1LBWA

Crystal structure of apo-form (p32) of dual activity fbpase/impase (af2372) from archaeoglobus fulgidus
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
252
structure length
252
Chain Sequence
MDERDALRISREIAGEVRKAIASMPLRERVKDVGMGKDGTPTKAADRVAEDAALEILRKERVTVVTEESGVLGEGDVFVALDPLDGTFNATRGIPVYSVSLCFSYSDKLKDAFFGYVYNLATGDEYYADSSGAYRNGERIEVSDAEELYCNAIIYYPDRKFPFKRMRIFGSAATELCFFADGSFDCFLDIRPGKMLRIYDAAAGVFIAEKAGGKVTELDGESLGNKKFDMQERLNIVAANEKLHPKLLELIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a dual activity IMPase/FBPase (AF2372) from Archaeoglobus fulgidus. The story of a mobile loop.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
molecule keywords fructose 1,6-bisphosphatase/inositol monophosphatase
total genus 87
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2002-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1lbwA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1lbwA02
1CNQA 5ESYA 1FBHA 1IMBA 1NV7A 3ROJA 3A29A 1FSAA 4FBPA 4HE2A 1FPJA 1EYIA 4N81A 3QMFA 3KC1A 1FPIA 3LV0A 5EQ8A 4PTKA 1Q9DA 5A5LA 1FPBA 4KXPA 1JP4A 5ET7A 1NUZA 2FBPA 4GWSA 1RDYA 1FPGA 5FBPA 3B8BA 1LBXA 5LDZA 3IFAA 5I3SA 2CZIA 1G0IA 3D1RA 1FPLA 1KA0A 1AWBA 1K9YA 4AS5A 2P3NA 1FBDA 1NV0A 2CZHA 2Y5LA 1XI6A 5ET6A 4HXVA 4G61A 1LBZA 1IMDA 1FRPA 1RDZA 1FBCA 1DBZA 1NUYA 1IMCA 1YXIA 2OX3A 2WBBA 1IMAA 4GX4A 1DCUA 1SPIA 2Q8MA 4GWWA 1FBGA 5EYGA 1RDXA 5EQAA 1INPA 1FJ6A 2VT5A 3LUZA 4IR8A 4MJOA 5DW8A 3RPLB 4HE0A 1NV4A 1FBPA 3FBPA 2JJKA 5EQ7A 2FIEA 1IMEA 1NUXA 4GWYA 1G0HA 1NUWA 1NV2A 5IZ3B 1BK4A 1FJ9A 1NI9A 2FVZA 1DK4A 4H46A 2FHYA 2WBDA 1LBYA 2QVVA 2GQ1A 3T0JA 1FPKA 1NV6A 1NV5A 2P3VA 3KC0A 1YYZA 5IZ1A 1QGXA 4GBWA 4GWUA 3IFCA 4H45A 4O7IA 1EYKA 1FBEA 1KA1A 2Q74A 4HE1A 5EYHA 1EYJA 4GWZA 5EQ9A 3KBZA 4GX6A 2OWZA 1KZ8A 2Y5KA 4AS4A 2HHMA 1LBVA 3RPLA 1YZ0A 2QVUA 2PCRA 2DDKA 4GX3A 5ET5A 1NV1A 5J16A 1K9ZA 1D9QA 2QVRA 4GBVA 1IMFA 2QFLA 3BIHA 2R8TA 1FPFA 4I40A 3RYDA 1FBFA 4I3YA 5T3JA 1NV3A 1FPEA 1FPDA 1VDWA 1LBWA 4I3EA 5IZ3A 4QXDA 2FIXA 1FTAA 2WEFA 5F24A 2BJIA 2F3BA 1LEVA 2CZKA 4GWXA 2F3DA 5ET8A 3BIGA
chains in the Genus database with same CATH superfamily
1CNQA 2OLBA 4FJPA 5H8NA 3TKDA 2RINA 3QMFA 3KN7A 5EHSA 1UTHB 1D9YA 4JSDA 3E78A 5H8HB 5TP9A 1XVXA 1A8FA 3SDFA 4LP2B 4PF6A 5KDTA 3MYUA 3Q25A 1FQAA 4GRKA 3BFUA 3FVNA 2Y5LA 1EZOA 5DEXA 4C0RA 3SEYA 4N6PA 2O7IA 2YLNA 1YXIA 2ZZXA 3FZVA 2F36A 5H8NB 2V3UA 3OELA 3RN8A 4EQ7A 5DW8A 4ZE8A 3O6IA 1FBPA 1D3KA 4OVSA 3RT6B 2P1SA 3C34A 3KJTA 3OO7A 3FASA 2X26A 4DI4B 2HEUA 5EQ9A 3Q26A 1ZMGA 2DYXA 3FV1A 4XKPA 1GGGA 1CB6A 3W9VA 2DP8A 5CI5A 2VPOA 1QKAA 1M5EA 2XD3A 3QK6A 5TU0A 1ZBMA 2ZXTA 4U4SA 4I3YA 4MLVA 4N13A 1OLCA 2HCAA 5I57B 1R9QA 3VVFA 2F3BA 4JWXA 4YU0A 4IO3A 1MY3A 3ODBA 3UORA 4N07A 3N6UA 5I58A 3S4UA 4N81A 2FYIA 1FPIA 4P9KA 1MDQA 2B3BA 2ZYNA 4KYEA 2FBPA 2IEEA 1RDYA 3IFAA 4Q0CA 3O2AA 3ILUB 1KA0A 4OEVA 4C1UA 1MM6A 4YB7A 3MVXA 4MHFA 4BDQA 4GVOA 2G29A 4RPOA 4U2RA 3R7XA 1NUYA 4WEDA 4IB2A 3RQTA 3TTRA 2WBBA 4YB6A 4GWWA 4PE3A 3RPLB 4AB6A 3FVOA 4KR5A 1NI9A 1SW4A 2QL3A 1SVXB 3HPIA 3IOTA 3Q29A 1LBYA 3PUYE 2P3VA 2Y7KA 4R2BA 4EXKA 2F6PA 2Z8DA 3TCFA 2ESNA 1EYKA 1PBPA 2PFYA 5L9OA 5I5PA 1KZ8A 4IGTA 1TT1A 2GH9A 5FHNA 1SDXA 1AMFA 5J16A 4MX6A 1FBFA 3H6VA 2KR0A 1XOCA 4G77A 3ONMA 4NN3A 4NF6B 5ITPA 4KYSA 4XKRA 3TODA 2F3DA 1Y20A 1LGBC 1VFDA 4QRZA 1FSAA 5A5XA 3H6TA 3IR1A 4N8GA 5A5LA 4NE4A 1JP4A 4POXA 5I59A 1FPGA 1S9TA 3TEPA 3TFLA 1UIUA 2B65A 1BLFA 2Y7RA 5AA3A 1B4ZA 2UYFA 1LB8A 1MY0A 4QFOA 2I3VA 4DCYA 4PBHA 3B6WA 4ELOA 3VLUA 2B4MA 2ALUA 3V89B 1FRPA 4BDMA 3PUXE 4POWA 4FEBA 2Z22A 4BDRA 2Q8MA 3EHTA 1IUDA 4F22A 3QUJA 1Y3QA 4H65A 1NUXA 2QJEA 2XXQA 3CIJA 3PTYA 4DIGA 2KLFA 5IZ1A 1Y1ZA 4ECFA 2H98A 4HE1A 1KWHA 4ZZEA 1D9VA 5LOMA 4QHQA 3H7MA 3TAJA 4LZ7A 3L6HA 1T0KA 3ZKLA 4PFRA 1QULA 4MF3A 3EKIA 5HBCA 3FD3A 4YKPA 1D9QA 2O68A 1DOTA 2V4CA 3UIFA 4MFIA 1PB8A 3EHUA 2HQ0A 5I59B 3BKIB 3C36A 4OFOA 3K2DA 1A54A 4GXSB 4ZEKA 1B52A 2P2AA 1MXZA 1FQCA 2I3WA 2XXPA 1IMBA 3EHSA 2OWSA 3OOAA 1B5HA 2OCUA 3ZSFA 5H8FA 4GF8A 1TFAA 2B4LA 3PD9A 4U21A 4ZZAA 5H8QA 3PPPA 2W7YA 2XWVA 2CMOA 4F3SA 5CBRA 3U92A 4G68B 1MXXA 1FTMA 4OANA 1EH3A 2O51A 5K2XA 2V3QA 4JBZA 3O97A 4ZEFA 5AA4A 1RKMA 2VPNA 4DDDA 1OVTA 1IXGA 4KPTA 4O94A 3TTNA 2VP1A 3MAMA 1II5A 1O64A 3H06B 4F31B 3RT8A 1NNTA 1ZJLA 2DWIA 3K1MA 2ZYOA 2AIXA 1YYZA 1PB9A 1PEBA 4O8MA 4H45A 1VE4A 1SI1A 4GX6A 4UABA 4OMBA 1LAFE 2HHMA 1HSLA 1B46A 2QS1A 1MXUA 3VE1B 5DT6A 2QVRA 3KEIA 3IO4A 1FQFA 2GHBA 4HS7A 4RXLA 3U72A 4GFRA 5CMKA 1Q1KA 4QXDA 2WYKA 4NG7A 3SEXA 4KYDA 2O7UA 3QAXA 3TCGA 2F97A 3LBSA 4IO7A 4PAFA 4P1EA 2VD3A 4HTGA 4DXUA 1LBBA 4DLDA 1URSA 5I2KB 3OO9A 1BTJA 1P99A 2DQVA 2OZZA 3D1RA 4GL8A 4AB5A 1IXHA 1ZTYA 1FBDA 1NV0A 4EF2A 2RCAA 5A5XB 2Q88A 4P47A 3ECRA 4Q8RA 4ND9A 1IMDA 3H6UA 3K6VA 4PETA 5I84A 2QMXA 3O29A 4GX4A 3OSRA 2VT5A 2BJJX 2DXYA 5ISUA 1QJMA 3AXFA 5EQ7A 1Z7NE 1A40A 3KGCA 4OESA 3M3FA 2QVVA 3MPKA 1MQHA 4X48A 2Q89A 4E0WA 1FQDA 1GTKA 4I62A 2OWZA 4RA1A 3H3GA 3IOWA 1MQGA 1YZ0A 2P0SA 4PQJA 4KD5A 4JVCA 2CZLA 4LONB 4HCWA 2ZZVA 3CR9A 1N7WA 3OO6A 3QXMA 1UQWA 4XTCQ 2CZKA 4IGRA 4FIMA 3B7DA 2ZNUA 3MZBA 3TQWA 1JEUA 1FQEA 3KN3A 3IJOB 2I0CA 1A55A 5J1DA 4KHZE 4WKMA 3E79A 4GQOA 2XX7A 4GOTA 3R26A 4G4PA 3CSGA 1LAXA 5FBPA 4H5FA 3SESA 4OEUA 4F39A 3JV9A 1B3GA 1WDNA 4XEQA 4NF0A 3N26A 2XWIA 1ZLQA 4PDHA 2Z8EA 4MAGA 4H0WA 2UVGA 4HXVA 3CFZA 1DBZA 1UTHA 5K2YA 1QUJA 1H44A 2AL5A 4HW8A 5TPAA 5H8QB 1MQIA 4OVQA 4PGPA 2XXIA 1LBCA 1GR2A 1MG1A 1EU8A 5B70A 2VOZA 1RYXA 2O1MA 3GXAA 1MH4A 3EF7A 1R6ZA 3V83A 1TWYA 5IZZA 3USDA 1AIVA 2Q74A 5EYHA 3SEVA 2Y7WA 1NNFA 3HV1A 5IAIA 4XIGQ 3DELB 3VXCA 5FTIA 4IO2A 1B3EA 4R73A 1IMFA 4QF9A 2AYSA 1PDAA 1FPFA 3RYDA 2XXKA 1NV3A 4NMYA 3U94A 1VDWA 1LBWA 4G68A 1I69A 3MJNA 4XKNA 3N6TA 1NV7A 3ROJA 3A29A 1YTVA 1ZU0A 3WAFA 2B3FA 4FBPA 2UXAA 4QFPA 1XHYA 1OMPA 3EPEA 3LV0A 5EQ8A 1JVXA 3T9HB 3KSJA 5DVIA 4KXPA 2YPNA 3UP9A 1IXIA 3MW0A 5DYHA 3FVKA 2XA5A 3KZGA 4PE5B 3T22A 3O28A 1FTOA 3C33A 1R1NA 2XD2A 1HSJA 3M3KA 2CZHA 4I8CA 5I58B 3CFLA 3VV5A 3T9XB 1Q35A 2F34A 1MXWA 3G3GA 3OD7A 5I2NB 4MIJA 1IXCA 4LZ8A 1YAEA 2A5TB 4PFWA 4GWYA 1NV2A 1FJ9A 5EYFA 2WBDA 2GQ1A 4PFIA 1NV5A 3TCHA 1B58A 1JVYA 1QGXA 3CI8A 1B6HA 1FBEA 1LFIA 4GL0A 4PAKA 1AH5A 3P7IA 1Y4CA 2R6GE 5ITOA 4PFYA 1O63A 1DPPA 4YZZA 2OWTA 2DDKA 3Q27A 5I2NA 3OEKA 2I49A 5I56A 4P3LA 1MXYA 4XXUA 4F3PA 1B32A 2FNCA 3SERA 3LR1A 4OYVA 1URGA 5DVFA 4I3EA 2E0SA 2NXOA 4U23A 4X1BA 4TLMB 3CG1A 2F7BA 3VVEA 2ZMBA 4OZ9A 2F78A 1F9BA 4OVTA 3DP6A 1USYE 1FW0A 2I0BA 3O6GA 2THIA 5ET7A 4MH5A 4NF6A 3G3HA 3FVGA 4GWSA 2GHAA 3GZGA 4NF4A 1G0IA 4H1XA 3HSTA 1NKXA 2ZZWA 4F19A 4YKKA 3OEMA 2ONKE 2XXUA 5L9MA 2DE2A 2QS4A 3RGYA 5ET6A 2PVUA 3IAZA 4ISUA 3GLBA 4HCYA 2HFBA 3H6WA 1ATGA 1FCKA 3T9VA 3QSLA 4X04A 1MY2A 2Y7IA 2FIEA 4MNCA 5FTHA 3PD8A 4XFEA 2F5XA 5IZ3B 4H67A 3B6TA 5IM2A 3D4CA 4R2FA 3CRBA 5B7DA 2ABHA 3H03A 2QS3A 5CBSA 3ZS6A 1EYJA 1I6QA 4GWZA 1P1QA 4MMPA 4NQ8A 2NWJA 4ZE9A 4MLQA 4BDNA 2HZLA 1Z7ME 5EHMA 5TPAB 4AQ4A 1LAHE 3OXNA 5IKBA 4MBPA 4NWCA 4EQBA 1FPDA 3RPWA 1SI0A 3FGSA 1Y3PA 2R9JA 1N3WA 4OA4A 4MEVA 1URDA 3IL1B 3L6GA 4GWXA 1SQYA 4N17A 3K6UA 4P56A 4N4UA 3A09A 2RCBA 3KOSA 4PAIA 2DWAA 2Q2AA 1XT8A 1SW2A 2MKZA 4NF8B 5CRYA 4FORA 2D5WA 5AA2D 3S9MC 4KQPA 3VDFA 1FPLA 4C1TA 4ZEIA 1AWBA 3SEWA 1MQDA 1B3FA 3TQLA 2OJTA 4G61A 1RDZA 1UIVA 2RC8A 1MQJA 4MCOA 3FV2A 1MH3A 1IMAA 4RYAA 5CM6A 4ZDMA 2A5SA 2O84X 4I9DA 2REJA 2LAOA 2XXVA 1CE2A 1NV4A 1B1HA 4IO6A 4NTLA 1LLSA 1YCJA 4EDPA 4FEDA 2OPEA 4U1ZA 5TP9B 1NV6A 4X8RA 4OHNA 3O9PA 1USYH 2HXRA 3NOHA 1B51A 3LSWA 4R6YA 3RNNA 2PYYA 1O7TA 4ELQA 3OMBA 1ANFA 4QSDA 2F6GA 1QW0A 4ZEDA 3PMVA 5ET5A 3MVYA 4PFTA 2PT2A 1P1WA 5H8HA 2X7QA 2YJPA 3TTLA 3OENA 2F7AA 5IGAA 3T9UA 2ONRA 2XWKA 1NH8A 3E4RA 4UACA 3I5OA 3TTKA 1B9JA 4YB5A 2H5YA 1B7HA 1H45A 3C4MA 1QUIA 2ZNTA 3U65A 3LUYA 2NVUB 5KCJB 4JXIA 2Y84A 2I48A 1FQBA 3FJ7A 2Q8JA 4OETA 4PDDA 1NH7A 3PUWE 4ESXA 2XX9A 1YPNA 3RY3A 5I57A 2P3NA 4OQOA 4O3AA 5CMBA 1XI6A 4P11A 2R71A 3CSBA 1H3DA 4YKIA 2ANJA 1IMCA 2DVCA 4XF5A 3G3IA 4NX1A 4NWDA 4MNPA 1RDXA 5EQAA 1VSOA 1LCTA 3E9XA 4O7MA 3MZ1A 3V8XB 1NNPA 1IMEA 1HSEA 1LAGE 1BK4A 4JB7A 4PGNA 4O3CA 1DK4A 3PPRA 1B40A 1JQFA 3ILTB 1M5FA 1MPBA 1MS7A 4H8IA 4G8MA 3QYTA 5AA2B 2O6AA 4IO5A 4BDLA 3FXRA 1BIYA 2QSXA 1LBVA 1MY4A 2RC9A 4WEPA 1SBPA 3GBBA 4GX3A 3IJXB 4LQ5A 4YICA 3SKPA 3MZ9A 2QFLA 4JDFA 3FJMA 3E13X 5T3JA 3U1OA 1B1XA 5IZ3A 1SD3A 5HM4B 3RTFB 1B5IA 2D21A 2WYPA 1N0TA 4GD5A 4F2OA 3BIGA 3T1BA 2NUVA 4OVJA 3TELA 3KSXA 4LUBA 4UA8A 3Q28A 1XC1A 4QSEA 3K02A 1DPEA 2WKYA 3IO6A 4FATA 1LSTA 1B7UA 1Q9DA 4PBQA 2UYEA 1B2HA 2H4IA 3CVGA 4GXAA 5F7VA 2UVIA 2O69A 3JZJA 3PU5A 4RY1A 1B4HA 1A99A 1K9YA 2QS2A 4THIA 3SETA 4R72A 2Q2CA 1FBCA 1TFDA 4GWOA 3RLFE 3A3CA 1DCUA 4OTEA 1QUKA 3TDJA 4IR8A 4YMBA 1BP5A 1J1NA 5KDTB 1VFEA 3T96B 5AA4B 1G0HA 4Q5TA 2FHYA 4N91A 4ZS9A 3R6UA 3IFCA 2WX9A 5JEIA 1N04A 3KBZA 2QMWA 2HXWA 3MVWA 1SYHA 4PCDA 2QVUA 3K1NA 4M1VA 2E1SA 4F1YA 3IX1A 3KN8A 3VFJA 2M8CA 1N7XA 4IO4A 2RF1A 1NNKA 2HZKA 3TTMA 3EQ1A 1TXFA 2KQZA 1B0LA 2V3TA 3FJGA 4HE2A 3TPAA 3PUZE 5CC2A 3N94A 3MUQA 4P0IA 4DXCA 4NF5B 1OLAA 3GYYA 3MQ9A 4NAPA 3E3KA 4EUOA 2XXYA 2V84A 3EN3A 1N76A 4R74A 5LDZA 1OVBA 3GBAA 4X1DA 3S9LC 2REGA 3TZAA 2DXRA 4ELRA 4OFJA 1OQGA 2H25A 5M2VA 1P1UA 2XXRA 1QKBA 1H76A 2DOJA 2ZYKA 3MPLA 1N84A 2XXWA 4L17A 4R9GA 2VHAA 5KCJA 4E0XA 2D3IA 1M5BA 2V93A 1INPA 4NF5A 2F8DA 4QFNA 4HE0A 3IOUA 1B3HA 2JJKA 1Y1MA 2PFZA 4ZECA 4N6DA 4G2ZA 2FVZA 3T0JA 5BUUA 4EQ9A 1R9LA 1MRPA 1DSNA 3LSFB 2OBGA 2PBWA 1ZKBA 4F3GA 3RPLA 2I58A 4RJZA 1L5TA 1SW1A 5CMCA 4Z7EA 4JVDA 3SZPA 1IQ7A 1DMBA 4U22A 3PPNA 3G7WA 1FPEA 3TMGA 4F29A 3C9HA 4TLLB 4EF1A 3FXUA 2FIXA 4FAJA 4M4GA 4H5GA 3PUVE 1WVJA 1LEVA 3VLWA 1H43A 4NHBA 4H6DA 4G68C 2IA4A 4LATA 1FPJA 1EYIA 2XX8A 1GVCA 3KC1A 1M5DA 1XVYA 4P8BA 2ZNSA 3G3KA 1OIBA 2UVHA 1IZ1A 1NUZA 1LCFA 1US4A 5ELVA 3B8BA 1LBXA 4LQ2A 1A7LA 4LVQA 2I4CA 3HO7A 1D4NA 1EZ9A 2GRVA 4YKJA 2Z23A 4AS5A 3C35A 3IB0A 2ONSA 4NEDA 1I6BA 2I4BA 3FUZA 4ELPA 4WXJA 3V5AA 1SPIA 2CEYA 3N5LA 3TYHA 3KFMA 4PF8A 1JNFA 4R75A 3C31A 4NGUA 3LSLA 4OWDA 3WAEA 1IITA 3OO8A 2HAUA 1POTA 3O6HA 4Z0IA 5ICQA 2NOOA 4EXLA 4O7IA 4PC9A 1KA1A 1MXVA 3IORA 1UTBA 2FA7A 1LB9A 4G8NA 2AL4A 4JWYA 2PCRA 1AL3A 1NV1A 1OQHA 2RKMA 4GBVA 1VR5A 4GLIA 4I40A 1I6AA 3PV0E 3FIRA 1B0HA 1M5CA 3H4ZA 4RK2A 1JW5A 3IB2A 2GFEA 5ET8A 1ZIUA 5ESYA 5H8SA 3DM0A 3MVZA 3PMXA 3KOTA 3HHFA 5JK4A 5ICTA 4BDOA 3D4GA 5JTYB 4F3BA 3MC2A 2UVJA 3RUMA 3FXQA 4LZ5A 2XWOA 4PFBA 1FPBA 3KJ7A 1B7ZA 1PBQA 5KZTA 2I6EA 5I3SA 3IOVA 3PMWA 3K0VA 4DI3D 1ELJA 3KBRA 3B6QA 3QIMA 3UGWA 3O66A 2H9BA 3MP1A 4YAHX 4TQUQ 3MSTA 5AA2A 3G3JA 3K1PA 3RTWB 1S50A 1JW4A 5EYGA 3HFUA 4LA9A 3T66A 3ISPA 3BBRA 4PFUA 4QBAA 3CHGA 5F1QA 4H46A 2PX1A 2QPQA 4K3FA 1MPCA 4OERA 1FPKA 4DCXA 3K01A 1JEVA 4JWOA 3ZKKA 4GBWA 3S2VA 3OSQA 4DZ1A 2DE4A 4AS4A 4N15A 4Q30B 2CEXA 1EZPA 2X7PA 3THIA 1K9ZA 2F35A 4FE8A 3SEUA 4NF8A 4ONYA 4RNSA 3BIHA 3A3UA 1B5JA 3JYRA 1IIWA 4P1LA 1FTJA 4RPNA 1FTAA 2WEFA 1N3XA 4R6HA 4LN5A 3CG3A 5HPQA 5DEXB 1MY1A 1Y3NA 5BWJA 2PMSA 4ZEBA 1US5A 2DWJA 1NMUA 3MP8A 1B3LA 4OVPA 3DP8A 1WODA 4N8YA 2A5TA 4PTKA 3UN6A 1MM7A 4R6KA 3W9WA 2OK2A 4DXBA 4F18A 5AA1A 2CZIA 1RYOA 3K6XA 4X9TA 4MNIA 5AE4A 4R9FA 2QRYA 2ZYMA 1POY1 3C32A 1LBZA 2XXXA 4I1DA 5I2KA 3M3LA 3HHGA 1MPDA 3G3FA 4DE8A 3HN0A 4ESWA 3DP4A 3K6WA 3T93B 4NF4B 1FJ6A 3F11A 1FTLA 3I6VA 1A8EA 3QUFA 4OXVA 4YMAA 4QFKA 2DVZA 4U4XA 1Y9UA 2VGQA 4F1UA 4FECA 1DTZA 1NL5A 4BLAA 4QFLA 3KC0A 3FXBA 3S9NC 1LFGA 4N6KA 4GWUA 2L5VA 2XXTA 3VXBA 3HCQA 1P1NA 2DS9A 3U8QA 3MWBA 2XXHA 3FATA 4KI0E 3I3VA 5H8FB 4U1OA 2HPGA 2V25A 4JVIA 2R8TA 3IK6B 1Y4TA 3UA8A 5L9SA 4OFLA 4KFQA 4KCCA 3KG2A 1SW5A 1LFHA 3LSXA 4OVRA 1UTBB 1BKAA 2OPDA 3B50A 2G93A 4O3BA 1FBHA 1PB7A 5LTCA 1SYIA 1AOVA 2Y7PA 4RK9A 1FTKA 5I56B 1PC3A 1NFTA 3M8UA 4PP0A 1DTGA 3MBPA 4G8HA 1QVSA 5CMMA 2XHDA 2DE3A 4IY6A 2O1LA 3K00A 3PPOA 2OX3A 3BFTA 2VD2A 4P0GA 1FBGA 1JW1A 1S7YA 2F7CA 4QSCA 2H99A 1IEJA 4H8JA 3LUZA 4MJOA 3DLNA 5DVJA 4OENA 4GIZA 3FBPA 1NUWA 3S9EA 5DTBA 1XS5A 5I7IA 3TUSA 1GV8A 3UK4A 3CFXA 4XKQA 2Z8FA 5FHMA 3MP6A 2PT1A 1B05A 2HAVA 2DSFA 1JETA 4IY5A 2DWHA 3W15C 3PGFA 2Y5KA 5L8DA 1MDP1 3K4UA 4JSOA 1P1OA 5FHOA 2RC7A 3VLVA 5JTYA 4TOZA 4KCDA 3LC8A 3U93A 4F1VA 2Q9TA 4F2QA 5F24A 3VVDA 2BJIA 3IB1A 3PPQA
chains in the Genus database with same CATH topology
1CNQA 5ESYA 2KQZA 1FBHA 1IMBA 1NV7A 3ROJA 5LTCA 3A29A 4NHBA 4PAFA 1FSAA 3U65A 4N17A 5JK4A 4P1EA 4FBPA 4P56A 4N4UA 2B4LA 4HE2A 4OVPA 1FPJA 1EYIA 4N81A 5J1DA 3QMFA 3E79A 3KC1A 4N8YA 4PAIA 1FPIA 4P9KA 3LV0A 5EQ8A 4P8BA 4PTKA 2XWOA 1Q9DA 5A5LA 2XWVA 1FPBA 3GYYA 4N8GA 4NAPA 4KXPA 4PBQA 1JP4A 4PFBA 5ET7A 3W9WA 1NUZA 2FBPA 4GWSA 2MKZA 1RDYA 1FPGA 5FBPA 4OANA 4F18A 3B8BA 1LBXA 5LDZA 3IFAA 5I3SA 3E78A 2CZIA 1G0IA 3D1RA 4PDDA 2XA5A 1FPLA 1KA0A 4X9TA 2V3QA 4MNIA 4PF6A 2ZZWA 4XEQA 1AWBA 3MYUA 4DI3D 4DI4B 1K9YA 4MHFA 4AS5A 4NF0A 4PBHA 4F19A 2P3NA 1FBDA 1NV0A 3T1BA 2CZHA 2XWIA 2Y5LA 4PDHA 4MAGA 2B4MA 2DE3A 1XI6A 2DE2A 5ET6A 4HXVA 2VPNA 4P47A 4G61A 1LBZA 1IMDA 1FRPA 1RDZA 4PETA 1FBCA 1DBZA 4HCYA 1NUYA 4MCOA 1IMCA 1YXIA 2ZZXA 2OX3A 2WBBA 4O94A 4XF5A 1IMAA 3MSTA 4GX4A 5CM6A 1DCUA 1SPIA 2CEYA 2Q8MA 4NX1A 4GWWA 1FBGA 4PE3A 4MNPA 4MIJA 5EYGA 1RDXA 5EQAA 1INPA 1FJ6A 2VT5A 3LUZA 4IR8A 4MJOA 3HFUA 4OVQA 4PGPA 4X04A 5DW8A 3RPLB 4O7MA 4HE0A 1NV4A 1FBPA 3FBPA 2DVZA 4PF8A 2JJKA 5EQ7A 2FIEA 2PFZA 3ISPA 1IMEA 4MNCA 1NUXA 4NGUA 4GWYA 4OVSA 4XFEA 4F1UA 1G0HA 2F5XA 1NUWA 1NV2A 5IZ3B 4N6DA 1BK4A 1FJ9A 1NI9A 2FVZA 3CHGA 4PGNA 4QBAA 1DK4A 4H46A 5I7IA 2FHYA 2WBDA 1LBYA 2QVVA 4N91A 2GQ1A 3T0JA 2QPQA 3PTYA 1FPKA 4PFIA 1NV6A 4X8RA 5IM2A 1NV5A 2P3VA 3KC0A 3FXBA 1YYZA 5IZ1A 1QGXA 4N6KA 4GBWA 4GWUA 3IFCA 4H45A 4O7IA 1EYKA 1FBEA 2L5VA 4O8MA 4PC9A 2PFYA 2HXRA 2WX9A 3NOHA 1KA1A 4PAKA 5IZZA 2Q74A 4HE1A 5EYHA 1EYJA 4GWZA 5EQ9A 3KBZA 4GX6A 2DE4A 2OWZA 1KZ8A 4MMPA 4UABA 2Y5KA 5I5PA 4AS4A 4NQ8A 4N15A 2HHMA 4PFRA 1LBVA 3RPLA 4PCDA 2CEXA 4YZZA 1YZ0A 2QVUA 2PCRA 2HZLA 2DDKA 3EKIA 3W9VA 4GX3A 5ET5A 1NV1A 2VPOA 5J16A 1K9ZA 4M1VA 2HPGA 1D9QA 2QVRA 4YICA 4GBVA 1IMFA 4JVIA 4P3LA 4MX6A 2QFLA 3BIHA 4JVDA 2R8TA 2V4CA 4OVTA 3SZPA 1FPFA 4JVCA 4I40A 3RYDA 1FBFA 4I3YA 2XXKA 5T3JA 5IGAA 2KR0A 1NV3A 1FPEA 1FPDA 4HCWA 1VDWA 1LBWA 4NN3A 4P1LA 4I3EA 5IZ3A 2XWKA 2ZZVA 2Q9TA 4QXDA 2FIXA 4F1VA 1FTAA 2WYPA 4OA4A 2WEFA 2WYKA 4MEVA 4NG7A 5F24A 2HZKA 4LN5A 4OVRA 2BJIA 2F3BA 1LEVA 2CZKA 4GWXA 2F3DA 3B50A 5ET8A 3BIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CNQ A;  5ESY A;  1FBH A;  1IMB A;  1NV7 A;  3ROJ A;  3A29 A;  1FSA A;  4FBP A;  4HE2 A;  1FPJ A;  1EYI A;  4N81 A;  3QMF A;  3KC1 A;  1FPI A;  3LV0 A;  5EQ8 A;  4PTK A;  1Q9D A;  5A5L A;  1FPB A;  4KXP A;  1JP4 A;  5ET7 A;  1NUZ A;  2FBP A;  4GWS A;  1RDY A;  1FPG A;  5FBP A;  3B8B A;  1LBX A;  5LDZ A;  3IFA A;  5I3S A;  2CZI A;  1G0I A;  3D1R A;  1FPL A;  1KA0 A;  1AWB A;  1K9Y A;  4AS5 A;  2P3N A;  1FBD A;  1NV0 A;  2CZH A;  2Y5L A;  1XI6 A;  5ET6 A;  4HXV A;  4G61 A;  1LBZ A;  1IMD A;  1FRP A;  1RDZ A;  1FBC A;  1DBZ A;  1NUY A;  1IMC A;  1YXI A;  2OX3 A;  2WBB A;  1IMA A;  4GX4 A;  1DCU A;  1SPI A;  2Q8M A;  4GWW A;  1FBG A;  5EYG A;  1RDX A;  5EQA A;  1INP A;  1FJ6 A;  2VT5 A;  3LUZ A;  4IR8 A;  4MJO A;  5DW8 A;  3RPL B;  4HE0 A;  1NV4 A;  1FBP A;  3FBP A;  2JJK A;  5EQ7 A;  2FIE A;  1IME A;  1NUX A;  4GWY A;  1G0H A;  1NUW A;  1NV2 A;  5IZ3 B;  1BK4 A;  1FJ9 A;  1NI9 A;  2FVZ A;  1DK4 A;  4H46 A;  2FHY A;  2WBD A;  1LBY A;  2QVV A;  2GQ1 A;  3T0J A;  1FPK A;  1NV6 A;  1NV5 A;  2P3V A;  3KC0 A;  1YYZ A;  5IZ1 A;  1QGX A;  4GBW A;  4GWU A;  3IFC A;  4H45 A;  4O7I A;  1EYK A;  1FBE A;  1KA1 A;  2Q74 A;  4HE1 A;  5EYH A;  1EYJ A;  4GWZ A;  5EQ9 A;  3KBZ A;  4GX6 A;  2OWZ A;  1KZ8 A;  2Y5K A;  4AS4 A;  2HHM A;  1LBV A;  3RPL A;  1YZ0 A;  2QVU A;  2PCR A;  2DDK A;  4GX3 A;  5ET5 A;  1NV1 A;  5J16 A;  1K9Z A;  1D9Q A;  2QVR A;  4GBV A;  1IMF A;  2QFL A;  3BIH A;  2R8T A;  1FPF A;  4I40 A;  3RYD A;  1FBF A;  4I3Y A;  5T3J A;  1NV3 A;  1FPE A;  1FPD A;  1VDW A;  1LBW A;  4I3E A;  5IZ3 A;  4QXD A;  2FIX A;  1FTA A;  2WEF A;  5F24 A;  2BJI A;  2F3B A;  1LEV A;  2CZK A;  4GWX A;  2F3D A;  5ET8 A;  3BIG A; 
#chains in the Genus database with same CATH topology
 1CNQ A;  2OLB A;  4FJP A;  5H8N A;  3TKD A;  2RIN A;  3QMF A;  3KN7 A;  5EHS A;  1UTH B;  1D9Y A;  4JSD A;  3E78 A;  5H8H B;  5TP9 A;  1XVX A;  1A8F A;  3SDF A;  4LP2 B;  4PF6 A;  5KDT A;  3MYU A;  3Q25 A;  1FQA A;  4GRK A;  3BFU A;  3FVN A;  2Y5L A;  1EZO A;  5DEX A;  4C0R A;  3SEY A;  4N6P A;  2O7I A;  2YLN A;  1YXI A;  2ZZX A;  3FZV A;  2F36 A;  5H8N B;  2V3U A;  3OEL A;  3RN8 A;  4EQ7 A;  5DW8 A;  4ZE8 A;  3O6I A;  1FBP A;  1D3K A;  4OVS A;  3RT6 B;  2P1S A;  3C34 A;  3KJT A;  3OO7 A;  3FAS A;  2X26 A;  4DI4 B;  2HEU A;  5EQ9 A;  3Q26 A;  1ZMG A;  2DYX A;  3FV1 A;  4XKP A;  1GGG A;  1CB6 A;  3W9V A;  2DP8 A;  5CI5 A;  2VPO A;  1QKA A;  1M5E A;  2XD3 A;  3QK6 A;  5TU0 A;  1ZBM A;  2ZXT A;  4U4S A;  4I3Y A;  4MLV A;  4N13 A;  1OLC A;  2HCA A;  5I57 B;  1R9Q A;  3VVF A;  2F3B A;  4JWX A;  4YU0 A;  4IO3 A;  1MY3 A;  3ODB A;  3UOR A;  4N07 A;  3N6U A;  5I58 A;  3S4U A;  4N81 A;  2FYI A;  1FPI A;  4P9K A;  1MDQ A;  2B3B A;  2ZYN A;  4KYE A;  2FBP A;  2IEE A;  1RDY A;  3IFA A;  4Q0C A;  3O2A A;  3ILU B;  1KA0 A;  4OEV A;  4C1U A;  1MM6 A;  4YB7 A;  3MVX A;  4MHF A;  4BDQ A;  4GVO A;  2G29 A;  4RPO A;  4U2R A;  3R7X A;  1NUY A;  4WED A;  4IB2 A;  3RQT A;  3TTR A;  2WBB A;  4YB6 A;  4GWW A;  4PE3 A;  3RPL B;  4AB6 A;  3FVO A;  4KR5 A;  1NI9 A;  1SW4 A;  2QL3 A;  1SVX B;  3HPI A;  3IOT A;  3Q29 A;  1LBY A;  3PUY E;  2P3V A;  2Y7K A;  4R2B A;  4EXK A;  2F6P A;  2Z8D A;  3TCF A;  2ESN A;  1EYK A;  1PBP A;  2PFY A;  5L9O A;  5I5P A;  1KZ8 A;  4IGT A;  1TT1 A;  2GH9 A;  5FHN A;  1SDX A;  1AMF A;  5J16 A;  4MX6 A;  1FBF A;  3H6V A;  2KR0 A;  1XOC A;  4G77 A;  3ONM A;  4NN3 A;  4NF6 B;  5ITP A;  4KYS A;  4XKR A;  3TOD A;  2F3D A;  1Y20 A;  1LGB C;  1VFD A;  4QRZ A;  1FSA A;  5A5X A;  3H6T A;  3IR1 A;  4N8G A;  5A5L A;  4NE4 A;  1JP4 A;  4POX A;  5I59 A;  1FPG A;  1S9T A;  3TEP A;  3TFL A;  1UIU A;  2B65 A;  1BLF A;  2Y7R A;  5AA3 A;  1B4Z A;  2UYF A;  1LB8 A;  1MY0 A;  4QFO A;  2I3V A;  4DCY A;  4PBH A;  3B6W A;  4ELO A;  3VLU A;  2B4M A;  2ALU A;  3V89 B;  1FRP A;  4BDM A;  3PUX E;  4POW A;  4FEB A;  2Z22 A;  4BDR A;  2Q8M A;  3EHT A;  1IUD A;  4F22 A;  3QUJ A;  1Y3Q A;  4H65 A;  1NUX A;  2QJE A;  2XXQ A;  3CIJ A;  3PTY A;  4DIG A;  2KLF A;  5IZ1 A;  1Y1Z A;  4ECF A;  2H98 A;  4HE1 A;  1KWH A;  4ZZE A;  1D9V A;  5LOM A;  4QHQ A;  3H7M A;  3TAJ A;  4LZ7 A;  3L6H A;  1T0K A;  3ZKL A;  4PFR A;  1QUL A;  4MF3 A;  3EKI A;  5HBC A;  3FD3 A;  4YKP A;  1D9Q A;  2O68 A;  1DOT A;  2V4C A;  3UIF A;  4MFI A;  1PB8 A;  3EHU A;  2HQ0 A;  5I59 B;  3BKI B;  3C36 A;  4OFO A;  3K2D A;  1A54 A;  4GXS B;  4ZEK A;  1B52 A;  2P2A A;  1MXZ A;  1FQC A;  2I3W A;  2XXP A;  1IMB A;  3EHS A;  2OWS A;  3OOA A;  1B5H A;  2OCU A;  3ZSF A;  5H8F A;  4GF8 A;  1TFA A;  2B4L A;  3PD9 A;  4U21 A;  4ZZA A;  5H8Q A;  3PPP A;  2W7Y A;  2XWV A;  2CMO A;  4F3S A;  5CBR A;  3U92 A;  4G68 B;  1MXX A;  1FTM A;  4OAN A;  1EH3 A;  2O51 A;  5K2X A;  2V3Q A;  4JBZ A;  3O97 A;  4ZEF A;  5AA4 A;  1RKM A;  2VPN A;  4DDD A;  1OVT A;  1IXG A;  4KPT A;  4O94 A;  3TTN A;  2VP1 A;  3MAM A;  1II5 A;  1O64 A;  3H06 B;  4F31 B;  3RT8 A;  1NNT A;  1ZJL A;  2DWI A;  3K1M A;  2ZYO A;  2AIX A;  1YYZ A;  1PB9 A;  1PEB A;  4O8M A;  4H45 A;  1VE4 A;  1SI1 A;  4GX6 A;  4UAB A;  4OMB A;  1LAF E;  2HHM A;  1HSL A;  1B46 A;  2QS1 A;  1MXU A;  3VE1 B;  5DT6 A;  2QVR A;  3KEI A;  3IO4 A;  1FQF A;  2GHB A;  4HS7 A;  4RXL A;  3U72 A;  4GFR A;  5CMK A;  1Q1K A;  4QXD A;  2WYK A;  4NG7 A;  3SEX A;  4KYD A;  2O7U A;  3QAX A;  3TCG A;  2F97 A;  3LBS A;  4IO7 A;  4PAF A;  4P1E A;  2VD3 A;  4HTG A;  4DXU A;  1LBB A;  4DLD A;  1URS A;  5I2K B;  3OO9 A;  1BTJ A;  1P99 A;  2DQV A;  2OZZ A;  3D1R A;  4GL8 A;  4AB5 A;  1IXH A;  1ZTY A;  1FBD A;  1NV0 A;  4EF2 A;  2RCA A;  5A5X B;  2Q88 A;  4P47 A;  3ECR A;  4Q8R A;  4ND9 A;  1IMD A;  3H6U A;  3K6V A;  4PET A;  5I84 A;  2QMX A;  3O29 A;  4GX4 A;  3OSR A;  2VT5 A;  2BJJ X;  2DXY A;  5ISU A;  1QJM A;  3AXF A;  5EQ7 A;  1Z7N E;  1A40 A;  3KGC A;  4OES A;  3M3F A;  2QVV A;  3MPK A;  1MQH A;  4X48 A;  2Q89 A;  4E0W A;  1FQD A;  1GTK A;  4I62 A;  2OWZ A;  4RA1 A;  3H3G A;  3IOW A;  1MQG A;  1YZ0 A;  2P0S A;  4PQJ A;  4KD5 A;  4JVC A;  2CZL A;  4LON B;  4HCW A;  2ZZV A;  3CR9 A;  1N7W A;  3OO6 A;  3QXM A;  1UQW A;  4XTC Q;  2CZK A;  4IGR A;  4FIM A;  3B7D A;  2ZNU A;  3MZB A;  3TQW A;  1JEU A;  1FQE A;  3KN3 A;  3IJO B;  2I0C A;  1A55 A;  5J1D A;  4KHZ E;  4WKM A;  3E79 A;  4GQO A;  2XX7 A;  4GOT A;  3R26 A;  4G4P A;  3CSG A;  1LAX A;  5FBP A;  4H5F A;  3SES A;  4OEU A;  4F39 A;  3JV9 A;  1B3G A;  1WDN A;  4XEQ A;  4NF0 A;  3N26 A;  2XWI A;  1ZLQ A;  4PDH A;  2Z8E A;  4MAG A;  4H0W A;  2UVG A;  4HXV A;  3CFZ A;  1DBZ A;  1UTH A;  5K2Y A;  1QUJ A;  1H44 A;  2AL5 A;  4HW8 A;  5TPA A;  5H8Q B;  1MQI A;  4OVQ A;  4PGP A;  2XXI A;  1LBC A;  1GR2 A;  1MG1 A;  1EU8 A;  5B70 A;  2VOZ A;  1RYX A;  2O1M A;  3GXA A;  1MH4 A;  3EF7 A;  1R6Z A;  3V83 A;  1TWY A;  5IZZ A;  3USD A;  1AIV A;  2Q74 A;  5EYH A;  3SEV A;  2Y7W A;  1NNF A;  3HV1 A;  5IAI A;  4XIG Q;  3DEL B;  3VXC A;  5FTI A;  4IO2 A;  1B3E A;  4R73 A;  1IMF A;  4QF9 A;  2AYS A;  1PDA A;  1FPF A;  3RYD A;  2XXK A;  1NV3 A;  4NMY A;  3U94 A;  1VDW A;  1LBW A;  4G68 A;  1I69 A;  3MJN A;  4XKN A;  3N6T A;  1NV7 A;  3ROJ A;  3A29 A;  1YTV A;  1ZU0 A;  3WAF A;  2B3F A;  4FBP A;  2UXA A;  4QFP A;  1XHY A;  1OMP A;  3EPE A;  3LV0 A;  5EQ8 A;  1JVX A;  3T9H B;  3KSJ A;  5DVI A;  4KXP A;  2YPN A;  3UP9 A;  1IXI A;  3MW0 A;  5DYH A;  3FVK A;  2XA5 A;  3KZG A;  4PE5 B;  3T22 A;  3O28 A;  1FTO A;  3C33 A;  1R1N A;  2XD2 A;  1HSJ A;  3M3K A;  2CZH A;  4I8C A;  5I58 B;  3CFL A;  3VV5 A;  3T9X B;  1Q35 A;  2F34 A;  1MXW A;  3G3G A;  3OD7 A;  5I2N B;  4MIJ A;  1IXC A;  4LZ8 A;  1YAE A;  2A5T B;  4PFW A;  4GWY A;  1NV2 A;  1FJ9 A;  5EYF A;  2WBD A;  2GQ1 A;  4PFI A;  1NV5 A;  3TCH A;  1B58 A;  1JVY A;  1QGX A;  3CI8 A;  1B6H A;  1FBE A;  1LFI A;  4GL0 A;  4PAK A;  1AH5 A;  3P7I A;  1Y4C A;  2R6G E;  5ITO A;  4PFY A;  1O63 A;  1DPP A;  4YZZ A;  2OWT A;  2DDK A;  3Q27 A;  5I2N A;  3OEK A;  2I49 A;  5I56 A;  4P3L A;  1MXY A;  4XXU A;  4F3P A;  1B32 A;  2FNC A;  3SER A;  3LR1 A;  4OYV A;  1URG A;  5DVF A;  4I3E A;  2E0S A;  2NXO A;  4U23 A;  4X1B A;  4TLM B;  3CG1 A;  2F7B A;  3VVE A;  2ZMB A;  4OZ9 A;  2F78 A;  1F9B A;  4OVT A;  3DP6 A;  1USY E;  1FW0 A;  2I0B A;  3O6G A;  2THI A;  5ET7 A;  4MH5 A;  4NF6 A;  3G3H A;  3FVG A;  4GWS A;  2GHA A;  3GZG A;  4NF4 A;  1G0I A;  4H1X A;  3HST A;  1NKX A;  2ZZW A;  4F19 A;  4YKK A;  3OEM A;  2ONK E;  2XXU A;  5L9M A;  2DE2 A;  2QS4 A;  3RGY A;  5ET6 A;  2PVU A;  3IAZ A;  4ISU A;  3GLB A;  4HCY A;  2HFB A;  3H6W A;  1ATG A;  1FCK A;  3T9V A;  3QSL A;  4X04 A;  1MY2 A;  2Y7I A;  2FIE A;  4MNC A;  5FTH A;  3PD8 A;  4XFE A;  2F5X A;  5IZ3 B;  4H67 A;  3B6T A;  5IM2 A;  3D4C A;  4R2F A;  3CRB A;  5B7D A;  2ABH A;  3H03 A;  2QS3 A;  5CBS A;  3ZS6 A;  1EYJ A;  1I6Q A;  4GWZ A;  1P1Q A;  4MMP A;  4NQ8 A;  2NWJ A;  4ZE9 A;  4MLQ A;  4BDN A;  2HZL A;  1Z7M E;  5EHM A;  5TPA B;  4AQ4 A;  1LAH E;  3OXN A;  5IKB A;  4MBP A;  4NWC A;  4EQB A;  1FPD A;  3RPW A;  1SI0 A;  3FGS A;  1Y3P A;  2R9J A;  1N3W A;  4OA4 A;  4MEV A;  1URD A;  3IL1 B;  3L6G A;  4GWX A;  1SQY A;  4N17 A;  3K6U A;  4P56 A;  4N4U A;  3A09 A;  2RCB A;  3KOS A;  4PAI A;  2DWA A;  2Q2A A;  1XT8 A;  1SW2 A;  2MKZ A;  4NF8 B;  5CRY A;  4FOR A;  2D5W A;  5AA2 D;  3S9M C;  4KQP A;  3VDF A;  1FPL A;  4C1T A;  4ZEI A;  1AWB A;  3SEW A;  1MQD A;  1B3F A;  3TQL A;  2OJT A;  4G61 A;  1RDZ A;  1UIV A;  2RC8 A;  1MQJ A;  4MCO A;  3FV2 A;  1MH3 A;  1IMA A;  4RYA A;  5CM6 A;  4ZDM A;  2A5S A;  2O84 X;  4I9D A;  2REJ A;  2LAO A;  2XXV A;  1CE2 A;  1NV4 A;  1B1H A;  4IO6 A;  4NTL A;  1LLS A;  1YCJ A;  4EDP A;  4FED A;  2OPE A;  4U1Z A;  5TP9 B;  1NV6 A;  4X8R A;  4OHN A;  3O9P A;  1USY H;  2HXR A;  3NOH A;  1B51 A;  3LSW A;  4R6Y A;  3RNN A;  2PYY A;  1O7T A;  4ELQ A;  3OMB A;  1ANF A;  4QSD A;  2F6G A;  1QW0 A;  4ZED A;  3PMV A;  5ET5 A;  3MVY A;  4PFT A;  2PT2 A;  1P1W A;  5H8H A;  2X7Q A;  2YJP A;  3TTL A;  3OEN A;  2F7A A;  5IGA A;  3T9U A;  2ONR A;  2XWK A;  1NH8 A;  3E4R A;  4UAC A;  3I5O A;  3TTK A;  1B9J A;  4YB5 A;  2H5Y A;  1B7H A;  1H45 A;  3C4M A;  1QUI A;  2ZNT A;  3U65 A;  3LUY A;  2NVU B;  5KCJ B;  4JXI A;  2Y84 A;  2I48 A;  1FQB A;  3FJ7 A;  2Q8J A;  4OET A;  4PDD A;  1NH7 A;  3PUW E;  4ESX A;  2XX9 A;  1YPN A;  3RY3 A;  5I57 A;  2P3N A;  4OQO A;  4O3A A;  5CMB A;  1XI6 A;  4P11 A;  2R71 A;  3CSB A;  1H3D A;  4YKI A;  2ANJ A;  1IMC A;  2DVC A;  4XF5 A;  3G3I A;  4NX1 A;  4NWD A;  4MNP A;  1RDX A;  5EQA A;  1VSO A;  1LCT A;  3E9X A;  4O7M A;  3MZ1 A;  3V8X B;  1NNP A;  1IME A;  1HSE A;  1LAG E;  1BK4 A;  4JB7 A;  4PGN A;  4O3C A;  1DK4 A;  3PPR A;  1B40 A;  1JQF A;  3ILT B;  1M5F A;  1MPB A;  1MS7 A;  4H8I A;  4G8M A;  3QYT A;  5AA2 B;  2O6A A;  4IO5 A;  4BDL A;  3FXR A;  1BIY A;  2QSX A;  1LBV A;  1MY4 A;  2RC9 A;  4WEP A;  1SBP A;  3GBB A;  4GX3 A;  3IJX B;  4LQ5 A;  4YIC A;  3SKP A;  3MZ9 A;  2QFL A;  4JDF A;  3FJM A;  3E13 X;  5T3J A;  3U1O A;  1B1X A;  5IZ3 A;  1SD3 A;  5HM4 B;  3RTF B;  1B5I A;  2D21 A;  2WYP A;  1N0T A;  4GD5 A;  4F2O A;  3BIG A;  3T1B A;  2NUV A;  4OVJ A;  3TEL A;  3KSX A;  4LUB A;  4UA8 A;  3Q28 A;  1XC1 A;  4QSE A;  3K02 A;  1DPE A;  2WKY A;  3IO6 A;  4FAT A;  1LST A;  1B7U A;  1Q9D A;  4PBQ A;  2UYE A;  1B2H A;  2H4I A;  3CVG A;  4GXA A;  5F7V A;  2UVI A;  2O69 A;  3JZJ A;  3PU5 A;  4RY1 A;  1B4H A;  1A99 A;  1K9Y A;  2QS2 A;  4THI A;  3SET A;  4R72 A;  2Q2C A;  1FBC A;  1TFD A;  4GWO A;  3RLF E;  3A3C A;  1DCU A;  4OTE A;  1QUK A;  3TDJ A;  4IR8 A;  4YMB A;  1BP5 A;  1J1N A;  5KDT B;  1VFE A;  3T96 B;  5AA4 B;  1G0H A;  4Q5T A;  2FHY A;  4N91 A;  4ZS9 A;  3R6U A;  3IFC A;  2WX9 A;  5JEI A;  1N04 A;  3KBZ A;  2QMW A;  2HXW A;  3MVW A;  1SYH A;  4PCD A;  2QVU A;  3K1N A;  4M1V A;  2E1S A;  4F1Y A;  3IX1 A;  3KN8 A;  3VFJ A;  2M8C A;  1N7X A;  4IO4 A;  2RF1 A;  1NNK A;  2HZK A;  3TTM A;  3EQ1 A;  1TXF A;  2KQZ A;  1B0L A;  2V3T A;  3FJG A;  4HE2 A;  3TPA A;  3PUZ E;  5CC2 A;  3N94 A;  3MUQ A;  4P0I A;  4DXC A;  4NF5 B;  1OLA A;  3GYY A;  3MQ9 A;  4NAP A;  3E3K A;  4EUO A;  2XXY A;  2V84 A;  3EN3 A;  1N76 A;  4R74 A;  5LDZ A;  1OVB A;  3GBA A;  4X1D A;  3S9L C;  2REG A;  3TZA A;  2DXR A;  4ELR A;  4OFJ A;  1OQG A;  2H25 A;  5M2V A;  1P1U A;  2XXR A;  1QKB A;  1H76 A;  2DOJ A;  2ZYK A;  3MPL A;  1N84 A;  2XXW A;  4L17 A;  4R9G A;  2VHA A;  5KCJ A;  4E0X A;  2D3I A;  1M5B A;  2V93 A;  1INP A;  4NF5 A;  2F8D A;  4QFN A;  4HE0 A;  3IOU A;  1B3H A;  2JJK A;  1Y1M A;  2PFZ A;  4ZEC A;  4N6D A;  4G2Z A;  2FVZ A;  3T0J A;  5BUU A;  4EQ9 A;  1R9L A;  1MRP A;  1DSN A;  3LSF B;  2OBG A;  2PBW A;  1ZKB A;  4F3G A;  3RPL A;  2I58 A;  4RJZ A;  1L5T A;  1SW1 A;  5CMC A;  4Z7E A;  4JVD A;  3SZP A;  1IQ7 A;  1DMB A;  4U22 A;  3PPN A;  3G7W A;  1FPE A;  3TMG A;  4F29 A;  3C9H A;  4TLL B;  4EF1 A;  3FXU A;  2FIX A;  4FAJ A;  4M4G A;  4H5G A;  3PUV E;  1WVJ A;  1LEV A;  3VLW A;  1H43 A;  4NHB A;  4H6D A;  4G68 C;  2IA4 A;  4LAT A;  1FPJ A;  1EYI A;  2XX8 A;  1GVC A;  3KC1 A;  1M5D A;  1XVY A;  4P8B A;  2ZNS A;  3G3K A;  1OIB A;  2UVH A;  1IZ1 A;  1NUZ A;  1LCF A;  1US4 A;  5ELV A;  3B8B A;  1LBX A;  4LQ2 A;  1A7L A;  4LVQ A;  2I4C A;  3HO7 A;  1D4N A;  1EZ9 A;  2GRV A;  4YKJ A;  2Z23 A;  4AS5 A;  3C35 A;  3IB0 A;  2ONS A;  4NED A;  1I6B A;  2I4B A;  3FUZ A;  4ELP A;  4WXJ A;  3V5A A;  1SPI A;  2CEY A;  3N5L A;  3TYH A;  3KFM A;  4PF8 A;  1JNF A;  4R75 A;  3C31 A;  4NGU A;  3LSL A;  4OWD A;  3WAE A;  1IIT A;  3OO8 A;  2HAU A;  1POT A;  3O6H A;  4Z0I A;  5ICQ A;  2NOO A;  4EXL A;  4O7I A;  4PC9 A;  1KA1 A;  1MXV A;  3IOR A;  1UTB A;  2FA7 A;  1LB9 A;  4G8N A;  2AL4 A;  4JWY A;  2PCR A;  1AL3 A;  1NV1 A;  1OQH A;  2RKM A;  4GBV A;  1VR5 A;  4GLI A;  4I40 A;  1I6A A;  3PV0 E;  3FIR A;  1B0H A;  1M5C A;  3H4Z A;  4RK2 A;  1JW5 A;  3IB2 A;  2GFE A;  5ET8 A;  1ZIU A;  5ESY A;  5H8S A;  3DM0 A;  3MVZ A;  3PMX A;  3KOT A;  3HHF A;  5JK4 A;  5ICT A;  4BDO A;  3D4G A;  5JTY B;  4F3B A;  3MC2 A;  2UVJ A;  3RUM A;  3FXQ A;  4LZ5 A;  2XWO A;  4PFB A;  1FPB A;  3KJ7 A;  1B7Z A;  1PBQ A;  5KZT A;  2I6E A;  5I3S A;  3IOV A;  3PMW A;  3K0V A;  4DI3 D;  1ELJ A;  3KBR A;  3B6Q A;  3QIM A;  3UGW A;  3O66 A;  2H9B A;  3MP1 A;  4YAH X;  4TQU Q;  3MST A;  5AA2 A;  3G3J A;  3K1P A;  3RTW B;  1S50 A;  1JW4 A;  5EYG A;  3HFU A;  4LA9 A;  3T66 A;  3ISP A;  3BBR A;  4PFU A;  4QBA A;  3CHG A;  5F1Q A;  4H46 A;  2PX1 A;  2QPQ A;  4K3F A;  1MPC A;  4OER A;  1FPK A;  4DCX A;  3K01 A;  1JEV A;  4JWO A;  3ZKK A;  4GBW A;  3S2V A;  3OSQ A;  4DZ1 A;  2DE4 A;  4AS4 A;  4N15 A;  4Q30 B;  2CEX A;  1EZP A;  2X7P A;  3THI A;  1K9Z A;  2F35 A;  4FE8 A;  3SEU A;  4NF8 A;  4ONY A;  4RNS A;  3BIH A;  3A3U A;  1B5J A;  3JYR A;  1IIW A;  4P1L A;  1FTJ A;  4RPN A;  1FTA A;  2WEF A;  1N3X A;  4R6H A;  4LN5 A;  3CG3 A;  5HPQ A;  5DEX B;  1MY1 A;  1Y3N A;  5BWJ A;  2PMS A;  4ZEB A;  1US5 A;  2DWJ A;  1NMU A;  3MP8 A;  1B3L A;  4OVP A;  3DP8 A;  1WOD A;  4N8Y A;  2A5T A;  4PTK A;  3UN6 A;  1MM7 A;  4R6K A;  3W9W A;  2OK2 A;  4DXB A;  4F18 A;  5AA1 A;  2CZI A;  1RYO A;  3K6X A;  4X9T A;  4MNI A;  5AE4 A;  4R9F A;  2QRY A;  2ZYM A;  1POY 1;  3C32 A;  1LBZ A;  2XXX A;  4I1D A;  5I2K A;  3M3L A;  3HHG A;  1MPD A;  3G3F A;  4DE8 A;  3HN0 A;  4ESW A;  3DP4 A;  3K6W A;  3T93 B;  4NF4 B;  1FJ6 A;  3F11 A;  1FTL A;  3I6V A;  1A8E A;  3QUF A;  4OXV A;  4YMA A;  4QFK A;  2DVZ A;  4U4X A;  1Y9U A;  2VGQ A;  4F1U A;  4FEC A;  1DTZ A;  1NL5 A;  4BLA A;  4QFL A;  3KC0 A;  3FXB A;  3S9N C;  1LFG A;  4N6K A;  4GWU A;  2L5V A;  2XXT A;  3VXB A;  3HCQ A;  1P1N A;  2DS9 A;  3U8Q A;  3MWB A;  2XXH A;  3FAT A;  4KI0 E;  3I3V A;  5H8F B;  4U1O A;  2HPG A;  2V25 A;  4JVI A;  2R8T A;  3IK6 B;  1Y4T A;  3UA8 A;  5L9S A;  4OFL A;  4KFQ A;  4KCC A;  3KG2 A;  1SW5 A;  1LFH A;  3LSX A;  4OVR A;  1UTB B;  1BKA A;  2OPD A;  3B50 A;  2G93 A;  4O3B A;  1FBH A;  1PB7 A;  5LTC A;  1SYI A;  1AOV A;  2Y7P A;  4RK9 A;  1FTK A;  5I56 B;  1PC3 A;  1NFT A;  3M8U A;  4PP0 A;  1DTG A;  3MBP A;  4G8H A;  1QVS A;  5CMM A;  2XHD A;  2DE3 A;  4IY6 A;  2O1L A;  3K00 A;  3PPO A;  2OX3 A;  3BFT A;  2VD2 A;  4P0G A;  1FBG A;  1JW1 A;  1S7Y A;  2F7C A;  4QSC A;  2H99 A;  1IEJ A;  4H8J A;  3LUZ A;  4MJO A;  3DLN A;  5DVJ A;  4OEN A;  4GIZ A;  3FBP A;  1NUW A;  3S9E A;  5DTB A;  1XS5 A;  5I7I A;  3TUS A;  1GV8 A;  3UK4 A;  3CFX A;  4XKQ A;  2Z8F A;  5FHM A;  3MP6 A;  2PT1 A;  1B05 A;  2HAV A;  2DSF A;  1JET A;  4IY5 A;  2DWH A;  3W15 C;  3PGF A;  2Y5K A;  5L8D A;  1MDP 1;  3K4U A;  4JSO A;  1P1O A;  5FHO A;  2RC7 A;  3VLV A;  5JTY A;  4TOZ A;  4KCD A;  3LC8 A;  3U93 A;  4F1V A;  2Q9T A;  4F2Q A;  5F24 A;  3VVD A;  2BJI A;  3IB1 A;  3PPQ A; 
#chains in the Genus database with same CATH homology
 1CNQ A;  5ESY A;  2KQZ A;  1FBH A;  1IMB A;  1NV7 A;  3ROJ A;  5LTC A;  3A29 A;  4NHB A;  4PAF A;  1FSA A;  3U65 A;  4N17 A;  5JK4 A;  4P1E A;  4FBP A;  4P56 A;  4N4U A;  2B4L A;  4HE2 A;  4OVP A;  1FPJ A;  1EYI A;  4N81 A;  5J1D A;  3QMF A;  3E79 A;  3KC1 A;  4N8Y A;  4PAI A;  1FPI A;  4P9K A;  3LV0 A;  5EQ8 A;  4P8B A;  4PTK A;  2XWO A;  1Q9D A;  5A5L A;  2XWV A;  1FPB A;  3GYY A;  4N8G A;  4NAP A;  4KXP A;  4PBQ A;  1JP4 A;  4PFB A;  5ET7 A;  3W9W A;  1NUZ A;  2FBP A;  4GWS A;  2MKZ A;  1RDY A;  1FPG A;  5FBP A;  4OAN A;  4F18 A;  3B8B A;  1LBX A;  5LDZ A;  3IFA A;  5I3S A;  3E78 A;  2CZI A;  1G0I A;  3D1R A;  4PDD A;  2XA5 A;  1FPL A;  1KA0 A;  4X9T A;  2V3Q A;  4MNI A;  4PF6 A;  2ZZW A;  4XEQ A;  1AWB A;  3MYU A;  4DI3 D;  4DI4 B;  1K9Y A;  4MHF A;  4AS5 A;  4NF0 A;  4PBH A;  4F19 A;  2P3N A;  1FBD A;  1NV0 A;  3T1B A;  2CZH A;  2XWI A;  2Y5L A;  4PDH A;  4MAG A;  2B4M A;  2DE3 A;  1XI6 A;  2DE2 A;  5ET6 A;  4HXV A;  2VPN A;  4P47 A;  4G61 A;  1LBZ A;  1IMD A;  1FRP A;  1RDZ A;  4PET A;  1FBC A;  1DBZ A;  4HCY A;  1NUY A;  4MCO A;  1IMC A;  1YXI A;  2ZZX A;  2OX3 A;  2WBB A;  4O94 A;  4XF5 A;  1IMA A;  3MST A;  4GX4 A;  5CM6 A;  1DCU A;  1SPI A;  2CEY A;  2Q8M A;  4NX1 A;  4GWW A;  1FBG A;  4PE3 A;  4MNP A;  4MIJ A;  5EYG A;  1RDX A;  5EQA A;  1INP A;  1FJ6 A;  2VT5 A;  3LUZ A;  4IR8 A;  4MJO A;  3HFU A;  4OVQ A;  4PGP A;  4X04 A;  5DW8 A;  3RPL B;  4O7M A;  4HE0 A;  1NV4 A;  1FBP A;  3FBP A;  2DVZ A;  4PF8 A;  2JJK A;  5EQ7 A;  2FIE A;  2PFZ A;  3ISP A;  1IME A;  4MNC A;  1NUX A;  4NGU A;  4GWY A;  4OVS A;  4XFE A;  4F1U A;  1G0H A;  2F5X A;  1NUW A;  1NV2 A;  5IZ3 B;  4N6D A;  1BK4 A;  1FJ9 A;  1NI9 A;  2FVZ A;  3CHG A;  4PGN A;  4QBA A;  1DK4 A;  4H46 A;  5I7I A;  2FHY A;  2WBD A;  1LBY A;  2QVV A;  4N91 A;  2GQ1 A;  3T0J A;  2QPQ A;  3PTY A;  1FPK A;  4PFI A;  1NV6 A;  4X8R A;  5IM2 A;  1NV5 A;  2P3V A;  3KC0 A;  3FXB A;  1YYZ A;  5IZ1 A;  1QGX A;  4N6K A;  4GBW A;  4GWU A;  3IFC A;  4H45 A;  4O7I A;  1EYK A;  1FBE A;  2L5V A;  4O8M A;  4PC9 A;  2PFY A;  2HXR A;  2WX9 A;  3NOH A;  1KA1 A;  4PAK A;  5IZZ A;  2Q74 A;  4HE1 A;  5EYH A;  1EYJ A;  4GWZ A;  5EQ9 A;  3KBZ A;  4GX6 A;  2DE4 A;  2OWZ A;  1KZ8 A;  4MMP A;  4UAB A;  2Y5K A;  5I5P A;  4AS4 A;  4NQ8 A;  4N15 A;  2HHM A;  4PFR A;  1LBV A;  3RPL A;  4PCD A;  2CEX A;  4YZZ A;  1YZ0 A;  2QVU A;  2PCR A;  2HZL A;  2DDK A;  3EKI A;  3W9V A;  4GX3 A;  5ET5 A;  1NV1 A;  2VPO A;  5J16 A;  1K9Z A;  4M1V A;  2HPG A;  1D9Q A;  2QVR A;  4YIC A;  4GBV A;  1IMF A;  4JVI A;  4P3L A;  4MX6 A;  2QFL A;  3BIH A;  4JVD A;  2R8T A;  2V4C A;  4OVT A;  3SZP A;  1FPF A;  4JVC A;  4I40 A;  3RYD A;  1FBF A;  4I3Y A;  2XXK A;  5T3J A;  5IGA A;  2KR0 A;  1NV3 A;  1FPE A;  1FPD A;  4HCW A;  1VDW A;  1LBW A;  4NN3 A;  4P1L A;  4I3E A;  5IZ3 A;  2XWK A;  2ZZV A;  2Q9T A;  4QXD A;  2FIX A;  4F1V A;  1FTA A;  2WYP A;  4OA4 A;  2WEF A;  2WYK A;  4MEV A;  4NG7 A;  5F24 A;  2HZK A;  4LN5 A;  4OVR A;  2BJI A;  2F3B A;  1LEV A;  2CZK A;  4GWX A;  2F3D A;  3B50 A;  5ET8 A;  3BIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...