1LBXA

Crystal structure of a ternary complex of dual activity fbpase/impase (af2372) from archaeoglobus fulgidus with calcium ions and d-myo-inositol-1-phosphate
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
252
structure length
252
Chain Sequence
MDERDALRISREIAGEVRKAIASMPLRERVKDVGMGKDGTPTKAADRVAEDAALEILRKERVTVVTEESGVLGEGDVFVALDPLDGTFNATRGIPVYSVSLCFSYSDKLKDAFFGYVYNLATGDEYYADSSGAYRNGERIEVSDAEELYCNAIIYYPDRKFPFKRMRIFGSAATELCFFADGSFDCFLDIRPGKMLRIYDAAAGVFIAEKAGGKVTELDGESLGNKKFDMQERLNIVAANEKLHPKLLELIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fructose 1,6-bisphosphatase/inositol monophosphatase
publication title Crystal structure of a dual activity IMPase/FBPase (AF2372) from Archaeoglobus fulgidus. The story of a mobile loop.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 79
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2002-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1lbxA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1lbxA02
1Q9DA 5EQ7A 1FPEA 4I3EA 2QVVA 1FPLA 4AS4A 4H46A 2WBDA 2OX3A 4I3YA 3IFAA 4GWWA 5EYGA 5A5LA 4GX3A 1FPKA 1KA1A 1LBWA 1FPJA 2F3BA 3KC1A 3QMFA 4HE2A 1EYKA 4MJOA 2FIEA 1D9QA 4N81A 2Q8MA 1FBPA 5ET6A 1NV0A 5EYHA 1IMDA 1KA0A 2CZHA 2Y5KA 1FBFA 1K9YA 2WBBA 4GX6A 1QGXA 2QVRA 1DK4A 5LDZA 5F24A 1AWBA 5T3JA 3RYDA 2CZIA 4GX4A 1RDZA 2WEFA 5I3SA 4G61A 1NUZA 4GBVA 1YYZA 5ET7A 5ESYA 5EQAA 1G0HA 3LUZA 1LEVA 1JP4A 1FPGA 1SPIA 2R8TA 4IR8A 2F3DA 3ROJA 2P3NA 1NV7A 1NV2A 5J16A 4GWSA 2GQ1A 1K9ZA 5DW8A 1DBZA 5EQ9A 3T0JA 3B8BA 5ET5A 3BIGA 5IZ3B 1IMFA 3KC0A 1FPBA 2FVZA 2OWZA 2JJKA 1YXIA 5IZ1A 1IMAA 1LBYA 2FIXA 1NI9A 1NUXA 1LBXA 2DDKA 4I40A 4GBWA 1FSAA 3RPLB 4PTKA 4HXVA 2Y5LA 3LV0A 1G0IA 4HE1A 1FBEA 1NV3A 2QFLA 2CZKA 5EQ8A 1FBGA 1LBVA 1FPDA 1NUYA 3KBZA 2FBPA 1NV1A 4FBPA 5FBPA 1BK4A 1NV6A 2FHYA 1YZ0A 2HHMA 1FTAA 4GWYA 4KXPA 1FJ6A 1NUWA 1NV4A 1FBDA 1IMEA 1LBZA 2BJIA 4GWZA 1INPA 3D1RA 3A29A 1RDXA 1KZ8A 4AS5A 1IMBA 4HE0A 4GWUA 1EYIA 4GWXA 1DCUA 2QVUA 1VDWA 1CNQA 5IZ3A 1FBCA 2Q74A 1FRPA 1EYJA 1IMCA 1RDYA 3FBPA 1FPIA 3IFCA 1FBHA 3BIHA 4O7IA 2PCRA 2VT5A 4QXDA 1FJ9A 5ET8A 2P3VA 1NV5A 3RPLA 1XI6A 1FPFA 4H45A
chains in the Genus database with same CATH superfamily
1IXHA 1N3WA 3TTMA 4P11A 1Y3PA 3M3LA 4OXVA 4P3LA 4GX3A 1XVXA 1MY1A 2D21A 2UVJA 2Q8MA 5ET6A 3Q26A 4KD5A 4F3SA 2QS2A 4KFQA 3VXBA 2QVRA 3OEMA 3GLBA 2I0BA 5H8NB 3IO4A 1ZMGA 4U4XA 1D9YA 1YYZA 3FJ7A 2X26A 1G0HA 4U1OA 1SPIA 3ROJA 4PFTA 3TELA 4XF5A 1MQDA 1MPDA 1PB8A 4ISUA 4E0XA 3PUXE 3R26A 4YMBA 3G3KA 5TPAB 2PT2A 2DVCA 5CBRA 3TTRA 1R9QA 1USYE 1XS5A 3G3HA 1UTBB 1AL3A 1RYXA 3N6UA 1B40A 2FBPA 2RC8A 3IB1A 1UTHB 5JTYA 4UABA 3IO6A 1FQDA 3HHGA 1BTJA 4KI0E 3TTKA 1FBDA 3FGSA 2P0SA 4YKPA 3DP8A 4FIMA 3O6IA 1N7XA 1EZOA 4H8JA 2XXHA 4TLLB 2ZNSA 3LSWA 4PBQA 4PAFA 2KR0A 1FPEA 3V89B 4I62A 3K6UA 3LSFB 5CM6A 2PFZA 2F7CA 5JTYB 4I3YA 3C33A 3D4GA 1Q35A 4F1VA 3KC1A 2F7BA 4NN3A 3QXMA 3MP8A 2XHDA 4POWA 4MMPA 3P7IA 4H5GA 1MY4A 2XWKA 3LC8A 2QRYA 5HBCA 3PMXA 1AWBA 5T3JA 3VVDA 2AYSA 3OOAA 4GBVA 3IJOB 4OETA 4IY5A 5ELVA 1B6HA 2B3FA 3HV1A 4PGNA 2ZYMA 3TQWA 3C31A 4EF1A 1R9LA 4O3CA 3G7WA 3IK6B 4H1XA 1FPBA 2FVZA 1GVCA 4I1DA 3E9XA 3FZVA 3Q27A 1QUJA 1SDXA 2V84A 2ZZWA 4YZZA 2Q88A 3BFUA 4LATA 1NKXA 3H6TA 4OEVA 4PFUA 2HFBA 3QUFA 3KN8A 1SI1A 5FBPA 4FATA 3IB2A 4G8NA 2BJIA 3SZPA 4NEDA 1NL5A 2OK2A 1FBCA 1FRPA 4PFWA 4DZ1A 1H45A 3IFCA 2NVUB 3TFLA 3IL1B 1FJ9A 2P3VA 1NV5A 1XI6A 4GD5A 4QFLA 5CMBA 3HSTA 4KCDA 2M8CA 3KGCA 1WDNA 3SETA 1KWHA 5I59A 1OIBA 1Y3QA 4POXA 4N6KA 1OLAA 2OPEA 1M5BA 1PBQA 2F6PA 4HS7A 2NXOA 3K6WA 3O6HA 4G2ZA 1JEUA 2WBBA 5I2NA 3KG2A 3RPWA 3PD9A 2PX1A 5KDTB 3PPQA 1UQWA 2WKYA 3S9MC 3DLNA 5ET7A 2QL3A 5ESYA 4H65A 1YCJA 2O68A 1FQFA 2XXKA 5FTIA 4DI4B 1OQHA 4YB5A 2ONRA 1XHYA 1K9ZA 1B4HA 2X7QA 4LONB 2G93A 1B7UA 3PUYE 2XD3A 3UK4A 3QIMA 4O94A 3KOSA 2P1SA 2QS3A 1SYHA 1PEBA 4NF5B 5DT6A 2OWTA 2Z23A 4O3AA 5I58B 1N7WA 2V3TA 4G77A 4P47A 3USDA 4K3FA 3PU5A 4IO5A 1IMCA 1FBHA 3ILUB 3I5OA 4DLDA 4RY1A 2DYXA 3JV9A 5H8FA 1LGBC 1B3FA 4EQBA 2ZZVA 1ZJLA 4OHNA 4WXJA 3FJMA 4NF8B 3C34A 1MM6A 4DXCA 1ATGA 4XKQA 5I84A 1I69A 1MQJA 2HXRA 4OFOA 3CG1A 3OEKA 3TTLA 4MLQA 3EKIA 2VD2A 1D9QA 1ZKBA 3CG3A 4KYDA 3TPAA 4NGUA 4GQOA 2HAVA 1DK4A 3OO9A 3UA8A 1FQEA 2XXWA 2A5TA 3IX1A 2WEFA 3MJNA 3R7XA 4QSEA 4P1EA 4IY6A 3KEIA 3U92A 1Y9UA 3T9UA 4PBHA 1DTGA 3FV1A 4G4PA 1B9JA 4F29A 1IXIA 3HO7A 2AL4A 1NMUA 4PDHA 4AB5A 5EQ9A 4OVTA 1IMFA 5KCJB 2ZNTA 1B3HA 2GHBA 2RINA 1DPPA 4PTKA 3PD8A 1PB9A 3TQLA 2MKZA 3QSLA 1NV3A 2F78A 4PFBA 1MXZA 2P2AA 1MRPA 4X04A 4XEQA 3EN3A 2ZYKA 4R6KA 4R72A 3I6VA 4ZEKA 1LCFA 2XXPA 4NF6A 1BP5A 1J1NA 1DOTA 5DVIA 5AA2D 4GRKA 1OLCA 4AS5A 1IMBA 4YKJA 4HE0A 3TODA 1EYIA 4N8GA 1RKMA 3O6GA 2Q74A 4PE3A 2O69A 4ZDMA 2VPNA 3IOVA 2HEUA 2V3QA 1Q9DA 5EQ7A 2I4BA 3CFXA 3CRBA 4WEDA 1NH7A 4L17A 4UA8A 2G29A 1KA1A 1DPEA 2E0SA 2WX9A 3O97A 4R6YA 1CB6A 3MBPA 2AL5A 3CFZA 3GYYA 2OZZA 1LLSA 2XXIA 1B52A 3PUVE 1MXXA 4GFRA 2H98A 5TP9A 4F31B 4BDOA 2YLNA 4R75A 2R8TA 4IR8A 2F3DA 3O9PA 2DP8A 2DWHA 4QSCA 1USYH 1NV2A 4RYAA 1MDQA 1HSEA 3FASA 3LSXA 4QBAA 1O63A 1LBXA 2X7PA 4JBZA 2L5VA 3I3VA 2Z8EA 1FSAA 2RF1A 1B51A 1RYOA 4P0GA 1SI0A 4KYEA 1PBPA 4OEUA 3NOHA 3ISPA 1H44A 5CI5A 1FTJA 4DCYA 5LOMA 1FJ6A 2OJTA 1SW4A 4FORA 4JWXA 3GZGA 1CNQA 3K6VA 2CEYA 4ZE8A 5I57A 3C32A 3MWBA 2IA4A 1US5A 1IITA 1FPFA 4RXLA 1POY1 1MH4A 3K1MA 4I3EA 1M5CA 2O1MA 3ZKLA 3IFAA 4YAHX 3TYHA 1OMPA 3U1OA 4MIJA 3QMFA 5I7IA 5LTCA 3CSBA 3N94A 4U4SA 3SEWA 4MX6A 1KA0A 3L6HA 3TZAA 2QS1A 2FA7A 2WYKA 1JEVA 4EUOA 2VGQA 4PFRA 3K0VA 1GV8A 3T93B 4ZEDA 2XA5A 3OO8A 2UVHA 1ANFA 3K1PA 1II5A 1CE2A 4DE8A 3LUYA 2XWIA 3RUMA 2P3NA 4EXLA 2GQ1A 1IIWA 5ITPA 4JSOA 4QFNA 2KLFA 3M3FA 4JVIA 1LBYA 4G8MA 2DE4A 1LAXA 2UXAA 4GXSB 4G8HA 1VFDA 3C4MA 3CHGA 4HCYA 3TEPA 3T9VA 4MBPA 4PAKA 2DWAA 4IGRA 4NX1A 3WAFA 4E0WA 5L8DA 3UP9A 4MEVA 1D9VA 4ELPA 4P8BA 1TFAA 4GWZA 2ABHA 1MS7A 1DCUA 4X9TA 5AA4A 1JETA 4R74A 2Y7RA 2UYEA 3BIHA 3TMGA 4O7IA 3DM0A 4IB2A 1B2HA 1UIUA 5IAIA 3W9VA 1FPLA 2GRVA 4AS4A 5DEXA 4ZECA 1TFDA 1FPKA 2QSXA 2HZKA 2XD2A 3K4UA 1FQCA 3EHTA 4DXUA 3K1NA 4OVPA 2F36A 2ONKE 2PBWA 1A99A 1B05A 3T1BA 5AA3A 1MXUA 5JEIA 2Z22A 4ZE9A 2XXYA 4M4GA 2OPDA 5L9MA 3OMBA 3S2VA 3G3IA 5J16A 5DVJA 3PPOA 2ZNUA 3U94A 3A09A 5IZ1A 4U21A 1IMAA 4XFEA 3K2DA 4R9GA 3E79A 3H06B 3U8QA 4ESWA 1MQGA 2GHAA 4HE1A 1QKAA 4OERA 1LFGA 1B7HA 5EQ8A 4JDFA 3DP4A 4YMAA 3U72A 3N5LA 2I58A 4F3BA 2RCBA 5H8QA 3OXNA 4FBPA 2F6GA 3G3FA 3WAEA 2FHYA 1YZ0A 3A3UA 2HHMA 2O51A 5DTBA 2QJEA 5DYHA 4N4UA 2QS4A 3CFLA 4BDQA 2Q89A 2DXRA 1H76A 5IZ3A 1TT1A 4EXKA 2HCAA 3SEVA 3T96B 2PCRA 2F97A 2HQ0A 2XX9A 3S4UA 3T9HB 3GBAA 4GL0A 1D4NA 3IJXB 5CBSA 4DI3D 2PT1A 4M1VA 3H03A 4C1TA 4XXUA 4G68A 1B5JA 2ZZXA 3G3GA 4R73A 3EQ1A 1P1OA 3RTFB 3IR1A 3SKPA 3EPEA 1QGXA 1Y1ZA 4GF8A 4ND9A 4EDPA 4LVQA 4OZ9A 2XXXA 4RJZA 4NQ8A 1VFEA 3FXRA 3JYRA 3KN3A 5EQAA 3S9EA 3S9NC 3DP6A 3H7MA 1VE4A 5J1DA 1QULA 1NV7A 3C36A 3B8BA 1POTA 3BIGA 1QKBA 4X1BA 1NI9A 4IO7A 1R6ZA 1US4A 2I0CA 4I40A 2I6EA 4OQOA 1JQFA 2I49A 4OESA 1B0LA 3FV2A 5I59B 3IB0A 4MH5A 4F39A 1NUYA 4HW8A 4TOZA 1T0KA 3RY3A 4FJPA 4RNSA 4NE4A 4OYVA 4ELQA 4GWYA 4KXPA 1NUWA 1Z7ME 3FIRA 2XXRA 1MPCA 2H99A 4H67A 3D1RA 5I2NB 3A29A 2E1SA 2F7AA 3BBRA 3FXUA 3H6WA 3VV5A 1Y4CA 5AE4A 1LBBA 3SEXA 4AB6A 3FBPA 3RT6B 1MG1A 4F2OA 4IO6A 2O7IA 1IXCA 4GOTA 4XKPA 1WODA 3MPKA 2QVVA 2RC9A 3CSGA 3VFJA 2V93A 1HSJA 1FQAA 2CMOA 2OX3A 4GWWA 2YJPA 1S7YA 2VPOA 3VE1B 2THIA 3B6QA 3E78A 4KR5A 1MPBA 1URSA 4MJOA 2FIEA 4BDMA 4YKIA 4ZZAA 3ZSFA 5AA1A 2AIXA 2ALUA 3THIA 2Y5KA 2NOOA 4GLIA 1QW0A 5FHNA 4JB7A 3PV0E 3MW0A 4P9KA 2BJJX 1SBPA 1RDZA 2UYFA 3RGYA 4OFJA 3KZGA 2Q2CA 1MY3A 3LUZA 5K2YA 3PUZE 4LUBA 3DELB 1SW1A 2R9JA 5DW8A 1OQGA 3T0JA 4R2FA 4ZZEA 3KC0A 1DSNA 3CIJA 4NG7A 2HAUA 3IOWA 5H8FB 3MZBA 5A5XA 2W7YA 4N8YA 1SQYA 2QFLA 3KN7A 3O29A 3UGWA 3K00A 3OO6A 3KSXA 2GH9A 3MVYA 2Y7KA 1YTVA 4R2BA 2H5YA 4PAIA 4ZS9A 4ELOA 2XXTA 3TKDA 4MHFA 3OELA 3IOTA 4FAJA 2UVIA 3HHFA 5CRYA 2WYPA 4I8CA 2A5TB 1Y4TA 4BDNA 1P99A 2XXQA 5EHMA 5L9SA 1A54A 4PP0A 5F7VA 4KYSA 4IGTA 2XWVA 4RPOA 4PDDA 2R6GE 2I3VA 2WBDA 2F34A 4OANA 2DXYA 3KJTA 4IO2A 1I6QA 3UORA 1P1UA 2REJA 2YPNA 1NV0A 3OENA 4H0WA 5I5PA 4NTLA 2F8DA 1D3KA 4N13A 2XXUA 5LDZA 3C9HA 2R71A 4O3BA 1MDP1 5DVFA 1JNFA 1HSLA 4MAGA 3HFUA 1EZ9A 2QMXA 4NF6B 1A8EA 3PPRA 1QUKA 4LN5A 4XKNA 3UIFA 1AIVA 4G68C 5FHMA 3MUQA 4LZ5A 1DBZA 3HN0A 1NNPA 2RCAA 4JVCA 2O84X 1ZBMA 4F2QA 3CI8A 4OTEA 2OBGA 5AA2A 3FXBA 4GBWA 2ANJA 2CZKA 1LBVA 1GTKA 3CR9A 1MH3A 4R9FA 2KQZA 4JXIA 4GXAA 3ILTB 4QFKA 1SW5A 4N6PA 5FHOA 1B0HA 1URDA 3O2AA 3R6UA 3GXAA 4GVOA 1LBCA 3RTWB 2QVUA 5I56A 4QSDA 4LP2B 5F1QA 4Q5TA 5AA2B 4OFLA 2V4CA 3OO7A 1MQHA 1B3LA 3E3KA 4PGPA 4ZEIA 5TP9B 3MPLA 5ET8A 4ECFA 4PC9A 1IQ7A 3RPLA 4H45A 3N6TA 4Z7EA 1SYIA 3TTNA 4EQ7A 1MXYA 3MZ9A 2VHAA 1LFHA 4XIGQ 3PUWE 3SEYA 3LR1A 3ONMA 3E13X 3B6TA 3MVWA 3MC2A 1R1NA 5CC2A 5H8HA 1K9YA 3V8XB 3W15C 3E4RA 3SERA 1O7TA 1B3GA 4RK9A 3RYDA 3KBRA 1Z7NE 4X48A 2DQVA 1LAFE 3JZJA 3VLWA 2HZLA 1FPGA 3KSJA 5I2KA 3OD7A 4GWSA 2XX7A 1FTMA 5ET5A 4PQJA 2JJKA 1PB7A 3CVGA 5H8HB 1LSTA 5I57B 1QUIA 2PFYA 2O6AA 4WKMA 4YB7A 1NUXA 2DDKA 1LAHE 3QUJA 2PMSA 3TAJA 4RK2A 2ZYNA 3PPPA 3SEUA 1FPDA 4F1YA 5H8NA 1NV1A 5L9OA 3MVZA 1S50A 5EHSA 1IMEA 3VVFA 2ESNA 4AQ4A 3Q25A 1VDWA 2RKMA 3KFMA 1H43A 1EYJA 3C35A 4OA4A 1RDYA 1A7LA 5TPAA 2ONSA 2HXWA 4FE8A 3N26A 2B4LA 1L5TA 1UTBA 1B5IA 2CEXA 4LA9A 4F22A 3RNNA 1UTHA 5M2VA 3AXFA 3Q28A 2D5WA 2NUVA 1B3EA 1IMDA 4KCCA 4KQPA 3K02A 5BWJA 3H3GA 2D3IA 2XXVA 5F24A 1TXFA 1O64A 2Z8DA 4P56A 1B1HA 2F5XA 1FTOA 3RT8A 2I4CA 3MSTA 4U23A 1EH3A 3VLUA 1JW4A 4F19A 3QYTA 1SW2A 2NWJA 3EHUA 2OLBA 2ZMBA 3PMWA 1F9BA 5AA4B 4OVRA 2A5SA 1WVJA 4JWOA 1YXIA 5K2XA 2V3UA 2O7UA 4Q30B 1DTZA 3PMVA 1SD3A 2B4MA 4QF9A 3F11A 3W9WA 3FJGA 1BIYA 1P1NA 5DEXB 4MCOA 3ODBA 1FCKA 3KBZA 1M5EA 3HPIA 3K6XA 1N3XA 4OENA 4Q8RA 1NH8A 1BK4A 3H6UA 4DIGA 1PDAA 4O7MA 1ZTYA 4X8RA 1LBZA 2DVZA 3U65A 2V25A 4YB6A 2QMWA 4N07A 4PF6A 3EF7A 3TCFA 4MFIA 4U2RA 2UVGA 4ONYA 4GL8A 4PETA 2DOJA 4DXBA 4JSDA 1Y1MA 5ISUA 4OWDA 5ITOA 1XOCA 5EYGA 4QFOA 1IXGA 4N15A 4TQUQ 4JVDA 1JW1A 4BDLA 1A55A 1N76A 5HPQA 3VXCA 1FBPA 1FTKA 4P0IA 1FBFA 1Y20A 5H8SA 4RPNA 4QHQA 1DMBA 4X1DA 4MF3A 5H8QB 4G61A 3BFTA 3B50A 5IGAA 1LEVA 4TLMB 5HM4B 4F3GA 4UACA 2XX8A 4WEPA 4I9DA 4FEDA 1Y3NA 1URGA 4EF2A 2O1LA 3FATA 5IZ3B 1A40A 3VLVA 2H9BA 3TCGA 4C1UA 4NWDA 3B6WA 4HCWA 3RLFE 4DDDA 3TDJA 5KDTA 4PE5B 2DE2A 1B32A 4YKKA 4PFYA 4F18A 1JVXA 1B1XA 1MXVA 4FEBA 4G68B 1FTAA 2Y7IA 3PGFA 4H8IA 4OVQA 1RDXA 4LZ8A 4U22A 4GWXA 1GR2A 3OSQA 2Q8JA 2PYYA 3T9XB 3H6VA 4GWOA 4QXDA 4YU0A 1A8FA 3T66A 1LAGE 1P1QA 1M5DA 3FVKA 3PTYA 4H46A 4NF5A 5IKBA 3FVNA 4LQ5A 1VSOA 5A5LA 1N84A 1EZPA 2F3BA 3BKIB 4N81A 1MY2A 2VOZA 5I58A 5EYHA 3H4ZA 3SESA 2CZHA 4N91A 3VDFA 4GX6A 1BKAA 2HPGA 2QPQA 2CZIA 1ZIUA 3LSLA 1NNKA 4YICA 5CMKA 2OCUA 1MY0A 1JP4A 1LFIA 1NNFA 5CMCA 1M5FA 4NF8A 2B65A 3B7DA 4C0RA 3S9LC 2OWZA 2FIXA 3G3JA 3ECRA 1ZLQA 3LV0A 2CZLA 4NMYA 4O8MA 5B70A 1VR5A 4P1LA 1TWYA 3IOUA 2DE3A 3RN8A 2IEEA 2XWOA 5JK4A 2Y7WA 4PF8A 1AOVA 4DCXA 2H25A 1IZ1A 3GBBA 1ELJA 1OVBA 3D4CA 3O66A 2LAOA 3SDFA 3VVEA 1PC3A 4MLVA 5KCJA 5KZTA 1FPIA 2DS9A 1QJMA 2VT5A 1IEJA 2PVUA 3K01A 3MQ9A 3T22A 2Y84A 3TUSA 3FVGA 1AMFA 3MP6A 4F3PA 1LBWA 1FPJA 1N04A 1YPNA 5EYFA 5A5XB 4NAPA 1LB9A 5TU0A 3FVOA 1FQBA 4XKRA 5FTHA 2DWIA 3FXQA 2ZYOA 1B5HA 5I3SA 4PCDA 1B7ZA 1NUZA 3M3KA 3QK6A 2Q2AA 4QFPA 4ZEFA 1XT8A 1H3DA 1XC1A 5B7DA 3IAZA 4ZEBA 4IO3A 2Q9TA 1LCTA 2VD3A 3KOTA 3L6GA 1S9TA 4Z0IA 1FTLA 1UIVA 2GFEA 1FW0A 4PFIA 4EQ9A 4R6HA 4HXVA 2Y5LA 1G0IA 4QRZA 4HTGA 2FNCA 3O28A 2I48A 3Q29A 4THIA 2I3WA 4GIZA 4OMBA 3UN6A 4H6DA 1NV6A 1BLFA 2F35A 1B46A 1I6AA 3ZKKA 1NFTA 3FUZA 2FYIA 1KZ8A 4ELRA 4GWUA 1JW5A 3FD3A 5CMMA 4OVJA 1P1WA 4N6DA 1YAEA 4MNPA 4JWYA 1SVXB 4LQ2A 4MNCA 4NHBA 4ESXA 4F1UA 1I6BA 1MXWA 2ZXTA 3KJ7A 4H5FA 4NF4A 2VP1A 5IZZA 3PPNA 4N17A 3MP1A 4XTCQ 1NNTA 1N0TA 4HE2A 1EYKA 3U93A 3M8UA 3MZ1A 4IO4A 1ZU0A 4RA1A 2H4IA 1QVSA 4BDRA 4KPTA 2OWSA 4GX4A 1GGGA 1Q1KA 2B3BA 3MVXA 1LB8A 4BLAA 2Z8FA 4NF4B 1XVYA 5ICQA 3EHSA 4FECA 5I56B 2DSFA 3MYUA 1IUDA 1MM7A 4U1ZA 2DWJA 3MAMA 4MNIA 1B58A 4OVSA 3RPLB 1MQIA 5ICTA 1JVYA 4NF0A 3RQTA 4KHZE 1FBEA 1OVTA 2Y7PA 3IORA 1FBGA 3HCQA 4NWCA 3A3CA 5IM2A 3LBSA 4LZ7A 3OSRA 5BUUA 1NV4A 1EU8A 3V83A 1B4ZA 1INPA 2REGA 4Q0CA 2RC7A 3V5AA 3ZS6A 3QAXA 1AH5A 5I2KB 3TCHA
chains in the Genus database with same CATH topology
1Q9DA 5EQ7A 2QVVA 2OX3A 5EYGA 4GWWA 4P3LA 4GX3A 4N15A 1KA1A 2VPOA 4JVDA 3E78A 4MJOA 2WX9A 2FIEA 2Q8MA 1FBPA 5ET6A 2Y5KA 1FBFA 3GYYA 2QVRA 4P9KA 1RDZA 4G61A 1YYZA 1G0HA 3LUZA 3B50A 1LEVA 5IGAA 1SPIA 2R8TA 4IR8A 2F3DA 3ROJA 4XF5A 1NV2A 5DW8A 3T0JA 5IZ3B 3KC0A 4QBAA 1LBXA 4NG7A 2L5VA 1FSAA 4HCWA 4N8YA 2QFLA 2DE2A 2FBPA 3NOHA 3ISPA 4PAIA 4UABA 4F18A 1FTAA 1FJ6A 4MHFA 1FBDA 4OVQA 1RDXA 2WYPA 4GWXA 1CNQA 2CEYA 4QXDA 4PBQA 4PAFA 1FPFA 2XWVA 2KR0A 1FPEA 4I3EA 4PDDA 5CM6A 2PFZA 3PTYA 4H46A 2WBDA 4I3YA 3IFAA 5A5LA 4OANA 4F1VA 4MIJA 2F3BA 3KC1A 3QMFA 5I7IA 5LTCA 4NN3A 4N81A 1NV0A 5EYHA 4MX6A 1KA0A 2CZHA 5I5PA 4N91A 4MMPA 4GX6A 2XWKA 2WYKA 5LDZA 2HPGA 1AWBA 2QPQA 5T3JA 4PFRA 2CZIA 2XA5A 4GBVA 4YICA 4MAGA 3HFUA 1JP4A 4LN5A 4PGNA 2XWIA 2P3NA 2GQ1A 1DBZA 1FPBA 2FVZA 2OWZA 4JVIA 1LBYA 4JVCA 2FIXA 2DE4A 3FXBA 4GBWA 2ZZWA 4YZZA 3LV0A 4O8MA 2CZKA 3CHGA 4HCYA 4P1LA 2DE3A 1LBVA 2XWOA 4PAKA 5JK4A 2KQZA 4NX1A 4PF8A 5FBPA 4MEVA 4P8BA 4GWZA 2BJIA 3SZPA 1DCUA 2QVUA 4X9TA 1FBCA 1FRPA 1FPIA 3IFCA 2V4CA 3BIHA 4O7IA 2VT5A 4PGPA 1FJ9A 5ET8A 2P3VA 1NV5A 4PC9A 3RPLA 1XI6A 4H45A 3W9VA 1FPLA 4AS4A 1FPKA 4N6KA 1LBWA 1FPJA 2HZKA 4OVPA 1K9YA 4NAPA 2WBBA 3RYDA 5I3SA 3T1BA 4PCDA 1NUZA 5ET7A 5ESYA 2HZLA 2XXKA 1FPGA 4DI4B 2Q9TA 5J16A 4GWSA 1K9ZA 5ET5A 5IZ1A 2JJKA 1IMAA 4XFEA 2PFYA 1NUXA 2DDKA 3E79A 4PFIA 4HXVA 2Y5LA 4O94A 1G0IA 4HE1A 5EQ8A 1FPDA 1NV1A 4FBPA 1NV6A 2FHYA 1YZ0A 2HHMA 4N4UA 1IMEA 4P47A 1KZ8A 4GWUA 1VDWA 5IZ3A 1EYJA 1IMCA 4OA4A 1RDYA 1FBHA 2PCRA 4N6DA 2B4LA 4MNPA 4MNCA 4NHBA 2ZZVA 4F1UA 4DI3D 2CEXA 2HXRA 5IZZA 4N17A 4M1VA 4HE2A 1EYKA 3EKIA 1D9QA 2ZZXA 1IMDA 4NGUA 1QGXA 1DK4A 5F24A 4P56A 2F5XA 4GX4A 2WEFA 4NQ8A 4P1EA 3MSTA 5EQAA 4PBHA 4F19A 5J1DA 1NV7A 4PDHA 5EQ9A 4OVTA 3B8BA 3BIGA 1IMFA 4OVRA 1YXIA 3MYUA 1NI9A 2B4MA 4MNIA 3W9WA 4I40A 4OVSA 3RPLB 4PTKA 2MKZA 4NF0A 1FBEA 1NV3A 1FBGA 4PFBA 4MCOA 4X04A 1NUYA 3KBZA 4XEQA 1BK4A 5IM2A 4O7MA 4GWYA 4X8RA 4KXPA 1NUWA 1NV4A 1LBZA 2DVZA 1INPA 3D1RA 3A29A 4AS5A 1IMBA 3U65A 4HE0A 1EYIA 4N8GA 2Q74A 4PF6A 3FBPA 4PE3A 2VPNA 2V3QA 4PETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q9D A;  5EQ7 A;  1FPE A;  4I3E A;  2QVV A;  1FPL A;  4AS4 A;  4H46 A;  2WBD A;  2OX3 A;  4I3Y A;  3IFA A;  4GWW A;  5EYG A;  5A5L A;  4GX3 A;  1FPK A;  1KA1 A;  1LBW A;  1FPJ A;  2F3B A;  3KC1 A;  3QMF A;  4HE2 A;  1EYK A;  4MJO A;  2FIE A;  1D9Q A;  4N81 A;  2Q8M A;  1FBP A;  5ET6 A;  1NV0 A;  5EYH A;  1IMD A;  1KA0 A;  2CZH A;  2Y5K A;  1FBF A;  1K9Y A;  2WBB A;  4GX6 A;  1QGX A;  2QVR A;  1DK4 A;  5LDZ A;  5F24 A;  1AWB A;  5T3J A;  3RYD A;  2CZI A;  4GX4 A;  1RDZ A;  2WEF A;  5I3S A;  4G61 A;  1NUZ A;  4GBV A;  1YYZ A;  5ET7 A;  5ESY A;  5EQA A;  1G0H A;  3LUZ A;  1LEV A;  1JP4 A;  1FPG A;  1SPI A;  2R8T A;  4IR8 A;  2F3D A;  3ROJ A;  2P3N A;  1NV7 A;  1NV2 A;  5J16 A;  4GWS A;  2GQ1 A;  1K9Z A;  5DW8 A;  1DBZ A;  5EQ9 A;  3T0J A;  3B8B A;  5ET5 A;  3BIG A;  5IZ3 B;  1IMF A;  3KC0 A;  1FPB A;  2FVZ A;  2OWZ A;  2JJK A;  1YXI A;  5IZ1 A;  1IMA A;  1LBY A;  2FIX A;  1NI9 A;  1NUX A;  1LBX A;  2DDK A;  4I40 A;  4GBW A;  1FSA A;  3RPL B;  4PTK A;  4HXV A;  2Y5L A;  3LV0 A;  1G0I A;  4HE1 A;  1FBE A;  1NV3 A;  2QFL A;  2CZK A;  5EQ8 A;  1FBG A;  1LBV A;  1FPD A;  1NUY A;  3KBZ A;  2FBP A;  1NV1 A;  4FBP A;  5FBP A;  1BK4 A;  1NV6 A;  2FHY A;  1YZ0 A;  2HHM A;  1FTA A;  4GWY A;  4KXP A;  1FJ6 A;  1NUW A;  1NV4 A;  1FBD A;  1IME A;  1LBZ A;  2BJI A;  4GWZ A;  1INP A;  3D1R A;  3A29 A;  1RDX A;  1KZ8 A;  4AS5 A;  1IMB A;  4HE0 A;  4GWU A;  1EYI A;  4GWX A;  1DCU A;  2QVU A;  1VDW A;  1CNQ A;  5IZ3 A;  1FBC A;  2Q74 A;  1FRP A;  1EYJ A;  1IMC A;  1RDY A;  3FBP A;  1FPI A;  3IFC A;  1FBH A;  3BIH A;  4O7I A;  2PCR A;  2VT5 A;  4QXD A;  1FJ9 A;  5ET8 A;  2P3V A;  1NV5 A;  3RPL A;  1XI6 A;  1FPF A;  4H45 A; 
#chains in the Genus database with same CATH topology
 1IXH A;  1N3W A;  3TTM A;  4P11 A;  1Y3P A;  3M3L A;  4OXV A;  4P3L A;  4GX3 A;  1XVX A;  1MY1 A;  2D21 A;  2UVJ A;  2Q8M A;  5ET6 A;  3Q26 A;  4KD5 A;  4F3S A;  2QS2 A;  4KFQ A;  3VXB A;  2QVR A;  3OEM A;  3GLB A;  2I0B A;  5H8N B;  3IO4 A;  1ZMG A;  4U4X A;  1D9Y A;  1YYZ A;  3FJ7 A;  2X26 A;  1G0H A;  4U1O A;  1SPI A;  3ROJ A;  4PFT A;  3TEL A;  4XF5 A;  1MQD A;  1MPD A;  1PB8 A;  4ISU A;  4E0X A;  3PUX E;  3R26 A;  4YMB A;  3G3K A;  5TPA B;  2PT2 A;  2DVC A;  5CBR A;  3TTR A;  1R9Q A;  1USY E;  1XS5 A;  3G3H A;  1UTB B;  1AL3 A;  1RYX A;  3N6U A;  1B40 A;  2FBP A;  2RC8 A;  3IB1 A;  1UTH B;  5JTY A;  4UAB A;  3IO6 A;  1FQD A;  3HHG A;  1BTJ A;  4KI0 E;  3TTK A;  1FBD A;  3FGS A;  2P0S A;  4YKP A;  3DP8 A;  4FIM A;  3O6I A;  1N7X A;  1EZO A;  4H8J A;  2XXH A;  4TLL B;  2ZNS A;  3LSW A;  4PBQ A;  4PAF A;  2KR0 A;  1FPE A;  3V89 B;  4I62 A;  3K6U A;  3LSF B;  5CM6 A;  2PFZ A;  2F7C A;  5JTY B;  4I3Y A;  3C33 A;  3D4G A;  1Q35 A;  4F1V A;  3KC1 A;  2F7B A;  4NN3 A;  3QXM A;  3MP8 A;  2XHD A;  4POW A;  4MMP A;  3P7I A;  4H5G A;  1MY4 A;  2XWK A;  3LC8 A;  2QRY A;  5HBC A;  3PMX A;  1AWB A;  5T3J A;  3VVD A;  2AYS A;  3OOA A;  4GBV A;  3IJO B;  4OET A;  4IY5 A;  5ELV A;  1B6H A;  2B3F A;  3HV1 A;  4PGN A;  2ZYM A;  3TQW A;  3C31 A;  4EF1 A;  1R9L A;  4O3C A;  3G7W A;  3IK6 B;  4H1X A;  1FPB A;  2FVZ A;  1GVC A;  4I1D A;  3E9X A;  3FZV A;  3Q27 A;  1QUJ A;  1SDX A;  2V84 A;  2ZZW A;  4YZZ A;  2Q88 A;  3BFU A;  4LAT A;  1NKX A;  3H6T A;  4OEV A;  4PFU A;  2HFB A;  3QUF A;  3KN8 A;  1SI1 A;  5FBP A;  4FAT A;  3IB2 A;  4G8N A;  2BJI A;  3SZP A;  4NED A;  1NL5 A;  2OK2 A;  1FBC A;  1FRP A;  4PFW A;  4DZ1 A;  1H45 A;  3IFC A;  2NVU B;  3TFL A;  3IL1 B;  1FJ9 A;  2P3V A;  1NV5 A;  1XI6 A;  4GD5 A;  4QFL A;  5CMB A;  3HST A;  4KCD A;  2M8C A;  3KGC A;  1WDN A;  3SET A;  1KWH A;  5I59 A;  1OIB A;  1Y3Q A;  4POX A;  4N6K A;  1OLA A;  2OPE A;  1M5B A;  1PBQ A;  2F6P A;  4HS7 A;  2NXO A;  3K6W A;  3O6H A;  4G2Z A;  1JEU A;  2WBB A;  5I2N A;  3KG2 A;  3RPW A;  3PD9 A;  2PX1 A;  5KDT B;  3PPQ A;  1UQW A;  2WKY A;  3S9M C;  3DLN A;  5ET7 A;  2QL3 A;  5ESY A;  4H65 A;  1YCJ A;  2O68 A;  1FQF A;  2XXK A;  5FTI A;  4DI4 B;  1OQH A;  4YB5 A;  2ONR A;  1XHY A;  1K9Z A;  1B4H A;  2X7Q A;  4LON B;  2G93 A;  1B7U A;  3PUY E;  2XD3 A;  3UK4 A;  3QIM A;  4O94 A;  3KOS A;  2P1S A;  2QS3 A;  1SYH A;  1PEB A;  4NF5 B;  5DT6 A;  2OWT A;  2Z23 A;  4O3A A;  5I58 B;  1N7W A;  2V3T A;  4G77 A;  4P47 A;  3USD A;  4K3F A;  3PU5 A;  4IO5 A;  1IMC A;  1FBH A;  3ILU B;  3I5O A;  4DLD A;  4RY1 A;  2DYX A;  3JV9 A;  5H8F A;  1LGB C;  1B3F A;  4EQB A;  2ZZV A;  1ZJL A;  4OHN A;  4WXJ A;  3FJM A;  4NF8 B;  3C34 A;  1MM6 A;  4DXC A;  1ATG A;  4XKQ A;  5I84 A;  1I69 A;  1MQJ A;  2HXR A;  4OFO A;  3CG1 A;  3OEK A;  3TTL A;  4MLQ A;  3EKI A;  2VD2 A;  1D9Q A;  1ZKB A;  3CG3 A;  4KYD A;  3TPA A;  4NGU A;  4GQO A;  2HAV A;  1DK4 A;  3OO9 A;  3UA8 A;  1FQE A;  2XXW A;  2A5T A;  3IX1 A;  2WEF A;  3MJN A;  3R7X A;  4QSE A;  4P1E A;  4IY6 A;  3KEI A;  3U92 A;  1Y9U A;  3T9U A;  4PBH A;  1DTG A;  3FV1 A;  4G4P A;  1B9J A;  4F29 A;  1IXI A;  3HO7 A;  2AL4 A;  1NMU A;  4PDH A;  4AB5 A;  5EQ9 A;  4OVT A;  1IMF A;  5KCJ B;  2ZNT A;  1B3H A;  2GHB A;  2RIN A;  1DPP A;  4PTK A;  3PD8 A;  1PB9 A;  3TQL A;  2MKZ A;  3QSL A;  1NV3 A;  2F78 A;  4PFB A;  1MXZ A;  2P2A A;  1MRP A;  4X04 A;  4XEQ A;  3EN3 A;  2ZYK A;  4R6K A;  4R72 A;  3I6V A;  4ZEK A;  1LCF A;  2XXP A;  4NF6 A;  1BP5 A;  1J1N A;  1DOT A;  5DVI A;  5AA2 D;  4GRK A;  1OLC A;  4AS5 A;  1IMB A;  4YKJ A;  4HE0 A;  3TOD A;  1EYI A;  4N8G A;  1RKM A;  3O6G A;  2Q74 A;  4PE3 A;  2O69 A;  4ZDM A;  2VPN A;  3IOV A;  2HEU A;  2V3Q A;  1Q9D A;  5EQ7 A;  2I4B A;  3CFX A;  3CRB A;  4WED A;  1NH7 A;  4L17 A;  4UA8 A;  2G29 A;  1KA1 A;  1DPE A;  2E0S A;  2WX9 A;  3O97 A;  4R6Y A;  1CB6 A;  3MBP A;  2AL5 A;  3CFZ A;  3GYY A;  2OZZ A;  1LLS A;  2XXI A;  1B52 A;  3PUV E;  1MXX A;  4GFR A;  2H98 A;  5TP9 A;  4F31 B;  4BDO A;  2YLN A;  4R75 A;  2R8T A;  4IR8 A;  2F3D A;  3O9P A;  2DP8 A;  2DWH A;  4QSC A;  1USY H;  1NV2 A;  4RYA A;  1MDQ A;  1HSE A;  3FAS A;  3LSX A;  4QBA A;  1O63 A;  1LBX A;  2X7P A;  4JBZ A;  2L5V A;  3I3V A;  2Z8E A;  1FSA A;  2RF1 A;  1B51 A;  1RYO A;  4P0G A;  1SI0 A;  4KYE A;  1PBP A;  4OEU A;  3NOH A;  3ISP A;  1H44 A;  5CI5 A;  1FTJ A;  4DCY A;  5LOM A;  1FJ6 A;  2OJT A;  1SW4 A;  4FOR A;  4JWX A;  3GZG A;  1CNQ A;  3K6V A;  2CEY A;  4ZE8 A;  5I57 A;  3C32 A;  3MWB A;  2IA4 A;  1US5 A;  1IIT A;  1FPF A;  4RXL A;  1POY 1;  1MH4 A;  3K1M A;  4I3E A;  1M5C A;  2O1M A;  3ZKL A;  3IFA A;  4YAH X;  3TYH A;  1OMP A;  3U1O A;  4MIJ A;  3QMF A;  5I7I A;  5LTC A;  3CSB A;  3N94 A;  4U4S A;  3SEW A;  4MX6 A;  1KA0 A;  3L6H A;  3TZA A;  2QS1 A;  2FA7 A;  2WYK A;  1JEV A;  4EUO A;  2VGQ A;  4PFR A;  3K0V A;  1GV8 A;  3T93 B;  4ZED A;  2XA5 A;  3OO8 A;  2UVH A;  1ANF A;  3K1P A;  1II5 A;  1CE2 A;  4DE8 A;  3LUY A;  2XWI A;  3RUM A;  2P3N A;  4EXL A;  2GQ1 A;  1IIW A;  5ITP A;  4JSO A;  4QFN A;  2KLF A;  3M3F A;  4JVI A;  1LBY A;  4G8M A;  2DE4 A;  1LAX A;  2UXA A;  4GXS B;  4G8H A;  1VFD A;  3C4M A;  3CHG A;  4HCY A;  3TEP A;  3T9V A;  4MBP A;  4PAK A;  2DWA A;  4IGR A;  4NX1 A;  3WAF A;  4E0W A;  5L8D A;  3UP9 A;  4MEV A;  1D9V A;  4ELP A;  4P8B A;  1TFA A;  4GWZ A;  2ABH A;  1MS7 A;  1DCU A;  4X9T A;  5AA4 A;  1JET A;  4R74 A;  2Y7R A;  2UYE A;  3BIH A;  3TMG A;  4O7I A;  3DM0 A;  4IB2 A;  1B2H A;  1UIU A;  5IAI A;  3W9V A;  1FPL A;  2GRV A;  4AS4 A;  5DEX A;  4ZEC A;  1TFD A;  1FPK A;  2QSX A;  2HZK A;  2XD2 A;  3K4U A;  1FQC A;  3EHT A;  4DXU A;  3K1N A;  4OVP A;  2F36 A;  2ONK E;  2PBW A;  1A99 A;  1B05 A;  3T1B A;  5AA3 A;  1MXU A;  5JEI A;  2Z22 A;  4ZE9 A;  2XXY A;  4M4G A;  2OPD A;  5L9M A;  3OMB A;  3S2V A;  3G3I A;  5J16 A;  5DVJ A;  3PPO A;  2ZNU A;  3U94 A;  3A09 A;  5IZ1 A;  4U21 A;  1IMA A;  4XFE A;  3K2D A;  4R9G A;  3E79 A;  3H06 B;  3U8Q A;  4ESW A;  1MQG A;  2GHA A;  4HE1 A;  1QKA A;  4OER A;  1LFG A;  1B7H A;  5EQ8 A;  4JDF A;  3DP4 A;  4YMA A;  3U72 A;  3N5L A;  2I58 A;  4F3B A;  2RCB A;  5H8Q A;  3OXN A;  4FBP A;  2F6G A;  3G3F A;  3WAE A;  2FHY A;  1YZ0 A;  3A3U A;  2HHM A;  2O51 A;  5DTB A;  2QJE A;  5DYH A;  4N4U A;  2QS4 A;  3CFL A;  4BDQ A;  2Q89 A;  2DXR A;  1H76 A;  5IZ3 A;  1TT1 A;  4EXK A;  2HCA A;  3SEV A;  3T96 B;  2PCR A;  2F97 A;  2HQ0 A;  2XX9 A;  3S4U A;  3T9H B;  3GBA A;  4GL0 A;  1D4N A;  3IJX B;  5CBS A;  4DI3 D;  2PT1 A;  4M1V A;  3H03 A;  4C1T A;  4XXU A;  4G68 A;  1B5J A;  2ZZX A;  3G3G A;  4R73 A;  3EQ1 A;  1P1O A;  3RTF B;  3IR1 A;  3SKP A;  3EPE A;  1QGX A;  1Y1Z A;  4GF8 A;  4ND9 A;  4EDP A;  4LVQ A;  4OZ9 A;  2XXX A;  4RJZ A;  4NQ8 A;  1VFE A;  3FXR A;  3JYR A;  3KN3 A;  5EQA A;  3S9E A;  3S9N C;  3DP6 A;  3H7M A;  1VE4 A;  5J1D A;  1QUL A;  1NV7 A;  3C36 A;  3B8B A;  1POT A;  3BIG A;  1QKB A;  4X1B A;  1NI9 A;  4IO7 A;  1R6Z A;  1US4 A;  2I0C A;  4I40 A;  2I6E A;  4OQO A;  1JQF A;  2I49 A;  4OES A;  1B0L A;  3FV2 A;  5I59 B;  3IB0 A;  4MH5 A;  4F39 A;  1NUY A;  4HW8 A;  4TOZ A;  1T0K A;  3RY3 A;  4FJP A;  4RNS A;  4NE4 A;  4OYV A;  4ELQ A;  4GWY A;  4KXP A;  1NUW A;  1Z7M E;  3FIR A;  2XXR A;  1MPC A;  2H99 A;  4H67 A;  3D1R A;  5I2N B;  3A29 A;  2E1S A;  2F7A A;  3BBR A;  3FXU A;  3H6W A;  3VV5 A;  1Y4C A;  5AE4 A;  1LBB A;  3SEX A;  4AB6 A;  3FBP A;  3RT6 B;  1MG1 A;  4F2O A;  4IO6 A;  2O7I A;  1IXC A;  4GOT A;  4XKP A;  1WOD A;  3MPK A;  2QVV A;  2RC9 A;  3CSG A;  3VFJ A;  2V93 A;  1HSJ A;  1FQA A;  2CMO A;  2OX3 A;  4GWW A;  2YJP A;  1S7Y A;  2VPO A;  3VE1 B;  2THI A;  3B6Q A;  3E78 A;  4KR5 A;  1MPB A;  1URS A;  4MJO A;  2FIE A;  4BDM A;  4YKI A;  4ZZA A;  3ZSF A;  5AA1 A;  2AIX A;  2ALU A;  3THI A;  2Y5K A;  2NOO A;  4GLI A;  1QW0 A;  5FHN A;  4JB7 A;  3PV0 E;  3MW0 A;  4P9K A;  2BJJ X;  1SBP A;  1RDZ A;  2UYF A;  3RGY A;  4OFJ A;  3KZG A;  2Q2C A;  1MY3 A;  3LUZ A;  5K2Y A;  3PUZ E;  4LUB A;  3DEL B;  1SW1 A;  2R9J A;  5DW8 A;  1OQG A;  3T0J A;  4R2F A;  4ZZE A;  3KC0 A;  1DSN A;  3CIJ A;  4NG7 A;  2HAU A;  3IOW A;  5H8F B;  3MZB A;  5A5X A;  2W7Y A;  4N8Y A;  1SQY A;  2QFL A;  3KN7 A;  3O29 A;  3UGW A;  3K00 A;  3OO6 A;  3KSX A;  2GH9 A;  3MVY A;  2Y7K A;  1YTV A;  4R2B A;  2H5Y A;  4PAI A;  4ZS9 A;  4ELO A;  2XXT A;  3TKD A;  4MHF A;  3OEL A;  3IOT A;  4FAJ A;  2UVI A;  3HHF A;  5CRY A;  2WYP A;  4I8C A;  2A5T B;  1Y4T A;  4BDN A;  1P99 A;  2XXQ A;  5EHM A;  5L9S A;  1A54 A;  4PP0 A;  5F7V A;  4KYS A;  4IGT A;  2XWV A;  4RPO A;  4PDD A;  2R6G E;  2I3V A;  2WBD A;  2F34 A;  4OAN A;  2DXY A;  3KJT A;  4IO2 A;  1I6Q A;  3UOR A;  1P1U A;  2REJ A;  2YPN A;  1NV0 A;  3OEN A;  4H0W A;  5I5P A;  4NTL A;  2F8D A;  1D3K A;  4N13 A;  2XXU A;  5LDZ A;  3C9H A;  2R71 A;  4O3B A;  1MDP 1;  5DVF A;  1JNF A;  1HSL A;  4MAG A;  3HFU A;  1EZ9 A;  2QMX A;  4NF6 B;  1A8E A;  3PPR A;  1QUK A;  4LN5 A;  4XKN A;  3UIF A;  1AIV A;  4G68 C;  5FHM A;  3MUQ A;  4LZ5 A;  1DBZ A;  3HN0 A;  1NNP A;  2RCA A;  4JVC A;  2O84 X;  1ZBM A;  4F2Q A;  3CI8 A;  4OTE A;  2OBG A;  5AA2 A;  3FXB A;  4GBW A;  2ANJ A;  2CZK A;  1LBV A;  1GTK A;  3CR9 A;  1MH3 A;  4R9F A;  2KQZ A;  4JXI A;  4GXA A;  3ILT B;  4QFK A;  1SW5 A;  4N6P A;  5FHO A;  1B0H A;  1URD A;  3O2A A;  3R6U A;  3GXA A;  4GVO A;  1LBC A;  3RTW B;  2QVU A;  5I56 A;  4QSD A;  4LP2 B;  5F1Q A;  4Q5T A;  5AA2 B;  4OFL A;  2V4C A;  3OO7 A;  1MQH A;  1B3L A;  3E3K A;  4PGP A;  4ZEI A;  5TP9 B;  3MPL A;  5ET8 A;  4ECF A;  4PC9 A;  1IQ7 A;  3RPL A;  4H45 A;  3N6T A;  4Z7E A;  1SYI A;  3TTN A;  4EQ7 A;  1MXY A;  3MZ9 A;  2VHA A;  1LFH A;  4XIG Q;  3PUW E;  3SEY A;  3LR1 A;  3ONM A;  3E13 X;  3B6T A;  3MVW A;  3MC2 A;  1R1N A;  5CC2 A;  5H8H A;  1K9Y A;  3V8X B;  3W15 C;  3E4R A;  3SER A;  1O7T A;  1B3G A;  4RK9 A;  3RYD A;  3KBR A;  1Z7N E;  4X48 A;  2DQV A;  1LAF E;  3JZJ A;  3VLW A;  2HZL A;  1FPG A;  3KSJ A;  5I2K A;  3OD7 A;  4GWS A;  2XX7 A;  1FTM A;  5ET5 A;  4PQJ A;  2JJK A;  1PB7 A;  3CVG A;  5H8H B;  1LST A;  5I57 B;  1QUI A;  2PFY A;  2O6A A;  4WKM A;  4YB7 A;  1NUX A;  2DDK A;  1LAH E;  3QUJ A;  2PMS A;  3TAJ A;  4RK2 A;  2ZYN A;  3PPP A;  3SEU A;  1FPD A;  4F1Y A;  5H8N A;  1NV1 A;  5L9O A;  3MVZ A;  1S50 A;  5EHS A;  1IME A;  3VVF A;  2ESN A;  4AQ4 A;  3Q25 A;  1VDW A;  2RKM A;  3KFM A;  1H43 A;  1EYJ A;  3C35 A;  4OA4 A;  1RDY A;  1A7L A;  5TPA A;  2ONS A;  2HXW A;  4FE8 A;  3N26 A;  2B4L A;  1L5T A;  1UTB A;  1B5I A;  2CEX A;  4LA9 A;  4F22 A;  3RNN A;  1UTH A;  5M2V A;  3AXF A;  3Q28 A;  2D5W A;  2NUV A;  1B3E A;  1IMD A;  4KCC A;  4KQP A;  3K02 A;  5BWJ A;  3H3G A;  2D3I A;  2XXV A;  5F24 A;  1TXF A;  1O64 A;  2Z8D A;  4P56 A;  1B1H A;  2F5X A;  1FTO A;  3RT8 A;  2I4C A;  3MST A;  4U23 A;  1EH3 A;  3VLU A;  1JW4 A;  4F19 A;  3QYT A;  1SW2 A;  2NWJ A;  3EHU A;  2OLB A;  2ZMB A;  3PMW A;  1F9B A;  5AA4 B;  4OVR A;  2A5S A;  1WVJ A;  4JWO A;  1YXI A;  5K2X A;  2V3U A;  2O7U A;  4Q30 B;  1DTZ A;  3PMV A;  1SD3 A;  2B4M A;  4QF9 A;  3F11 A;  3W9W A;  3FJG A;  1BIY A;  1P1N A;  5DEX B;  4MCO A;  3ODB A;  1FCK A;  3KBZ A;  1M5E A;  3HPI A;  3K6X A;  1N3X A;  4OEN A;  4Q8R A;  1NH8 A;  1BK4 A;  3H6U A;  4DIG A;  1PDA A;  4O7M A;  1ZTY A;  4X8R A;  1LBZ A;  2DVZ A;  3U65 A;  2V25 A;  4YB6 A;  2QMW A;  4N07 A;  4PF6 A;  3EF7 A;  3TCF A;  4MFI A;  4U2R A;  2UVG A;  4ONY A;  4GL8 A;  4PET A;  2DOJ A;  4DXB A;  4JSD A;  1Y1M A;  5ISU A;  4OWD A;  5ITO A;  1XOC A;  5EYG A;  4QFO A;  1IXG A;  4N15 A;  4TQU Q;  4JVD A;  1JW1 A;  4BDL A;  1A55 A;  1N76 A;  5HPQ A;  3VXC A;  1FBP A;  1FTK A;  4P0I A;  1FBF A;  1Y20 A;  5H8S A;  4RPN A;  4QHQ A;  1DMB A;  4X1D A;  4MF3 A;  5H8Q B;  4G61 A;  3BFT A;  3B50 A;  5IGA A;  1LEV A;  4TLM B;  5HM4 B;  4F3G A;  4UAC A;  2XX8 A;  4WEP A;  4I9D A;  4FED A;  1Y3N A;  1URG A;  4EF2 A;  2O1L A;  3FAT A;  5IZ3 B;  1A40 A;  3VLV A;  2H9B A;  3TCG A;  4C1U A;  4NWD A;  3B6W A;  4HCW A;  3RLF E;  4DDD A;  3TDJ A;  5KDT A;  4PE5 B;  2DE2 A;  1B32 A;  4YKK A;  4PFY A;  4F18 A;  1JVX A;  1B1X A;  1MXV A;  4FEB A;  4G68 B;  1FTA A;  2Y7I A;  3PGF A;  4H8I A;  4OVQ A;  1RDX A;  4LZ8 A;  4U22 A;  4GWX A;  1GR2 A;  3OSQ A;  2Q8J A;  2PYY A;  3T9X B;  3H6V A;  4GWO A;  4QXD A;  4YU0 A;  1A8F A;  3T66 A;  1LAG E;  1P1Q A;  1M5D A;  3FVK A;  3PTY A;  4H46 A;  4NF5 A;  5IKB A;  3FVN A;  4LQ5 A;  1VSO A;  5A5L A;  1N84 A;  1EZP A;  2F3B A;  3BKI B;  4N81 A;  1MY2 A;  2VOZ A;  5I58 A;  5EYH A;  3H4Z A;  3SES A;  2CZH A;  4N91 A;  3VDF A;  4GX6 A;  1BKA A;  2HPG A;  2QPQ A;  2CZI A;  1ZIU A;  3LSL A;  1NNK A;  4YIC A;  5CMK A;  2OCU A;  1MY0 A;  1JP4 A;  1LFI A;  1NNF A;  5CMC A;  1M5F A;  4NF8 A;  2B65 A;  3B7D A;  4C0R A;  3S9L C;  2OWZ A;  2FIX A;  3G3J A;  3ECR A;  1ZLQ A;  3LV0 A;  2CZL A;  4NMY A;  4O8M A;  5B70 A;  1VR5 A;  4P1L A;  1TWY A;  3IOU A;  2DE3 A;  3RN8 A;  2IEE A;  2XWO A;  5JK4 A;  2Y7W A;  4PF8 A;  1AOV A;  4DCX A;  2H25 A;  1IZ1 A;  3GBB A;  1ELJ A;  1OVB A;  3D4C A;  3O66 A;  2LAO A;  3SDF A;  3VVE A;  1PC3 A;  4MLV A;  5KCJ A;  5KZT A;  1FPI A;  2DS9 A;  1QJM A;  2VT5 A;  1IEJ A;  2PVU A;  3K01 A;  3MQ9 A;  3T22 A;  2Y84 A;  3TUS A;  3FVG A;  1AMF A;  3MP6 A;  4F3P A;  1LBW A;  1FPJ A;  1N04 A;  1YPN A;  5EYF A;  5A5X B;  4NAP A;  1LB9 A;  5TU0 A;  3FVO A;  1FQB A;  4XKR A;  5FTH A;  2DWI A;  3FXQ A;  2ZYO A;  1B5H A;  5I3S A;  4PCD A;  1B7Z A;  1NUZ A;  3M3K A;  3QK6 A;  2Q2A A;  4QFP A;  4ZEF A;  1XT8 A;  1H3D A;  1XC1 A;  5B7D A;  3IAZ A;  4ZEB A;  4IO3 A;  2Q9T A;  1LCT A;  2VD3 A;  3KOT A;  3L6G A;  1S9T A;  4Z0I A;  1FTL A;  1UIV A;  2GFE A;  1FW0 A;  4PFI A;  4EQ9 A;  4R6H A;  4HXV A;  2Y5L A;  1G0I A;  4QRZ A;  4HTG A;  2FNC A;  3O28 A;  2I48 A;  3Q29 A;  4THI A;  2I3W A;  4GIZ A;  4OMB A;  3UN6 A;  4H6D A;  1NV6 A;  1BLF A;  2F35 A;  1B46 A;  1I6A A;  3ZKK A;  1NFT A;  3FUZ A;  2FYI A;  1KZ8 A;  4ELR A;  4GWU A;  1JW5 A;  3FD3 A;  5CMM A;  4OVJ A;  1P1W A;  4N6D A;  1YAE A;  4MNP A;  4JWY A;  1SVX B;  4LQ2 A;  4MNC A;  4NHB A;  4ESX A;  4F1U A;  1I6B A;  1MXW A;  2ZXT A;  3KJ7 A;  4H5F A;  4NF4 A;  2VP1 A;  5IZZ A;  3PPN A;  4N17 A;  3MP1 A;  4XTC Q;  1NNT A;  1N0T A;  4HE2 A;  1EYK A;  3U93 A;  3M8U A;  3MZ1 A;  4IO4 A;  1ZU0 A;  4RA1 A;  2H4I A;  1QVS A;  4BDR A;  4KPT A;  2OWS A;  4GX4 A;  1GGG A;  1Q1K A;  2B3B A;  3MVX A;  1LB8 A;  4BLA A;  2Z8F A;  4NF4 B;  1XVY A;  5ICQ A;  3EHS A;  4FEC A;  5I56 B;  2DSF A;  3MYU A;  1IUD A;  1MM7 A;  4U1Z A;  2DWJ A;  3MAM A;  4MNI A;  1B58 A;  4OVS A;  3RPL B;  1MQI A;  5ICT A;  1JVY A;  4NF0 A;  3RQT A;  4KHZ E;  1FBE A;  1OVT A;  2Y7P A;  3IOR A;  1FBG A;  3HCQ A;  4NWC A;  3A3C A;  5IM2 A;  3LBS A;  4LZ7 A;  3OSR A;  5BUU A;  1NV4 A;  1EU8 A;  3V83 A;  1B4Z A;  1INP A;  2REG A;  4Q0C A;  2RC7 A;  3V5A A;  3ZS6 A;  3QAX A;  1AH5 A;  5I2K B;  3TCH A; 
#chains in the Genus database with same CATH homology
 1Q9D A;  5EQ7 A;  2QVV A;  2OX3 A;  5EYG A;  4GWW A;  4P3L A;  4GX3 A;  4N15 A;  1KA1 A;  2VPO A;  4JVD A;  3E78 A;  4MJO A;  2WX9 A;  2FIE A;  2Q8M A;  1FBP A;  5ET6 A;  2Y5K A;  1FBF A;  3GYY A;  2QVR A;  4P9K A;  1RDZ A;  4G61 A;  1YYZ A;  1G0H A;  3LUZ A;  3B50 A;  1LEV A;  5IGA A;  1SPI A;  2R8T A;  4IR8 A;  2F3D A;  3ROJ A;  4XF5 A;  1NV2 A;  5DW8 A;  3T0J A;  5IZ3 B;  3KC0 A;  4QBA A;  1LBX A;  4NG7 A;  2L5V A;  1FSA A;  4HCW A;  4N8Y A;  2QFL A;  2DE2 A;  2FBP A;  3NOH A;  3ISP A;  4PAI A;  4UAB A;  4F18 A;  1FTA A;  1FJ6 A;  4MHF A;  1FBD A;  4OVQ A;  1RDX A;  2WYP A;  4GWX A;  1CNQ A;  2CEY A;  4QXD A;  4PBQ A;  4PAF A;  1FPF A;  2XWV A;  2KR0 A;  1FPE A;  4I3E A;  4PDD A;  5CM6 A;  2PFZ A;  3PTY A;  4H46 A;  2WBD A;  4I3Y A;  3IFA A;  5A5L A;  4OAN A;  4F1V A;  4MIJ A;  2F3B A;  3KC1 A;  3QMF A;  5I7I A;  5LTC A;  4NN3 A;  4N81 A;  1NV0 A;  5EYH A;  4MX6 A;  1KA0 A;  2CZH A;  5I5P A;  4N91 A;  4MMP A;  4GX6 A;  2XWK A;  2WYK A;  5LDZ A;  2HPG A;  1AWB A;  2QPQ A;  5T3J A;  4PFR A;  2CZI A;  2XA5 A;  4GBV A;  4YIC A;  4MAG A;  3HFU A;  1JP4 A;  4LN5 A;  4PGN A;  2XWI A;  2P3N A;  2GQ1 A;  1DBZ A;  1FPB A;  2FVZ A;  2OWZ A;  4JVI A;  1LBY A;  4JVC A;  2FIX A;  2DE4 A;  3FXB A;  4GBW A;  2ZZW A;  4YZZ A;  3LV0 A;  4O8M A;  2CZK A;  3CHG A;  4HCY A;  4P1L A;  2DE3 A;  1LBV A;  2XWO A;  4PAK A;  5JK4 A;  2KQZ A;  4NX1 A;  4PF8 A;  5FBP A;  4MEV A;  4P8B A;  4GWZ A;  2BJI A;  3SZP A;  1DCU A;  2QVU A;  4X9T A;  1FBC A;  1FRP A;  1FPI A;  3IFC A;  2V4C A;  3BIH A;  4O7I A;  2VT5 A;  4PGP A;  1FJ9 A;  5ET8 A;  2P3V A;  1NV5 A;  4PC9 A;  3RPL A;  1XI6 A;  4H45 A;  3W9V A;  1FPL A;  4AS4 A;  1FPK A;  4N6K A;  1LBW A;  1FPJ A;  2HZK A;  4OVP A;  1K9Y A;  4NAP A;  2WBB A;  3RYD A;  5I3S A;  3T1B A;  4PCD A;  1NUZ A;  5ET7 A;  5ESY A;  2HZL A;  2XXK A;  1FPG A;  4DI4 B;  2Q9T A;  5J16 A;  4GWS A;  1K9Z A;  5ET5 A;  5IZ1 A;  2JJK A;  1IMA A;  4XFE A;  2PFY A;  1NUX A;  2DDK A;  3E79 A;  4PFI A;  4HXV A;  2Y5L A;  4O94 A;  1G0I A;  4HE1 A;  5EQ8 A;  1FPD A;  1NV1 A;  4FBP A;  1NV6 A;  2FHY A;  1YZ0 A;  2HHM A;  4N4U A;  1IME A;  4P47 A;  1KZ8 A;  4GWU A;  1VDW A;  5IZ3 A;  1EYJ A;  1IMC A;  4OA4 A;  1RDY A;  1FBH A;  2PCR A;  4N6D A;  2B4L A;  4MNP A;  4MNC A;  4NHB A;  2ZZV A;  4F1U A;  4DI3 D;  2CEX A;  2HXR A;  5IZZ A;  4N17 A;  4M1V A;  4HE2 A;  1EYK A;  3EKI A;  1D9Q A;  2ZZX A;  1IMD A;  4NGU A;  1QGX A;  1DK4 A;  5F24 A;  4P56 A;  2F5X A;  4GX4 A;  2WEF A;  4NQ8 A;  4P1E A;  3MST A;  5EQA A;  4PBH A;  4F19 A;  5J1D A;  1NV7 A;  4PDH A;  5EQ9 A;  4OVT A;  3B8B A;  3BIG A;  1IMF A;  4OVR A;  1YXI A;  3MYU A;  1NI9 A;  2B4M A;  4MNI A;  3W9W A;  4I40 A;  4OVS A;  3RPL B;  4PTK A;  2MKZ A;  4NF0 A;  1FBE A;  1NV3 A;  1FBG A;  4PFB A;  4MCO A;  4X04 A;  1NUY A;  3KBZ A;  4XEQ A;  1BK4 A;  5IM2 A;  4O7M A;  4GWY A;  4X8R A;  4KXP A;  1NUW A;  1NV4 A;  1LBZ A;  2DVZ A;  1INP A;  3D1R A;  3A29 A;  4AS5 A;  1IMB A;  3U65 A;  4HE0 A;  1EYI A;  4N8G A;  2Q74 A;  4PF6 A;  3FBP A;  4PE3 A;  2VPN A;  2V3Q A;  4PET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...