1LBWA

Crystal structure of apo-form (p32) of dual activity fbpase/impase (af2372) from archaeoglobus fulgidus
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
252
structure length
252
Chain Sequence
MDERDALRISREIAGEVRKAIASMPLRERVKDVGMGKDGTPTKAADRVAEDAALEILRKERVTVVTEESGVLGEGDVFVALDPLDGTFNATRGIPVYSVSLCFSYSDKLKDAFFGYVYNLATGDEYYADSSGAYRNGERIEVSDAEELYCNAIIYYPDRKFPFKRMRIFGSAATELCFFADGSFDCFLDIRPGKMLRIYDAAAGVFIAEKAGGKVTELDGESLGNKKFDMQERLNIVAANEKLHPKLLELIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a dual activity IMPase/FBPase (AF2372) from Archaeoglobus fulgidus. The story of a mobile loop.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
molecule keywords fructose 1,6-bisphosphatase/inositol monophosphatase
total genus 87
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2002-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1lbwA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1lbwA02
1NV6A 1G0HA 3ROJA 5FBPA 2OX3A 1NUYA 3D1RA 2Q74A 1EYJA 3LV0A 2FHYA 2FIEA 4GX6A 1FBPA 4H45A 2F3BA 1FJ9A 1INPA 1FRPA 3IFAA 5I3SA 4HE0A 1QGXA 2QVUA 4I3YA 2CZKA 2QFLA 2JJKA 1IMAA 3KC1A 2R8TA 1RDZA 1RDXA 5EQ7A 5EQAA 4H46A 1DK4A 1RDYA 1K9ZA 5EYHA 4I40A 5LDZA 3QMFA 4GWSA 2FIXA 4HE1A 1NI9A 2QVRA 2Y5LA 1LBZA 2VT5A 2WBBA 1YYZA 4GWXA 4GX3A 5EQ9A 1FBEA 1G0IA 1NUWA 1FBHA 5ET5A 1FPBA 1BK4A 2P3VA 1SPIA 5ET6A 4GX4A 1FBDA 1FPGA 3FBPA 4FBPA 1JP4A 4MJOA 1Q9DA 1VDWA 1NV0A 1LBVA 1EYIA 1DBZA 1LEVA 1LBWA 1LBYA 2BJIA 1NV1A 1NV7A 3KBZA 4GBVA 2HHMA 1IMCA 4PTKA 4IR8A 4GWUA 2FBPA 4HXVA 4GWYA 3IFCA 4AS4A 1FPDA 3RYDA 1NV2A 5DW8A 4O7IA 5ESYA 3RPLA 1NUZA 1NV5A 1FBGA 4KXPA 5IZ3A 1FPEA 1IMDA 3KC0A 2GQ1A 3T0JA 1LBXA 2OWZA 1KA0A 5EQ8A 1FPJA 5F24A 1FJ6A 1FPFA 1YXIA 1NV3A 4GWWA 1CNQA 1IMEA 1EYKA 1AWBA 1FSAA 5IZ3B 3LUZA 4I3EA 5IZ1A 3A29A 1FPKA 3BIHA 1FBFA 1NUXA 2WEFA 3B8BA 2CZIA 4GWZA 1FPLA 1NV4A 2Q8MA 2P3NA 2DDKA 1IMFA 1FBCA 4N81A 2CZHA 4HE2A 4QXDA 5T3JA 1YZ0A 1IMBA 2FVZA 1DCUA 4GBWA 1K9YA 5ET7A 1XI6A 1FTAA 2PCRA 2Y5KA 1KA1A 4G61A 2F3DA 5ET8A 2QVVA 5A5LA 1D9QA 3BIGA 5J16A 3RPLB 1KZ8A 1FPIA 5EYGA 4AS5A 2WBDA
chains in the Genus database with same CATH superfamily
2Y7WA 4GVOA 1G0HA 2HQ0A 4KI0E 1MG1A 3TODA 4H67A 3LV0A 2FHYA 3K6WA 1QJMA 1N0TA 3TUSA 3R7XA 5KZTA 2GHAA 1IXCA 1OIBA 1B58A 3PMVA 2WX9A 1RDXA 4GOTA 5F7VA 3CVGA 3PUZE 2AYSA 3D4CA 4DLDA 1TXFA 4NQ8A 1JEUA 1OLAA 5EYFA 3K2DA 4IO5A 2IA4A 1SVXB 5TU0A 1M5DA 4JSOA 4N17A 2DP8A 2R6GE 3MPLA 5AA1A 4OVRA 2ZYNA 1RYXA 1P1QA 1TFDA 3TZAA 3CHGA 2KQZA 4HXVA 3KOSA 3IFCA 1H45A 2XD3A 3RPLA 3N6UA 3PPRA 1B32A 4O3BA 4PAIA 1FTOA 4G4PA 2QS1A 1FJ6A 4GF8A 1US4A 3THIA 4JXIA 1IZ1A 5DTBA 2Z22A 4EXKA 2MKZA 4PC9A 2WEFA 4DE8A 5I59B 4EF2A 1NV4A 3UK4A 2GRVA 5I7IA 4Q8RA 2XX8A 3RUMA 1FBCA 3GLBA 1XHYA 4PFUA 3KGCA 4LVQA 4JSDA 5ITPA 2VP1A 1ZTYA 4KFQA 4XF5A 4GBWA 4NF5B 2I6EA 3L6GA 1ELJA 4U1OA 4KCDA 3S9EA 4QFKA 5J1DA 2WBDA 4ZEBA 2I48A 2V4CA 4N6KA 1MDQA 1F9BA 2XXXA 3IORA 4R9FA 4H45A 1FJ9A 1FRPA 2HCAA 1UTHB 4RXLA 1PBQA 4POXA 2O51A 2UVJA 3G3JA 2H9BA 4OFJA 2F7AA 1GVCA 3H3GA 1NKXA 3TTRA 5H8NA 2I0CA 1Y4CA 4FEBA 5I84A 1B7UA 4MH5A 4F2QA 1BK4A 2HXWA 3LSLA 1FBDA 4F2OA 2ZYOA 3FV1A 1NV0A 1VFDA 2OPDA 3C36A 3FXUA 1IMCA 4P9KA 3ISPA 1MXXA 1FQAA 1NV2A 1DTZA 4PF6A 4X1DA 4N07A 4ESXA 4DI4B 3ZKLA 3IJOB 3FJ7A 3V8XB 3A3UA 3MQ9A 1FQEA 3BKIB 4K3FA 3O9PA 4R6HA 4BDOA 1LSTA 2YLNA 5ISUA 5F1QA 3LBSA 4DZ1A 1FBFA 1NUXA 3PPNA 2FNCA 4I1DA 3MP1A 1B0HA 5ITOA 5K2XA 1AMFA 3VFJA 1FTAA 2ESNA 1IUDA 1MY2A 2ZXTA 4KR5A 3QK6A 4LATA 1KZ8A 2RCAA 4IY6A 5FTHA 4X04A 2Q74A 1WDNA 4GRKA 1DSNA 2FA7A 3K4UA 3IK6B 4P47A 3VVDA 2JJKA 4P56A 2DS9A 1DK4A 4PFWA 5FHNA 4U1ZA 1MY4A 5DVJA 5BUUA 3KN7A 4QF9A 1M5EA 1YAEA 4GWXA 2Z8FA 3UA8A 2OWTA 1B9JA 2VOZA 4FEDA 1LEVA 2KR0A 1LBWA 1LBYA 2B3FA 2FYIA 1PB7A 3Q25A 4AS4A 4O94A 1Q35A 2PBWA 4DCYA 4OVSA 2UVGA 3WAFA 3FVGA 5DYHA 2Q2AA 3K6XA 2XHDA 2BJJX 3V83A 1EU8A 2F7BA 2B3BA 4UABA 4JWYA 2HFBA 3E79A 1XVYA 3ILTB 1MXUA 3BBRA 4F1YA 4HCWA 1SI1A 2QMWA 2UVIA 3CFLA 2O6AA 3G3KA 3TTLA 1OLCA 4H5FA 2CEYA 4YKPA 4EDPA 1CE2A 1SBPA 1SYIA 4BDLA 4YAHX 3C32A 5K2YA 2O7IA 1B7HA 5TPAB 1A7LA 2QS3A 2I58A 5EYGA 3UIFA 2V25A 3D1RA 4YU0A 4WKMA 3K01A 1O64A 4EXLA 2FIEA 3HN0A 1MH4A 1T0KA 3Q28A 1FTMA 4F3GA 2XXUA 4PETA 1MS7A 3C4MA 3W9WA 1N7WA 1RDZA 3MP8A 2ZZXA 4BDQA 4OENA 2Q9TA 1B3HA 3OO7A 5CMBA 4UA8A 1POY1 1FQFA 4OHNA 1O63A 2XXVA 2ZZVA 1B5IA 1LBVA 3KBZA 2NXOA 4GXSB 4IO3A 4PFBA 1Z7NE 4I62A 4ZEFA 3LSXA 2XX9A 3QSLA 3TCGA 4O7IA 4RY1A 4ZDMA 1FTJA 3MVZA 4LP2B 3Q27A 1AH5A 5LTCA 1JW1A 4IB2A 4UACA 3SETA 2F6PA 4M1VA 3FXBA 3BIHA 4NF6B 3O6IA 5I5PA 2P3NA 5AA2D 4GL0A 2ONSA 4NF4B 5H8HB 4F18A 5CBSA 4GL8A 4GXAA 3RLFE 4P0GA 4MAGA 3O6GA 4ZEDA 1IXGA 1CB6A 4KYDA 3IL1B 4PFIA 1SW1A 3MZ1A 3T93B 4LZ5A 3P7IA 3B6QA 1VSOA 1B3GA 4H0WA 2Y7RA 3C9HA 2Y84A 1IEJA 1LCTA 1UTBB 2H4IA 5EQ9A 2XD2A 2P2AA 3H7MA 1Y20A 1ZMGA 4XIGQ 2OBGA 1FBHA 1SW2A 3QAXA 2D3IA 1OMPA 4KCCA 4PGNA 4HTGA 5AA4B 3OELA 1EYIA 2XXWA 3SEWA 2VHAA 4GWUA 4PFTA 4R6YA 3WAEA 4GFRA 3UGWA 4FIMA 4PE5B 1H76A 2IEEA 3K1PA 1YTVA 3RT6B 4DDDA 2ZYKA 3FD3A 4MFIA 4WXJA 2XXTA 3RGYA 1YXIA 1QVSA 1JW5A 4BDNA 1UIUA 1AWBA 1FSAA 2O68A 4OVJA 5CBRA 4KYSA 5IZ1A 3IOTA 3I3VA 2CZIA 4AB6A 4U22A 2OZZA 1BTJA 1AOVA 1TFAA 1LCFA 1YZ0A 4XKNA 1DTGA 1MXZA 2O7UA 5DVFA 5L9OA 5KDTA 3Q26A 4OXVA 2XXYA 4GLIA 4PP0A 4RA1A 4DXCA 3E3KA 3RPWA 3IJXB 3U1OA 3EN3A 2F3BA 5H8QB 3PMWA 5FHMA 4EUOA 1PBPA 2F35A 5I58A 1SYHA 2Y7IA 3C35A 3ECRA 4X1BA 1B4ZA 4IO4A 2WYKA 1R9QA 1B3FA 4I40A 4GWSA 3ZKKA 3MC2A 5I58B 2P0SA 3KOTA 4X48A 3MWBA 2PX1A 1FBEA 1B1HA 2RKMA 5HM4B 2QPQA 1NNPA 3IX1A 2QJEA 2QL3A 2NUVA 3T66A 1NV1A 1PB9A 4ZEKA 5B70A 3RN8A 3MPKA 1BKAA 1SI0A 4H8JA 4RJZA 3H06B 4G68C 1D9VA 1US5A 4IY5A 1B5JA 3MJNA 4M4GA 3KC0A 4P11A 1USYH 3T0JA 5KCJA 4PQJA 4XKPA 1NNKA 4N6DA 3TELA 5CMKA 1LBBA 3FIRA 1CNQA 4E0WA 5JTYA 4TQUQ 3KG2A 1VR5A 3FXRA 1FPKA 4N15A 1SW5A 3C33A 3T9VA 4G8HA 3M8UA 2ZZWA 2DVCA 4HCYA 5FHOA 3S9NC 1XI6A 4ZE8A 3CSBA 1QKBA 2F5XA 4ZEIA 2W7YA 1QW0A 4P1LA 3MP6A 2O1LA 4XKQA 2WYPA 2H99A 3G3HA 2XWOA 4O3CA 4NWCA 4XFEA 2QVUA 3KSJA 2O84X 1ZJLA 3T1BA 4RK2A 1UQWA 5I56A 1GGGA 1B05A 2OWSA 3CRBA 3K00A 3O6HA 2WKYA 4MMPA 3MVWA 4QFNA 3TMGA 3QUFA 3DP4A 4G8MA 1FQBA 3CG1A 1G0IA 1P99A 2F78A 2O1MA 4NE4A 3PV0E 3KSXA 4GX4A 5A5XB 4MJOA 3FBPA 1JP4A 2HZLA 2QRYA 5AA4A 4GWYA 4XEQA 4Z7EA 5I2NB 5DW8A 4YICA 3U93A 1NUZA 4H65A 4R9GA 2RCBA 5AE4A 1JQFA 3S9MC 4ZZAA 3KFMA 1DOTA 3VXCA 4NF6A 4N13A 3TPAA 3MAMA 2XXPA 5CM6A 4YKKA 1AIVA 4PE3A 3B8BA 1H3DA 4NX1A 2HEUA 4N81A 2ONKE 4PFRA 3R26A 4U21A 3H03A 1ZBMA 2B65A 4Q30B 5IM2A 4EF1A 4R2BA 1JVYA 1D9QA 3TQWA 3C31A 1NV6A 3ROJA 4NWDA 1MPDA 2PT1A 2DE4A 1ATGA 4OWDA 3TTKA 2R71A 4THIA 3OOAA 2QMXA 1MY0A 1N04A 3PU5A 3T9HB 5I56B 4I9DA 4Q0CA 3OO6A 1K9ZA 3QMFA 4YZZA 2FIXA 4DCXA 2XXRA 3U65A 2A5TA 2Y7PA 2XWIA 4GX3A 2P1SA 1NUWA 1Y9UA 4C1UA 3ONMA 2RINA 4NHBA 2XXQA 3IOVA 4DXBA 1RYOA 3AXFA 3IOWA 2X7QA 1QUIA 2GH9A 4Q5TA 3GBAA 4OZ9A 1GV8A 1URSA 1ANFA 5TPAA 1MQIA 4N8GA 3N6TA 1ZU0A 1XS5A 1NV5A 3TTNA 1MQDA 5IAIA 4FORA 1JVXA 4MBPA 1SD3A 1IMEA 2NWJA 5IZ3B 4P3LA 3CFXA 2F97A 1Y3QA 3EHTA 3K1NA 3VDFA 3S9LC 2DVZA 1YCJA 4LQ5A 1A8EA 3VLUA 3HHGA 2A5SA 1S50A 3KZGA 2REGA 3VXBA 2Y5KA 3TCFA 3F11A 1B4HA 4GIZA 5A5LA 4U4XA 3T9UA 4LQ2A 1LFHA 1N7XA 2XA5A 4WEPA 1IITA 4ISUA 4NTLA 3U94A 1NH7A 1NMUA 4L17A 3IFAA 4HW8A 4XTCQ 2I49A 4PAFA 5DEXA 3NOHA 2HAUA 3KC1A 5A5XA 5H8SA 3DP6A 3TQLA 4FJPA 2L5VA 3TTMA 2G93A 3HHFA 2QVRA 2Y5LA 1R1NA 1UTBA 3OMBA 4FECA 1YYZA 5AA3A 4FE8A 2CEXA 2F7CA 4U4SA 1HSLA 3FVNA 2OPEA 1AL3A 2V93A 5AA2A 3GYYA 4MX6A 2V3TA 1VDWA 3LSFB 4IO2A 2BJIA 4IR8A 4F39A 5I2KA 3SEYA 1IQ7A 2RC8A 4MIJA 4NG7A 3CI8A 5ESYA 3VVFA 2PT2A 1S7YA 3TEPA 1LB8A 3SEXA 2GQ1A 2XX7A 4MCOA 1P1OA 4JB7A 3CFZA 3MVXA 2Q8MA 2I3VA 3PUXE 1PDAA 1SDXA 3MZ9A 2RF1A 2OCUA 1B52A 1R6ZA 4O8MA 4NF0A 4N8YA 1UIVA 4P0IA 3PUVE 3RTWB 2F3DA 4QFLA 4QBAA 1B3EA 4JVIA 1MQHA 1FTKA 4IO6A 3IOUA 2QS4A 1LAXA 2AIXA 3E78A 4GX6A 3ZSFA 4R75A 3KJ7A 3FJMA 1ZKBA 3IB0A 1RDYA 4JDFA 4F31B 1DPPA 3M3KA 3O29A 3ILUB 3JYRA 4PAKA 3A3CA 4RPOA 4F3BA 2WBBA 1LFGA 3SEUA 1LB9A 3KBRA 3GXAA 1MPCA 4O7MA 3IO6A 5JEIA 1Q9DA 3OO8A 4DXUA 1DBZA 1MPBA 1IXHA 1YPNA 5DVIA 1NV7A 4OEUA 3QUJA 3ODBA 5TP9A 2QSXA 3UP9A 3PGFA 3T96B 4G8NA 3FJGA 2I4CA 3MYUA 4N6PA 2PFZA 5EHSA 3IB1A 3PPQA 4I8CA 1FBGA 5CMMA 1IMDA 2PYYA 4NN3A 3HCQA 5H8QA 3HO7A 3CG3A 1ZLQA 4H5GA 4GWWA 2CMOA 2B4LA 1NH8A 4IGTA 1H43A 2VPNA 4ELPA 3FZVA 5CC2A 2OLBA 3K1MA 4EQ7A 4LZ8A 3G7WA 3HFUA 1OVTA 2ABHA 1B3LA 4LONB 2CZLA 4ZS9A 5EHMA 4X8RA 1HSJA 5FBPA 3RQTA 3FASA 1P1NA 4RYAA 1MXVA 3U8QA 4OMBA 1EYJA 1Y4TA 4OA4A 4YB5A 5L9MA 4F1VA 3MW0A 4O3AA 2XXKA 3TFLA 4MNIA 1N3XA 3O66A 1LLSA 3U92A 5EQAA 4ZZEA 3GBBA 1D9YA 1RKMA 3IB2A 1M5BA 4JWXA 5LDZA 3IO4A 1NNTA 3TCHA 1FPBA 2R9JA 4G77A 1SPIA 4FATA 2ONRA 4GBVA 1DMBA 3MSTA 2Q88A 3M3FA 3BFUA 4OVPA 3QXMA 4OVQA 3I5OA 1KWHA 4KXPA 3T22A 1DPEA 1LBXA 3OSRA 4ELOA 4H8IA 3SZPA 3QYTA 1XC1A 2DE3A 1Y1MA 3H6VA 4NF4A 5H8HA 3GZGA 4R74A 4DIGA 3OO9A 5ICQA 2DDKA 4KHZE 2H98A 4HE2A 5CMCA 1N84A 2HXRA 3MBPA 1LAGE 4YB7A 1DCUA 3VLWA 1S9TA 2ZNTA 5ET8A 2QVVA 4F29A 3VV5A 3K6UA 5J16A 2DXYA 1MXYA 4YKIA 4LZ7A 2ALUA 1A55A 2OX3A 1XOCA 2H5YA 5H8FA 1A8FA 5DEXB 3BFTA 4TLMB 1USYE 1INPA 3N5LA 1QGXA 4G68B 2VD3A 4OEVA 5ELVA 2DWIA 3IR1A 3CSGA 5IKBA 2E0SA 4XXUA 3SESA 4OETA 3EHUA 3O97A 4ECFA 1II5A 2PMSA 1MQJA 1J1NA 5ET5A 5ET6A 1FPGA 2LAOA 3B6TA 1POTA 3DLNA 3TKDA 1LAFE 3SEVA 3OSQA 4NF8B 1JW4A 2PFYA 3RYDA 1B0LA 1TWYA 3KN3A 4NGUA 3USDA 4ELQA 3M3LA 1FPEA 1H44A 4ONYA 4KQPA 1B51A 1FPFA 2DE2A 1FQDA 3KJTA 3TDJA 1I6AA 3O2AA 1M5FA 2GFEA 4I3EA 2O69A 3B50A 3A29A 1NFTA 1OVBA 1FPLA 2Z23A 3EPEA 2Q8JA 2F36A 1URDA 1BLFA 3DP8A 1MY3A 2FVZA 5IZZA 5TP9B 3L6HA 1GR2A 3FUZA 3E9XA 2M8CA 3EQ1A 5I2NA 1M5CA 1L5TA 2ZMBA 3MVYA 4F22A 1B40A 2B4MA 4XKRA 2E1SA 4X9TA 3B7DA 2Q89A 4ESWA 3T9XB 4YKJA 2Q2CA 2QS2A 2DYXA 4KPTA 1Y3PA 4EQBA 1BIYA 1B5HA 5I3SA 1A40A 4LUBA 3LUYA 4RNSA 4OFLA 3OENA 4PCDA 1JETA 4OVTA 3VLVA 1HSEA 5EYHA 3D4GA 2OJTA 4BDRA 2ZNUA 1QULA 4KD5A 1NNFA 4MLQA 1JNFA 1Q1KA 2HZKA 1QUJA 3VVEA 3C34A 3QIMA 4OYVA 4FBPA 2I3WA 1B46A 1A54A 2ZNSA 4ZECA 1NL5A 5JTYB 3H4ZA 4NF5A 3H6WA 1MXWA 3V5AA 2D21A 1PC3A 1URGA 5I59A 3Q29A 5FTIA 1Y1ZA 2GHBA 5F24A 1B2HA 5M2VA 4E0XA 1NV3A 1UTHA 4H6DA 4GQOA 1N76A 4F1UA 3DM0A 2NOOA 3E4RA 4QSEA 4C1TA 4OESA 2ZYMA 4NEDA 2V3UA 4MNCA 3UORA 4QFOA 4MEVA 3H6UA 4JVCA 1FCKA 2RC7A 2CZHA 1PB8A 4ND9A 1MY1A 4F19A 1A99A 1LFIA 3BIGA 1FTLA 5AA2B 1EZOA 4AS5A 3SERA 2UYEA 1SQYA 3G3GA 3TAJA 1D4NA 5JK4A 5L8DA 3OD7A 4IGRA 4I3YA 4OERA 1MM7A 2RC9A 2QFLA 3I6VA 3G3IA 4PDDA 4H46A 1Y3NA 3S2VA 3FATA 3EF7A 3PTYA 2VT5A 3PD8A 2F8DA 5H8NB 4KYEA 4AB5A 4P1EA 3PD9A 3VE1B 4F3SA 3PPOA 4YB6A 1JEVA 4F3PA 4YMBA 2AL4A 2HHMA 4PTKA 4PFYA 4RK9A 2FBPA 1FPDA 4EQ9A 4OANA 2DOJA 2F34A 3N26A 1I69A 4QSCA 4QFPA 3FXQA 3RT8A 3DELB 4H1XA 5I57A 5IZ3A 4G2ZA 3U72A 1B1XA 4POWA 2THIA 2OWZA 3FVKA 3EKIA 1FQCA 2UYFA 3ZS6A 1EH3A 4JBZA 1QUKA 1SW4A 4GWOA 3H6TA 4QXDA 3PUWE 4MLVA 1KA1A 4U2RA 4G61A 1N3WA 1D3KA 2X26A 5CI5A 2KLFA 4OQOA 1XVXA 4PBQA 2DQVA 2G29A 2HPGA 2XXHA 1NUYA 2REJA 2Y7KA 4G68A 3LC8A 4HS7A 5I2KB 1O7TA 4HE0A 2F6GA 2DWJA 3FGSA 2YJPA 2I4BA 3PMXA 2R8TA 1I6QA 4NMYA 4QHQA 1VE4A 2YPNA 5CRYA 3S4UA 1MH3A 3W15C 5L9SA 5KDTB 1NI9A 4N91A 3FV2A 2ANJA 3EHSA 1TT1A 2HAVA 5ICTA 1MDP1 2P3VA 4JVDA 4OFOA 4R73A 3KEIA 4JWOA 3K02A 1LBCA 2NVUB 3JZJA 5IGAA 2H25A 4MF3A 3TYHA 2PVUA 3UN6A 1BP5A 3PUYE 5B7DA 3A09A 3K0VA 1EZPA 1KA0A 4NAPA 1OQHA 1EYKA 3N94A 4PGPA 3KN8A 4AQ4A 3LUZA 4C0RA 1MM6A 1LGBC 2X7PA 1IMFA 4TOZA 5HBCA 1WODA 2Z8EA 2XXIA 5T3JA 1ZIUA 3IAZA 3CIJA 2PCRA 1XT8A 3OEMA 1LAHE 5KCJB 4R6KA 3RPLB 4QSDA 5I57B 4LA9A 3SDFA 3R6UA 2OK2A 2XWVA 3E13X 1FBPA 2VGQA 4N4UA 5H8FB 1P1WA 1GTKA 2XWKA 4TLLB 2CZKA 1PEBA 3JV9A 1IMAA 5EQ7A 1IXIA 4R2FA 3RNNA 4HE1A 4FAJA 1LBZA 3HV1A 3V89B 4ELRA 4R72A 4OTEA 3HSTA 1FW0A 2UXAA 3B6WA 2DWHA 4LN5A 2VD2A 3LR1A 2Z8DA 5BWJA 3RY3A 2A5TB 1I6BA 2V3QA 3O28A 4PF8A 3MUQA 2AL5A 4DI3D 3SKPA 3MZBA 2I0BA 2VPOA 1MRPA 4P8BA 5LOMA 2DSFA 1P1UA 2DWAA 3RTFB 1B7ZA 5EQ8A 3OXNA 4Z0IA 1FPJA 3CR9A 4PDHA 4NF8A 4MNPA 2D5WA 4U23A 2DXRA 3K6VA 5DT6A 3HPIA 4YMAA 4MHFA 3PPPA 4GWZA 4BLAA 3G3FA 4IO7A 1QKAA 1R9LA 4RPNA 1MQGA 4QRZA 3W9VA 1Z7ME 1IMBA 1K9YA 1OQGA 5ET7A 3FVOA 4ZE9A 2UVHA 1IIWA 1VFEA 2V84A 4GD5A 4WEDA 5HPQA 3OEKA 1WVJA 4PBHA 3LSWA 1FPIA 1B6HA 4BDMA 1EZ9A
chains in the Genus database with same CATH topology
1NV6A 1G0HA 3ROJA 5FBPA 2HPGA 2OX3A 4P1LA 4X9TA 2DE4A 2XA5A 2V4CA 1NUYA 3D1RA 4X04A 2Q74A 1EYJA 4OA4A 4N6KA 2XWVA 3LV0A 2FHYA 2FIEA 3E78A 4GX6A 2WYPA 1FBPA 4H45A 4N4UA 4PFIA 4F1VA 5JK4A 2F3BA 1FJ9A 1INPA 1FRPA 2XXKA 3IFAA 5I3SA 2XWOA 4HE0A 4MNIA 4PETA 4XFEA 4P47A 1QGXA 2QVUA 4I3YA 2XWKA 4PAFA 2CZKA 3T1BA 3W9WA 3NOHA 2QFLA 4PCDA 2JJKA 1IMAA 3KC1A 2R8TA 1RDZA 1RDXA 5EQ7A 5EQAA 2WX9A 4OVTA 4P56A 4PDDA 4H46A 1DK4A 4MMPA 1RDYA 2WYKA 1K9ZA 5EYHA 2ZZXA 4I40A 5LDZA 3QMFA 4GWSA 2L5VA 4YZZA 4PAKA 2FIXA 4HE1A 1NI9A 3PTYA 2QVRA 2Y5LA 4N91A 1LBZA 2Q9TA 3U65A 2VT5A 2XWIA 4NQ8A 2WBBA 1YYZA 4GWXA 4GX3A 5EQ9A 1FBEA 2CEXA 2HZKA 1G0IA 1NUWA 4P1EA 1FBHA 5ET5A 1FPBA 1BK4A 2QPQA 4O7MA 4LN5A 2P3VA 1SPIA 5ET6A 4GX4A 1FBDA 4JVDA 3GYYA 1FPGA 3FBPA 4FBPA 1JP4A 4MJOA 2ZZVA 4MX6A 1Q9DA 1VDWA 4NHBA 4PC9A 4PGNA 1NV0A 1LBVA 1EYIA 1DBZA 1LEVA 1LBWA 1LBYA 2BJIA 1NV1A 1NV7A 3KBZA 4GBVA 3MSTA 4OVRA 5J1DA 2HHMA 1IMCA 4PTKA 4IR8A 2HZLA 3ISPA 4P9KA 4PFBA 5IGAA 4GWUA 2FBPA 2KQZA 3CHGA 4HXVA 4GWYA 4XEQA 3IFCA 4AS4A 2V3QA 4O94A 1FPDA 4OVPA 4PF8A 4OANA 4OVQA 2PFYA 3RYDA 1NV2A 3MYUA 5DW8A 4MIJA 4N8GA 4NG7A 4PF6A 4O7IA 4YICA 4DI3D 5ESYA 3RPLA 2PFZA 4OVSA 4N15A 1NUZA 4DI4B 4NGUA 1NV5A 4MAGA 2VPOA 1FBGA 4P8BA 4PE3A 4PAIA 4KXPA 5IZ3A 1FPEA 1IMDA 4UABA 3KC0A 2GQ1A 3T0JA 4NN3A 1LBXA 2OWZA 1KA0A 5EQ8A 1FPJA 5F24A 5LTCA 1FJ6A 4PDHA 4NAPA 3EKIA 1FPFA 2DE2A 3E79A 3SZPA 4N6DA 1YXIA 2DE3A 1NV3A 4MNPA 4GWWA 1CNQA 1IMEA 1EYKA 4PGPA 1AWBA 1FSAA 5IZ3B 4MCOA 2B4LA 4P3LA 4HCWA 2KR0A 3LUZA 4I3EA 3B50A 4M1VA 4MHFA 4F1UA 5IZ1A 5CM6A 3A29A 3FXBA 1FPKA 3BIHA 1FBFA 1NUXA 2WEFA 3B8BA 2CZIA 4GWZA 2MKZA 1FPLA 1NV4A 2VPNA 4MNCA 5I5PA 2Q8MA 4MEVA 2P3NA 2DDKA 2DVZA 4JVCA 4NX1A 5I7IA 1IMFA 1FBCA 4N81A 2CEYA 2CZHA 4HE2A 2ZZWA 4PFRA 4QXDA 4HCYA 3W9VA 4F18A 5T3JA 1YZ0A 2HXRA 1IMBA 4F19A 3HFUA 2FVZA 4O8MA 4NF0A 4N8YA 1DCUA 4XF5A 4GBWA 1K9YA 5IZZA 5ET7A 1XI6A 4N17A 1FTAA 2PCRA 2Y5KA 1KA1A 5IM2A 4G61A 2F3DA 5ET8A 2QVVA 5A5LA 2B4MA 1D9QA 3BIGA 4PBHA 4QBAA 5J16A 3RPLB 2F5XA 4JVIA 1KZ8A 1FPIA 5EYGA 4X8RA 4AS5A 4PBQA 2WBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NV6 A;  1G0H A;  3ROJ A;  5FBP A;  2OX3 A;  1NUY A;  3D1R A;  2Q74 A;  1EYJ A;  3LV0 A;  2FHY A;  2FIE A;  4GX6 A;  1FBP A;  4H45 A;  2F3B A;  1FJ9 A;  1INP A;  1FRP A;  3IFA A;  5I3S A;  4HE0 A;  1QGX A;  2QVU A;  4I3Y A;  2CZK A;  2QFL A;  2JJK A;  1IMA A;  3KC1 A;  2R8T A;  1RDZ A;  1RDX A;  5EQ7 A;  5EQA A;  4H46 A;  1DK4 A;  1RDY A;  1K9Z A;  5EYH A;  4I40 A;  5LDZ A;  3QMF A;  4GWS A;  2FIX A;  4HE1 A;  1NI9 A;  2QVR A;  2Y5L A;  1LBZ A;  2VT5 A;  2WBB A;  1YYZ A;  4GWX A;  4GX3 A;  5EQ9 A;  1FBE A;  1G0I A;  1NUW A;  1FBH A;  5ET5 A;  1FPB A;  1BK4 A;  2P3V A;  1SPI A;  5ET6 A;  4GX4 A;  1FBD A;  1FPG A;  3FBP A;  4FBP A;  1JP4 A;  4MJO A;  1Q9D A;  1VDW A;  1NV0 A;  1LBV A;  1EYI A;  1DBZ A;  1LEV A;  1LBW A;  1LBY A;  2BJI A;  1NV1 A;  1NV7 A;  3KBZ A;  4GBV A;  2HHM A;  1IMC A;  4PTK A;  4IR8 A;  4GWU A;  2FBP A;  4HXV A;  4GWY A;  3IFC A;  4AS4 A;  1FPD A;  3RYD A;  1NV2 A;  5DW8 A;  4O7I A;  5ESY A;  3RPL A;  1NUZ A;  1NV5 A;  1FBG A;  4KXP A;  5IZ3 A;  1FPE A;  1IMD A;  3KC0 A;  2GQ1 A;  3T0J A;  1LBX A;  2OWZ A;  1KA0 A;  5EQ8 A;  1FPJ A;  5F24 A;  1FJ6 A;  1FPF A;  1YXI A;  1NV3 A;  4GWW A;  1CNQ A;  1IME A;  1EYK A;  1AWB A;  1FSA A;  5IZ3 B;  3LUZ A;  4I3E A;  5IZ1 A;  3A29 A;  1FPK A;  3BIH A;  1FBF A;  1NUX A;  2WEF A;  3B8B A;  2CZI A;  4GWZ A;  1FPL A;  1NV4 A;  2Q8M A;  2P3N A;  2DDK A;  1IMF A;  1FBC A;  4N81 A;  2CZH A;  4HE2 A;  4QXD A;  5T3J A;  1YZ0 A;  1IMB A;  2FVZ A;  1DCU A;  4GBW A;  1K9Y A;  5ET7 A;  1XI6 A;  1FTA A;  2PCR A;  2Y5K A;  1KA1 A;  4G61 A;  2F3D A;  5ET8 A;  2QVV A;  5A5L A;  1D9Q A;  3BIG A;  5J16 A;  3RPL B;  1KZ8 A;  1FPI A;  5EYG A;  4AS5 A;  2WBD A; 
#chains in the Genus database with same CATH topology
 2Y7W A;  4GVO A;  1G0H A;  2HQ0 A;  4KI0 E;  1MG1 A;  3TOD A;  4H67 A;  3LV0 A;  2FHY A;  3K6W A;  1QJM A;  1N0T A;  3TUS A;  3R7X A;  5KZT A;  2GHA A;  1IXC A;  1OIB A;  1B58 A;  3PMV A;  2WX9 A;  1RDX A;  4GOT A;  5F7V A;  3CVG A;  3PUZ E;  2AYS A;  3D4C A;  4DLD A;  1TXF A;  4NQ8 A;  1JEU A;  1OLA A;  5EYF A;  3K2D A;  4IO5 A;  2IA4 A;  1SVX B;  5TU0 A;  1M5D A;  4JSO A;  4N17 A;  2DP8 A;  2R6G E;  3MPL A;  5AA1 A;  4OVR A;  2ZYN A;  1RYX A;  1P1Q A;  1TFD A;  3TZA A;  3CHG A;  2KQZ A;  4HXV A;  3KOS A;  3IFC A;  1H45 A;  2XD3 A;  3RPL A;  3N6U A;  3PPR A;  1B32 A;  4O3B A;  4PAI A;  1FTO A;  4G4P A;  2QS1 A;  1FJ6 A;  4GF8 A;  1US4 A;  3THI A;  4JXI A;  1IZ1 A;  5DTB A;  2Z22 A;  4EXK A;  2MKZ A;  4PC9 A;  2WEF A;  4DE8 A;  5I59 B;  4EF2 A;  1NV4 A;  3UK4 A;  2GRV A;  5I7I A;  4Q8R A;  2XX8 A;  3RUM A;  1FBC A;  3GLB A;  1XHY A;  4PFU A;  3KGC A;  4LVQ A;  4JSD A;  5ITP A;  2VP1 A;  1ZTY A;  4KFQ A;  4XF5 A;  4GBW A;  4NF5 B;  2I6E A;  3L6G A;  1ELJ A;  4U1O A;  4KCD A;  3S9E A;  4QFK A;  5J1D A;  2WBD A;  4ZEB A;  2I48 A;  2V4C A;  4N6K A;  1MDQ A;  1F9B A;  2XXX A;  3IOR A;  4R9F A;  4H45 A;  1FJ9 A;  1FRP A;  2HCA A;  1UTH B;  4RXL A;  1PBQ A;  4POX A;  2O51 A;  2UVJ A;  3G3J A;  2H9B A;  4OFJ A;  2F7A A;  1GVC A;  3H3G A;  1NKX A;  3TTR A;  5H8N A;  2I0C A;  1Y4C A;  4FEB A;  5I84 A;  1B7U A;  4MH5 A;  4F2Q A;  1BK4 A;  2HXW A;  3LSL A;  1FBD A;  4F2O A;  2ZYO A;  3FV1 A;  1NV0 A;  1VFD A;  2OPD A;  3C36 A;  3FXU A;  1IMC A;  4P9K A;  3ISP A;  1MXX A;  1FQA A;  1NV2 A;  1DTZ A;  4PF6 A;  4X1D A;  4N07 A;  4ESX A;  4DI4 B;  3ZKL A;  3IJO B;  3FJ7 A;  3V8X B;  3A3U A;  3MQ9 A;  1FQE A;  3BKI B;  4K3F A;  3O9P A;  4R6H A;  4BDO A;  1LST A;  2YLN A;  5ISU A;  5F1Q A;  3LBS A;  4DZ1 A;  1FBF A;  1NUX A;  3PPN A;  2FNC A;  4I1D A;  3MP1 A;  1B0H A;  5ITO A;  5K2X A;  1AMF A;  3VFJ A;  1FTA A;  2ESN A;  1IUD A;  1MY2 A;  2ZXT A;  4KR5 A;  3QK6 A;  4LAT A;  1KZ8 A;  2RCA A;  4IY6 A;  5FTH A;  4X04 A;  2Q74 A;  1WDN A;  4GRK A;  1DSN A;  2FA7 A;  3K4U A;  3IK6 B;  4P47 A;  3VVD A;  2JJK A;  4P56 A;  2DS9 A;  1DK4 A;  4PFW A;  5FHN A;  4U1Z A;  1MY4 A;  5DVJ A;  5BUU A;  3KN7 A;  4QF9 A;  1M5E A;  1YAE A;  4GWX A;  2Z8F A;  3UA8 A;  2OWT A;  1B9J A;  2VOZ A;  4FED A;  1LEV A;  2KR0 A;  1LBW A;  1LBY A;  2B3F A;  2FYI A;  1PB7 A;  3Q25 A;  4AS4 A;  4O94 A;  1Q35 A;  2PBW A;  4DCY A;  4OVS A;  2UVG A;  3WAF A;  3FVG A;  5DYH A;  2Q2A A;  3K6X A;  2XHD A;  2BJJ X;  3V83 A;  1EU8 A;  2F7B A;  2B3B A;  4UAB A;  4JWY A;  2HFB A;  3E79 A;  1XVY A;  3ILT B;  1MXU A;  3BBR A;  4F1Y A;  4HCW A;  1SI1 A;  2QMW A;  2UVI A;  3CFL A;  2O6A A;  3G3K A;  3TTL A;  1OLC A;  4H5F A;  2CEY A;  4YKP A;  4EDP A;  1CE2 A;  1SBP A;  1SYI A;  4BDL A;  4YAH X;  3C32 A;  5K2Y A;  2O7I A;  1B7H A;  5TPA B;  1A7L A;  2QS3 A;  2I58 A;  5EYG A;  3UIF A;  2V25 A;  3D1R A;  4YU0 A;  4WKM A;  3K01 A;  1O64 A;  4EXL A;  2FIE A;  3HN0 A;  1MH4 A;  1T0K A;  3Q28 A;  1FTM A;  4F3G A;  2XXU A;  4PET A;  1MS7 A;  3C4M A;  3W9W A;  1N7W A;  1RDZ A;  3MP8 A;  2ZZX A;  4BDQ A;  4OEN A;  2Q9T A;  1B3H A;  3OO7 A;  5CMB A;  4UA8 A;  1POY 1;  1FQF A;  4OHN A;  1O63 A;  2XXV A;  2ZZV A;  1B5I A;  1LBV A;  3KBZ A;  2NXO A;  4GXS B;  4IO3 A;  4PFB A;  1Z7N E;  4I62 A;  4ZEF A;  3LSX A;  2XX9 A;  3QSL A;  3TCG A;  4O7I A;  4RY1 A;  4ZDM A;  1FTJ A;  3MVZ A;  4LP2 B;  3Q27 A;  1AH5 A;  5LTC A;  1JW1 A;  4IB2 A;  4UAC A;  3SET A;  2F6P A;  4M1V A;  3FXB A;  3BIH A;  4NF6 B;  3O6I A;  5I5P A;  2P3N A;  5AA2 D;  4GL0 A;  2ONS A;  4NF4 B;  5H8H B;  4F18 A;  5CBS A;  4GL8 A;  4GXA A;  3RLF E;  4P0G A;  4MAG A;  3O6G A;  4ZED A;  1IXG A;  1CB6 A;  4KYD A;  3IL1 B;  4PFI A;  1SW1 A;  3MZ1 A;  3T93 B;  4LZ5 A;  3P7I A;  3B6Q A;  1VSO A;  1B3G A;  4H0W A;  2Y7R A;  3C9H A;  2Y84 A;  1IEJ A;  1LCT A;  1UTB B;  2H4I A;  5EQ9 A;  2XD2 A;  2P2A A;  3H7M A;  1Y20 A;  1ZMG A;  4XIG Q;  2OBG A;  1FBH A;  1SW2 A;  3QAX A;  2D3I A;  1OMP A;  4KCC A;  4PGN A;  4HTG A;  5AA4 B;  3OEL A;  1EYI A;  2XXW A;  3SEW A;  2VHA A;  4GWU A;  4PFT A;  4R6Y A;  3WAE A;  4GFR A;  3UGW A;  4FIM A;  4PE5 B;  1H76 A;  2IEE A;  3K1P A;  1YTV A;  3RT6 B;  4DDD A;  2ZYK A;  3FD3 A;  4MFI A;  4WXJ A;  2XXT A;  3RGY A;  1YXI A;  1QVS A;  1JW5 A;  4BDN A;  1UIU A;  1AWB A;  1FSA A;  2O68 A;  4OVJ A;  5CBR A;  4KYS A;  5IZ1 A;  3IOT A;  3I3V A;  2CZI A;  4AB6 A;  4U22 A;  2OZZ A;  1BTJ A;  1AOV A;  1TFA A;  1LCF A;  1YZ0 A;  4XKN A;  1DTG A;  1MXZ A;  2O7U A;  5DVF A;  5L9O A;  5KDT A;  3Q26 A;  4OXV A;  2XXY A;  4GLI A;  4PP0 A;  4RA1 A;  4DXC A;  3E3K A;  3RPW A;  3IJX B;  3U1O A;  3EN3 A;  2F3B A;  5H8Q B;  3PMW A;  5FHM A;  4EUO A;  1PBP A;  2F35 A;  5I58 A;  1SYH A;  2Y7I A;  3C35 A;  3ECR A;  4X1B A;  1B4Z A;  4IO4 A;  2WYK A;  1R9Q A;  1B3F A;  4I40 A;  4GWS A;  3ZKK A;  3MC2 A;  5I58 B;  2P0S A;  3KOT A;  4X48 A;  3MWB A;  2PX1 A;  1FBE A;  1B1H A;  2RKM A;  5HM4 B;  2QPQ A;  1NNP A;  3IX1 A;  2QJE A;  2QL3 A;  2NUV A;  3T66 A;  1NV1 A;  1PB9 A;  4ZEK A;  5B70 A;  3RN8 A;  3MPK A;  1BKA A;  1SI0 A;  4H8J A;  4RJZ A;  3H06 B;  4G68 C;  1D9V A;  1US5 A;  4IY5 A;  1B5J A;  3MJN A;  4M4G A;  3KC0 A;  4P11 A;  1USY H;  3T0J A;  5KCJ A;  4PQJ A;  4XKP A;  1NNK A;  4N6D A;  3TEL A;  5CMK A;  1LBB A;  3FIR A;  1CNQ A;  4E0W A;  5JTY A;  4TQU Q;  3KG2 A;  1VR5 A;  3FXR A;  1FPK A;  4N15 A;  1SW5 A;  3C33 A;  3T9V A;  4G8H A;  3M8U A;  2ZZW A;  2DVC A;  4HCY A;  5FHO A;  3S9N C;  1XI6 A;  4ZE8 A;  3CSB A;  1QKB A;  2F5X A;  4ZEI A;  2W7Y A;  1QW0 A;  4P1L A;  3MP6 A;  2O1L A;  4XKQ A;  2WYP A;  2H99 A;  3G3H A;  2XWO A;  4O3C A;  4NWC A;  4XFE A;  2QVU A;  3KSJ A;  2O84 X;  1ZJL A;  3T1B A;  4RK2 A;  1UQW A;  5I56 A;  1GGG A;  1B05 A;  2OWS A;  3CRB A;  3K00 A;  3O6H A;  2WKY A;  4MMP A;  3MVW A;  4QFN A;  3TMG A;  3QUF A;  3DP4 A;  4G8M A;  1FQB A;  3CG1 A;  1G0I A;  1P99 A;  2F78 A;  2O1M A;  4NE4 A;  3PV0 E;  3KSX A;  4GX4 A;  5A5X B;  4MJO A;  3FBP A;  1JP4 A;  2HZL A;  2QRY A;  5AA4 A;  4GWY A;  4XEQ A;  4Z7E A;  5I2N B;  5DW8 A;  4YIC A;  3U93 A;  1NUZ A;  4H65 A;  4R9G A;  2RCB A;  5AE4 A;  1JQF A;  3S9M C;  4ZZA A;  3KFM A;  1DOT A;  3VXC A;  4NF6 A;  4N13 A;  3TPA A;  3MAM A;  2XXP A;  5CM6 A;  4YKK A;  1AIV A;  4PE3 A;  3B8B A;  1H3D A;  4NX1 A;  2HEU A;  4N81 A;  2ONK E;  4PFR A;  3R26 A;  4U21 A;  3H03 A;  1ZBM A;  2B65 A;  4Q30 B;  5IM2 A;  4EF1 A;  4R2B A;  1JVY A;  1D9Q A;  3TQW A;  3C31 A;  1NV6 A;  3ROJ A;  4NWD A;  1MPD A;  2PT1 A;  2DE4 A;  1ATG A;  4OWD A;  3TTK A;  2R71 A;  4THI A;  3OOA A;  2QMX A;  1MY0 A;  1N04 A;  3PU5 A;  3T9H B;  5I56 B;  4I9D A;  4Q0C A;  3OO6 A;  1K9Z A;  3QMF A;  4YZZ A;  2FIX A;  4DCX A;  2XXR A;  3U65 A;  2A5T A;  2Y7P A;  2XWI A;  4GX3 A;  2P1S A;  1NUW A;  1Y9U A;  4C1U A;  3ONM A;  2RIN A;  4NHB A;  2XXQ A;  3IOV A;  4DXB A;  1RYO A;  3AXF A;  3IOW A;  2X7Q A;  1QUI A;  2GH9 A;  4Q5T A;  3GBA A;  4OZ9 A;  1GV8 A;  1URS A;  1ANF A;  5TPA A;  1MQI A;  4N8G A;  3N6T A;  1ZU0 A;  1XS5 A;  1NV5 A;  3TTN A;  1MQD A;  5IAI A;  4FOR A;  1JVX A;  4MBP A;  1SD3 A;  1IME A;  2NWJ A;  5IZ3 B;  4P3L A;  3CFX A;  2F97 A;  1Y3Q A;  3EHT A;  3K1N A;  3VDF A;  3S9L C;  2DVZ A;  1YCJ A;  4LQ5 A;  1A8E A;  3VLU A;  3HHG A;  2A5S A;  1S50 A;  3KZG A;  2REG A;  3VXB A;  2Y5K A;  3TCF A;  3F11 A;  1B4H A;  4GIZ A;  5A5L A;  4U4X A;  3T9U A;  4LQ2 A;  1LFH A;  1N7X A;  2XA5 A;  4WEP A;  1IIT A;  4ISU A;  4NTL A;  3U94 A;  1NH7 A;  1NMU A;  4L17 A;  3IFA A;  4HW8 A;  4XTC Q;  2I49 A;  4PAF A;  5DEX A;  3NOH A;  2HAU A;  3KC1 A;  5A5X A;  5H8S A;  3DP6 A;  3TQL A;  4FJP A;  2L5V A;  3TTM A;  2G93 A;  3HHF A;  2QVR A;  2Y5L A;  1R1N A;  1UTB A;  3OMB A;  4FEC A;  1YYZ A;  5AA3 A;  4FE8 A;  2CEX A;  2F7C A;  4U4S A;  1HSL A;  3FVN A;  2OPE A;  1AL3 A;  2V93 A;  5AA2 A;  3GYY A;  4MX6 A;  2V3T A;  1VDW A;  3LSF B;  4IO2 A;  2BJI A;  4IR8 A;  4F39 A;  5I2K A;  3SEY A;  1IQ7 A;  2RC8 A;  4MIJ A;  4NG7 A;  3CI8 A;  5ESY A;  3VVF A;  2PT2 A;  1S7Y A;  3TEP A;  1LB8 A;  3SEX A;  2GQ1 A;  2XX7 A;  4MCO A;  1P1O A;  4JB7 A;  3CFZ A;  3MVX A;  2Q8M A;  2I3V A;  3PUX E;  1PDA A;  1SDX A;  3MZ9 A;  2RF1 A;  2OCU A;  1B52 A;  1R6Z A;  4O8M A;  4NF0 A;  4N8Y A;  1UIV A;  4P0I A;  3PUV E;  3RTW B;  2F3D A;  4QFL A;  4QBA A;  1B3E A;  4JVI A;  1MQH A;  1FTK A;  4IO6 A;  3IOU A;  2QS4 A;  1LAX A;  2AIX A;  3E78 A;  4GX6 A;  3ZSF A;  4R75 A;  3KJ7 A;  3FJM A;  1ZKB A;  3IB0 A;  1RDY A;  4JDF A;  4F31 B;  1DPP A;  3M3K A;  3O29 A;  3ILU B;  3JYR A;  4PAK A;  3A3C A;  4RPO A;  4F3B A;  2WBB A;  1LFG A;  3SEU A;  1LB9 A;  3KBR A;  3GXA A;  1MPC A;  4O7M A;  3IO6 A;  5JEI A;  1Q9D A;  3OO8 A;  4DXU A;  1DBZ A;  1MPB A;  1IXH A;  1YPN A;  5DVI A;  1NV7 A;  4OEU A;  3QUJ A;  3ODB A;  5TP9 A;  2QSX A;  3UP9 A;  3PGF A;  3T96 B;  4G8N A;  3FJG A;  2I4C A;  3MYU A;  4N6P A;  2PFZ A;  5EHS A;  3IB1 A;  3PPQ A;  4I8C A;  1FBG A;  5CMM A;  1IMD A;  2PYY A;  4NN3 A;  3HCQ A;  5H8Q A;  3HO7 A;  3CG3 A;  1ZLQ A;  4H5G A;  4GWW A;  2CMO A;  2B4L A;  1NH8 A;  4IGT A;  1H43 A;  2VPN A;  4ELP A;  3FZV A;  5CC2 A;  2OLB A;  3K1M A;  4EQ7 A;  4LZ8 A;  3G7W A;  3HFU A;  1OVT A;  2ABH A;  1B3L A;  4LON B;  2CZL A;  4ZS9 A;  5EHM A;  4X8R A;  1HSJ A;  5FBP A;  3RQT A;  3FAS A;  1P1N A;  4RYA A;  1MXV A;  3U8Q A;  4OMB A;  1EYJ A;  1Y4T A;  4OA4 A;  4YB5 A;  5L9M A;  4F1V A;  3MW0 A;  4O3A A;  2XXK A;  3TFL A;  4MNI A;  1N3X A;  3O66 A;  1LLS A;  3U92 A;  5EQA A;  4ZZE A;  3GBB A;  1D9Y A;  1RKM A;  3IB2 A;  1M5B A;  4JWX A;  5LDZ A;  3IO4 A;  1NNT A;  3TCH A;  1FPB A;  2R9J A;  4G77 A;  1SPI A;  4FAT A;  2ONR A;  4GBV A;  1DMB A;  3MST A;  2Q88 A;  3M3F A;  3BFU A;  4OVP A;  3QXM A;  4OVQ A;  3I5O A;  1KWH A;  4KXP A;  3T22 A;  1DPE A;  1LBX A;  3OSR A;  4ELO A;  4H8I A;  3SZP A;  3QYT A;  1XC1 A;  2DE3 A;  1Y1M A;  3H6V A;  4NF4 A;  5H8H A;  3GZG A;  4R74 A;  4DIG A;  3OO9 A;  5ICQ A;  2DDK A;  4KHZ E;  2H98 A;  4HE2 A;  5CMC A;  1N84 A;  2HXR A;  3MBP A;  1LAG E;  4YB7 A;  1DCU A;  3VLW A;  1S9T A;  2ZNT A;  5ET8 A;  2QVV A;  4F29 A;  3VV5 A;  3K6U A;  5J16 A;  2DXY A;  1MXY A;  4YKI A;  4LZ7 A;  2ALU A;  1A55 A;  2OX3 A;  1XOC A;  2H5Y A;  5H8F A;  1A8F A;  5DEX B;  3BFT A;  4TLM B;  1USY E;  1INP A;  3N5L A;  1QGX A;  4G68 B;  2VD3 A;  4OEV A;  5ELV A;  2DWI A;  3IR1 A;  3CSG A;  5IKB A;  2E0S A;  4XXU A;  3SES A;  4OET A;  3EHU A;  3O97 A;  4ECF A;  1II5 A;  2PMS A;  1MQJ A;  1J1N A;  5ET5 A;  5ET6 A;  1FPG A;  2LAO A;  3B6T A;  1POT A;  3DLN A;  3TKD A;  1LAF E;  3SEV A;  3OSQ A;  4NF8 B;  1JW4 A;  2PFY A;  3RYD A;  1B0L A;  1TWY A;  3KN3 A;  4NGU A;  3USD A;  4ELQ A;  3M3L A;  1FPE A;  1H44 A;  4ONY A;  4KQP A;  1B51 A;  1FPF A;  2DE2 A;  1FQD A;  3KJT A;  3TDJ A;  1I6A A;  3O2A A;  1M5F A;  2GFE A;  4I3E A;  2O69 A;  3B50 A;  3A29 A;  1NFT A;  1OVB A;  1FPL A;  2Z23 A;  3EPE A;  2Q8J A;  2F36 A;  1URD A;  1BLF A;  3DP8 A;  1MY3 A;  2FVZ A;  5IZZ A;  5TP9 B;  3L6H A;  1GR2 A;  3FUZ A;  3E9X A;  2M8C A;  3EQ1 A;  5I2N A;  1M5C A;  1L5T A;  2ZMB A;  3MVY A;  4F22 A;  1B40 A;  2B4M A;  4XKR A;  2E1S A;  4X9T A;  3B7D A;  2Q89 A;  4ESW A;  3T9X B;  4YKJ A;  2Q2C A;  2QS2 A;  2DYX A;  4KPT A;  1Y3P A;  4EQB A;  1BIY A;  1B5H A;  5I3S A;  1A40 A;  4LUB A;  3LUY A;  4RNS A;  4OFL A;  3OEN A;  4PCD A;  1JET A;  4OVT A;  3VLV A;  1HSE A;  5EYH A;  3D4G A;  2OJT A;  4BDR A;  2ZNU A;  1QUL A;  4KD5 A;  1NNF A;  4MLQ A;  1JNF A;  1Q1K A;  2HZK A;  1QUJ A;  3VVE A;  3C34 A;  3QIM A;  4OYV A;  4FBP A;  2I3W A;  1B46 A;  1A54 A;  2ZNS A;  4ZEC A;  1NL5 A;  5JTY B;  3H4Z A;  4NF5 A;  3H6W A;  1MXW A;  3V5A A;  2D21 A;  1PC3 A;  1URG A;  5I59 A;  3Q29 A;  5FTI A;  1Y1Z A;  2GHB A;  5F24 A;  1B2H A;  5M2V A;  4E0X A;  1NV3 A;  1UTH A;  4H6D A;  4GQO A;  1N76 A;  4F1U A;  3DM0 A;  2NOO A;  3E4R A;  4QSE A;  4C1T A;  4OES A;  2ZYM A;  4NED A;  2V3U A;  4MNC A;  3UOR A;  4QFO A;  4MEV A;  3H6U A;  4JVC A;  1FCK A;  2RC7 A;  2CZH A;  1PB8 A;  4ND9 A;  1MY1 A;  4F19 A;  1A99 A;  1LFI A;  3BIG A;  1FTL A;  5AA2 B;  1EZO A;  4AS5 A;  3SER A;  2UYE A;  1SQY A;  3G3G A;  3TAJ A;  1D4N A;  5JK4 A;  5L8D A;  3OD7 A;  4IGR A;  4I3Y A;  4OER A;  1MM7 A;  2RC9 A;  2QFL A;  3I6V A;  3G3I A;  4PDD A;  4H46 A;  1Y3N A;  3S2V A;  3FAT A;  3EF7 A;  3PTY A;  2VT5 A;  3PD8 A;  2F8D A;  5H8N B;  4KYE A;  4AB5 A;  4P1E A;  3PD9 A;  3VE1 B;  4F3S A;  3PPO A;  4YB6 A;  1JEV A;  4F3P A;  4YMB A;  2AL4 A;  2HHM A;  4PTK A;  4PFY A;  4RK9 A;  2FBP A;  1FPD A;  4EQ9 A;  4OAN A;  2DOJ A;  2F34 A;  3N26 A;  1I69 A;  4QSC A;  4QFP A;  3FXQ A;  3RT8 A;  3DEL B;  4H1X A;  5I57 A;  5IZ3 A;  4G2Z A;  3U72 A;  1B1X A;  4POW A;  2THI A;  2OWZ A;  3FVK A;  3EKI A;  1FQC A;  2UYF A;  3ZS6 A;  1EH3 A;  4JBZ A;  1QUK A;  1SW4 A;  4GWO A;  3H6T A;  4QXD A;  3PUW E;  4MLV A;  1KA1 A;  4U2R A;  4G61 A;  1N3W A;  1D3K A;  2X26 A;  5CI5 A;  2KLF A;  4OQO A;  1XVX A;  4PBQ A;  2DQV A;  2G29 A;  2HPG A;  2XXH A;  1NUY A;  2REJ A;  2Y7K A;  4G68 A;  3LC8 A;  4HS7 A;  5I2K B;  1O7T A;  4HE0 A;  2F6G A;  2DWJ A;  3FGS A;  2YJP A;  2I4B A;  3PMX A;  2R8T A;  1I6Q A;  4NMY A;  4QHQ A;  1VE4 A;  2YPN A;  5CRY A;  3S4U A;  1MH3 A;  3W15 C;  5L9S A;  5KDT B;  1NI9 A;  4N91 A;  3FV2 A;  2ANJ A;  3EHS A;  1TT1 A;  2HAV A;  5ICT A;  1MDP 1;  2P3V A;  4JVD A;  4OFO A;  4R73 A;  3KEI A;  4JWO A;  3K02 A;  1LBC A;  2NVU B;  3JZJ A;  5IGA A;  2H25 A;  4MF3 A;  3TYH A;  2PVU A;  3UN6 A;  1BP5 A;  3PUY E;  5B7D A;  3A09 A;  3K0V A;  1EZP A;  1KA0 A;  4NAP A;  1OQH A;  1EYK A;  3N94 A;  4PGP A;  3KN8 A;  4AQ4 A;  3LUZ A;  4C0R A;  1MM6 A;  1LGB C;  2X7P A;  1IMF A;  4TOZ A;  5HBC A;  1WOD A;  2Z8E A;  2XXI A;  5T3J A;  1ZIU A;  3IAZ A;  3CIJ A;  2PCR A;  1XT8 A;  3OEM A;  1LAH E;  5KCJ B;  4R6K A;  3RPL B;  4QSD A;  5I57 B;  4LA9 A;  3SDF A;  3R6U A;  2OK2 A;  2XWV A;  3E13 X;  1FBP A;  2VGQ A;  4N4U A;  5H8F B;  1P1W A;  1GTK A;  2XWK A;  4TLL B;  2CZK A;  1PEB A;  3JV9 A;  1IMA A;  5EQ7 A;  1IXI A;  4R2F A;  3RNN A;  4HE1 A;  4FAJ A;  1LBZ A;  3HV1 A;  3V89 B;  4ELR A;  4R72 A;  4OTE A;  3HST A;  1FW0 A;  2UXA A;  3B6W A;  2DWH A;  4LN5 A;  2VD2 A;  3LR1 A;  2Z8D A;  5BWJ A;  3RY3 A;  2A5T B;  1I6B A;  2V3Q A;  3O28 A;  4PF8 A;  3MUQ A;  2AL5 A;  4DI3 D;  3SKP A;  3MZB A;  2I0B A;  2VPO A;  1MRP A;  4P8B A;  5LOM A;  2DSF A;  1P1U A;  2DWA A;  3RTF B;  1B7Z A;  5EQ8 A;  3OXN A;  4Z0I A;  1FPJ A;  3CR9 A;  4PDH A;  4NF8 A;  4MNP A;  2D5W A;  4U23 A;  2DXR A;  3K6V A;  5DT6 A;  3HPI A;  4YMA A;  4MHF A;  3PPP A;  4GWZ A;  4BLA A;  3G3F A;  4IO7 A;  1QKA A;  1R9L A;  4RPN A;  1MQG A;  4QRZ A;  3W9V A;  1Z7M E;  1IMB A;  1K9Y A;  1OQG A;  5ET7 A;  3FVO A;  4ZE9 A;  2UVH A;  1IIW A;  1VFE A;  2V84 A;  4GD5 A;  4WED A;  5HPQ A;  3OEK A;  1WVJ A;  4PBH A;  3LSW A;  1FPI A;  1B6H A;  4BDM A;  1EZ9 A; 
#chains in the Genus database with same CATH homology
 1NV6 A;  1G0H A;  3ROJ A;  5FBP A;  2HPG A;  2OX3 A;  4P1L A;  4X9T A;  2DE4 A;  2XA5 A;  2V4C A;  1NUY A;  3D1R A;  4X04 A;  2Q74 A;  1EYJ A;  4OA4 A;  4N6K A;  2XWV A;  3LV0 A;  2FHY A;  2FIE A;  3E78 A;  4GX6 A;  2WYP A;  1FBP A;  4H45 A;  4N4U A;  4PFI A;  4F1V A;  5JK4 A;  2F3B A;  1FJ9 A;  1INP A;  1FRP A;  2XXK A;  3IFA A;  5I3S A;  2XWO A;  4HE0 A;  4MNI A;  4PET A;  4XFE A;  4P47 A;  1QGX A;  2QVU A;  4I3Y A;  2XWK A;  4PAF A;  2CZK A;  3T1B A;  3W9W A;  3NOH A;  2QFL A;  4PCD A;  2JJK A;  1IMA A;  3KC1 A;  2R8T A;  1RDZ A;  1RDX A;  5EQ7 A;  5EQA A;  2WX9 A;  4OVT A;  4P56 A;  4PDD A;  4H46 A;  1DK4 A;  4MMP A;  1RDY A;  2WYK A;  1K9Z A;  5EYH A;  2ZZX A;  4I40 A;  5LDZ A;  3QMF A;  4GWS A;  2L5V A;  4YZZ A;  4PAK A;  2FIX A;  4HE1 A;  1NI9 A;  3PTY A;  2QVR A;  2Y5L A;  4N91 A;  1LBZ A;  2Q9T A;  3U65 A;  2VT5 A;  2XWI A;  4NQ8 A;  2WBB A;  1YYZ A;  4GWX A;  4GX3 A;  5EQ9 A;  1FBE A;  2CEX A;  2HZK A;  1G0I A;  1NUW A;  4P1E A;  1FBH A;  5ET5 A;  1FPB A;  1BK4 A;  2QPQ A;  4O7M A;  4LN5 A;  2P3V A;  1SPI A;  5ET6 A;  4GX4 A;  1FBD A;  4JVD A;  3GYY A;  1FPG A;  3FBP A;  4FBP A;  1JP4 A;  4MJO A;  2ZZV A;  4MX6 A;  1Q9D A;  1VDW A;  4NHB A;  4PC9 A;  4PGN A;  1NV0 A;  1LBV A;  1EYI A;  1DBZ A;  1LEV A;  1LBW A;  1LBY A;  2BJI A;  1NV1 A;  1NV7 A;  3KBZ A;  4GBV A;  3MST A;  4OVR A;  5J1D A;  2HHM A;  1IMC A;  4PTK A;  4IR8 A;  2HZL A;  3ISP A;  4P9K A;  4PFB A;  5IGA A;  4GWU A;  2FBP A;  2KQZ A;  3CHG A;  4HXV A;  4GWY A;  4XEQ A;  3IFC A;  4AS4 A;  2V3Q A;  4O94 A;  1FPD A;  4OVP A;  4PF8 A;  4OAN A;  4OVQ A;  2PFY A;  3RYD A;  1NV2 A;  3MYU A;  5DW8 A;  4MIJ A;  4N8G A;  4NG7 A;  4PF6 A;  4O7I A;  4YIC A;  4DI3 D;  5ESY A;  3RPL A;  2PFZ A;  4OVS A;  4N15 A;  1NUZ A;  4DI4 B;  4NGU A;  1NV5 A;  4MAG A;  2VPO A;  1FBG A;  4P8B A;  4PE3 A;  4PAI A;  4KXP A;  5IZ3 A;  1FPE A;  1IMD A;  4UAB A;  3KC0 A;  2GQ1 A;  3T0J A;  4NN3 A;  1LBX A;  2OWZ A;  1KA0 A;  5EQ8 A;  1FPJ A;  5F24 A;  5LTC A;  1FJ6 A;  4PDH A;  4NAP A;  3EKI A;  1FPF A;  2DE2 A;  3E79 A;  3SZP A;  4N6D A;  1YXI A;  2DE3 A;  1NV3 A;  4MNP A;  4GWW A;  1CNQ A;  1IME A;  1EYK A;  4PGP A;  1AWB A;  1FSA A;  5IZ3 B;  4MCO A;  2B4L A;  4P3L A;  4HCW A;  2KR0 A;  3LUZ A;  4I3E A;  3B50 A;  4M1V A;  4MHF A;  4F1U A;  5IZ1 A;  5CM6 A;  3A29 A;  3FXB A;  1FPK A;  3BIH A;  1FBF A;  1NUX A;  2WEF A;  3B8B A;  2CZI A;  4GWZ A;  2MKZ A;  1FPL A;  1NV4 A;  2VPN A;  4MNC A;  5I5P A;  2Q8M A;  4MEV A;  2P3N A;  2DDK A;  2DVZ A;  4JVC A;  4NX1 A;  5I7I A;  1IMF A;  1FBC A;  4N81 A;  2CEY A;  2CZH A;  4HE2 A;  2ZZW A;  4PFR A;  4QXD A;  4HCY A;  3W9V A;  4F18 A;  5T3J A;  1YZ0 A;  2HXR A;  1IMB A;  4F19 A;  3HFU A;  2FVZ A;  4O8M A;  4NF0 A;  4N8Y A;  1DCU A;  4XF5 A;  4GBW A;  1K9Y A;  5IZZ A;  5ET7 A;  1XI6 A;  4N17 A;  1FTA A;  2PCR A;  2Y5K A;  1KA1 A;  5IM2 A;  4G61 A;  2F3D A;  5ET8 A;  2QVV A;  5A5L A;  2B4M A;  1D9Q A;  3BIG A;  4PBH A;  4QBA A;  5J16 A;  3RPL B;  2F5X A;  4JVI A;  1KZ8 A;  1FPI A;  5EYG A;  4X8R A;  4AS5 A;  4PBQ A;  2WBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...