1LBUA

Hydrolase metallo (zn) dd-peptidase
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
213
structure length
213
Chain Sequence
DGCYTWSGTLSEGSSGEAVRQLQIRVAGYPGTGAQLAIDGQFGPATKAAVQRFQSAYGLAADGIAGPATFNKIYQLQDDDCTPVNFTYAELNRCNSDWSGGKVSAATARANALVTMWKLQAMRHAMGDKPITVNGGFRSVTCNSNVGGASNSRHMYGHAADLGAGSQGFCALAQAARNHGFTEILGPGYPGHNDHTHVAGGDGRFWSAPSCGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MURAMOYL-PENTAPEPTIDE CARBOXYPEPTIDASE
publication title Streptomyces Albus G D-Ala-A-Ala Carboxypeptidase
pubmed rcsb
molecule tags Hydrolase
total genus 69
structure length 213
sequence length 213
ec nomenclature ec 3.4.17.14: Zinc D-Ala-D-Ala carboxypeptidase.
pdb deposition date 1996-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01471 PG_binding_1 Putative peptidoglycan binding domain
A PF08291 Peptidase_M15_3 Peptidase M15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.101.10 Mainly Alpha Orthogonal Bundle Muramoyl-pentapeptide Carboxypeptidase; domain 1 PGBD-like superfamily/PGBD 1lbuA01
3.30.1380.10 Alpha Beta 2-Layer Sandwich Muramoyl-pentapeptide Carboxypeptidase; domain 2 Muramoyl-pentapeptide Carboxypeptidase; domain 2 1lbuA02
4MPHA 2IBGE 2BH7A 3N1PB 3BKHA 3D2ZA 2VO9A 3N1QA 4OX5A 2WKXA 4JIDA 4BJ4A 1L6JA 4BXDA 1VHHA 4BXJA 3N1OA 3K7HB 1EAKA 4BXEA 1TZPA 3M1NA 2WG4A 2WFRA 3BKVA 3N1FA 4MUTA 3HO5H 2WFQA 3D2YA 3MXWA 3D1MA 4MURA 4OX3A 4F78A 2WFXA 3N1GA 2WG3A 4MUSA 4LPQA 4G54A 4BPAA 1U10A 3K7GB 3K7JB 3K7IB 4NT9A 4C4NA 4D0YA 4OAKA 3N1RA 4OXDA 4BOLA 1R44A 1LBUA 5HNMA 4MUQA 4C4MA 3N1MB
chains in the Genus database with same CATH superfamily
1WC9A 3CUEB 3BKHA 4OX5A 3N1QA 1L6JA 1VHHA 4BXJA 3K7HB 1EAKA 2J3RB 3M1NA 2WG4A 2OSOA 2C0JB 1U10A 3K7GB 3K7JB 5HNMA 4MUQA 3CUED 2J3TA 2BH7A 3D2ZA 3N1OA 4BXEA 1TZPA 4MUTA 2CFHA 2OSDA 3HO5H 3KXCC 2J3WD 1WC8A 3MXWA 3D1MA 4OX3A 2WFXA 2BJNA 4NT9A 4D0YA 4OXDA 4MPHA 2IBGE 2J3RA 2VO9A 2WKXA 4JIDA 2C0JA 2J3TB 3BKVA 2WFQA 3D2YA 4MURA 2WG3A 4MUSA 4LPQA 4OAKA 4BOLA 3N1MB 3NJCA 2CFHC 3N1PB 1SZ7A 4BJ4A 4BXDA 2WFRA 3N1FA 2J3WB 2PWNA 4F78A 3N1GA 4G54A 4BPAA 3K7IB 4C4NA 3KXCA 3N1RA 1R44A 1LBUA 4C4MA
chains in the Genus database with same CATH topology
4MPHA 2IBGE 2BH7A 3N1PB 3BKHA 3D2ZA 2VO9A 3N1QA 4OX5A 2WKXA 4JIDA 4BJ4A 1L6JA 4BXDA 1VHHA 4BXJA 3N1OA 3K7HB 1EAKA 4BXEA 1TZPA 3M1NA 2WG4A 2WFRA 3BKVA 3N1FA 4MUTA 3HO5H 2WFQA 3D2YA 3MXWA 3D1MA 4MURA 4OX3A 4F78A 2WFXA 3N1GA 2WG3A 4MUSA 4LPQA 4G54A 4BPAA 1U10A 3K7GB 3K7JB 3K7IB 4NT9A 4C4NA 4D0YA 4OAKA 3N1RA 4OXDA 4BOLA 1R44A 1LBUA 5HNMA 4MUQA 4C4MA 3N1MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MPH A;  2IBG E;  2BH7 A;  3N1P B;  3BKH A;  3D2Z A;  2VO9 A;  3N1Q A;  4OX5 A;  2WKX A;  4JID A;  4BJ4 A;  1L6J A;  4BXD A;  1VHH A;  4BXJ A;  3N1O A;  3K7H B;  1EAK A;  4BXE A;  1TZP A;  3M1N A;  2WG4 A;  2WFR A;  3BKV A;  3N1F A;  4MUT A;  3HO5 H;  2WFQ A;  3D2Y A;  3MXW A;  3D1M A;  4MUR A;  4OX3 A;  4F78 A;  2WFX A;  3N1G A;  2WG3 A;  4MUS A;  4LPQ A;  4G54 A;  4BPA A;  1U10 A;  3K7G B;  3K7J B;  3K7I B;  4NT9 A;  4C4N A;  4D0Y A;  4OAK A;  3N1R A;  4OXD A;  4BOL A;  1R44 A;  1LBU A;  5HNM A;  4MUQ A;  4C4M A;  3N1M B; 
#chains in the Genus database with same CATH topology
 1WC9 A;  3CUE B;  3BKH A;  4OX5 A;  3N1Q A;  1L6J A;  1VHH A;  4BXJ A;  3K7H B;  1EAK A;  2J3R B;  3M1N A;  2WG4 A;  2OSO A;  2C0J B;  1U10 A;  3K7G B;  3K7J B;  5HNM A;  4MUQ A;  3CUE D;  2J3T A;  2BH7 A;  3D2Z A;  3N1O A;  4BXE A;  1TZP A;  4MUT A;  2CFH A;  2OSD A;  3HO5 H;  3KXC C;  2J3W D;  1WC8 A;  3MXW A;  3D1M A;  4OX3 A;  2WFX A;  2BJN A;  4NT9 A;  4D0Y A;  4OXD A;  4MPH A;  2IBG E;  2J3R A;  2VO9 A;  2WKX A;  4JID A;  2C0J A;  2J3T B;  3BKV A;  2WFQ A;  3D2Y A;  4MUR A;  2WG3 A;  4MUS A;  4LPQ A;  4OAK A;  4BOL A;  3N1M B;  3NJC A;  2CFH C;  3N1P B;  1SZ7 A;  4BJ4 A;  4BXD A;  2WFR A;  3N1F A;  2J3W B;  2PWN A;  4F78 A;  3N1G A;  4G54 A;  4BPA A;  3K7I B;  4C4N A;  3KXC A;  3N1R A;  1R44 A;  1LBU A;  4C4M A; 
#chains in the Genus database with same CATH homology
 4MPH A;  2IBG E;  2BH7 A;  3N1P B;  3BKH A;  3D2Z A;  2VO9 A;  3N1Q A;  4OX5 A;  2WKX A;  4JID A;  4BJ4 A;  1L6J A;  4BXD A;  1VHH A;  4BXJ A;  3N1O A;  3K7H B;  1EAK A;  4BXE A;  1TZP A;  3M1N A;  2WG4 A;  2WFR A;  3BKV A;  3N1F A;  4MUT A;  3HO5 H;  2WFQ A;  3D2Y A;  3MXW A;  3D1M A;  4MUR A;  4OX3 A;  4F78 A;  2WFX A;  3N1G A;  2WG3 A;  4MUS A;  4LPQ A;  4G54 A;  4BPA A;  1U10 A;  3K7G B;  3K7J B;  3K7I B;  4NT9 A;  4C4N A;  4D0Y A;  4OAK A;  3N1R A;  4OXD A;  4BOL A;  1R44 A;  1LBU A;  5HNM A;  4MUQ A;  4C4M A;  3N1M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...