4DFP A;  3KHH A;  8ICR A;  1NJX A;  5KFX A;  2HHW A;  4O3Q A;  3EPI A;  4NY8 A;  5KFU A;  3HT3 A;  4MFF A;  5J2A A;  1L5U A;  1ZQI A;  2VA2 A;  3Q8P B;  5IIN A;  3RRG A;  8ICP A;  2IHN A;  4EBD A;  5KFS A;  1NK9 A;  5J0U A;  4UBC A;  3RH4 A;  5DBB A;  3GDX A;  4UBB A;  8ICT A;  5KT6 A;  4ECW A;  3PML A;  4NLK A;  8ICO A;  2VA3 A;  8ICY A;  4NM1 A;  4F8R A;  1BPZ A;  5DLF A;  2XGP A;  1QSL A;  4JWN A;  4P4O A;  4YR3 A;  4F5P A;  4M9G A;  4KLT A;  3ZDE A;  2BQR A;  4UQG A;  1Z3E B;  3ETL A;  3C5F A;  3C5G A;  2AJQ A;  2HHT A;  5DDM A;  4KLQ A;  9ICV A;  3H4D A;  1ZJN A;  3RR7 A;  5KFA A;  4DS5 A;  4YFK A;  2AQ4 A;  1Y88 A;  2A1J A;  4Z6C A;  4I29 A;  1UT5 A;  9ICJ A;  1KLN A;  2BKE A;  3E2E A;  3JPP A;  1ZQX A;  4MFA A;  3TFS A;  1ZQW A;  4ED2 A;  3KTQ A;  4ED3 A;  4LZD A;  2W9C B;  1TFR A;  4QZI A;  4F2S A;  4O9M A;  3PY8 A;  1D9D A;  3C2K A;  5KG4 A;  3OJS A;  2V9W A;  7ICG A;  2PFQ A;  4JV2 A;  2XY5 A;  3IM1 A;  5HNK A;  3HX0 A;  2PFO A;  4R8U A;  8ICM A;  3FYH A;  5KFK A;  4EYI B;  4M9N A;  1SZP A;  2HW3 A;  2FPM A;  4O3R A;  3PVX A;  1ZQB A;  5L1K A;  3UQ0 A;  4MF8 A;  3QEA Z;  1TK8 A;  2HHS A;  1A76 A;  4DOB A;  3H7I A;  3V72 A;  3HWT A;  8ICZ A;  1WCL A;  4O3N A;  3RB3 A;  4TUS A;  3RH6 A;  5CHG A;  4F4Z A;  3RAQ A;  4KLD A;  5CR0 A;  3ISC A;  4YMO A;  3KHR A;  2UVR A;  4M2Y A;  2BCU A;  1ZET A;  4BWJ A;  5DGB A;  3PW2 A;  2IMW P;  2KTQ A;  1KRP A;  2ZUC A;  4KLS A;  4B9S A;  2C2D A;  1L3V A;  2I1Q A;  2AGP A;  9ICQ A;  4DS4 A;  1V9P A;  5J0P A;  4O3P A;  4DF8 A;  3UXN A;  4F4W A;  9ICM A;  3JPO A;  1UA1 A;  4Z6F A;  4F5O A;  2FMQ A;  3GIK A;  5DQH A;  2XO7 A;  4K4I A;  1TAQ A;  4ECS A;  3Q8Q B;  5J0T A;  1S10 A;  3QZ8 A;  4J9M A;  4I2B A;  3BJY A;  5KFO A;  2R8G A;  3N97 B;  4J9S A;  4IQT A;  2W9B B;  4ED6 A;  4F3O A;  7ICI A;  8ICS A;  8ICL A;  1LB2 B;  3PMN A;  1NJW A;  1X9W A;  4DSE A;  4Q8E A;  4DSF A;  3PX6 A;  1ZQR A;  1TK0 A;  9ICK A;  3TAP A;  4UAY A;  2BQ3 A;  1BPY A;  1XSP A;  5F9L A;  4DL5 A;  3M9N B;  3TAQ A;  4C8O A;  1IXR A;  3UXO A;  3H4B A;  2GWS A;  2B21 A;  5KG6 A;  4RT2 A;  2VA8 A;  4PHP A;  3M8R A;  3G6V A;  4J9K A;  4FS1 A;  1ZQJ A;  5KFL A;  8ICF A;  4RUC A;  2F1H A;  5J0X A;  3PNC A;  4GXK A;  1BVS A;  4DFM A;  4M0A A;  1ZQT A;  5EWF A;  4Z6E A;  1ZQF A;  4QZB A;  2KFN A;  1S0N A;  4PPX A;  3MDA A;  3MR5 A;  5KFE A;  1NKC A;  3ZDC A;  1B43 A;  4QZA A;  2JEJ A;  2NRV A;  3H8S A;  5J2D A;  3H8J A;  3V7K A;  1ZQG A;  3QEB Z;  1XWL A;  4I2A A;  2NRW A;  5KFH A;  3ISB A;  3C2L A;  5DQI A;  2UVU A;  5J2J A;  2J6S A;  9ICW A;  4J9Q A;  4DOA A;  5IIK A;  4QWC A;  3MR2 A;  1MC8 A;  1ZQD A;  4DSJ A;  4P2H A;  3LWM A;  5J0Q A;  1NK8 A;  4BXO A;  5III A;  1S77 D;  4UAW A;  4O3O A;  1SL2 A;  2FLN A;  4DEZ A;  2DFL A;  2KZ3 A;  4RPY A;  2JZB B;  3PW4 A;  3RJK A;  3TQ1 A;  5IIJ A;  4KLI A;  9ICS A;  2FLP A;  4KIT B;  3BQT A;  1BPE A;  4KLL A;  2Y1J A;  2W9A A;  5KFN A;  4UB2 A;  1CEZ A;  3EYZ A;  3HP6 A;  3KHG A;  3PW5 A;  2BDP A;  2FPL A;  2ZTC A;  5EOZ A;  2XCA A;  8ICX A;  4GC7 A;  1ZQO A;  3C1Y A;  3RTV A;  4DQI A;  3NGD A;  3T5L A;  4R64 A;  4ELV A;  1S0M A;  4I2F A;  1L3T A;  2ISP A;  5BOM A;  2RDI A;  1RXW A;  4ELT A;  4QW8 A;  4I2G A;  5J2C A;  4PHD A;  3PO4 A;  1NK6 A;  1Z00 A;  4YVZ A;  1D9F A;  5BOL A;  4KLE A;  8ICI A;  5L1J A;  5KFW A;  4P4P A;  3OGU A;  4I2D A;  4RPX A;  3V6J A;  1XU4 A;  4YG2 A;  4QZG A;  2C2E A;  4DSI A;  1WCN A;  1T4G A;  4IR9 A;  9ICU A;  1RYS A;  4Q44 A;  3GV5 B;  2W8L A;  3T5K A;  4QZE A;  3PX4 A;  2R8J A;  4EZ9 A;  4QWA A;  4YCX A;  1NK5 A;  9ICE A;  3GFK B;  5KFJ A;  5KFG A;  1NK4 A;  3RJE A;  4RUA A;  4RQ7 A;  5J0S A;  3V7L A;  3AUO A;  2V4Q A;  2ZJ8 A;  3RBD A;  3THV A;  2HHV A;  3M9O B;  4ECQ A;  4QWB A;  5J2E A;  3LDA A;  3OSN A;  4YR2 A;  5KFY A;  4I27 A;  4UB4 A;  4FBT A;  2C22 A;  2FMP A;  4F2R A;  2ASL A;  4JWM A;  1ZQV A;  7ICL A;  1NJY A;  4RQ2 A;  3G6Y A;  2P6U A;  2R8H A;  4TUR A;  8ICN A;  4GXI A;  3EWA A;  2Q0Z X;  4KLF A;  4R63 A;  3EPG A;  5KG0 A;  4R66 A;  3TAN A;  5KFD A;  8ICB A;  3HW8 A;  2F1J A;  5KFT A;  5KFP A;  3QE9 Y;  3BQ2 A;  1K1Q A;  2PI5 A;  4RQ5 A;  4O5K A;  4M6W B;  4NLZ A;  4O0I A;  7ICU A;  3RR8 A;  4EBE A;  4YP3 A;  1XO1 A;  2MUT B;  1L3U A;  4TUQ A;  1SKR A;  5KT5 A;  1IM4 A;  4IQV A;  2HHQ A;  4YQW A;  5KFF A;  4BGD A;  4QZ9 A;  4F4Y A;  1DGS A;  5J2H A;  2DPI A;  4KLM A;  4NXZ A;  4B9V A;  5J0R A;  3GII A;  3UQ2 A;  2JZB A;  4F5Q A;  3EW9 A;  1XS9 D;  4PHE A;  2R8I A;  4XUS A;  1MQ3 A;  9ICC A;  4QZH A;  3SV3 A;  3NTU A;  4MFC A;  1U49 A;  1KSP A;  1BPB A;  4GC6 A;  4IRD A;  3MBY A;  7ICJ A;  5KG7 A;  4DL3 A;  1KFS A;  5J2B A;  4EYH B;  4F50 A;  4B9L A;  8ICU A;  3MGH A;  3T5H A;  5C5J A;  3JPQ A;  9ICO A;  5HMM A;  5L9X A;  5DG9 A;  5KFM A;  5J0O A;  2DPJ A;  2NRT A;  9ICL A;  2JEF A;  1KFD A;  4QZC A;  4FS2 A;  4XRH A;  7ICS A;  5IIO A;  1JN3 A;  4DOC A;  4RPZ A;  2BHN A;  7ICO A;  3OHA A;  1ZQL A;  4BWM A;  4TQS A;  5L1L A;  1LV5 A;  1HUO A;  4M04 A;  8ICQ A;  4EBC A;  2PXI A;  2AGO A;  5DB7 A;  5KG1 A;  4YR0 A;  4NLN A;  4JUZ A;  1COO A;  2MAX A;  4X5V A;  5HML A;  1QSS A;  5KFC A;  2BCR A;  8ICW A;  9ICN A;  2KN7 A;  1S9F A;  1NK0 A;  4I2E A;  5D4B A;  4KLG A;  1QTM A;  3BDP A;  8ICV A;  5KFR A;  1TKD A;  5D49 A;  3QZ7 A;  3C21 A;  5BPC A;  5KG5 A;  3BQ0 A;  4IQU A;  3PR5 B;  2M9N A;  4I2J A;  2BPC A;  4YMM A;  2W9C A;  3MFH A;  4J9N A;  7ICT A;  1ZJM A;  4RNO A;  4IR1 A;  1ZQA A;  4XQ8 A;  5IIL A;  4B9M A;  1PZN A;  1ARO P;  5KFI A;  3TFR A;  3PW7 A;  1ZQE A;  1U45 A;  3UPQ A;  1H38 A;  1A77 A;  3MGI A;  4E0D A;  4GXJ A;  3ZD9 A;  4O5E A;  7ICK A;  2PI4 A;  9ICF A;  2A1J B;  4PHA A;  1HJP A;  2AU0 A;  4Q8F A;  1L3S A;  1ZQM A;  4ED8 A;  4I28 A;  2KFZ A;  1QLN A;  5CB1 A;  4J9P A;  3B0Y A;  1KEJ A;  4ECY A;  1XSL A;  2BCV A;  1UA0 A;  4DLG A;  2FPK A;  1ZQP A;  1NKE A;  9ICT A;  5EWE A;  4ECZ A;  1RXV A;  9ICI A;  4J9L A;  4ECV A;  2JEI A;  2PFN A;  4KLH A;  4LVS A;  1TK5 A;  3C2M A;  2C2R A;  4R8U B;  3PO5 A;  2H5X A;  5CA7 A;  4RQ4 A;  4M9H A;  4I2I A;  2RDJ A;  5DKW A;  5CWR A;  8ICK A;  4XA5 A;  4O5C A;  4Q45 A;  3H40 A;  4DSK A;  1RZT A;  4KTQ A;  8ICC A;  4G3I A;  2BPG A;  1U4B A;  4RQ0 A;  3SI8 A;  4HYK A;  3RB6 A;  1RPL A;  5DQG A;  4MEY A;  3JPT A;  1KDH A;  4NLG A;  3RJI A;  8ICJ A;  2ALZ A;  3GIL A;  1RYR A;  2P66 A;  4B9N A;  4BDP A;  2FLL A;  2W9B A;  3BQ1 A;  4RU9 A;  4DFJ A;  3C1Z A;  4DL7 A;  1XC9 A;  1MQ2 A;  4RNM A;  3OJU A;  1X9S A;  5DG7 A;  4LZG A;  4Q43 A;  3JPN A;  5DB6 A;  1ZQQ A;  4DQP A;  3SYZ A;  3JPR A;  4QW9 A;  2ZUD A;  3RJF A;  4F92 B;  2XY6 A;  1D8Y A;  1ZQZ A;  1N56 A;  4MEX A;  4IRK A;  1U9L A;  1ZYQ A;  4Z6D A;  2HHU A;  4M9J A;  1SKW A;  1C7Y A;  4UB1 A;  1EXN A;  3EZ5 A;  4KLO A;  5KTQ A;  3IHQ B;  3RAX A;  1NJZ A;  1S0O A;  1SL0 A;  7ICV A;  3RJH A;  1X2I A;  3RB4 A;  4DQQ A;  1ZQH A;  3T5J A;  2BQU A;  4PGX A;  2WTF A;  3V7J A;  4DQS A;  4MF2 A;  9ICX A;  4ELU A;  1TVA A;  4PGQ A;  7ICN A;  4C8L A;  9ICA A;  7ICQ A;  4J9O A;  3ZD8 A;  4ECR A;  3AU6 A;  4JV1 A;  4RZR A;  3ZDD A;  4ZH4 A;  4YXM A;  4YXJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...