1LBXA

Crystal structure of a ternary complex of dual activity fbpase/impase (af2372) from archaeoglobus fulgidus with calcium ions and d-myo-inositol-1-phosphate
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
252
structure length
252
Chain Sequence
MDERDALRISREIAGEVRKAIASMPLRERVKDVGMGKDGTPTKAADRVAEDAALEILRKERVTVVTEESGVLGEGDVFVALDPLDGTFNATRGIPVYSVSLCFSYSDKLKDAFFGYVYNLATGDEYYADSSGAYRNGERIEVSDAEELYCNAIIYYPDRKFPFKRMRIFGSAATELCFFADGSFDCFLDIRPGKMLRIYDAAAGVFIAEKAGGKVTELDGESLGNKKFDMQERLNIVAANEKLHPKLLELIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fructose 1,6-bisphosphatase/inositol monophosphatase
publication title Crystal structure of a dual activity IMPase/FBPase (AF2372) from Archaeoglobus fulgidus. The story of a mobile loop.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Hydrolase
total genus 79
structure length 252
sequence length 252
chains with identical sequence B
ec nomenclature ec 3.1.3.11: Fructose-bisphosphatase.
pdb deposition date 2002-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00459 Inositol_P Inositol monophosphatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.540.10 Alpha Beta 2-Layer Sandwich Fructose-1,6-Bisphosphatase; Chain A, domain 1 Fructose-1,6-Bisphosphatase, subunit A, domain 1 1lbxA01
3.40.190.80 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 1lbxA02
2QVVA 1NV2A 1NUWA 3IFCA 4GBWA 1FPEA 5LDZA 3BIHA 1INPA 1FJ9A 2VT5A 4HE2A 2Q74A 1DBZA 2F3BA 3D1RA 5ET8A 5IZ3B 4GX4A 5T3JA 1FBFA 5ET7A 1G0IA 2DDKA 1AWBA 2GQ1A 5F24A 4H46A 1FJ6A 1FRPA 1FPLA 1K9YA 1Q9DA 4I40A 4GWUA 1YYZA 5IZ3A 1LBYA 5EYGA 1G0HA 1NV6A 4MJOA 1NUZA 1VDWA 1CNQA 4GX3A 1IMBA 1NV0A 4O7IA 1FPIA 1FBHA 2FIXA 4GWSA 5EYHA 1EYIA 2QFLA 4PTKA 3RYDA 2JJKA 1XI6A 1LBZA 5EQAA 3ROJA 5EQ9A 1FPDA 3QMFA 1DCUA 1FBPA 4GBVA 2FBPA 5A5LA 1LBVA 2FVZA 1NUXA 1RDZA 1D9QA 1IMEA 3KBZA 5ET6A 5EQ7A 1DK4A 2WEFA 3RPLB 2Q8MA 3KC0A 1EYJA 1FPBA 1NV3A 1SPIA 3IFAA 4AS5A 1FBDA 3KC1A 3B8BA 3FBPA 1LBWA 2WBBA 3A29A 1RDXA 1QGXA 2Y5KA 3BIGA 1FPKA 4GWWA 4GWYA 1K9ZA 3RPLA 4GWZA 2P3NA 5FBPA 4GX6A 4AS4A 2OWZA 4H45A 2FHYA 1JP4A 2BJIA 1YXIA 1FBGA 5ESYA 1EYKA 1NV5A 1LEVA 1KA0A 3LV0A 3T0JA 2R8TA 1FTAA 1FSAA 2WBDA 1RDYA 5DW8A 2PCRA 5EQ8A 4HE1A 1FPGA 2F3DA 4G61A 2QVUA 1NUYA 5I3SA 2QVRA 4GWXA 1FPJA 4KXPA 1NV4A 2OX3A 1FBEA 2P3VA 1FPFA 4FBPA 4I3YA 1NV1A 2HHMA 1BK4A 4I3EA 5IZ1A 1IMAA 1KA1A 2CZHA 1LBXA 2FIEA 1IMDA 5J16A 4IR8A 5ET5A 3LUZA 4QXDA 4HXVA 1IMFA 1NI9A 1YZ0A 1KZ8A 2CZKA 4HE0A 2CZIA 1NV7A 1IMCA 1FBCA 4N81A 2Y5LA
chains in the Genus database with same CATH superfamily
4DCXA 1B3EA 1D3KA 2Y84A 4PFBA 3K2DA 5AE4A 5H8QB 3A3UA 4N17A 1MXYA 3K6VA 2Y7PA 4I40A 2VHAA 3H6WA 4GX3A 5DTBA 1EYIA 1H44A 4ZE8A 2F7CA 3ROJA 2HPGA 4O3CA 4PE3A 3QMFA 2PT2A 1IXCA 3QXMA 4MMPA 5A5LA 3KEIA 2YPNA 3Q25A 5M2VA 1SYIA 1I6AA 4Q5TA 1NH8A 4EXLA 1I6QA 3U65A 3RT8A 1GGGA 1K9ZA 3WAEA 1YTVA 2P3NA 4PFIA 2D21A 2GHBA 2I3WA 3F11A 4E0WA 1URSA 3VVEA 1WODA 1FTAA 3OO6A 1B7UA 1UIUA 3SEXA 2OCUA 2QVRA 4ZE9A 1SBPA 4ESXA 4P47A 1NV1A 4RK9A 4GXAA 1B3HA 2DVZA 3CHGA 3N6TA 5I58B 5J16A 1IMFA 1FQBA 4P1LA 2Y5LA 2QVVA 2Q2CA 5I58A 1FQFA 2I49A 5KDTB 3KOSA 5T3JA 3MP1A 2ZNSA 3ECRA 4OQOA 2D5WA 2I48A 1CE2A 1NFTA 2V3UA 2ZZWA 5KDTA 1H43A 2XHDA 3PMWA 4ZEFA 3SESA 4KQPA 1LGBC 2Q8JA 2RKMA 1AL3A 4RK2A 5A5XB 1LCFA 3HSTA 3VXCA 3RYDA 2JJKA 3TODA 1EZOA 4DZ1A 3H6VA 5H8HA 2UVGA 4N6PA 2ESNA 1IITA 5A5XA 1NUXA 1RDZA 4GFRA 3EPEA 2XXIA 4GL0A 3HPIA 4U21A 1S50A 3H03A 5JK4A 2H4IA 1IXGA 3PPRA 2DXYA 1DSNA 1PC3A 3TTRA 1Q1KA 2VOZA 1Y20A 2PT1A 1KA0A 1M5CA 2Y7WA 5DW8A 3HO7A 4N8GA 4DIGA 2NWJA 4HTGA 4FECA 4BDLA 2O84X 2P3VA 3TTLA 4KD5A 3TZAA 1GVCA 1B1HA 4KR5A 1LBXA 5CBRA 1JNFA 2UXAA 5ET5A 2KQZA 1RYXA 1YAEA 1O63A 1M5BA 1YZ0A 1M5FA 3FVOA 5BWJA 3RT6B 2CZIA 2XXTA 1N04A 5CBSA 3HCQA 4OFLA 2Z23A 1YCJA 3OO7A 3OD7A 2GQ1A 4LATA 2VP1A 2B3FA 1WDNA 4ZEBA 2ALUA 2ANJA 1MQGA 4MJOA 2THIA 1VDWA 2XX8A 1B7HA 2QFLA 1FPDA 3FIRA 1FBPA 4F3PA 2QSXA 4PCDA 5I2KA 1N7XA 4XKPA 2WYPA 4GRKA 4ELPA 4N91A 2HAVA 2V3TA 3PPQA 2XWVA 2PMSA 5DVFA 2DWHA 4AS4A 2F35A 2XXXA 2FHYA 3U92A 5I59B 5IAIA 2R8TA 3G3FA 5IM2A 1B2HA 4PBHA 4PDHA 5LTCA 3RPWA 4C1TA 4FAJA 1NNPA 1FBEA 3FV2A 4FBPA 1B3FA 3TMGA 4R72A 4N6DA 4R6HA 4FIMA 4LONB 1LFIA 4HXVA 4P0IA 1URGA 2NXOA 3KSJA 4F29A 4OVPA 3K0VA 3IFCA 3M3LA 2O51A 3E13X 4H8IA 4PF8A 3D1RA 2KLFA 3T96B 2AIXA 2OK2A 3V89B 4RJZA 2FYIA 1QUJA 3OO8A 2O69A 3S9NC 4WEDA 1JEVA 4NQ8A 3MC2A 4RPNA 2X26A 5I5PA 2FIXA 3G3KA 3CI8A 5H8NB 3MJNA 4JWXA 5DEXB 3Q28A 1S9TA 1LBBA 1DCUA 3QIMA 3FVNA 3JV9A 4IY6A 3MP6A 1CB6A 5DEXA 3IX1A 2HAUA 2RINA 4HS7A 1P1OA 2Y7IA 1DPPA 1HSLA 1LCTA 4I62A 3KC1A 3FZVA 1Y4TA 3O6IA 1RDXA 1QGXA 5TP9B 5H8FA 1FPKA 1NNFA 4EDPA 1ELJA 1II5A 4EQBA 1A55A 4R2FA 1B1XA 1USYE 1Y3NA 1B58A 1ZU0A 3HHGA 4IO2A 1RDYA 1MXWA 5TP9A 4C1UA 4EXKA 4ELQA 2XD3A 3FJGA 1RYOA 4XFEA 1XS5A 4P8BA 2OX3A 1FTJA 2I0CA 3WAFA 4LQ5A 5CMCA 2HHMA 2BJJX 4G77A 1M5EA 4R6YA 4ZS9A 1PB9A 4IR8A 4ESWA 4MFIA 3QAXA 1TWYA 1MH3A 1F9BA 1LAHE 3E79A 3HFUA 1XC1A 2NOOA 3CSBA 3UK4A 1MPCA 3TAJA 4QHQA 4TLLB 2AYSA 5ET8A 4JXIA 1WVJA 1B5HA 4K3FA 4MBPA 4G2ZA 4YB6A 3SERA 3K00A 4UA8A 1NL5A 4LZ7A 3OEMA 4OVRA 3TDJA 3MYUA 3E4RA 5EYFA 3PD8A 1SVXB 3DELB 4YKKA 4HCWA 5FHOA 3IOUA 3C9HA 2E1SA 3VE1B 2Q89A 4MIJA 3T93B 4GWSA 1FCKA 4NX1A 5L8DA 4QFPA 2DYXA 4KYEA 2ZNUA 3B6TA 1SQYA 5I2NB 4MNCA 4OERA 3KC0A 3EKIA 4ZZEA 4H8JA 1SPIA 3FASA 2UVJA 1MXZA 4MLVA 5I2NA 1B0HA 1EH3A 5J1DA 1O64A 3A29A 2REGA 3R6UA 4GWYA 5FBPA 4GX6A 2B65A 1H76A 1N76A 5CMKA 3GXAA 2XX9A 3VXBA 3IB1A 1N3XA 3FGSA 2HEUA 2M8CA 1ZKBA 1MXXA 2UVHA 4NWDA 4UACA 3OELA 5I56B 3PUVE 1JW5A 3E3KA 3MVWA 4PGPA 2OZZA 4MEVA 4PGNA 4YKPA 1UTBB 2VD2A 4MCOA 1NV2A 3BIHA 1FJ9A 3PPPA 3U72A 2XXWA 4RXLA 3EHTA 2XXKA 1UTBA 4U1OA 3PUZE 1B7ZA 1FJ6A 5K2YA 1YYZA 4X1DA 4KYDA 4DXUA 1FQEA 2O1MA 1B3GA 1XI6A 4BDNA 1ZLQA 2DS9A 2DOJA 1PDAA 1MQIA 2OWTA 3KBZA 4EF2A 1DK4A 2WEFA 1NNTA 3SETA 3B6WA 3RPLB 1LAGE 4R75A 3G3GA 2RF1A 3H6TA 2VGQA 3LSXA 1QVSA 3IOVA 2DWJA 5L9OA 4FEDA 4LA9A 3FUZA 4PC9A 3RPLA 2HXWA 1SD3A 3H6UA 4OVSA 1SYHA 3KN7A 4EUOA 3MP8A 1SW1A 2F6PA 4MX6A 1FSAA 4NN3A 4XKQA 2QJEA 3LSWA 1DTGA 4XEQA 2QVUA 4NE4A 3BBRA 4KI0E 2PFZA 4R2BA 2VPNA 1FPFA 4QRZA 4I3EA 3CIJA 5CMBA 4GQOA 1KWHA 1IMDA 4JB7A 4IO6A 2ZXTA 5DVIA 2RC9A 3K1NA 4I9DA 4GF8A 2F7AA 4QFLA 4N4UA 1FTMA 3LR1A 4GBWA 2CMOA 4MNPA 1FPEA 5IGAA 1GTKA 5B70A 1DOTA 1JW4A 3FXUA 4X9TA 3K1MA 3TFLA 4NGUA 4AQ4A 1K9YA 4JWOA 1FQAA 3GZGA 1LLSA 5AA3A 2OPDA 4O7IA 1FPIA 3T9HB 3OSQA 2A5SA 3KBRA 5EQ9A 4F2QA 4ZEIA 4DXCA 3VFJA 4F2OA 4PF6A 3ISPA 1MPDA 2IA4A 3TYHA 5H8HB 2GH9A 2A5TB 3IFAA 3B8BA 4DLDA 4PQJA 1BP5A 1VE4A 3MPLA 1BIYA 1QKBA 3SZPA 1S7YA 3IOWA 3EF7A 5JTYB 3S9MC 2A5TA 4XKNA 3PMXA 5ESYA 3DM0A 3EHUA 4EQ7A 4P0GA 4G68B 3MZBA 4GOTA 2UVIA 2XXRA 4JVDA 3O6GA 4F39A 3TCHA 3W9WA 1FPGA 4GL8A 3TEPA 3MQ9A 5JTYA 2DWIA 4OA4A 4IB2A 4O3BA 2H98A 5L9SA 4G68A 1MDP1 2ZZVA 4WXJA 3EHSA 3EQ1A 4ISUA 2XXYA 2F8DA 2CZHA 3IORA 3TTNA 2OWSA 4GIZA 1UTHB 4QXDA 4IGRA 4OFOA 3FXBA 3PPNA 5F1QA 3MSTA 3QSLA 2OJTA 1UTHA 4OEUA 1QUIA 2Q74A 1B51A 1LAXA 5B7DA 5CM6A 3IO4A 2F5XA 4GWUA 3KJTA 2P0SA 1G0HA 2UYFA 2Z8FA 1CNQA 2XXVA 2XWOA 3B50A 1ZJLA 5FHMA 3KSXA 4YZZA 1Z7ME 2GHAA 4F3GA 1ZBMA 1PB7A 4HW8A 5AA2D 4H65A 4EQ9A 2DP8A 4TLMB 2Q9TA 3U93A 4ZEDA 2RC7A 1VR5A 3FVGA 3GYYA 3TCGA 5F7VA 3G3HA 1FBDA 4XIGQ 3T66A 4PFUA 2ZYMA 2WBBA 1N0TA 3FJ7A 5L9MA 4NF8B 3BIGA 5I2KB 4GWOA 5AA1A 4NF4B 4YU0A 3KFMA 2HFBA 4NF0A 4NF8A 2HXRA 4NF4A 2YJPA 1JVYA 4GWXA 3H06B 1NV4A 4GVOA 2I4BA 4LZ5A 3O29A 4OETA 3T9UA 2G93A 4F22A 1A8EA 3FJMA 3UN6A 3K01A 2ZNTA 4UABA 4QSDA 1IMCA 2QS4A 1XVYA 2ONKE 2RCBA 4IY5A 1DBZA 3O97A 4FJPA 2ZZXA 5FHNA 1SW5A 3U8QA 3NOHA 3OEKA 1FPLA 4WEPA 1XOCA 1US4A 1EZPA 3A09A 3B6QA 1D4NA 5IKBA 1B5JA 4GLIA 4N13A 2ZYOA 3M3FA 2KR0A 2L5VA 4QSCA 2XWKA 3T1BA 2NVUB 2XXPA 4YB5A 4OESA 1POY1 2R9JA 4LUBA 3W15C 3KGCA 1Y9UA 1FPBA 4KHZE 1J1NA 1D9VA 3JYRA 1MDQA 1HSJA 4R9GA 5DVJA 4OEVA 4MAGA 3SEYA 1N84A 1P1WA 2AL5A 4OVQA 4OANA 4RNSA 3CFLA 5H8FB 2DWAA 2PCRA 3MWBA 4ELOA 2F97A 1MQDA 3TQLA 1P1NA 5CC2A 2P1SA 1I69A 3O66A 4O8MA 2PBWA 2FA7A 4I3YA 3SEWA 1N3WA 3MBPA 4Q8RA 3W9VA 3C36A 5KCJB 4THIA 1KZ8A 5I57A 4YB7A 3RN8A 2HZKA 4Q0CA 1FQDA 1Q35A 3U94A 2Z8EA 3I5OA 3OSRA 5KCJA 2O6AA 4JWYA 1MY2A 3K6UA 1MM7A 2O68A 2QPQA 1A7LA 3RQTA 1DTZA 3PUWE 2I0BA 3D4CA 4OFJA 1UQWA 2GRVA 4IO4A 1MXUA 5EYGA 1ANFA 4X1BA 4F31B 1SDXA 4HCYA 3RNNA 4POWA 2FBPA 5LOMA 1B05A 5AA2A 4C0RA 1OVBA 1GV8A 4O7MA 3TQWA 1LBWA 5DYHA 2OPEA 4PAFA 4ZZAA 4R73A 3G7WA 1M5DA 2OWZA 4H45A 4G8HA 1JP4A 2DQVA 2MKZA 1A54A 3LV0A 3T0JA 1PEBA 3MZ9A 3ZKKA 5EQ8A 4PP0A 1IQ7A 1ZTYA 1TFAA 4RA1A 1R6ZA 3E78A 3JZJA 5IZ1A 3KZGA 5JEIA 1YPNA 3L6HA 2QL3A 3KG2A 4TOZA 1MXVA 4U4XA 3UORA 1Z7NE 1BLFA 3K4UA 3OMBA 3PV0E 3C35A 1IZ1A 4N15A 3MVYA 1AIVA 3IL1B 4G8MA 2QRYA 4BDQA 1XT8A 2F78A 1PBPA 4LP2B 1LSTA 3LBSA 3I6VA 2WX9A 4ZECA 4PAKA 1NH7A 3L6GA 2OLBA 4MLQA 1NUZA 4I8CA 3ODBA 1NV0A 2XXQA 1MS7A 2B4LA 4JSDA 1AH5A 4JSOA 1EU8A 4P3LA 1LBZA 3VDFA 3T9XB 3C4MA 2QS3A 3VLVA 4MF3A 4MH5A 3THIA 1POTA 3LUYA 4Z0IA 1FTOA 2IEEA 4JDFA 3S2VA 4OVJA 4OVTA 3O6HA 5CI5A 2UYEA 4H67A 3O2AA 2Y5KA 2RCAA 4PE5B 2PYYA 4PFRA 3TPAA 3DLNA 3ILUB 3TELA 3IB2A 4YKJA 1N7WA 2OBGA 4X48A 2WBDA 4IO3A 3PD9A 1OQGA 1PBQA 4G61A 5H8SA 2QS2A 3SEUA 3A3CA 3FXRA 1B5IA 4KFQA 1Y4CA 4X8RA 3Q27A 3QK6A 2X7PA 1SW2A 1KA1A 1SW4A 3ZS6A 1JEUA 1H45A 4ONYA 1IXHA 1JVXA 2Z22A 3T22A 3OO9A 3M3KA 4PTKA 5H8QA 4XXUA 3MW0A 1GR2A 2VT5A 1LAFE 4GX4A 5ITPA 3MUQA 2H99A 3TUSA 1IUDA 4R6KA 2DSFA 3RLFE 1TFDA 2H25A 2ABHA 2R6GE 4OXVA 1JETA 1A99A 4DE8A 3IO6A 2NUVA 3C32A 2CZLA 5BUUA 2LAOA 5CMMA 4GBVA 2PX1A 1EZ9A 4GD5A 1MH4A 1LB8A 2XD2A 5ET6A 4PFTA 3PGFA 3LSFB 1MQHA 4AS5A 4DCYA 2DXRA 4H6DA 2VPOA 4QBAA 2ONRA 2ZYNA 3SDFA 1XVXA 4NHBA 4E0XA 2H9BA 3R7XA 1NUYA 3K6XA 5EHMA 3UP9A 1QW0A 2WYKA 3MZ1A 1A8FA 3ZKLA 4F18A 4RPOA 1H3DA 1VFEA 3TKDA 4Z7EA 4WKMA 4RYAA 3EN3A 1OVTA 4BLAA 3SKPA 1AMFA 1NV7A 1P1QA 5ICTA 3ILTB 1IIWA 3K6WA 3IOTA 3PPOA 3KOTA 5IZ3B 2I3VA 2D3IA 2E0SA 1FBFA 5ET7A 1VSOA 1FW0A 5F24A 4NMYA 4H46A 1BTJA 5HBCA 3PUYE 3CVGA 5IZ3A 1B0LA 5FTHA 1LBYA 5ITOA 5FTIA 1OLAA 3HHFA 3V83A 4F1VA 2F36A 1DMBA 4QFKA 1B3LA 3KJ7A 5EQAA 3H4ZA 3IJOB 4Q30B 4P9KA 3IAZA 1RKMA 4OWDA 4ND9A 4F1YA 3TTMA 1EYJA 4U2RA 1PB8A 2R71A 3R26A 3K02A 4H1XA 3N6UA 5ISUA 4IGTA 4NG7A 4M4GA 1URDA 4DXBA 2X7QA 4NF5B 3VV5A 5HPQA 4LZ8A 2B3BA 2Z8DA 3P7IA 4GWZA 3D4GA 2YLNA 4LVQA 4H5FA 3CSGA 1EYKA 3LSLA 3OXNA 1LEVA 4NF5A 2F6GA 3RTFB 1BKAA 1SI0A 4G68C 4XF5A 3VVFA 3FXQA 4BDRA 3H7MA 2QMXA 3Q26A 1IXIA 1NMUA 1P1UA 4PBQA 1DPEA 2QMWA 4TQUQ 4F3BA 4OZ9A 4YMBA 3SEVA 5TU0A 4QSEA 1MY0A 4F3SA 1SI1A 4P1EA 3RGYA 4OTEA 3GBBA 1OLCA 2I4CA 5LDZA 2I58A 1R1NA 4P11A 3N26A 2W7YA 4OMBA 4HE2A 4EF1A 2F3BA 4OYVA 2DDKA 2V4CA 4LQ2A 4YKIA 4ZDMA 4QF9A 1QUKA 1Q9DA 1LFHA 1US5A 1NV6A 3PU5A 1OQHA 1IMBA 2DE4A 2REJA 2HCAA 1MM6A 4F1UA 5EHSA 4YMAA 4N8YA 4I1DA 4RY1A 2P2AA 3BKIB 4PFYA 4M1VA 1IMEA 3TTKA 5K2XA 3DP4A 4R9FA 4FATA 1QJMA 2Q8MA 4P56A 3TCFA 1XHYA 1NV3A 1B32A 2WKYA 3MAMA 2DE2A 2Q88A 5I59A 4GWWA 4ECFA 3I3VA 3C31A 4NTLA 4U1ZA 4AB5A 1FBGA 4KCCA 3IR1A 2HQ0A 2V84A 1LFGA 4QFNA 1IEJA 4HE1A 5ICQA 5I3SA 2ZYKA 3V5AA 3N94A 3DP8A 1MY3A 2O7UA 4NF6B 4NEDA 5DT6A 1LB9A 3RY3A 3PUXE 2ZMBA 1TXFA 1MRPA 1IMAA 3HV1A 1A40A 2VD3A 3G3JA 3MPKA 2FIEA 2G29A 2B4MA 4NF6A 4N07A 3LUZA 1NI9A 5I7IA 3QUFA 1UIVA 4HE0A 4XKRA 1R9QA 3LC8A 3Q29A 3CG1A 4PFWA 5HM4B 4F19A 1B52A 3ONMA 1NUWA 1INPA 1B46A 4L17A 3T9VA 4DDDA 5I57B 3FV1A 1Y1MA 3C33A 1QULA 1AWBA 2RC8A 3PMVA 3IJXB 5H8NA 4QFOA 3CFXA 4U22A 2V3QA 2F7BA 4IO5A 5I84A 3KN3A 4XTCQ 2O1LA 1FBHA 1JQFA 3S4UA 4FE8A 2CEYA 4DI4B 4X04A 1R9LA 2XXHA 4PDDA 4IO7A 3OOAA 1B6HA 4U4SA 1USYH 1LBVA 2FVZA 4DI3D 3V8XB 1MY1A 4JVCA 3VVDA 2DE3A 1FTKA 3O28A 4G8NA 4H5GA 3IB0A 2Y7RA 3FBPA 3QYTA 1L5TA 3C34A 3UGWA 2V25A 1Y3PA 5AA2B 1MY4A 3UA8A 5CRYA 2BJIA 1TT1A 4O94A 4NWCA 1B4HA 3QUJA 2H5YA 5IZZA 1LBCA 1P99A 2F3DA 1NKXA 4YICA 4KXPA 1MQJA 1ATGA 3M8UA 4BDOA 1NNKA 3ZSFA 4LN5A 2PFYA 4JVIA 3MVZA 3S9LC 4H0WA 3G3IA 4FORA 2GFEA 2FNCA 1HSEA 4YAHX 4N81A 1Y3QA 2DVCA 4KYSA 4MHFA 3BFTA 2PVUA 3BFUA 4G4PA 3PTYA 3GBAA 4MNIA 4OENA 1AOVA 3E9XA 4ELRA 1G0IA 3B7DA 3KN8A 4BDMA 1I6BA 3FATA 1FRPA 3GLBA 4FEBA 2QS1A 1QKAA 3N5LA 4KCDA 3VLWA 3OENA 1FTLA 2XX7A 3S9EA 5KZTA 2XA5A 1OIBA 3H3GA 5EYHA 1Y1ZA 1FQCA 4JBZA 2V93A 3AXFA 3CG3A 1T0KA 1D9YA 2Y7KA 4N6KA 1D9QA 5EQ7A 1B9JA 2ONSA 4PAIA 4OHNA 4O3AA 5AA4B 3VLUA 1JW1A 1ZMGA 4KPTA 3CR9A 3CFZA 3U1OA 2XXUA 4AB6A 2HZLA 4U23A 1YXIA 5AA4A 1NV5A 3USDA 1O7TA 3FVKA 5I56A 2CEXA 3HN0A 3K1PA 2Q2AA 1FPJA 1ZIUA 4NAPA 2I6EA 2F34A 5ELVA 1MPBA 3RTWB 1BK4A 3IK6B 1OMPA 5TPAB 4PETA 1MG1A 1B4ZA 3DP6A 3UIFA 1VFDA 4POXA 3FD3A 3CRBA 4R74A 2XWIA 3O9PA 2CZKA 1B40A 3MVXA 1FBCA 3RUMA 2AL4A 4ZEKA 2O7IA 5TPAA 4GXSB
chains in the Genus database with same CATH topology
1DBZA 4PFBA 5ET8A 5IZ3B 1FBFA 5ET7A 2ZZXA 4OVRA 3MYUA 5F24A 4N17A 4H46A 3NOHA 1FPLA 4I40A 5IZ3A 1LBYA 4HCWA 4GX3A 4MIJA 4F1VA 4GWSA 1EYIA 4NX1A 5EQAA 3ROJA 2HPGA 2KR0A 4PE3A 3QMFA 2L5VA 4MMPA 2XWKA 3T1BA 5A5LA 4MNCA 4P9KA 3KC0A 3EKIA 1EYJA 1FPBA 1SPIA 4NG7A 3U65A 5J1DA 3A29A 4MAGA 4GWYA 1K9ZA 4GWZA 2P3NA 5FBPA 4GX6A 4PFIA 4OVQA 4OANA 1EYKA 1LEVA 1FTAA 2PCRA 2QVRA 4XF5A 4O8MA 4P47A 4I3YA 1NV1A 4PBQA 2DVZA 3CHGA 5J16A 4PGPA 3W9VA 1IMFA 4MEVA 4PGNA 1KZ8A 4P1EA 2HZKA 4P1LA 4MCOA 2Y5LA 2QVVA 1NV2A 5LDZA 3BIHA 1FJ9A 4HE2A 2F3BA 5T3JA 2XXKA 2DDKA 2QPQA 2V4CA 1FJ6A 2ZZWA 1Q9DA 1YYZA 5EYGA 1NV6A 1IMBA 2DE4A 4F1UA 3RYDA 2JJKA 4HCYA 1XI6A 4N8YA 4M1VA 2FBPA 1NUXA 1RDZA 3KBZA 1IMEA 1DK4A 2WEFA 3RPLB 2Q8MA 4P56A 1NV3A 2DE2A 4O7MA 1LBWA 4PAFA 5JK4A 4PC9A 4GWWA 3RPLA 2OWZA 4H45A 1JP4A 4OVSA 2MKZA 1FBGA 1KA0A 3LV0A 3T0JA 4MX6A 1FSAA 5DW8A 4N8GA 4NN3A 5EQ8A 4HE1A 4XEQA 2QVUA 5I3SA 3E78A 2PFZA 2VPNA 2P3VA 1FPFA 4I3EA 5IZ1A 1IMAA 1LBXA 2FIEA 2B4MA 1IMDA 5ET5A 3LUZA 2KQZA 1NI9A 5I7IA 1YZ0A 4HE0A 2CZIA 4F19A 4N4UA 4GBWA 1NUWA 4MNPA 4N15A 1FPEA 1INPA 5IGAA 1AWBA 4X9TA 2GQ1A 4NGUA 1K9YA 2V3QA 2WX9A 4PAKA 4MJOA 1NUZA 1VDWA 1NV0A 4O7IA 1FPIA 1FBHA 2B4LA 2QFLA 4DI4B 2CEYA 4X04A 4P3LA 1LBZA 5EQ9A 1FPDA 4PDDA 1FBPA 1LBVA 2FVZA 4DI3D 4PCDA 4JVCA 4PF6A 3ISPA 4OVTA 2WYPA 2DE3A 3IFAA 4N91A 3B8BA 3FBPA 2XWVA 2Y5KA 3SZPA 4PFRA 4AS4A 2FHYA 2BJIA 4O94A 5ESYA 4JVDA 2R8TA 2WBDA 5IZZA 5IM2A 3W9WA 1FPGA 4YICA 2F3DA 4G61A 4PBHA 4PDHA 5LTCA 4KXPA 4OA4A 1FBEA 4X8RA 2ZZVA 4FBPA 4N6DA 1KA1A 4LN5A 2CZHA 2PFYA 4JVIA 4QXDA 4HXVA 3FXBA 3MSTA 4OVPA 4N81A 4PTKA 4MHFA 3IFCA 2VT5A 4PF8A 2Q74A 3PTYA 4MNIA 3D1RA 4GX4A 1G0IA 5CM6A 1FRPA 2F5XA 4GWUA 1G0HA 4NQ8A 1CNQA 2XA5A 2XWOA 5I5PA 2FIXA 3B50A 5EYHA 4YZZA 1DCUA 4GBVA 4N6KA 1D9QA 5ET6A 5EQ7A 2Q9TA 4PAIA 3GYYA 4AS5A 1FBDA 3KC1A 2WBBA 1RDXA 1QGXA 3BIGA 1FPKA 2HZLA 1YXIA 2VPOA 4QBAA 1NV5A 4NF0A 1RDYA 4NHBA 2HXRA 2CEXA 1NUYA 4XFEA 4GWXA 1FPJA 4NAPA 4P8BA 1NV4A 2OX3A 2WYKA 4F18A 2HHMA 1BK4A 4PETA 4IR8A 2XWIA 2CZKA 1NV7A 4UABA 1IMCA 1FBCA 3E79A 3HFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QVV A;  1NV2 A;  1NUW A;  3IFC A;  4GBW A;  1FPE A;  5LDZ A;  3BIH A;  1INP A;  1FJ9 A;  2VT5 A;  4HE2 A;  2Q74 A;  1DBZ A;  2F3B A;  3D1R A;  5ET8 A;  5IZ3 B;  4GX4 A;  5T3J A;  1FBF A;  5ET7 A;  1G0I A;  2DDK A;  1AWB A;  2GQ1 A;  5F24 A;  4H46 A;  1FJ6 A;  1FRP A;  1FPL A;  1K9Y A;  1Q9D A;  4I40 A;  4GWU A;  1YYZ A;  5IZ3 A;  1LBY A;  5EYG A;  1G0H A;  1NV6 A;  4MJO A;  1NUZ A;  1VDW A;  1CNQ A;  4GX3 A;  1IMB A;  1NV0 A;  4O7I A;  1FPI A;  1FBH A;  2FIX A;  4GWS A;  5EYH A;  1EYI A;  2QFL A;  4PTK A;  3RYD A;  2JJK A;  1XI6 A;  1LBZ A;  5EQA A;  3ROJ A;  5EQ9 A;  1FPD A;  3QMF A;  1DCU A;  1FBP A;  4GBV A;  2FBP A;  5A5L A;  1LBV A;  2FVZ A;  1NUX A;  1RDZ A;  1D9Q A;  1IME A;  3KBZ A;  5ET6 A;  5EQ7 A;  1DK4 A;  2WEF A;  3RPL B;  2Q8M A;  3KC0 A;  1EYJ A;  1FPB A;  1NV3 A;  1SPI A;  3IFA A;  4AS5 A;  1FBD A;  3KC1 A;  3B8B A;  3FBP A;  1LBW A;  2WBB A;  3A29 A;  1RDX A;  1QGX A;  2Y5K A;  3BIG A;  1FPK A;  4GWW A;  4GWY A;  1K9Z A;  3RPL A;  4GWZ A;  2P3N A;  5FBP A;  4GX6 A;  4AS4 A;  2OWZ A;  4H45 A;  2FHY A;  1JP4 A;  2BJI A;  1YXI A;  1FBG A;  5ESY A;  1EYK A;  1NV5 A;  1LEV A;  1KA0 A;  3LV0 A;  3T0J A;  2R8T A;  1FTA A;  1FSA A;  2WBD A;  1RDY A;  5DW8 A;  2PCR A;  5EQ8 A;  4HE1 A;  1FPG A;  2F3D A;  4G61 A;  2QVU A;  1NUY A;  5I3S A;  2QVR A;  4GWX A;  1FPJ A;  4KXP A;  1NV4 A;  2OX3 A;  1FBE A;  2P3V A;  1FPF A;  4FBP A;  4I3Y A;  1NV1 A;  2HHM A;  1BK4 A;  4I3E A;  5IZ1 A;  1IMA A;  1KA1 A;  2CZH A;  1LBX A;  2FIE A;  1IMD A;  5J16 A;  4IR8 A;  5ET5 A;  3LUZ A;  4QXD A;  4HXV A;  1IMF A;  1NI9 A;  1YZ0 A;  1KZ8 A;  2CZK A;  4HE0 A;  2CZI A;  1NV7 A;  1IMC A;  1FBC A;  4N81 A;  2Y5L A; 
#chains in the Genus database with same CATH topology
 4DCX A;  1B3E A;  1D3K A;  2Y84 A;  4PFB A;  3K2D A;  5AE4 A;  5H8Q B;  3A3U A;  4N17 A;  1MXY A;  3K6V A;  2Y7P A;  4I40 A;  2VHA A;  3H6W A;  4GX3 A;  5DTB A;  1EYI A;  1H44 A;  4ZE8 A;  2F7C A;  3ROJ A;  2HPG A;  4O3C A;  4PE3 A;  3QMF A;  2PT2 A;  1IXC A;  3QXM A;  4MMP A;  5A5L A;  3KEI A;  2YPN A;  3Q25 A;  5M2V A;  1SYI A;  1I6A A;  4Q5T A;  1NH8 A;  4EXL A;  1I6Q A;  3U65 A;  3RT8 A;  1GGG A;  1K9Z A;  3WAE A;  1YTV A;  2P3N A;  4PFI A;  2D21 A;  2GHB A;  2I3W A;  3F11 A;  4E0W A;  1URS A;  3VVE A;  1WOD A;  1FTA A;  3OO6 A;  1B7U A;  1UIU A;  3SEX A;  2OCU A;  2QVR A;  4ZE9 A;  1SBP A;  4ESX A;  4P47 A;  1NV1 A;  4RK9 A;  4GXA A;  1B3H A;  2DVZ A;  3CHG A;  3N6T A;  5I58 B;  5J16 A;  1IMF A;  1FQB A;  4P1L A;  2Y5L A;  2QVV A;  2Q2C A;  5I58 A;  1FQF A;  2I49 A;  5KDT B;  3KOS A;  5T3J A;  3MP1 A;  2ZNS A;  3ECR A;  4OQO A;  2D5W A;  2I48 A;  1CE2 A;  1NFT A;  2V3U A;  2ZZW A;  5KDT A;  1H43 A;  2XHD A;  3PMW A;  4ZEF A;  3SES A;  4KQP A;  1LGB C;  2Q8J A;  2RKM A;  1AL3 A;  4RK2 A;  5A5X B;  1LCF A;  3HST A;  3VXC A;  3RYD A;  2JJK A;  3TOD A;  1EZO A;  4DZ1 A;  3H6V A;  5H8H A;  2UVG A;  4N6P A;  2ESN A;  1IIT A;  5A5X A;  1NUX A;  1RDZ A;  4GFR A;  3EPE A;  2XXI A;  4GL0 A;  3HPI A;  4U21 A;  1S50 A;  3H03 A;  5JK4 A;  2H4I A;  1IXG A;  3PPR A;  2DXY A;  1DSN A;  1PC3 A;  3TTR A;  1Q1K A;  2VOZ A;  1Y20 A;  2PT1 A;  1KA0 A;  1M5C A;  2Y7W A;  5DW8 A;  3HO7 A;  4N8G A;  4DIG A;  2NWJ A;  4HTG A;  4FEC A;  4BDL A;  2O84 X;  2P3V A;  3TTL A;  4KD5 A;  3TZA A;  1GVC A;  1B1H A;  4KR5 A;  1LBX A;  5CBR A;  1JNF A;  2UXA A;  5ET5 A;  2KQZ A;  1RYX A;  1YAE A;  1O63 A;  1M5B A;  1YZ0 A;  1M5F A;  3FVO A;  5BWJ A;  3RT6 B;  2CZI A;  2XXT A;  1N04 A;  5CBS A;  3HCQ A;  4OFL A;  2Z23 A;  1YCJ A;  3OO7 A;  3OD7 A;  2GQ1 A;  4LAT A;  2VP1 A;  2B3F A;  1WDN A;  4ZEB A;  2ALU A;  2ANJ A;  1MQG A;  4MJO A;  2THI A;  1VDW A;  2XX8 A;  1B7H A;  2QFL A;  1FPD A;  3FIR A;  1FBP A;  4F3P A;  2QSX A;  4PCD A;  5I2K A;  1N7X A;  4XKP A;  2WYP A;  4GRK A;  4ELP A;  4N91 A;  2HAV A;  2V3T A;  3PPQ A;  2XWV A;  2PMS A;  5DVF A;  2DWH A;  4AS4 A;  2F35 A;  2XXX A;  2FHY A;  3U92 A;  5I59 B;  5IAI A;  2R8T A;  3G3F A;  5IM2 A;  1B2H A;  4PBH A;  4PDH A;  5LTC A;  3RPW A;  4C1T A;  4FAJ A;  1NNP A;  1FBE A;  3FV2 A;  4FBP A;  1B3F A;  3TMG A;  4R72 A;  4N6D A;  4R6H A;  4FIM A;  4LON B;  1LFI A;  4HXV A;  4P0I A;  1URG A;  2NXO A;  3KSJ A;  4F29 A;  4OVP A;  3K0V A;  3IFC A;  3M3L A;  2O51 A;  3E13 X;  4H8I A;  4PF8 A;  3D1R A;  2KLF A;  3T96 B;  2AIX A;  2OK2 A;  3V89 B;  4RJZ A;  2FYI A;  1QUJ A;  3OO8 A;  2O69 A;  3S9N C;  4WED A;  1JEV A;  4NQ8 A;  3MC2 A;  4RPN A;  2X26 A;  5I5P A;  2FIX A;  3G3K A;  3CI8 A;  5H8N B;  3MJN A;  4JWX A;  5DEX B;  3Q28 A;  1S9T A;  1LBB A;  1DCU A;  3QIM A;  3FVN A;  3JV9 A;  4IY6 A;  3MP6 A;  1CB6 A;  5DEX A;  3IX1 A;  2HAU A;  2RIN A;  4HS7 A;  1P1O A;  2Y7I A;  1DPP A;  1HSL A;  1LCT A;  4I62 A;  3KC1 A;  3FZV A;  1Y4T A;  3O6I A;  1RDX A;  1QGX A;  5TP9 B;  5H8F A;  1FPK A;  1NNF A;  4EDP A;  1ELJ A;  1II5 A;  4EQB A;  1A55 A;  4R2F A;  1B1X A;  1USY E;  1Y3N A;  1B58 A;  1ZU0 A;  3HHG A;  4IO2 A;  1RDY A;  1MXW A;  5TP9 A;  4C1U A;  4EXK A;  4ELQ A;  2XD3 A;  3FJG A;  1RYO A;  4XFE A;  1XS5 A;  4P8B A;  2OX3 A;  1FTJ A;  2I0C A;  3WAF A;  4LQ5 A;  5CMC A;  2HHM A;  2BJJ X;  4G77 A;  1M5E A;  4R6Y A;  4ZS9 A;  1PB9 A;  4IR8 A;  4ESW A;  4MFI A;  3QAX A;  1TWY A;  1MH3 A;  1F9B A;  1LAH E;  3E79 A;  3HFU A;  1XC1 A;  2NOO A;  3CSB A;  3UK4 A;  1MPC A;  3TAJ A;  4QHQ A;  4TLL B;  2AYS A;  5ET8 A;  4JXI A;  1WVJ A;  1B5H A;  4K3F A;  4MBP A;  4G2Z A;  4YB6 A;  3SER A;  3K00 A;  4UA8 A;  1NL5 A;  4LZ7 A;  3OEM A;  4OVR A;  3TDJ A;  3MYU A;  3E4R A;  5EYF A;  3PD8 A;  1SVX B;  3DEL B;  4YKK A;  4HCW A;  5FHO A;  3IOU A;  3C9H A;  2E1S A;  3VE1 B;  2Q89 A;  4MIJ A;  3T93 B;  4GWS A;  1FCK A;  4NX1 A;  5L8D A;  4QFP A;  2DYX A;  4KYE A;  2ZNU A;  3B6T A;  1SQY A;  5I2N B;  4MNC A;  4OER A;  3KC0 A;  3EKI A;  4ZZE A;  4H8J A;  1SPI A;  3FAS A;  2UVJ A;  1MXZ A;  4MLV A;  5I2N A;  1B0H A;  1EH3 A;  5J1D A;  1O64 A;  3A29 A;  2REG A;  3R6U A;  4GWY A;  5FBP A;  4GX6 A;  2B65 A;  1H76 A;  1N76 A;  5CMK A;  3GXA A;  2XX9 A;  3VXB A;  3IB1 A;  1N3X A;  3FGS A;  2HEU A;  2M8C A;  1ZKB A;  1MXX A;  2UVH A;  4NWD A;  4UAC A;  3OEL A;  5I56 B;  3PUV E;  1JW5 A;  3E3K A;  3MVW A;  4PGP A;  2OZZ A;  4MEV A;  4PGN A;  4YKP A;  1UTB B;  2VD2 A;  4MCO A;  1NV2 A;  3BIH A;  1FJ9 A;  3PPP A;  3U72 A;  2XXW A;  4RXL A;  3EHT A;  2XXK A;  1UTB A;  4U1O A;  3PUZ E;  1B7Z A;  1FJ6 A;  5K2Y A;  1YYZ A;  4X1D A;  4KYD A;  4DXU A;  1FQE A;  2O1M A;  1B3G A;  1XI6 A;  4BDN A;  1ZLQ A;  2DS9 A;  2DOJ A;  1PDA A;  1MQI A;  2OWT A;  3KBZ A;  4EF2 A;  1DK4 A;  2WEF A;  1NNT A;  3SET A;  3B6W A;  3RPL B;  1LAG E;  4R75 A;  3G3G A;  2RF1 A;  3H6T A;  2VGQ A;  3LSX A;  1QVS A;  3IOV A;  2DWJ A;  5L9O A;  4FED A;  4LA9 A;  3FUZ A;  4PC9 A;  3RPL A;  2HXW A;  1SD3 A;  3H6U A;  4OVS A;  1SYH A;  3KN7 A;  4EUO A;  3MP8 A;  1SW1 A;  2F6P A;  4MX6 A;  1FSA A;  4NN3 A;  4XKQ A;  2QJE A;  3LSW A;  1DTG A;  4XEQ A;  2QVU A;  4NE4 A;  3BBR A;  4KI0 E;  2PFZ A;  4R2B A;  2VPN A;  1FPF A;  4QRZ A;  4I3E A;  3CIJ A;  5CMB A;  4GQO A;  1KWH A;  1IMD A;  4JB7 A;  4IO6 A;  2ZXT A;  5DVI A;  2RC9 A;  3K1N A;  4I9D A;  4GF8 A;  2F7A A;  4QFL A;  4N4U A;  1FTM A;  3LR1 A;  4GBW A;  2CMO A;  4MNP A;  1FPE A;  5IGA A;  1GTK A;  5B70 A;  1DOT A;  1JW4 A;  3FXU A;  4X9T A;  3K1M A;  3TFL A;  4NGU A;  4AQ4 A;  1K9Y A;  4JWO A;  1FQA A;  3GZG A;  1LLS A;  5AA3 A;  2OPD A;  4O7I A;  1FPI A;  3T9H B;  3OSQ A;  2A5S A;  3KBR A;  5EQ9 A;  4F2Q A;  4ZEI A;  4DXC A;  3VFJ A;  4F2O A;  4PF6 A;  3ISP A;  1MPD A;  2IA4 A;  3TYH A;  5H8H B;  2GH9 A;  2A5T B;  3IFA A;  3B8B A;  4DLD A;  4PQJ A;  1BP5 A;  1VE4 A;  3MPL A;  1BIY A;  1QKB A;  3SZP A;  1S7Y A;  3IOW A;  3EF7 A;  5JTY B;  3S9M C;  2A5T A;  4XKN A;  3PMX A;  5ESY A;  3DM0 A;  3EHU A;  4EQ7 A;  4P0G A;  4G68 B;  3MZB A;  4GOT A;  2UVI A;  2XXR A;  4JVD A;  3O6G A;  4F39 A;  3TCH A;  3W9W A;  1FPG A;  4GL8 A;  3TEP A;  3MQ9 A;  5JTY A;  2DWI A;  4OA4 A;  4IB2 A;  4O3B A;  2H98 A;  5L9S A;  4G68 A;  1MDP 1;  2ZZV A;  4WXJ A;  3EHS A;  3EQ1 A;  4ISU A;  2XXY A;  2F8D A;  2CZH A;  3IOR A;  3TTN A;  2OWS A;  4GIZ A;  1UTH B;  4QXD A;  4IGR A;  4OFO A;  3FXB A;  3PPN A;  5F1Q A;  3MST A;  3QSL A;  2OJT A;  1UTH A;  4OEU A;  1QUI A;  2Q74 A;  1B51 A;  1LAX A;  5B7D A;  5CM6 A;  3IO4 A;  2F5X A;  4GWU A;  3KJT A;  2P0S A;  1G0H A;  2UYF A;  2Z8F A;  1CNQ A;  2XXV A;  2XWO A;  3B50 A;  1ZJL A;  5FHM A;  3KSX A;  4YZZ A;  1Z7M E;  2GHA A;  4F3G A;  1ZBM A;  1PB7 A;  4HW8 A;  5AA2 D;  4H65 A;  4EQ9 A;  2DP8 A;  4TLM B;  2Q9T A;  3U93 A;  4ZED A;  2RC7 A;  1VR5 A;  3FVG A;  3GYY A;  3TCG A;  5F7V A;  3G3H A;  1FBD A;  4XIG Q;  3T66 A;  4PFU A;  2ZYM A;  2WBB A;  1N0T A;  3FJ7 A;  5L9M A;  4NF8 B;  3BIG A;  5I2K B;  4GWO A;  5AA1 A;  4NF4 B;  4YU0 A;  3KFM A;  2HFB A;  4NF0 A;  4NF8 A;  2HXR A;  4NF4 A;  2YJP A;  1JVY A;  4GWX A;  3H06 B;  1NV4 A;  4GVO A;  2I4B A;  4LZ5 A;  3O29 A;  4OET A;  3T9U A;  2G93 A;  4F22 A;  1A8E A;  3FJM A;  3UN6 A;  3K01 A;  2ZNT A;  4UAB A;  4QSD A;  1IMC A;  2QS4 A;  1XVY A;  2ONK E;  2RCB A;  4IY5 A;  1DBZ A;  3O97 A;  4FJP A;  2ZZX A;  5FHN A;  1SW5 A;  3U8Q A;  3NOH A;  3OEK A;  1FPL A;  4WEP A;  1XOC A;  1US4 A;  1EZP A;  3A09 A;  3B6Q A;  1D4N A;  5IKB A;  1B5J A;  4GLI A;  4N13 A;  2ZYO A;  3M3F A;  2KR0 A;  2L5V A;  4QSC A;  2XWK A;  3T1B A;  2NVU B;  2XXP A;  4YB5 A;  4OES A;  1POY 1;  2R9J A;  4LUB A;  3W15 C;  3KGC A;  1Y9U A;  1FPB A;  4KHZ E;  1J1N A;  1D9V A;  3JYR A;  1MDQ A;  1HSJ A;  4R9G A;  5DVJ A;  4OEV A;  4MAG A;  3SEY A;  1N84 A;  1P1W A;  2AL5 A;  4OVQ A;  4OAN A;  4RNS A;  3CFL A;  5H8F B;  2DWA A;  2PCR A;  3MWB A;  4ELO A;  2F97 A;  1MQD A;  3TQL A;  1P1N A;  5CC2 A;  2P1S A;  1I69 A;  3O66 A;  4O8M A;  2PBW A;  2FA7 A;  4I3Y A;  3SEW A;  1N3W A;  3MBP A;  4Q8R A;  3W9V A;  3C36 A;  5KCJ B;  4THI A;  1KZ8 A;  5I57 A;  4YB7 A;  3RN8 A;  2HZK A;  4Q0C A;  1FQD A;  1Q35 A;  3U94 A;  2Z8E A;  3I5O A;  3OSR A;  5KCJ A;  2O6A A;  4JWY A;  1MY2 A;  3K6U A;  1MM7 A;  2O68 A;  2QPQ A;  1A7L A;  3RQT A;  1DTZ A;  3PUW E;  2I0B A;  3D4C A;  4OFJ A;  1UQW A;  2GRV A;  4IO4 A;  1MXU A;  5EYG A;  1ANF A;  4X1B A;  4F31 B;  1SDX A;  4HCY A;  3RNN A;  4POW A;  2FBP A;  5LOM A;  1B05 A;  5AA2 A;  4C0R A;  1OVB A;  1GV8 A;  4O7M A;  3TQW A;  1LBW A;  5DYH A;  2OPE A;  4PAF A;  4ZZA A;  4R73 A;  3G7W A;  1M5D A;  2OWZ A;  4H45 A;  4G8H A;  1JP4 A;  2DQV A;  2MKZ A;  1A54 A;  3LV0 A;  3T0J A;  1PEB A;  3MZ9 A;  3ZKK A;  5EQ8 A;  4PP0 A;  1IQ7 A;  1ZTY A;  1TFA A;  4RA1 A;  1R6Z A;  3E78 A;  3JZJ A;  5IZ1 A;  3KZG A;  5JEI A;  1YPN A;  3L6H A;  2QL3 A;  3KG2 A;  4TOZ A;  1MXV A;  4U4X A;  3UOR A;  1Z7N E;  1BLF A;  3K4U A;  3OMB A;  3PV0 E;  3C35 A;  1IZ1 A;  4N15 A;  3MVY A;  1AIV A;  3IL1 B;  4G8M A;  2QRY A;  4BDQ A;  1XT8 A;  2F78 A;  1PBP A;  4LP2 B;  1LST A;  3LBS A;  3I6V A;  2WX9 A;  4ZEC A;  4PAK A;  1NH7 A;  3L6G A;  2OLB A;  4MLQ A;  1NUZ A;  4I8C A;  3ODB A;  1NV0 A;  2XXQ A;  1MS7 A;  2B4L A;  4JSD A;  1AH5 A;  4JSO A;  1EU8 A;  4P3L A;  1LBZ A;  3VDF A;  3T9X B;  3C4M A;  2QS3 A;  3VLV A;  4MF3 A;  4MH5 A;  3THI A;  1POT A;  3LUY A;  4Z0I A;  1FTO A;  2IEE A;  4JDF A;  3S2V A;  4OVJ A;  4OVT A;  3O6H A;  5CI5 A;  2UYE A;  4H67 A;  3O2A A;  2Y5K A;  2RCA A;  4PE5 B;  2PYY A;  4PFR A;  3TPA A;  3DLN A;  3ILU B;  3TEL A;  3IB2 A;  4YKJ A;  1N7W A;  2OBG A;  4X48 A;  2WBD A;  4IO3 A;  3PD9 A;  1OQG A;  1PBQ A;  4G61 A;  5H8S A;  2QS2 A;  3SEU A;  3A3C A;  3FXR A;  1B5I A;  4KFQ A;  1Y4C A;  4X8R A;  3Q27 A;  3QK6 A;  2X7P A;  1SW2 A;  1KA1 A;  1SW4 A;  3ZS6 A;  1JEU A;  1H45 A;  4ONY A;  1IXH A;  1JVX A;  2Z22 A;  3T22 A;  3OO9 A;  3M3K A;  4PTK A;  5H8Q A;  4XXU A;  3MW0 A;  1GR2 A;  2VT5 A;  1LAF E;  4GX4 A;  5ITP A;  3MUQ A;  2H99 A;  3TUS A;  1IUD A;  4R6K A;  2DSF A;  3RLF E;  1TFD A;  2H25 A;  2ABH A;  2R6G E;  4OXV A;  1JET A;  1A99 A;  4DE8 A;  3IO6 A;  2NUV A;  3C32 A;  2CZL A;  5BUU A;  2LAO A;  5CMM A;  4GBV A;  2PX1 A;  1EZ9 A;  4GD5 A;  1MH4 A;  1LB8 A;  2XD2 A;  5ET6 A;  4PFT A;  3PGF A;  3LSF B;  1MQH A;  4AS5 A;  4DCY A;  2DXR A;  4H6D A;  2VPO A;  4QBA A;  2ONR A;  2ZYN A;  3SDF A;  1XVX A;  4NHB A;  4E0X A;  2H9B A;  3R7X A;  1NUY A;  3K6X A;  5EHM A;  3UP9 A;  1QW0 A;  2WYK A;  3MZ1 A;  1A8F A;  3ZKL A;  4F18 A;  4RPO A;  1H3D A;  1VFE A;  3TKD A;  4Z7E A;  4WKM A;  4RYA A;  3EN3 A;  1OVT A;  4BLA A;  3SKP A;  1AMF A;  1NV7 A;  1P1Q A;  5ICT A;  3ILT B;  1IIW A;  3K6W A;  3IOT A;  3PPO A;  3KOT A;  5IZ3 B;  2I3V A;  2D3I A;  2E0S A;  1FBF A;  5ET7 A;  1VSO A;  1FW0 A;  5F24 A;  4NMY A;  4H46 A;  1BTJ A;  5HBC A;  3PUY E;  3CVG A;  5IZ3 A;  1B0L A;  5FTH A;  1LBY A;  5ITO A;  5FTI A;  1OLA A;  3HHF A;  3V83 A;  4F1V A;  2F36 A;  1DMB A;  4QFK A;  1B3L A;  3KJ7 A;  5EQA A;  3H4Z A;  3IJO B;  4Q30 B;  4P9K A;  3IAZ A;  1RKM A;  4OWD A;  4ND9 A;  4F1Y A;  3TTM A;  1EYJ A;  4U2R A;  1PB8 A;  2R71 A;  3R26 A;  3K02 A;  4H1X A;  3N6U A;  5ISU A;  4IGT A;  4NG7 A;  4M4G A;  1URD A;  4DXB A;  2X7Q A;  4NF5 B;  3VV5 A;  5HPQ A;  4LZ8 A;  2B3B A;  2Z8D A;  3P7I A;  4GWZ A;  3D4G A;  2YLN A;  4LVQ A;  4H5F A;  3CSG A;  1EYK A;  3LSL A;  3OXN A;  1LEV A;  4NF5 A;  2F6G A;  3RTF B;  1BKA A;  1SI0 A;  4G68 C;  4XF5 A;  3VVF A;  3FXQ A;  4BDR A;  3H7M A;  2QMX A;  3Q26 A;  1IXI A;  1NMU A;  1P1U A;  4PBQ A;  1DPE A;  2QMW A;  4TQU Q;  4F3B A;  4OZ9 A;  4YMB A;  3SEV A;  5TU0 A;  4QSE A;  1MY0 A;  4F3S A;  1SI1 A;  4P1E A;  3RGY A;  4OTE A;  3GBB A;  1OLC A;  2I4C A;  5LDZ A;  2I58 A;  1R1N A;  4P11 A;  3N26 A;  2W7Y A;  4OMB A;  4HE2 A;  4EF1 A;  2F3B A;  4OYV A;  2DDK A;  2V4C A;  4LQ2 A;  4YKI A;  4ZDM A;  4QF9 A;  1QUK A;  1Q9D A;  1LFH A;  1US5 A;  1NV6 A;  3PU5 A;  1OQH A;  1IMB A;  2DE4 A;  2REJ A;  2HCA A;  1MM6 A;  4F1U A;  5EHS A;  4YMA A;  4N8Y A;  4I1D A;  4RY1 A;  2P2A A;  3BKI B;  4PFY A;  4M1V A;  1IME A;  3TTK A;  5K2X A;  3DP4 A;  4R9F A;  4FAT A;  1QJM A;  2Q8M A;  4P56 A;  3TCF A;  1XHY A;  1NV3 A;  1B32 A;  2WKY A;  3MAM A;  2DE2 A;  2Q88 A;  5I59 A;  4GWW A;  4ECF A;  3I3V A;  3C31 A;  4NTL A;  4U1Z A;  4AB5 A;  1FBG A;  4KCC A;  3IR1 A;  2HQ0 A;  2V84 A;  1LFG A;  4QFN A;  1IEJ A;  4HE1 A;  5ICQ A;  5I3S A;  2ZYK A;  3V5A A;  3N94 A;  3DP8 A;  1MY3 A;  2O7U A;  4NF6 B;  4NED A;  5DT6 A;  1LB9 A;  3RY3 A;  3PUX E;  2ZMB A;  1TXF A;  1MRP A;  1IMA A;  3HV1 A;  1A40 A;  2VD3 A;  3G3J A;  3MPK A;  2FIE A;  2G29 A;  2B4M A;  4NF6 A;  4N07 A;  3LUZ A;  1NI9 A;  5I7I A;  3QUF A;  1UIV A;  4HE0 A;  4XKR A;  1R9Q A;  3LC8 A;  3Q29 A;  3CG1 A;  4PFW A;  5HM4 B;  4F19 A;  1B52 A;  3ONM A;  1NUW A;  1INP A;  1B46 A;  4L17 A;  3T9V A;  4DDD A;  5I57 B;  3FV1 A;  1Y1M A;  3C33 A;  1QUL A;  1AWB A;  2RC8 A;  3PMV A;  3IJX B;  5H8N A;  4QFO A;  3CFX A;  4U22 A;  2V3Q A;  2F7B A;  4IO5 A;  5I84 A;  3KN3 A;  4XTC Q;  2O1L A;  1FBH A;  1JQF A;  3S4U A;  4FE8 A;  2CEY A;  4DI4 B;  4X04 A;  1R9L A;  2XXH A;  4PDD A;  4IO7 A;  3OOA A;  1B6H A;  4U4S A;  1USY H;  1LBV A;  2FVZ A;  4DI3 D;  3V8X B;  1MY1 A;  4JVC A;  3VVD A;  2DE3 A;  1FTK A;  3O28 A;  4G8N A;  4H5G A;  3IB0 A;  2Y7R A;  3FBP A;  3QYT A;  1L5T A;  3C34 A;  3UGW A;  2V25 A;  1Y3P A;  5AA2 B;  1MY4 A;  3UA8 A;  5CRY A;  2BJI A;  1TT1 A;  4O94 A;  4NWC A;  1B4H A;  3QUJ A;  2H5Y A;  5IZZ A;  1LBC A;  1P99 A;  2F3D A;  1NKX A;  4YIC A;  4KXP A;  1MQJ A;  1ATG A;  3M8U A;  4BDO A;  1NNK A;  3ZSF A;  4LN5 A;  2PFY A;  4JVI A;  3MVZ A;  3S9L C;  4H0W A;  3G3I A;  4FOR A;  2GFE A;  2FNC A;  1HSE A;  4YAH X;  4N81 A;  1Y3Q A;  2DVC A;  4KYS A;  4MHF A;  3BFT A;  2PVU A;  3BFU A;  4G4P A;  3PTY A;  3GBA A;  4MNI A;  4OEN A;  1AOV A;  3E9X A;  4ELR A;  1G0I A;  3B7D A;  3KN8 A;  4BDM A;  1I6B A;  3FAT A;  1FRP A;  3GLB A;  4FEB A;  2QS1 A;  1QKA A;  3N5L A;  4KCD A;  3VLW A;  3OEN A;  1FTL A;  2XX7 A;  3S9E A;  5KZT A;  2XA5 A;  1OIB A;  3H3G A;  5EYH A;  1Y1Z A;  1FQC A;  4JBZ A;  2V93 A;  3AXF A;  3CG3 A;  1T0K A;  1D9Y A;  2Y7K A;  4N6K A;  1D9Q A;  5EQ7 A;  1B9J A;  2ONS A;  4PAI A;  4OHN A;  4O3A A;  5AA4 B;  3VLU A;  1JW1 A;  1ZMG A;  4KPT A;  3CR9 A;  3CFZ A;  3U1O A;  2XXU A;  4AB6 A;  2HZL A;  4U23 A;  1YXI A;  5AA4 A;  1NV5 A;  3USD A;  1O7T A;  3FVK A;  5I56 A;  2CEX A;  3HN0 A;  3K1P A;  2Q2A A;  1FPJ A;  1ZIU A;  4NAP A;  2I6E A;  2F34 A;  5ELV A;  1MPB A;  3RTW B;  1BK4 A;  3IK6 B;  1OMP A;  5TPA B;  4PET A;  1MG1 A;  1B4Z A;  3DP6 A;  3UIF A;  1VFD A;  4POX A;  3FD3 A;  3CRB A;  4R74 A;  2XWI A;  3O9P A;  2CZK A;  1B40 A;  3MVX A;  1FBC A;  3RUM A;  2AL4 A;  4ZEK A;  2O7I A;  5TPA A;  4GXS B; 
#chains in the Genus database with same CATH homology
 1DBZ A;  4PFB A;  5ET8 A;  5IZ3 B;  1FBF A;  5ET7 A;  2ZZX A;  4OVR A;  3MYU A;  5F24 A;  4N17 A;  4H46 A;  3NOH A;  1FPL A;  4I40 A;  5IZ3 A;  1LBY A;  4HCW A;  4GX3 A;  4MIJ A;  4F1V A;  4GWS A;  1EYI A;  4NX1 A;  5EQA A;  3ROJ A;  2HPG A;  2KR0 A;  4PE3 A;  3QMF A;  2L5V A;  4MMP A;  2XWK A;  3T1B A;  5A5L A;  4MNC A;  4P9K A;  3KC0 A;  3EKI A;  1EYJ A;  1FPB A;  1SPI A;  4NG7 A;  3U65 A;  5J1D A;  3A29 A;  4MAG A;  4GWY A;  1K9Z A;  4GWZ A;  2P3N A;  5FBP A;  4GX6 A;  4PFI A;  4OVQ A;  4OAN A;  1EYK A;  1LEV A;  1FTA A;  2PCR A;  2QVR A;  4XF5 A;  4O8M A;  4P47 A;  4I3Y A;  1NV1 A;  4PBQ A;  2DVZ A;  3CHG A;  5J16 A;  4PGP A;  3W9V A;  1IMF A;  4MEV A;  4PGN A;  1KZ8 A;  4P1E A;  2HZK A;  4P1L A;  4MCO A;  2Y5L A;  2QVV A;  1NV2 A;  5LDZ A;  3BIH A;  1FJ9 A;  4HE2 A;  2F3B A;  5T3J A;  2XXK A;  2DDK A;  2QPQ A;  2V4C A;  1FJ6 A;  2ZZW A;  1Q9D A;  1YYZ A;  5EYG A;  1NV6 A;  1IMB A;  2DE4 A;  4F1U A;  3RYD A;  2JJK A;  4HCY A;  1XI6 A;  4N8Y A;  4M1V A;  2FBP A;  1NUX A;  1RDZ A;  3KBZ A;  1IME A;  1DK4 A;  2WEF A;  3RPL B;  2Q8M A;  4P56 A;  1NV3 A;  2DE2 A;  4O7M A;  1LBW A;  4PAF A;  5JK4 A;  4PC9 A;  4GWW A;  3RPL A;  2OWZ A;  4H45 A;  1JP4 A;  4OVS A;  2MKZ A;  1FBG A;  1KA0 A;  3LV0 A;  3T0J A;  4MX6 A;  1FSA A;  5DW8 A;  4N8G A;  4NN3 A;  5EQ8 A;  4HE1 A;  4XEQ A;  2QVU A;  5I3S A;  3E78 A;  2PFZ A;  2VPN A;  2P3V A;  1FPF A;  4I3E A;  5IZ1 A;  1IMA A;  1LBX A;  2FIE A;  2B4M A;  1IMD A;  5ET5 A;  3LUZ A;  2KQZ A;  1NI9 A;  5I7I A;  1YZ0 A;  4HE0 A;  2CZI A;  4F19 A;  4N4U A;  4GBW A;  1NUW A;  4MNP A;  4N15 A;  1FPE A;  1INP A;  5IGA A;  1AWB A;  4X9T A;  2GQ1 A;  4NGU A;  1K9Y A;  2V3Q A;  2WX9 A;  4PAK A;  4MJO A;  1NUZ A;  1VDW A;  1NV0 A;  4O7I A;  1FPI A;  1FBH A;  2B4L A;  2QFL A;  4DI4 B;  2CEY A;  4X04 A;  4P3L A;  1LBZ A;  5EQ9 A;  1FPD A;  4PDD A;  1FBP A;  1LBV A;  2FVZ A;  4DI3 D;  4PCD A;  4JVC A;  4PF6 A;  3ISP A;  4OVT A;  2WYP A;  2DE3 A;  3IFA A;  4N91 A;  3B8B A;  3FBP A;  2XWV A;  2Y5K A;  3SZP A;  4PFR A;  4AS4 A;  2FHY A;  2BJI A;  4O94 A;  5ESY A;  4JVD A;  2R8T A;  2WBD A;  5IZZ A;  5IM2 A;  3W9W A;  1FPG A;  4YIC A;  2F3D A;  4G61 A;  4PBH A;  4PDH A;  5LTC A;  4KXP A;  4OA4 A;  1FBE A;  4X8R A;  2ZZV A;  4FBP A;  4N6D A;  1KA1 A;  4LN5 A;  2CZH A;  2PFY A;  4JVI A;  4QXD A;  4HXV A;  3FXB A;  3MST A;  4OVP A;  4N81 A;  4PTK A;  4MHF A;  3IFC A;  2VT5 A;  4PF8 A;  2Q74 A;  3PTY A;  4MNI A;  3D1R A;  4GX4 A;  1G0I A;  5CM6 A;  1FRP A;  2F5X A;  4GWU A;  1G0H A;  4NQ8 A;  1CNQ A;  2XA5 A;  2XWO A;  5I5P A;  2FIX A;  3B50 A;  5EYH A;  4YZZ A;  1DCU A;  4GBV A;  4N6K A;  1D9Q A;  5ET6 A;  5EQ7 A;  2Q9T A;  4PAI A;  3GYY A;  4AS5 A;  1FBD A;  3KC1 A;  2WBB A;  1RDX A;  1QGX A;  3BIG A;  1FPK A;  2HZL A;  1YXI A;  2VPO A;  4QBA A;  1NV5 A;  4NF0 A;  1RDY A;  4NHB A;  2HXR A;  2CEX A;  1NUY A;  4XFE A;  4GWX A;  1FPJ A;  4NAP A;  4P8B A;  1NV4 A;  2OX3 A;  2WYK A;  4F18 A;  2HHM A;  1BK4 A;  4PET A;  4IR8 A;  2XWI A;  2CZK A;  1NV7 A;  4UAB A;  1IMC A;  1FBC A;  3E79 A;  3HFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...