1LC0A

Structure of biliverdin reductase and the enzyme-nadh complex
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
290
structure length
290
Chain Sequence
b'MITNSGKFGVVVVGVGRAGSVRLRDLKDPRSAAFLNLIGFVSRRELGSLDEVRQISLEDALRSQEIDVAYICSESSSHEDYIRQFLQAGKHVLVEYPMTLSFAAAQELWELAAQKGRVLHEEHVELLMEEFEFLRREVLGKELLKGSLRFTASPLEEERFGFPAFSGISRLTWLVSLFGELSLISATLEERKEDQYMKMTVQLETQNKGLLSWIEEKGPGLKRNRYVNFQFTSGSLEEVPSVGVNKNIFLKDQDIFVQKLLDQVSAEDLAAEKKRIMHCLGLASDIQKLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biliverdin Reductase A
molecule tags Oxidoreductase
source organism Rattus norvegicus
publication title Crystal structure of a biliverdin IXalpha reductase enzyme-cofactor complex.
pubmed doi rcsb
total genus 94
structure length 290
sequence length 290
ec nomenclature ec 1.3.1.24: Biliverdin reductase.
pdb deposition date 2002-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF09166 Biliv-reduc_cat Biliverdin reductase, catalytic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1lc0A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lc0A01
3HDJA 1JKIA 2DBRA 3D4NA 1ISMA 3PFWO 2H9IA 3D4PA 3DZFA 1CWUA 4BO4A 4M49A 3SLGA 1GFSA 2X7HA 3PWSA 3I4FA 4GGPA 1MA0A 4IJVA 4FFMA 2D59A 4LMRA 3FRJA 4A10A 4ALNA 3AOEA 3KETA 4RPLA 2QRLA 3R6DA 4PZEA 3GDFA 1EVJA 2E82A 4WKGA 3S1LA 3ZU2A 5BSHA 3MJVA 1I2ZA 5AXAA 3HADA 1A7AA 2GZ3A 5T8KC 4CM3A 1KETA 4TQGA 4B7XA 1ISFA 2Y0EA 4Q3CA 4RVGA 3F46A 3GVXA 3X2FA 1ZFNA 1L1FA 2A35A 1PTJA 4KWIA 1Y8QA 1SB8A 3I1JA 1R4NB 1VJ0A 3AU8A 3D5TA 3FD8A 4NFYA 1U8XX 1I30A 2V65A 1ZMOA 1BSVA 5A02A 2C0CA 4MO2A 3T7EA 1SO8A 3AI3A 3ANLA 3E48A 5DCYA 4PRKA 3EZYA 4KUGA 4U7WA 2VYND 3WQQA 1JKFA 1ONOA 1F12A 4EDFA 1PL6A 1VJ1A 3ONDA 1N2SA 3AM4A 3UW3A 2OOSA 2WEKA 4J43A 4Z3DA 1UH5A 2IEBA 1PZHA 3SLKA 4D0RA 1YQGA 5TIIA 3GFBA 3LK7A 3QVOA 2I5PO 3WWYA 2PD4A 4WNCA 3OIFA 2E6UX 2GCGA 3E8XA 1O6ZA 2J8ZA 4OH1A 1LXCA 4BNYA 2H5LA 5C3MA 4WOJA 4U0JA 1TVEA 1E77A 4CMGA 1Q1NA 2PZJA 4YJHA 3GZNB 2EG9A 1P0FA 2P9CA 4DC1A 1QYXA 1T25A 2Q99A 3NGLA 3HHPA 3VZPA 3P19A 5L4SA 3FCOA 1JDJA 4HP8A 1IE3A 2DC1A 3EDMA 4PLGA 3UHAA 1AUPA 1H6BA 3D7LA 1DHTA 4BGUA 4H15A 5JC8A 1GY8A 2JFFA 4AJOA 2NNLD 3DWFA 2NVWA 1UDAA 2OBYA 5EESA 5TLSA 1C0IA 5L9AA 1O5IA 3DOCA 3C1TA 4EJ0A 4R9SA 2RHCA 1K3TA 1V0JA 4ILKA 4HNGA 4EITA 1UZNA 4EJMA 1U5CA 1DOHA 4CM5A 3PPIA 4PG5A 2WD7B 1AXEA 4FB5A 3E1KA 1LX6A 3WG9A 2EV9A 4E30A 1YB5A 4YT8A 1UXKA 1YWGO 1DEHA 3ETEA 1DRWA 3GHHA 3F4BA 2UVDA 2GRAA 4PLTA 1YB4A 1G1AA 4DUPA 3WSWA 3ICCA 2BLLA 3QVXA 3G3EA 1LU9A 1QV7A 5AYVA 1E1NA 4BNKA 3UFXA 3TZQA 1XA0A 1IYZA 1RPNA 2X4GA 3DZGA 3PGJA 5I7SA 2IODA 3E5RA 1DXYA 2C7GA 2FR0A 5GMOA 5LC1A 3W4KA 2JAHA 1HTBA 3ORFA 2VQ3A 3NJ4A 1M66A 2VOJA 3ETDA 2RH8A 3ICPA 3ZV3A 4KP7A 1LRJA 5JDIA 3EC7A 1NASA 4RF5A 2PD3A 2O3TA 3RKUA 4U5QA 1JAYA 5KOIA 4IJWA 4FFOA 2UDPA 3K2EA 4RORA 1QMGA 3U9LA 4LK3A 4NFHA 3TDKA 5A9RA 3BTUA 4PLFA 1JN0A 1CQIA 4HADA 4UVDA 4WCDA 1YBAA 2J3KA 1XU9A 4CPDA 2DUUA 1HL3A 4F6LA 3I23A 2OORA 1NAIA 1BDBA 2NACA 4YTEA 5G0WA 3R3SA 2HLPA 2O2SA 5L4NA 3ZU4A 3ZWAA 5JAQA 1SC6A 3B20A 4KTVE 2IZ0A 3JQ9A 3D3EA 2XF8A 1Q0HA 2ZB8A 3IAHA 3HQ4O 3NRCA 4HUJA 4J49A 2YQ5A 5A5EA 2EP5A 1B16A 2H1SA 4M54A 4TROA 1GYPA 2V6BA 3S55A 4J1QA 3OJFA 4XB2A 3DZIA 3MZ0A 3C85A 4GSLA 4NR0A 4S3MA 3DBLA 2A9FA 2HU2A 3GAZA 1DIHA 3CUKA 4RVHA 2NU8A 2DFDA 3F1KA 3SC4A 2AQ8A 5CEFA 1UJMA 4NNJA 1GV0A 3NTRA 2X0IA 1J6UA 2ZB3A 1IHYA 3JD3A 2QIOA 1BXZA 1E5QA 3HFGA 4K6CA 2B4RO 5CDTA 4D44A 4BKPA 1RYEA 1ZIDA 2ZKLA 2Q1WA 4CR7A 2O2YA 3FHLA 2C2XA 5G2OA 4JBHA 5BNTA 1YS4A 1PR9A 3PJEA 4WJZA 1KC1A 3RUIA 3JQ9C 4IDEA 1CRWG 1YJQA 1EQ2A 1VL0A 5K6AA 1SEPA 1OMOA 4B3HA 1T2DA 1DC6A 2D0IA 4FPXA 5EQFA 3WJ7A 3NT5A 4TRRA 5EQDA 5KJ1A 4BNLA 1O89A 1C14A 3I9LA 5COBA 1Z6ZA 2B35A 4ZHSA 4R1NA 4C7KA 2CVQA 1VPDA 3D4OA 1E3WB 3AFNA 1QYDA 2SCUA 4WNIA 4PG8A 4HX5A 2EXXA 4RCVA 3E9QA 3I9MA 3VTZA 2ZTMA 1YOVB 2HK8A 3B6ZA 3UGKA 1CEQA 1NP3A 3BTSA 3PEFA 5DBFA 4DPMA 1BMDA 4FQ8A 4O63O 3DAGA 1NQ5A 1JQBA 4PN3A 4E5MA 4RPKA 4CMJA 2OUIA 2GSDA 1R66A 1I10A 3GN1A 1PWXA 1G0OA 4PVDA 3T4XA 1YJ8A 2I65A 4BMSA 2DVMA 4GVLA 3IP3A 4NBWA 2HJSA 2XXBA 4I8XA 4K9DA 3V2HA 1UAGA 3KHUA 2PGJA 4P8RA 1P44A 3ZWOA 1E7RA 5KVCA 3WGGA 3HDHA 4JCOA 2DKNA 3DHNA 3P2YA 3DL2A 4II3A 5IDYA 3RSHA 5F1OA 3GQVA 1WAMA 4I5EA 4A73A 1BW9B 2ZQZA 3O8QB 1X7GA 1FDUA 1H94A 1AXGA 4G5HA 2EJWA 3MTJA 3PQDA 3BTOA 4BNGA 4E2WA 3H6KA 3EW7A 2WYUA 1MLDA 1MG5A 3HB5X 5CPFA 5HTOA 1KVQA 3PVZA 4JP3A 1DJNA 4MP8A 4PIVA 5G0TA 4ZQGA 4DVJA 4J2OA 2OO5A 3ZWVA 5KTKA 3TRIA 2Z95A 4B7UA 2DLDA 4R16A 3QWIA 4J9UE 4RGBA 5TJ9A 1JA9A 3WLFA 2H6EA 3R0IA 2GD1O 1YKFA 5L40A 3KEOA 2Y93A 2OXIA 4J3FA 2F1KA 3QIVA 4Z3KA 4PVCA 1GYQA 1YL5A 3ONFA 4QTZA 4YYZA 3MTGA 4XR9A 3ZWYA 4CMIB 3DZJA 3NTOA 3LC1O 4FJ0A 4IDGA 4II2A 2R00C 5A3VA 4BNMA 3RUDA 4LRSB 1I24A 2VYNA 1BDMA 3JQDA 1I5RA 3VPHA 5CAEA 3PLNA 4RQUA 4NHEA 5JO0A 1Y9AA 3DTTA 5L4LA 1ENPA 5EERA 2D5CA 4UAGA 5JNLA 3ZWCA 1ID1A 4MKZA 1P1JA 4MVJD 4J0EA 4L4XA 4R1UA 4RO0A 2OL4A 4W7HA 4A0SA 4D3DA 2YV3A 3BHMA 3KB6A 4TKLA 4W9NA 5TF4A 2OP0A 1E92A 4MOWA 4FN4A 3L9XA 3RBZA 1FDVA 3JV7A 2RBEA 1FDTA 1P1IA 1ZK4A 3W8EA 1XYGA 4MP6A 1GCOA 2EW2A 5JYEA 2Q1SA 1ZEJA 3DFUA 1NBOA 3Q2IA 3KBOA 3F5SA 3NT2A 1P1FA 3P2OA 3F3SA 1PEDA 1QRRA 2Q45A 1M6WA 3RROA 4WLEA 3C1AA 1NVMB 3ZWMA 7MDHA 1DC5A 1LSOA 4O6VA 1MFZA 1TI7A 1GUZA 3ZHYA 3GDOA 2UAGA 2W4QA 2G1UA 3OQBA 4IDCA 1I32A 2ET6A 2A94A 5G0SA 1EVZA 2YW9A 4QFCA 3ROQA 1Z82A 3OA0A 1T2EA 3A14A 2VUTA 4LVCA 1ZH8A 4FBGA 1E3IA 2B0JA 1G6KA 2GN6A 1B2LA 1DIGA 1X7DA 1B8UA 1UDBA 2OMEA 3W6UA 4IMPA 2X0RA 3CEAA 1AHHA 1X0VA 4DBVO 3WQRA 1MX3A 1UXIA 5KVVA 5DOZA 5B1YA 2VUUA 2UV8A 4GAEA 4IDBA 4JX8A 5ILOA 2NM0A 2VWPA 4XGNA 4EUEA 4CM8B 2AEMA 4HFJA 3K73O 3INTA 1UXJA 3C24A 3WYBA 1X13A 4ALKA 5I7EA 4L8VA 2EEZA 3K8ZA 1Y7TA 2W8ZA 3ASUA 4YJFA 1SBYA 2Q4BA 2QW8A 4AJ4A 3DC2A 3DBHA 4DGSA 5LDHA 3L9WA 4H16A 2WWRA 4J4BA 2D4AA 1BTOA 2J3HA 1ZBQA 3GG2A 4XQ9A 4KQXA 3WFIA 3IIEA 3WBFA 3FWNA 3H9QA 2I66A 1N92A 2GO1A 4IGEA 3WGHA 3KYCB 5CDYA 3QY9A 3SJUA 5TRTA 1E0DA 2JFGA 1GYRA 3MJSA 5A9SB 1EVIA 1LDEA 1QV6A 3JD1A 1YQXA 3Q9UA 2IYOA 1WZIA 1GADO 2HRZA 1D3AA 2HSDA 4HWKA 4OOEA 1MG0A 1Q7GA 4DYDA 3WS7A 1FK8A 1V3TA 2E48A 3INRA 4DTIA 1XSEA 3VZSA 5THKA 4L73A 2CZCA 3C3XA 4NBRA 1K0UA 3WTCA 5A3JA 1B3BA 3GC6A 4FCCA 3BHJA 3GF4A 4YAEA 1PZFA 4JXKA 1CQJA 5JW6A 1Z75A 3ZCXA 1CYDA 2O4CA 4KMSA 4OGWA 2VRBA 2X23A 3PTZA 4CL3A 2J6IA 5BT9A 1Q7CA 4FR5A 3B70A 4YRDA 4YPOA 4ZICA 2IRWA 1UXHA 2UYYA 3HDQA 5DT9A 2BI8A 4K6FA 4M86A 1R4MB 1LLQA 5DBGA 3GPIA 4IY1A 4MVJF 1PGJA 1ENOA 3O9ZA 2FSSA 3GK3A 4K26A 5JDIC 4FW8A 3U09A 4DYVA 3V8BA 3QHAA 5F5NA 3V1TC 3A28A 2P5YA 1UUFA 5TX7A 4EGFA 3UCXA 3PHGA 3AWDA 2OFPA 3JQFC 2Y99A 4UEJA 2HMWA 3PZRA 3L07A 5TT1A 3EY4A 3D3WB 2IE0A 3MOGA 4DQUA 3H7AA 4OL9A 1DRVA 4P38A 4D45A 2R2GA 1VSVA 1A71A 4JN6B 1SPXA 3PWKA 1K89A 5A9SA 4YAKA 3V2GA 4OXYA 2B83A 2BRUA 4UUMA 2AE2A 2PTGA 1LLDA 1ISJA 1HXHA 3TSCA 2R6JA 3ONEA 4B4WA 4JQCA 2HK7A 2AEJA 1QXSA 1A4IA 4PLPA 3IJRA 1EBUA 3K92A 1PIWA 1ZW1A 1E6EA 4IZHA 5TQVA 2DAPA 1GPDG 5DDIP 4YAGA 2Y1FA 3DXFA 3EMKA 5CDUA 1M2WA 1WLYA 2P5UA 3VH2A 4BNHA 1X1TA 2A4KA 1T2AA 2YYYA 4YEDA 1ADCA 2Q1UA 3WQSB 4O0LA 1Q7BA 1WDKA 1QP8A 5B4VA 2CVZA 4PZCA 2Q22A 1OOEA 1CJCA 3VDRA 2B5WA 2EP7A 4FD3A 4BO9A 3DBRB 2NADA 3OJOA 5GY7A 5FEUA 2VT2A 5BR7A 5CPBA 3G1UA 2CVOA 4CMHA 4WLNA 3UUWA 1BWSA 1XQ1A 2POQX 4MVJH 2GN8A 3QWFA 3DBRA 3JQFA 1WWKA 1Y8QB 1ULSA 2CDAA 1U5AA 3G1TA 3PRJA 4I9NA 1N1GA 3GHYA 2D1YA 3C8MA 1IY8A 4J6FA 1C0KA 4O1MA 4BNZA 2BFAA 1IL0A 3U4CA 3CMMA 3I3OA 5TC4A 3RASA 4QQRA 1DPGA 4IM7A 2X6TA 4JJFA 4Y98A 4NZ9A 4CQLB 3H3JA 3JCZA 5K9ZA 2NTVA 3MEQA 3S2EA 3AUAA 5IZCA 4RPJA 4OSPA 4GVXA 3GA0A 4EYEA 1JWAB 5ER9A 1MB4A 4L4RA 5KIAA 1TT5B 1PGQA 1ZKMA 1I3MA 4JJIA 1XQ6A 1DDOA 4RF2A 2BGKA 4R9RA 3TF5A 1W8DA 4P4LA 5EL0A 3LC2O 1EK6A 4AICA 3HE3A 4CM7A 4D3SA 2CFCA 2W90A 1NHGA 2WMDA 4YT4A 5JS6A 1E7SA 1IUKA 4I9UA 3WSVA 3DMYA 4YJGB 5M6DA 3AOEC 4J7UA 1KC3A 1A27A 1OAAA 3DHEA 3CMCO 2Y1OA 4XDZA 4QO7A 3U4IA 4ZGWA 4BO0A 5A9TA 3R3JA 4FIZA 4D46A 2RCYA 1HDYA 3KYDB 4HY3A 2VT3A 4ZVVA 4BO7A 5IN4A 4FDAA 4Z9XA 1K2WA 1ZK0A 3AUTA 3TOXA 1YRLA 1GQQA 4BQRA 1I0ZA 3DEYX 1IZ9A 1XWFA 4NG5A 3U0BA 2EKLA 4GWKA 1YO6A 3EK2A 2BHLA 4RL6A 1IULA 1BRMA 1MP0A 4XYGA 5T5QA 3OM9A 4BO1A 2OGUA 1UDCA 4CM1A 1LA2A 3JYLA 1PZEA 1U9JA 2B5VA 2YHIA 2Z5LA 4J4HA 2O3RA 3L4BC 2EF1A 5AOVA 4CLRA 4MVJM 1GQYA 4LRTB 4FSHA 3VPGA 8LDHA 2Y0CA 4Z9FA 3ZW8A 2PKQO 4BNUA 2VHVA 1GU7A 2W98A 2RIRA 1O8CA 3H2ZA 1B8VA 4XJTA 3M6IA 5EINA 4LMPA 3LT2A 2E49A 5JDCC 5JY6A 5G0UA 3ST7A 5IJZA 5L45A 3BZUA 3GVHA 3AW9A 2YY7A 4WOKA 1LDGA 4YJHB 1WNTA 4R54A 4BB6A 2AQIA 3M2TA 2ZCVA 4UUPA 1U3WA 2I6TA 3GGOA 3OH8A 2Q49A 3NJ8A 3FPCA 5FF9A 1PJ3A 4YCAA 4CQMA 1XEAA 4XR4A 2NV6A 3WB9A 5B12A 1E6UA 3CH6A 3B1JA 5JYFA 4E5PA 4Y67A 5CDGA 1E7MA 5DN9A 2Y1CA 3JSAA 2DPGA 4RZHA 2DFVA 3E18A 5IG2A 1V8BA 4GSKA 1NQOA 2X5OA 4Q39A 1WDMA 2GR9A 1JLLA 2VZ0A 3PLRA 3JYQA 3NEPX 4GX1A 1OI7A 4DMMA 4E13A 4F45A 4UVIA 4BGEA 2UUPA 1ISGA 3MJTA 2ZYGA 3NDRA 4EBFA 4CMBA 4ZRMA 1F8GA 1M75A 4OQYA 1C3VA 1PQWA 2W2LA 4TWRA 3QP9A 5T67A 4XCVA 1TT7A 3V5NA 4FC7A 3SXPA 3WYCA 3PJDA 2DQ4A 3KEQA 1LJ8A 4NK5A 3TZKA 3E6AA 4DPKA 1GZ4A 1LDNA 5KJFA 2PK3A 5A03A 3OSUA 3PIDA 4M1QA 3KLMX 4MKRA 1NWHA 2VYVD 4R01A 3MWEB 3VC7A 1LC0A 1P0CA 4EEZA 1IZ0A 3DOOA 2NU6A 2P68A 4R68A 3DR3A 3LF1A 2JCYA 4NPCA 4BV8A 4DLAA 1U2DA 4KWHA 2O4UX 3CINA 3GY0A 1NX6A 2R00A 1KVSA 3BMNB 1HKUA 3G17A 1Y5MA 3WGZA 3WOHA 4XD2A 5JCXA 1EE2A 4CL8A 3E5MA 5FYDA 3DBVO 4E32A 2BMAA 3U3XA 2WSBA 4IIVA 1PS9A 4G65A 4TVBA 4XB1A 3UKOA 5IDQA 3WMWA 5AXDA 5JFOA 5U9CA 3VVCA 5F1PA 3DMTC 1E1MA 2O7SA 4TMFA 4QXMA 3MJ4A 4YWJA 3EZLA 1EQUA 4I5GA 5L53A 3GVPA 2HDHA 4CUKA 2PA3A 3DFZA 3I52A 1B0AA 3K30A 4R41A 1NHWA 1X14A 3N74A 4J1NA 5JY1A 3AFMA 1KVTA 1XKQA 1ZK1A 4NBUA 2FR8A 4U0KA 1F8FA 3PGXA 2DTEA 2I76A 4M55A 1NQAO 2J5RA 3W4IA 4XWYA 1UXGA 1DFIA 1KYQA 3WNVA 4MVJG 3JQGA 4BB5A 1DIRA 5ICSA 3FSRA 4UVEA 3GZNA 1W73A 4W7IA 1PS8A 4ZQEA 1DJQA 1X0XA 4CODB 1QYWA 2RH4A 4J90A 3I9KA 4FFLA 5L7WA 1QSGA 3P5SA 4P4NA 1F06A 1Y6JA 4E5YA 3FN4A 1PZGA 3B1FA 1ENZA 3BMNA 3H9GA 3R1IA 4W4TA 4J0FA 2C5AA 3E9NA 4BS9A 2PZMA 1NAHA 1ZXBA 1DHRA 3V1UA 5U1PA 1GUYA 2WDZA 3KYDA 1R16A 2FMUA 3KLPX 4XIJA 5JYAA 5JCJD 1TA4A 1PQPA 1LTHR 4ALJA 1PGPA 2NSDA 3C1OA 2FN7A 4B8ZA 3RBVA 1E6WA 4A2CA 3KM0A 1I33A 1B8PA 4IQ8A 5L7YA 4P4GA 3U62A 2VTEA 3QVSA 3C7CB 3QA9A 5DNAA 1CERA 3CSDA 1NPDA 2X0NA 2DBQA 3OP4A 3HNPA 4O5OA 1VL8A 3DDNA 3PYLA 3CE6A 4CV2A 3OEWA 5K6AC 3OQ6A 3WNQA 4ZQFA 1H2HA 3HG7A 2VZ9A 4ZJUA 1HZJA 1PJLA 3AY6A 3ZWBA 5H83A 1YBMA 3L0DA 1O95A 5KVSA 2Q1TA 4L75A 5CFZA 1DO8A 3ITDA 3HN7A 3Q9NA 3TN7A 2FSVA 4Q3BA 4AVYA 2FP4A 1ZNQO 4PFJA 3RAJA 3ZNNA 1H6AA 5JAMA 3WYEA 1U4SA 7ADHA 4DLBA 1PR3A 1FF9A 3JYOA 4YB8A 1D1TA 1P33A 1D8AA 3GOHA 4XYLA 2DPHA 1GTMA 5BQFA 2YQ4A 3U4DA 3PDUA 3QE3A 1J5PA 5ICMA 3PJGA 2QRKA 2QRJA 3IS3A 1R0LA 1T1SA 2V6FA 1SAYA 3OEYA 4XZ3A 3UCFA 1ZJYA 4KTTE 2AMFA 4E21A 4TRMA 4Y6RA 2GN9A 2FR1A 1PGNA 4OKNA 4CV1A 1V6AA 1Y8RB 4WUVA 4E0BA 2IZ1A 3FI9A 1IPEA 3BYZA 1AGNA 1NVTA 5JO9A 4BO3A 4YBZA 3RD5A 1O9BA 4UREA 1YE3A 4U6QA 5HM8A 1F17A 4PLHA 4CMEA 4OQZA 1BHSA 4XKJA 1A72A 4BMVA 4S1VA 1U7TA 4KUEA 1DC3A 3QVWA 3QJ5A 5COAA 3TL3A 3LLSA 1R4MA 2WE7A 1Q0QA 4MDHA 3SC6A 4BV9A 4E12A 4EZBA 3UXYA 1YH3A 1NXQA 1PWZA 3ZNQA 4ID9A 1JVBA 1NR1A 1ONPA 4AJNA 3PYXA 1ENYA 3H5AA 2VZ8A 4NJMA 4NI5A 2G0TA 4MIYA 2NU9A 3LQFA 1KEPA 3GRPA 3S2IA 3KOUA 2G17A 3CZMA 1AHIA 1KVUA 1BXKA 4TSKA 1F0YA 4OKIA 3BMQB 3U4HA 3JQAA 2C20A 4XJSA 2HAEA 4BKUA 2G76A 3NYWA 4F6CA 3ZHXA 3TFOA 3BTVA 1K5HA 4E2XA 1B15A 5C7OO 4LCEA 3ZV5A 3E9MA 4IDAA 4FFRA 2I99A 3V2UA 2O48X 5B4TA 4AJ1A 5THQA 4L0QA 3ZU5A 3FTPA 2DT5A 3PWZA 4URFA 3UOGA 3INGA 1ISIA 1CDOA 2PNFA 2X1HA 4JNKA 4CR6A 3FBGA 2Y66A 1D4FA 3S2FA 1N8KA 1ZCJA 3GH3A 1XHLA 3IUSA 4J9VA 4CM4A 3KRTA 4KQWA 1YBVA 4Z0HO 3GNQA 2DBZA 2FPIA 1E3EA 4IZIA 3AUSA 5DULA 4D7AA 5H82A 5LCXA 4B3JA 2O3QA 4RLHA 1X15A 2VYVA 5JPIA 3UH1A 5I7FA 2EGGA 4ESOA 2O3SA 3RWBA 4AG3A 2X5JO 3ABIA 1MXFA 4WLFA 2NVUB 1EVYA 4ALLA 4CMEC 4E5KA 2IZZA 2DU8A 1RM4A 4LSMA 3O4RA 3L4SO 3ZHBA 5L95A 5KJCA 3GMSA 5T6BA 3U5TA 4I5FA 1KBZA 1EUCA 1X7HA 2I3GA 2X9GA 4PLZA 3RJ9A 5I8WA 3IDSA 2E4AA 4GLOA 4RDHA 1WVGA 1VC2A 2HQ1A 4DIFA 1C1DB 1HRDA 1E7YA 1D1SA 1E1KA 1GDHA 3D5QA 4GX5A 4E3ZA 1DB3A 3ENNA 1LSUA 4NFSA 3PFFA 1KEUA 5C7IO 3OHSX 5JLAA 1KEVA 1E1LA 2JFHA 3SX2A 2D2IA 4CQMD 4BOYA 3DHYA 3RC9A 1V3VA 2HMTA 3BAZA 3WIDA 1QG6A 3ROMA 1UP6A 3OJLA 3JQ8B 4BO5A 4C4OA 4CJXA 1LQTA 3O38A 4CLOA 1P31A 1HDXA 1PJ2A 2X86A 5IDXA 5I9NA 5J23A 4UUNA 2O50A 1PJ4A 1W0CA 4J1TA 1Z74A 1M67A 3V1YA 3ROKA 1SCUA 4AJLA 2HMUA 3O8QA 4FJ2A 2JL1A 4OAQA 3JQ7B 3ZHZA 2Y67A 4RVUA 1GZ3A 4YA6A 5T73A 4PZDA 2PZKA 4B4OA 1WP4A 4OJNA 2BGMA 1GCUA 1LUAA 5A05A 3IMFA 3WIEA 4YXFA 1LDMA 1SMKA 1PJQA 3K31A 3QSGA 3GZ4A 2YV2A 1V35A 2J5KA 3KTDA 5F3RA 2P9EA 4OIMA 4PLWA 1L7EA 4H3VA 4GPD1 1U3VA 2GERA 2G5CA 5DP1A 2JHGA 4YR9A 1PQUA 1N9GA 3ZWXA 3K9QO 3D1LA 3JD0A 3UICA 3CXRA 2NQ8A 4FGWA 1UP7A 3LT0A 3QWBA 1NFFA 3AI2A 1E3JA 1EE9A 4L4SA 1LRLA 1ZK3A 4YRBA 3KYBA 1NVGA 2VRCD 3BXXA 5TGDA 4NBVA 4IDFA 5IXYA 1YOVA 1Z7EA 4WECA 3VPSA 1DFGA 1K6IA 5JSFA 3CIFA 5KKAA 3GGPA 5A4DA 4MP3A 1IOLA 1XIVA 5TSDA 5G4KA 2GZ2A 4PG7A 2QZ9A 2YJZA 3ADPA 3WGTA 1SZJG 5TNXA 1I8TA 9LDTA 1XU7A 4GX2A 5COQA 3KSZO 1YONA 3FNGA 4R1SA 3FBTA 4ZN6A 5CDSA 3NAQA 1L7DA 2J5QA 1HDGO 3JQCA 3RUEA 5C5IA 9LDBA 3SVTA 1HF3A 2Q3EA 1P3DA 1Q0LA 4OHUA 1B3RA 1LSJA 5DBIA 2J3IA 3FWZA 2GLXA 2YFHA 3OECA 3O26A 4DXHA 2P91A 3JQBA 1T4DA 3H65A 3RU9A 3RQSA 3TPCA 1T26A 1BVUA 4UEKA 1MUUA 4IJUA 2IYPA 4HV4A 2I9PA 8ADHA 4XGIA 2PWZA 3EHEA 1EBFA 4NBTA 1P74A 4ND4A 4CUJA 1H6CA 3CKYA 5F1KA 3Q1LA 1ZUD1 2ZQYA 4IS2A 4WLUA 3ZWWA 5JE8A 4DBZA 3ADOA 4N5LA 2Q2WA 3JQ7A 3H2SA 1P77A 1RM0A 3PDJA 5ITVA 4DIBA 4MVJE 1B14A 2YFQA 5AQ1A 1AE1A 4J1SA 3N58A 2V6MA 4I9HA 4CMKA 2Q50A 2EERA 1V3UA 3H5RA 4BNVA 5C7LO 1XCBA 4TZTA 4I5DA 4CM4B 1JW9B 3OF2A 5L51A 2AXQA 4CLRB 4MJLA 5EIOA 2P4HX 1ZMTA 2ZYAA 2YHIB 3W6ZA 3KZVA 4N18A 2HCTA 2UUOA 4EW6A 1NFRA 2AE1A 4YQYA 1HLDA 3H9JA 1ISHA 4Z0TA 3VDQA 3ULKA 3LU1A 3ZN2A 2PKRA 1JVSA 3ZH2A 1HDRA 2O3JA 1G0NA 4LVUA 3JYNA 4MKXA 2JKVA 2BFMA 3HWRA 3RUHA 2NTNA 3DAPA 4GKBA 1MC4A 2C59A 4E5NA 4Y9DA 1Y5RA 4ND5A 5F21A 3RUCA 2IXBA 5FI5A 3I83A 4CLHA 1HEUA 4L74A 3NDIA 4XYEA 4YAIA 3M1AA 2AQKA 1HZZA 1ARZA 1ZK2A 4JROA 3U49A 1I3NA 2PH5A 2VHWA 5TT0A 2ZB4A 1DAPA 4LW8A 4PLCA 3MJCA 4OXKA 5ILGA 1U3TA 3GVCA 4XIYA 2PGDA 1I01A 1ML3A 4I1IA 5DP2A 3RC7A 3DBLB 5CP8A 1MGOA 4LCJA 1LEHA 1FXSA 2PLAA 2EWMA 3VKUA 1RYDA 1HYHA 1NR7A 3AUUA 5JDCA 4IXTA 4L76A 1WZEA 4QT0A 1GEGA 1H0KA 3A4VA 2AEFA 3E03A 1X1EA 1GL3A 5G0VA 3Q11A 4CM9D 1U28A 4WCFB 1VE9A 3PIIA 1QLHA 4NDNE 1LNQA 2QYTA 4TRNA 1KVRA 1HSZA 4CV3A 2AW5A 4E2YA 4AL4A 2CSUA 1I3LA 1I3KA 1N7HA 2RHRA 4L9RA 1BGVA 1UAYA 1N1EA 4A27A 4J91A 3GNTA 3TZCA 4BVAA 2AQHA 1NNUA 3GT0A 2J3JA 4DPLA 3QLJA 1YDEA 4BNJA 4QX6A 2YDYA 3GEGA 4IQ0A 3ETGA 1E3WA 2BD0A 3RJ5A 3MJEA 1YGYA 5H81A 4UEOA 4MIEA 3LZ6A 1TT5A 3DAFA 2PV7A 3EYWA 3I6QA 1JU9A 3OFSA 4U6SA 2GF2A 4JBIA 4TZKA 4BNNA 2RAFA 5IF3A 4GX0A 3K2BA 4PGFA 2B36A 4UVHA 3JQ6A 3EGOA 1BXGB 5HWSA 3GUCA 3TWOA 2BFOA 3KO8A 5G4LA 1R37A 4WLOA 5ITWA 4ZRNA 4Z0PA 2CMDA 4HNHA 3JYPA 1CF2O 2P9GA 3S2GA 5JCJA 3HDYA 4YACA 4XDYA 4GWGA 1GPJA 4CM9A 2DTDA 2GNAA 4BGIA 1HYGA 4FC6A 3VH3A 4MINA 1A9YA 1UZMA 3WDSA 1DFHA 1VRWA 3VAZA 3NUGA 1NPTO 3MWDB 5BNFA 1O94A 5JAIA 4FOSA 3Q3CA 4AJHA 3AY3A 3STHA 1EK5A 3PK0A 4Q3NA 3OETA 4R5HA 2JAPA 2ZB7A 3H3FA 3LT4A 5DZSA 1HE5A 3GGGA 5IN5A 6LDHA 3ZNOA 4GQAA 3CTMA 5MDHA 1QORA 3T7CA 2HK9A 3W8FA 1ONNA 1GZ6A 3D0OA 4NH4A 3AJRA 5CG2A 2ILTA 1DLIA 1WW8A 4LGVA 4XYMA 1F14A 4XQCA 2Y1GA 3GN2A 4E31A 2AG8A 2C29D 2P4QA 2W2LD 4GI2A 4KUHA 3FR8A 4QFDA 4IGFA 3GG9A 4IBOA 1RM5A 1UZLA 2XPCA 2HO5A 1KY4A 3TZHA 1VJTA 3BHIA 1CETA 3SJ7A 1KOLA 1NWCA 1ADGA 1TXGA 4BNTA 1RJWA 1PJTA 1B7GO 2O7QA 4BNIA 4JJGA 3UCEA 2EKPA 4TKMA 4YT2A 5HBRA 1DC4A 1T4BA 4B3IA 1K6XA 3MOIA 3DMTA 1SEVA 2HUNA 2TMGA 3L6DA 5ES3A 1NTOA 1C0LA 1ADFA 4ALIA 2Q46A 1ZZEA 5AXBA 3PYMA 1EDOA 1FJHA 1PJSA 2VOEA 4NU6A 4BO8A 4DQVA 1W4ZA 5T57A 4AJEA 5DOVA 2LDXA 1C1XB 3JQGB 4JP2A 4AJPA 4XRGA 2Q2QA 1MV8A 2CDCA 3HN2A 4BKRA 3VPFA 4IQGA 3VTFA 4M87A 4Q3AA 4B79A 4AFNA 4HFRA 1Z7BA 3Q0EA 2YV1A 2DTXA 2GGSA 3I9OA 1XG5A 3H9UA 3OJEA 5A5FA 4FGSA 2GASA 2P2SA 5C37A 2EHDA 2FWMX 1R0SA 4JIGA 1Y81A 3G49A 3VH1A 4D41A 1VI2A 1A5ZA 3HUDA 4G2NA 4R3WA 2QZZA 2WJPA 3HSKA 2WYWA 1Y8RA 3VZQA 1LQUA 4FOOA 2OZPA 4W99A 1VLLA 3WGOA 1J0XO 1PSDA 1HLPA 5B4UA 5IFLA 3E82A 3EVNA 4RF4A 5MGBA 3VVBA 2PFGA 1P1KA 2C7VA 4CQMB 2VNSA 3L77A 5F5LA 1MFPA 3WGQA 3RI3A 2NWQA 1S6YA 3I4CA 3UVEA 3ZU3A 3F1LA 1DBVO 1RM3A 1EUDA 3JQAD 1IB6A 3QQPA 1LC3A 5FFFA 2TMDA 4B8WA 2G82A 2BI7A 1P1HA 4Q9NA 3KYCA 2Y68A 1VKOA 1GAEO 2WTBA 4Q3EA 4D79A 4KZPA 2EIHA 3VZRA 5T8KA 1SOVA 3SEFA 3C7AA 5CHEA 3M1LA 4B4UA 3GLQA 5DCUA 4W82A 3RFTA 2BKAA 2YDXA 4YJFB 1BXGA 4MPDA 2I67A 3K5PA 2ZJ0A 2Z1NA 1HWYA 4FS3A 4BGVA 2W2KB 3AK4A 3IKVA 1GUFA 2PH3A 1Y9EA 3TL2A 4PRLA 3ZV4A 1OFGA 3RC1A 1J49A 3RUAA 4Y6SA 1U8FO 2GPTA 4B7CA 1YVEI 3TQHA 3NKLA 4QECA 2D3TA 3VH4A 1XELA 2YZ7A 4UULA 4TRJA 3WBBA 4J2HA 4P22A 2WD7A 4GL4A 3WGYA 1XLTA 3IUPA 3HJAA 4F3YA 4R51A 3TNLA 3IL2A 1WPQA 3W1VA 2Y0DA 1H93A 2PKQP 2I3AA 1T2FA 4CLDA 5HS4A 3C7DB 3IC5A 3PQEA 2B69A 1NFQA 3TJRA 1T24A 4ND2A 3ZI0A 3ROPA 4AJ2A 4RQTA 2GYYA 2AA3A 1XDWA 5CEEA 1A4UA 1LI4A 3H5NA 4WE3A 1M76A 1GQ2A 3G0OA 1YL6A 1GV1A 3S8MA 1R12A 3DB2A 3WTBA 1GR0A 5BSGA 4O59O 5U4QA 4DL9A 2C54A 4XGKA 2ZTUA 4DA9A 4E2ZA 1A7KA 3DTYA 3I6IA 3KSDO 1EMDA 1GD1O 1N7GA 2QHXA 3ON5A 2AHRA 4EJ6A 1LRKA 3AI1A 1E7WA 2O3UA 4OYRA 2VUSA 4ITUA 2VRCA 1LLCA 1KERA 3ZZNA 2V7PA 1HT0A 4GGOA 2YHUA 2CD9A 1ORRA 3PQFA 4RZIA 3WX0A 2HMVA 1ZO8A 3F6YA 5IZCC 4EUFA 1PGOA 1R0KA 3VKVA 5KJ6A 2GUGA 3NDJA 2WYVA 4WASA 2ZATA 2XXJA 2YUTA 1EZ4A 2QG4A 4PCVA 1SOWA 4PG4A 3OBBA 2EGHA 4DC0A 2XOXA 1UR5A 2Q4EA 1AN9A 4MVJA 3O03A 3UF0A 3W8DA 4G81A 4ZA2A 3N7UA 5J9GA 1HDCA 1QR6A 3BMCA 2X9NA 4FFPA 3ZW9A 4DRYA 3WMXA 3F47A 1U4OA 3VHRA 3LT1A 5KVQA 3PI7A 5HRUA 4DIOA 1ZEMA 4J7CA 4UUOA 3COSA 3FNHA 4NQZA 4D42A 4NMHA 1H5QA 2C82A 1IHXA 4Y6PA 1BW9A 3ZWPA 3ITKA 5BNIA 4GMGA 2NTJA 3L6EA 4WCFA 1YL7A 3PHLA 4ND1A 2GN4A 5EN4A 1KIFA 3Q2KA 4KDFA 1QKIA 2NVBA 4BNXA 3AM3A 3JD4A 5DF1A 2HJRA 3GR6A 3HZZA 2H63A 1DLJA 5GZ1A 4R69A 4QEDA 5EPOA 4LSWA 4M89A 3RU7A 3WJAA 5ENVA 3RCBA 3RIHA 4HFNA 3WR5A 5ADHA 1LLUA 1N5DA 5HS6A 4N54A 2JD0A 4UVGA 5CG1A 1SB9A 3RC2A 1MXHA 3I9JA 3EAGA 3IP1A 4BIIA 3AM5A 1PJBA 2HMSA 4BQPA 4K1LA 4WEOA 1W6UA 2X9VA 3PXXA 2VWHA 1YQDA 3D3WA 1HE2A 4IPTA 3QVTA 4CQLA 4CLOB 1ZXLA 4OSOA 3WWZA 1FDWA 2X0JA 4D43A 3RBXA 4HFMA 4RF3A 4INAA 2FOIA 2BGLA 3B1KA 1D7OA 2CNBA 2B37A 2DM6A 5T64A 4AJJA 1ZJZA 4JK3A 3FPLA 3WLEA 4BNWA 2CF5A 1E5LA 4BO6A 4D3FA 4RLSA 5B37A 4BO2A 1C1XA 4Z6KA 1TB4A 4OMUA 3IOYA 4CV0A 5I9LA 4RVFA 2WM3A 4IIUA 1CIVA 3K6JA 1B26A 2NVUA 4E33A 4PLVA 5EMHA 2JD2A 3GDGA 2HRBA 4AJKA 1YB1A 2BELA 3AY7A 3EVTA 4A26A 4IDDA 1N9GB 4BKQA 4K28A 4CUZA 3WXBA 4CM6A 2OP1A 4JBGA 4IINA 3OJ0A 1O0SA 4J7XA 4HBGA 3DZBA 2PD6A 1EFLA 1LDYA 4ZQHA 3QRWA 5IDWA 3AOGA 4YRAA 4CMCA 3H8VA 1HE4A 2JCVA 4CMAA 2EJVA 1SNYA 2OBNA 4H7PA 3DZKA 5IXSA 2AG5A 2D5AA 4YQZA 5I7VA 5K0ZA 4ND3A 3PHIA 4I08A 5LDGA 1NYTA 2VHYA 5AVOA 3GVIA 2HKIA 1U1IA 2DBVO 3BMOA 4CLEA 1EEHA 2BFPA 4QO8A 4TVOA 2PZLA 3I9NA 4RPHA 1VM6A 1HDZA 2FZWA 3JQAB 4NU5A 2CF6A 1LBEA 4XYBA 2X8LA 3TZ6A 1WXDA 1ULUA 1UP4A 1DAOA 3DONA 1TEHA 2C2YA 2WD8A 4EEXA 3RFXA 3PJFA 4WK6A 1V9LA 5GZ3A 2FZEA 5DCWA 4R5MA 2O23A 3IKTA 3RKRA 2JD1A 2JJYA 4YT5A 1TLTA 1LSSA 3NV9A 2OHXA 1IPFA 4E4YA 3GPDG 4D0SA 4J4TA 3OICA 2PGLA 3JQ8A 1H2BA 5A06A 1K6JA 2VHZA 3BMQA 3OIDA 4ONEA 3FNEA 4WGGA 2IDZA 6ADHA 3RVDA 3KVOA 1S7CA 5A04A 4XRRA 4QSMA 3A9WA 4CMIA 1DIBA 3ANMA 3TOZA 4NK4A 5EJ2A 3SBOA 2F00A 2V6GA 4JGBA 4QUKA 4CR8A 2VN8A 2FY8A 2BH9A 3UAGA 4AJIA 4YDRA 4WEQA 2CUKA 1H9AA 1EUZA 1E7QA 1KS9A 2BF7A 2W2KA 3AU9A 4RDIA 5BSEA 4Q3DA 4ALMA 3H4VA 1Q2XA 2X58A 3CPSA 1ZSVA 4ROSA 5AXCA 3LC7O 4IUYA 4YJGA 3EUWA 2VHXA 2PR2A 2WE8A 4GMFA 3LYLA 1KEWA 2Y1DA 4DMLA 3IQDB 2FRDA 4LN1A 3DZHA 2ZTLA 3TFQA 4ZD6A 5I8ZA 4NIMA 3QWHA 1ZVMA 3NGXA 2JHFA 4EUHA 4RPGA 3ZV6A 3LF2A 3WGIA 3BMOB 2VNAA 3JTMA 3LSYA 3F5QA 3OIGA 1PJCA 1NM5A 4YVFA 4GBJA 4DREA 2C07A 4GLLA 1Z73A 3T4EA 1DSSG 1RKXA 4BHTA 2LDBA 4MIOA 1RWBA 3GNSA 3IJPA 1T2CA 3OQ1A 4N5NA 1U7HA 4LISA 4XEHA 1EDZA 1H6DA 1HE3A 3BMCB 3DQPA 5IAAA 1H9BA 3KV3O 3KXDA 4OM8A 4XX0A 1P9LA 5JBIA 4CM8A 4R4JA 4Z9YA 1OC2A 4ZU3A 5KKCA 1BG6A 3ENKA 4XA8A 4M8SA 1NPYA 5L3ZA 2QYSA 3PP8A 2XAAA 3QWAA 3A06A 1HETA 1QYVA 3JQEA 3CZRA 3GRKA 3ANNA 4N7RA 2E37A 3RFVA 1E3SA 2PY6A 2Z1MA 2NUAA 1EFKA 4IJKA 1YXMA 3PHHA 1JAXA 4RVDA 2CDBA 4C7JA 5JAZA 3HFSA 3HB4X 1P45A 3F9IA 4KOAA 5A1TA 3ZWNA 3BA1A 4N5MA 2FPPA 1DIAA 3PZBA 4WLVA 5JC1A 4OOFA 4PG6A 1M6HA 1R15A 1GEEA 4W9NC 4BUCA 3RUFA 1BVRA 1PU2A 3F4LA 5JXWA 1I36A 1LDBA 2FHSA 4A03A 5KCZA 3GEMA 3NTQA 3M2PA 1I2CA 3FR7A 3W4JA 4CLXA 4OXNA 3WICA 1JTVA 5KJEA 4GKVA 3NT4A 4MVJP 1MC5A 1R4NA 2C5EA 4R1TA 4A7PA 2GDZA 3LVFO 1HDOA 4FFNA 3KUXA 1WMAA 3X2EA 3VOSA 1NQTA 4HXYA 1Y1PA 4RVSA 5ER6A 3ZNPA 4OO3A 3D64A 4JLWA 4YJDA 2VCYA 1ZSYA 2Q2VA 4GH5A 3UN1A 4IMRA 2JCXA 1PL8A 1U2GA 4BNFA 2ZJ1A 4F46A 3DO5A 1OC4A 4E6PA 2X22A 3H9EO 4RJTA 5CEJA 4J16A 3ZGYA 3GEDA 3G79A 1HSOA 3PHJA 5I9MA 1VSUA 4U8GA 1WMBA 3FF4A 3P7MA 5IZ4A 3DBHB 2Y1EA 1VKNA 1YDWA 2VWQA 5TS3A 5FWNA 2ZIZA 4BKOA 2FPGA 4NJOA 2ZYDA 3FNFA 1R6DA 2EKQA 1QLJA 2IEDA 3GMDA 1U3UA 4WPGA 4YAJA 3FTNA 4NJMB 3OA2A 2VTDA 3GUYA 4XQGA 1XGKA 2NQTA 5JMPA 2QQ5A 4DWVA 5HA5A 1P1RA 1E3LA 4BL5A 1DRUA 3GFGA 1XR3A 4PLYA 4RV9A 4XQEA 2D8AA 3JD2A 4B4VA 1C1DA 4WCFC 3QW2A 2ZTVA 3Q6IA 1J4AA 3VPXA 1ADBA 2QX7A 3BIOA 3KSUA 1WDLA 1C0PA 3K96A 2GZ1A 5GZ6A 4W6ZA 5TJHA 4MVJI 3L6OO 3A1NA 4ZQBA 4FJ1A 1QYCA 1T1RA 4HKTA 1JWBB 1A9ZA 2NLOA 1PS0A 1KY5A 3OMLA 3NX4A 1OZAA 2A92A 1PL7A 2B4QA 2NU7A 2Y05A 1JKJA 3ASVA 4A5OA 1FDSA 4EI2A 5JMWA 2EW8A 1HYEA 4DLLA 2ZK7A 3L4BA 3I5MA 3ZDFA 1VL6A 3LDHA 1PX0A 1FMCA 5G4KB 3MCVA 3JQBC 4DQXA 2DUWA 2IXAA 5KWEA 2X5KO 5FI3A 1ZSNA 4IXWA 4X54A 4Y8VA 3LLVA 5BSFA 3GAFA 2CY0A 5L7TA 3WFJA 1I2BA 4KDEA 3QV1A 4BMNA 5JYDA 4IS3A 1OBFO 3DOJA 5KNLA 4R3NA 5ENDA 1Z45A 2B4TO 2VWGA 2ZCUA
chains in the Genus database with same CATH superfamily
1BJRE 1RCUA 2CZGA 2XQKA 1SBZA 4MW0A 1QGZA 2DBRA 2KW5A 1OLSB 2J9FA 1D2EA 1X80B 2H9IA 2Q9BA 4E5UA 2D5BA 1KR5A 1WKVA 3IXLA 3DZFA 3MWYW 5HJ5A 1CWUA 3GAMA 4BO4A 3KB8A 2ZVDA 1J2UA 1K08A 1GFSA 3G2IA 3PWSA 1GTL1 3ORQA 2M1ZA 3H86A 4GGPA 5B5SA 4AZ0A 2OAP1 5FUMA 4KE7A 1UZAA 5IT4A 2DHQA 5LL6P 3Q85A 3FRJA 4PC3A 3EISA 4M1TA 4ALNA 3AOEA 4XPIB 4MAFA 4LJAA 2QQGA 4RPLA 2BSQA 4KIJA 2VJMA 3HKBA 1EVJA 4WKGA 3OLWA 4EDHA 3MJVA 5BSHA 1QYIA 2IIPA 2Q27A 4FZVA 4HRVA 4V3CA 2CMKA 2PRKA 3UWPA 4ES6A 4PGMA 3LK6A 1NVBA 1F0NA 2EEPA 2NT3A 2X13A 4CM3A 2WSLA 5M29A 5TVOB 5DHPA 5AVKA 3DDHA 4K8OA 5D51S 2JH9A 5A71A 3HCBA 4TTRA 2CXXA 4MKFA 2Y0EA 3ISVA 3RVPA 4RVGA 3EBPA 3HB1A 1K4YA 4RIEA 4MDYA 4KWIA 1SBHA 3HKEB 1D0VA 4GYKA 5ELMA 1ZLYA 2O0JA 2JLWA 2Y77A 3KB2A 3FTFA 4OMCA 4BTEA 4UPVA 3ECAA 4NFYA 1NIJA 1XZQA 3DHVA 3LP8A 4R2LA 4I55B 2C0CA 4MO2A 1OILA 2LIPA 1SO8A 5EJGA 5BSTA 3OUTA 1L5LA 4F3NA 1Z2CA 1P9NA 2R7AA 5IT5A 3EZYA 1B42A 2R751 3IEXA 4D3YA 4MKGA 3CX3A 3AF6A 4S1OA 1PL6A 4BN5A 3KDAA 4KQIA 4NCNA 3AM4A 3UW3A 1LPPA 1XVTA 2WEKA 2YZGA 4FI3F 4Z3DA 5KSZA 3T3PB 4P33A 1MEEA 1PZHA 3E7DA 2MSEB 1YQGA 3HACA 3ETCA 3LK7A 2W2QA 3GZJA 5DNVA 4KQMA 5AFSA 1QVZA 2E6UX 4EJSC 2QNBA 4WOPA 1YIOA 3ESRA 1FA9A 4OH1A 2FG5A 6ABPA 1KO4A 4WOJA 3BWBA 1UPXA 4J03A 1FRFS 3PJRA 4RJJA 5LWQA 3ZD7A 2ODBA 3I0ZA 1Y89A 4MQLA 4YJHA 4BFWA 2EG9A 4UHEA 3SM3A 1T25A 1JBKA 2I4NA 2Q99A 5GINE 3NGLA 1ZOIA 2ZSFA 3HHPA 3FUVA 3G9QA 2WWXA 1WSBA 3NYRA 1AQNA 1HE8B 1YMVA 4BEBA 3EPHA 5G40A 2ISQA 1KFEB 3UHAA 5B1EA 5J4KA 3D7LA 5FA6A 4BGUA 2B1RA 4H15A 4QJ4A 3SZOA 4U3JA 5JC8A 2ZWVA 4BWVA 1DKQA 1QOPB 1Z6PA 4CTOA 1UDAA 2A9JA 4WX2B 1DCTA 1C0IA 1JIKA 1L7QA 3W6NA 4NXMB 1O5IA 2JDID 3U3MA 1XXHA 3IAXA 4C87A 4EJ0A 3QUQA 1TAHA 3SKVA 1UOOA 3O4VA 4ILKA 5ERXA 7REQB 4EJMA 4DMUB 1MAHA 1VLQA 3C6YA 4MGHA 5NLLA 5KSYA 5LSAA 2IVFA 1E4YA 1NLMA 1MCZA 3C6BA 3Q7QA 2OHOA 3NCTA 4X44A 3WB0A 2VAWA 3MWEA 2J9ZB 3WIVA 3E1KA 1J97A 4CTJA 3Q8KA 1PJZA 1LX6A 3DP9A 1IAVA 4OJKA 2JG3A 1UBNA 2I2FA 2FQYA 4E30A 1YB5A 2DGDA 5BORA 2ID8A 2XWBF 3ETEA 521PA 3R7DA 2ZPAA 5AVVA 2JRLA 3UWOA 4GM0A 3WSWA 3MTDA 2NSHA 3G3EA 3U7JA 2HL6A 2NZ8A 4MW7A 5C8ZA 1RWOA 1QV7A 2OG2A 3IRVA 1E1NA 3E3OA 4KXWA 2HSZA 2BE9A 4LI3X 3TZQA 3OE1A 2KJQA 2IUSA 3UG6A 1JEOA 2EFCB 3JASA 3RK0A 4OK3A 1BFUA 1RXEA 3QHQA 2X4GA 2A7QA 1WSDA 2C88A 3TSOA 1JHRA 3QF4A 1EJ6A 3E5RA 2C7GA 4S1WA 3BB1A 3DCIA 4RFSA 5GMOA 5LC1A 2JAHA 4EB3A 2WWYA 3AP3A 3QUCA 4DMKA 1L5WA 2BKUA 2HCFA 4IXNA 4UTVA 1JLKA 2C77A 2YIJA 3FJ1A 2RH8A 1YK1A 3O5AA 2ONYA 4KP7A 5AW6A 3BFXA 2AR9A 1XVIA 3IXMA 4U3JB 5BRAA 1SCKA 2X19A 2WKRA 3L7KA 4RF5A 1TRHA 4X6XA 5FR1A 3OSZA 1EGMB 5ALMA 4ANFA 4R6WA 3K2EA 2PFSA 3VC1A 2O7RA 3MT0A 2O2GA 5LP6F 1W5SA 3BTUA 1CQIA 4HADA 5IHPA 1NF9A 4WCDA 2NPFA 1AG9A 1XU9A 1YV9A 5AJTA 3ZS9A 4UM5A 1HL3A 1XDGA 3HBJA 3I23A 2OORA 1W44A 1BDBA 3F74A 3JU3A 3PL1A 2EIXA 4K1XA 4Q1FA 5G0WA 4C4RA 1N33B 3OHPA 3A31A 1ZI8A 3OPXA 5AKIA 2E5WA 2O2SA 1K4MA 2XODA 3NH9A 4Q1EA 3ZU4A 4S04A 1B0UA 3D81A 1HR0B 3AONB 4F06A 3ER8A 1RQRA 4OMFG 1ORDA 1YNOA 2IZ0A 3F8WA 1O6CA 4QICA 3JQ9A 1G8JA 2WF8A 4G2TA 3TB6A 2Q3BA 5TMBA 5ALVA 3OEED 2IPMA 3ZZMA 1J8YF 3CVWA 1V4VA 2X8BA 2ATCA 3G8DA 4MQ6A 5GQSA 4TMTA 4Z5XA 5CITA 4HUJA 2A84A 3FGNA 2EP5A 2H1SA 3EFEA 3MUEA 2FZCA 3PTLA 4TWAA 5FTNA 2ACKA 4X95A 2LE0A 3OJFA 4AUEA 3DZIA 5DRTA 2QRVA 2A9FA 4GQIA 1RC0A 2FU5C 3V8PA 3GAZA 1PTKA 2BTQB 3CUKA 1WUIS 2NU8A 3L7OA 4Q37A 5CEFA 5FA8A 2BBSA 2X0IA 1P3JA 2ENUA 4LECA 3FWKA 2NPIA 1JUDA 4JLPA 3MINA 3VDXA 4D44A 2JPDA 4BKPA 3N8DA 2ZKLA 5DHFA 1Z4PX 5KNBH 1YJXA 2BLNA 2G9RA 1H2RS 1KPGA 2O2YA 5GWXA 4ON9A 1ZG3A 1YS4A 3ANXA 4JB2A 4WJZA 2EL7A 4IILA 4BU0A 4DDVA 1M2JA 3KZKA 2DQYA 4I50F 2FJPA 4YCJA 3W79A 1AT1A 1ZC4A 1CR1A 2A7XA 4G5YA 5DI3B 4L16A 3SG0A 3HCDA 4W5TA 5AKKA 5EQFA 2HWYA 3DL4A 1JIVA 3AUYA 5EQDA 3IMCA 3T7JA 3SYMA 1AK9A 1JJVA 2R4QA 1ULAA 5BV2P 1EE1A 1OX5A 3FPFA 2ZJYA 4RD6A 5AM0A 3S4YA 2CVQA 3K9WA 4G4GA 1MOSA 1Z16A 1O3YA 3A0RB 1U2QA 3S8YA 2SCUA 3CNOA 3JVEA 1ONBA 1C9KA 2EXXA 3BN3A 2I3DA 3IOEA 3KR1A 3QV2A 4G24A 4HZGA 5CX4A 5K2MA 3MD9A 5FWXB 4QVKA 1JHZA 4B6OA 1EH5A 3BTSA 4XUCA 1G6Q1 4YRNA 5KYKA 2QTCA 1NQ5A 2A1TS 4E5MA 3ICWA 1T9GS 1LI5A 4PR3A 1VZ2A 3ACDA 2BMJA 2B7CA 5HF6A 5THXA 4NG4A 1I10A 3GJQA 2AOXA 3BKWA 4IYJA 5IHXA 4PVDA 3GUZA 4GM4A 4GVLA 1CEYA 4GEKA 1KZ9A 2HJSA 4I8XA 1WIWA 2WWVD 2ZSKA 4QQFA 4K9DA 1QHSA 1UAGA 1P4JA 1GXSB 2Q62A 4KAFA 2SICE 4PIMA 4YWHA 1U0RA 4CYMA 4DA8A 1J5XA 2ECKA 3WGGA 5LNK6 4ECAA 4A73A 2YH2A 3M7IA 5LZ7A 4XOUA 3ELDA 2YYAA 1E9VA 1FDUA 1X1QA 4RWEA 4ZAYA 2FZVA 4D5GA 5LZ4A 4D82A 5AM2A 4AF8A 3EW7A 3ZVMA 2GHQA 4I99A 4HRXA 4PIVA 3QFTA 3W6PA 4HNUA 4ZQGA 2YVKA 1OBHA 4R1LA 4AO6A 3TMKA 4M9CA 3RSCA 1YFJA 2Z95A 1NUUA 4FOLA 1YE5A 1QIKA 3MB8A 4ZALA 3FRHA 3HY3A 4O2BA 2X0FA 2EBWA 2QN3A 4CN8A 2BWJA 4A0RA 5L40A 4HYYA 3HL0A 2VEOA 4US1R 2XUIA 3QIVA 3KPJA 4HO1X 4RMNA 5EZSA 2HHJA 2RGRA 3ZVNA 3KD2A 2G1KA 2H1WA 4XR9A 4IVNA 1HM5A 4NULA 4QEKA 2Z4RA 3ZQUA 3ZWYA 3DZJA 3NTOA 3TMAA 2DR3A 2GQ0A 4IDGA 1DEXA 4ZO9A 3HVIA 5CVDA 4OGKA 3RUDA 1I24A 2GM9A 2RHWA 1AJEA 5C8YF 2J0EA 5L4LA 1PG5A 4QNRA 5LYJF 2D5CA 3PR3A 2L69A 1FP6A 2OHJA 4NV3A 5JNLA 3H05A 4M88A 3ZWCA 2PPLA 4X7PA 3OPYA 3DZCA 3F49S 4RO0A 3WL7A 2YZ2A 1AY0A 4R1UA 4U7JA 4W7HA 2BMWA 4JJAA 4OI1A 2YV3A 1BIFA 3BHMA 3KB6A 4QPDA 4W9NA 3H5WA 3KSMA 3K1TA 5KKNB 2C4UA 3KUUA 4KAXA 3ENVA 4B17A 2V03A 3VR5H 3ILHA 3B1WA 2II6A 5EUQB 4G4SP 4MWZA 5H3LA 3ZV7A 5JYEA 2EW2A 2OO5C 4JT2A 1NBOA 1V4BA 4MYDA 3KBOA 3QENA 2IY9A 3G2MA 3REFA 3LV8A 3CSUA 2CFTA 1H8EA 3F3SA 5L6MB 3WKAA 5J2UB 5EXTA 1N5RA 2AXEA 3CU5A 2J4DA 4IZ6A 1E62A 1YULA 1GKUB 3LO5A 3ZWMA 7MDHA 2ZYHA 3K20A 1TJ4A 4QU0A 1DC5A 2QXYA 3AVVA 2B1JA 5EXXA 4N12A 4NEHB 1TI7A 1NVAA 1Z0KA 2OYRA 3RVSA 4L8GA 2W4QA 2P0YA 2LKDA 1RYZA 1XTTA 4DXDA 5I3ZA 2WV9A 2F1RA 4DG5A 3O83A 1T6BY 3R5KA 1EVZA 2QR3A 4HZIA 3EARA 4QFCA 4IIYA 2MT9A 1P1BA 4JC4A 4CCSA 1EUQA 2QTRA 1IOWA 2JFBA 3A14A 3EVBA 2FW1A 4OFWA 1ZH8A 3GDHA 3DUFB 2ZJ6A 3HKCA 2P1ZA 3ZBTA 3IOMA 2VPYA 4K6HA 1B2LA 1KAMA 1DVRA 1B8UA 1X7DA 2ZPUA 3ESBA 4QASA 5AM5A 2PNJA 1LW7A 1KY2A 4XUGB 5BW4A 2X0RA 5L8VA 5FLKA 1TQ8A 3C4JA 4OHZA 1SHKA 2ZSJA 3LPDA 4KR9A 3UY4A 2WUDA 1KF0A 2H16A 1R50A 4DBVO 2WMYA 3MWJA 721PA 2Y2UA 3F6RA 4UAJA 2R7MA 1R2QA 3N8IA 1DAEA 1CB7A 1UXIA 3IA2A 3OKFA 5J1TB 1BXRA 2CEAA 4QDKA 1K06A 4WKCA 4HMPA 3ND7A 4FW9A 4IDBA 1DJOA 3RYCB 4V0NA 2NM0A 3P0FA 4OFBA 4CM8B 1JYSA 5FHRA 5EKDA 5EFZA 1UXJA 1LPSA 4QATA 1XZJA 3BH7A 4ALKA 3Q40A 1XTJA 1DBWA 3IHTA 3EEYA 1SBYA 1SR8A 3ABZA 3LBIA 1EXWA 1OXMA 1QO0D 1TM2A 4X3PA 5LDHA 3X1WA 1MEOA 4H16A 1N3IA 4GPEA 4J4BA 4D8YA 1GWNA 1ZBQA 2QVBA 3ZUGA 1VHTA 1GKYA 2YHBA 3IIEA 5AESA 1D6JA 1JNYA 2I66A 1N92A 3EDQA 4TXJA 4UM9B 2B8EA 5CDYA 1X1SA 4POAA 1PNTA 3CB2A 2JFGA 2RHTA 2GKOA 1GYRA 3GJYA 3PNBA 4JB0A 1TTQB 2LCIA 3M89A 1NUQA 4FBLA 4WKOA 3RVQA 5ULLA 2O2ZA 3CUUA 4QOJA 2JB9A 4JWKA 4KREA 3DCNA 1U3GA 1MG0A 1H65A 2QPAA 3MMPA 4NH0A 5KNCD 1ECPA 2R48A 3JXEA 5FYQA 1M2EA 4UOEA 4MUJA 4OUDB 1V3TA 2E48A 1QZZA 2M98A 5B3AA 5EXPA 2B2NA 4QD3A 5IK2D 1UJ5A 4HDNA 4N65A 3UXHA 3GGJA 4EMTA 3PNQA 1V16A 1M1ZA 3DXYA 2CFSA 1B3BA 2AJCA 4ZWNA 2YOFA 3BHJA 3GF4A 3OQHA 3R40A 1NLZA 4FCCA 4YAEA 1KJYA 1E60A 3QBDA 4ZXPA 2XZOA 2ZIGA 5E7MA 1CQJA 3LBAA 5F1YA 3ZCXA 4OGWA 4RWZA 4JI2B 1A8SA 2WF7A 3NBQA 3NHUA 4RE5A 4D4HA 5BT9A 2XTJA 5JIBA 1Q7CA 1L3IA 2FFAA 2BJWA 3LIPA 3MILA 4NXNB 1ILWA 5AUPB 2XWJI 1U8CB 2EQ5A 3SJAA 4CKBA 2QWXA 4KH0A 2I1LA 4TXLA 2IRWA 4HL6A 5DBIA 1UXHA 2ZRPA 2C92A 1B1CA 2I3ZA 5DT9A 2XF2A 3SC3A 2PLRA 3DAOA 4G0QA 2E85A 1FBTA 4KE8A 2FPNA 2WT9A 3OZGA 4BEWA 1KR2A 4P58A 5A5GA 4BP3A 4YH1A 5I6DA 4KK3A 4U1RA 4L1KA 4JBWA 4CIBA 1C8KA 5DWQA 2HI0A 3NKVA 5EG5A 4KYVA 3F3YA 1JSLA 5CT4A 3LP5A 4G67A 3K09A 3QNMA 4YMSA 2QVCA 3GK3A 4JP8A 4HEJA 3AVXA 3QHAA 5F5NA 3V1TC 3A28A 3AI7A 3VSDA 4X8OA 4I4TB 5DYWA 3I4LA 1IOVA 4EGFA 4Y0AA 3R77A 3JQFC 4B8ZA 3P4XA 4AKSA 2E55A 2RHMA 2JFQA 3ABSB 2JI9A 2VSQA 1NN3A 3FPSA 2HMWA 3ND9A 2VL7A 4QOEA 4JLUA 5JI3E 2QPLA 1A9PA 4HAWA 3T4UA 3D3WB 4ASUA 4Q4HA 2CXHA 4W5RA 1FVHA 4OHBA 1DRVA 2WB2A 1UFRA 3SNHA 3CZ9A 4D45A 2PUDA 1VSVA 1E61A 2H3HA 2B99A 5B1IA 3T7TA 1SPXA 1YQEA 5ES4B 4D57A 1K89A 3R5FA 5KYWA 3VKHA 3DB1A 1DXQA 3EXHA 4GT1A 1KRXA 4P08A 3DVAA 4UTZA 1ISJA 4JLNA 1ZWKA 4ZI5A 1J5EB 2HK7A 3Q7RA 1A4IA 1EBUA 3HVUA 3PNMA 5T4EA 4YV7A 1JQAA 2IXGA 3KPUA 1GPDG 1T3GA 4QVGA 4MTLA 2WJJA 1TIKA 2X6QA 5F33A 1JSCA 2BUAA 1I1QB 3DXFA 4GGMX 3EMKA 5ENZA 3ZYCA 1UM9B 1HDIA 1WLYA 2NSLA 5ILQA 2BH2A 3BXHA 2CBXA 4EKNB 3QKTA 1CQZA 5JARA 3VH2A 4BNHA 2QGZA 4C08A 1NW6A 4BP9A 4E7PA 1RJ9A 1X1TA 2ERXA 3EASA 4PO8A 4E14A 1FIUA 4URZR 4WXRA 4G36A 1K3FA 1ADCA 4YEDA 1SWVA 3UGJA 4ZP1A 1SA0B 1Z5WA 4AM8A 2R96A 2J7PA 2CVZA 3AB8A 4PZCA 5LIRA 2VDWB 4CIDA 4DUZB 2BHNA 1AS2A 3E9DA 2B5WA 4O89A 3HPRA 1E98A 4G0ZA 1HEIA 2IHVA 4AF7A 2XCUA 1BX0A 4NENB 5GY7A 4IGAA 5FEUA 3EIFA 3H9CA 4MEBA 1MHPA 4G09A 1OLXA 4BY9E 4NYMR 4EHAA 1UBGA 2ZRMA 1TKBA 3E2PA 4NBNA 2UZ4A 4ID3A 3UUWA 2JLBA 4PZPA 1I5OA 3ZJTA 3DBRA 1K98A 1Y8QB 3P26A 4HDCA 4OI4A 5HE8A 3TQQA 3V6MA 3H83A 4I9NA 5K0TA 1Z0UA 3G1WA 4GI5A 2D1YA 4IEFB 4IP0A 4JS0A 4U7DA 1C0KA 4U2KA 3JQQA 2FOLA 1IATA 3IAM6 3SSNA 5BUZA 4W9RA 5LP6C 1VXOA 2FSVC 1EHYA 2R1VA 1JJ7A 1U3DA 3KOOA 3RASA 3T5CA 4FX2A 1WOMA 4JJFA 4NZ9A 3FZGA 4K46A 1YZUA 4GZMA 5K9ZA 4KKXB 1RBZA 4Y6QA 4CWAA 1N2XA 2FUEA 5BWNA 3ZJYA 4B3MB 2O1EA 5ICGA 5EVJA 1CDZA 1D1PA 3K1YA 1W9MA 5KIAA 3BWMA 2I7DA 1OA1A 1PGQA 1YRAA 4MS3B 4RF2A 5DE3A 3OFKA 3VI3B 2VHEA 4OATA 4GDFA 4DJFC 4LXTA 4F6RB 4O1HA 3IIMA 2ABWA 4BFUA 2QXTA 3LC2O 4CM7A 4LC9A 3HE3A 4OLFA 4AICA 2IHNA 4NFLA 2FV8A 2W90A 1I5EA 4N01A 2R62A 4I3HA 3SK0A 2K6GA 4BIMA 3T3MB 1EFAA 2O8VA 1WZCA 3KVRA 1N1MA 1YHYA 5T3UA 4OHVA 4F86A 5FI1B 4YCDA 5D2CA 3AOEC 3BOSA 2JFUA 3WZMA 4AECA 4HWRA 4GICA 3CE9A 4HUTA 4ZAFA 1KAEA 3TIGA 1V7CA 2DJ5A 3THXA 4YCLA 1OAAA 3IFSA 1GFZA 5D3MA 3STTA 2A8YA 3LGSA 2HQSA 2AN4A 3TQRA 4OJYA 1L1QA 2CFIA 3BCHA 2DX7A 2I0FA 1UPTA 3F98A 1OH7A 2M6LA 1CS4C 5A9TA 4HGRA 4L7QA 5LBTA 3T7SA 3R3JA 3O95A 1JEYB 1XMJA 3Q41A 3OD1A 4MQFA 3LS2A 4L78A 3ZHTA 5J3JA 1SUBA 2IDKA 1HDYA 2ZI4A 3D6HA 3L6UA 1LPBB 2VT3A 1OWOA 4ZVVA 4PTLA 4Z9XA 1BMFA 3I2FA 3ZEAA 1FSPA 3ITEA 1YRLA 5JWRA 1GQQA 2A5LA 2SHKA 2Z8YA 3I6ZA 4RETA 4KVGA 1IZ9A 2MWMA 5BYJA 4NG5A 1PD0A 4RSGA 2JDIA 5AVWA 4ZZ3A 1IULA 2HWKA 1E79A 2AOWA 4GP6A 5T5QA 4BO1A 1U02A 5CYOA 4N8DA 4PQRA 4A36A 1UDCA 4N48A 4B09A 4MA0A 4CM1A 3LY5A 4OHYA 3A7EA 3EGEA 3IEKA 2R65A 4GO1A 3LUGA 1GGNA 3LKBA 4WFQA 2XLCA 2B5VA 2DFTA 2Z5LA 1IG3A 1PDVA 2O3RA 3KKEA 2EF1A 2QN2A 3LBHA 1H8HA 4MVJM 1R0WA 4LRTB 2Z3VA 2KLHA 3CBQA 3G5LA 3MBOA 4FSHA 2O7NA 2Y0CA 4NCJA 2BGIA 1ODKA 4Z9FA 1XAGA 4BNUA 3PC8C 3QEBZ 1KXJA 1GU7A 4LOLA 3CKKA 3M6IA 1NURA 3LT2A 5IJZA 5JDCC 5J2TF 5EHNA 3OM8A 1WBJB 3ZPXA 2NIPA 4M9UA 3AHDA 4Z0NA 4YJHB 2C8JA 3UJHA 3K9FC 2AQIA 1EK0A 2POCA 1SOUA 4QUDA 4N0DA 1QC5A 5AO9A 2V4UA 1XDDA 3GGOA 5ITZA 1C80A 3BXPA 4TGLA 1JB1A 1M74A 3ZE6A 4XR4A 1CUHA 3AETB 1PL0A 4WV3A 2NV6A 3WB9A 1LVGA 4Q9AA 5ALLA 3EQ7A 4AKTA 5C34B 5J2UA 1IONA 4GD3Q 3G0CA 3U2QA 2PTHA 2PVCA 1GGFA 1PV4A 2XSZA 1E7MA 2HLHA 2Y3IA 1E3QA 5DN9A 3VR6A 4L9AA 3F90A 3VFDA 1XB2A 5AICA 4OQQA 5ALHA 1T1JA 1A82A 3T4EA 2MINB 2DFVA 2O5VA 3X1XA 2QZSA 1V8BA 1RI5A 1VZ3A 2VSNA 1CJBA 4EA7A 3QXSA 2P2LA 4MYUA 1EESA 1A8PA 4CZ2A 5ELXA 2RGXA 4GX1A 3ORYA 4MR7B 3RYIB 2IC5A 2ZYGA 3C41J 4EBFA 1T13A 4M9QA 3HUEA 4ZRMA 4IR7A 4WTOA 1M75A 4OQYA 3W90A 1C3VA 1PQWA 1EP9A 1UIMA 4FFVA 4XCVA 1TT7A 3V5NA 2QMZA 4XSGA 3SXPA 1SKUA 1RMTA 2DQ4A 2I8LA 4RGVA 3VU0A 5CXQA 3VKGA 1U9ZA 1QE5A 5FLXA 1QTNA 1V7ZA 4JOCA 3R7NA 3DULA 4WXYB 3CLSD 4FFDA 5DNCA 6PFKA 4X85A 2VYVD 2XDWA 3UK2A 2JLUA 2FWJA 3PQ3A 1RCFA 1XUOA 1QM5A 4O2BB 2JI6A 4ZYLA 1SUSA 3HJRA 1Z18A 3HO8A 1EUDB 2P68A 4PAMA 1XK7A 4R68A 4RZ2A 4Y18A 2JCYA 3LYHA 3QVUA 1UWVA 1GZUA 2LP4Y 3N8KA 4KWHA 3S2YA 5J4VA 3R6LA 2QMEA 3OZIA 1PBTA 1I6KA 3OBIA 3OZBA 2AC7A 1ETHA 1Y5MA 3PXBA 4FFSA 4L5JA 1NDUA 4R3UC 3WOHA 4XD2A 5ISMA 3E5NA 3O8BA 3QH4A 1ZUNB 4NMMA 4R1PA 3ZDEA 2WFLA 1F3OA 3BFVA 1DO2A 3O1IC 4E32A 2OBLA 3TOCA 4TVBA 2WSBA 4D5EA 2PSJA 2QU8A 3LWDA 1KZ7B 3FAZA 3FCEA 3UKOA 3ZXUB 5H8WA 3VA7A 3MLEA 4B4KA 4ERXA 3AF2A 4HBZA 1G9TA 4LJ9A 3VVCA 1P91A 3DMTC 2B30A 4HAIA 1E1MA 4U5XA 3V4FA 1GPNA 1L7MA 1WUKS 1XK6A 3OKCA 4TMFA 4Y2TA 2MOKA 1KSGA 4EG7A 4YWJA 2YBDA 1RQGA 1VIYA 4D3XA 3H0CA 2HDHA 2GAJA 4CUKA 3DFZA 1B0AA 1SKAA 4J1NA 5H7XA 1U8YA 2HNAA 2CHEA 2NXCA 3AF4A 3B52X 4PANA 5J40A 5JY1A 2VJAA 4L4YA 3VVMA 5T3YA 3VNRA 1O87A 2ZRKA 3NIWA 3TBHA 1SVNA 2GEUA 1BKSB 2C42A 2IX9A 2R1VB 1OKKD 3HCPA 3LHKA 4JQZA 5D7NA 2WQ7A 3MUNA 3PI6A 1NQAO 1K7CA 3N9IA 2WJGA 4M1KA 5JQGB 4O4HF 4PPQA 3JQGA 2NXJA 2QTBA 5FPKA 5JSZB 2JFVA 4EVRA 3K2QA 4PSVA 3SFTA 2Y71A 1SZDA 2BDTA 3FSRA 3GZNA 1PS8A 3EXG2 5BSMA 1MAWA 1O97D 1X0XA 2XVZA 5T4BA 3L7IA 4FU0A 1L4GA 3B3GA 3BXGA 2BKEA 4FFLA 5L7WA 2JJ2D 3JQRA 3NVDA 2K2QB 1YJAA 3P5SA 2P0AA 4E5YA 1PZGA 1SG6A 3GFTA 3R1IA 4WRRA 5HBGA 4JMLA 4J0FA 4CFSA 3QGMA 5KAMA 3PSHA 2FQXA 1NJ5A 3ER9A 1NAHA 4BFCA 1ZXBA 2G80A 3RSQA 5CIYA 3MBKA 3MCTA 2B9EA 3I61A 1R16A 2FMUA 4L5AA 3DOEA 2RG1A 1G8YA 1YB6A 3HNOA 3ADKA 1J99A 2FN7A 2H57A 3C1OA 3U0VA 4RHCA 4H4CA 2FUKA 1KY3A 1I33A 1YCGA 4IQ8A 5DLPA 3HUUA 2CYBA 3TPFA 4IX1A 3QVSA 3B6EA 2JA2A 4GE0A 1VA4A 3UQZA 5DVZA 2PIDA 3CSDA 5FORA 4AXBA 4ZANA 2X0NA 2EZ4A 3IQXA 3N07A 2WIDA 1II8B 3OMWA 4MUXA 1DARA 3CE6A 3AHFA 2FUNB 2OORC 3OQPA 3OQ6A 3WNQA 4ZQFA 1R8JA 1XMXA 1JXAA 2V4ZA 3GFPA 4QJ3A 3RRYA 3PKJA 1E3TA 5DEOA 3SDZA 3W2IA 2WAAA 1PJLA 1TW3A 4KLCA 4M60A 1KWKA 3G23A 1PWHA 4EYKA 2KPOA 5H83A 2AI3A 1ODIA 1U2SA 1FRNA 3NNSA 1Y8ZA 2QUKA 1DO8A 2LUOA 1FP7A 3OZWA 3DZ5B 3DE3X 3KJGA 4ZOQI 4ZYXA 2P1RA 3IAS1 4P4TA 4XH9B 3TLXA 1UPBA 1UXOA 2GDJA 4INZA 1PR3A 1ATIA 1WQ4A 3E15A 4YB8A 5CNMA 5DNEA 3O6VA 1D1TA 3CUWA 4B82A 3IWCB 4H17A 5CH8A 3PF9A 5I3CA 1KBOA 3R9XA 2X6RA 3U4DA 2CNWD 1MHMB 1H05A 2A9OA 3PDUA 3KFXA 3RRNA 5ICMA 2VEDA 2QRKA 4Z86A 3PIRA 1XALA 2QRJA 2BFDB 3B5EA 2P6MA 2P8JA 4KN8A 1L4EA 1N5LA 3UCFA 4BFVA 3TUXA 4C0AC 1VG8A 4KTTE 4ZO6A 4LJRA 2FWAA 5CLFA 5DISB 4V24A 1H1DA 1NZFA 2GK4A 1GZ7A 1QRTA 1IPEA 4QDZA 5JO9A 2GBFA 1M73E 1U98A 2YWBA 3U3JA 1E89A 1DJMA 3HYNA 5FOXA 3J7TA 5TPWA 1T0JB 2E6KA 2OEPA 3TZBA 2O8BB 1JH8A 1SKYB 3WWDA 4ZI3A 1JIIA 5DX1A 4U6QA 4JJ7A 4MNTA 2QW1A 4LJLA 2WWFA 4PHTA 2W9XA 3V4ZA 1BHSA 1XMOB 3ND6A 1KAHA 3RG2A 2PRYA 1I4LD 2NTEA 3BA6A 5EIBD 5JBNA 1ULBA 2G63A 5J63A 2XYGA 3QJ5A 4BJ1A 1CIPA 1QF6A 1Q0QA 3GFRA 1B8OA 2HBYA 3ZK8A 1EFHA 2ZS7A 3FCUB 5GTDA 5JANA 4EZBA 4CFYA 4KXXA 3UXYA 1UBCA 1VYTA 1NXQA 3GRZA 3SHFA 3H87A 3ZK7A 4DJEC 1E4EA 3SDSA 1XZDA 3WMFA 5I47A 2JFOA 1NR1A 5LP6A 3TUZC 1JFFB 4M1YA 2I03A 1F48A 5HP4A 2CLCX 1MQSA 3KL4A 2ZAOA 4RMGA 5IM4A 3M5WA 2OZVA 3HJGA 3IODA 2IOHA 4P31A 5JD5A 2NO5A 2G0TA 2I29A 5K0GA 2NU9A 3LQFA 3GRPA 1QP0A 3KOUA 4AP9A 2G17A 3E2IA 4MR9A 5CURA 5B58C 5BUCA 1RYMA 3B9PA 4EGSA 1ZITA 1ADJA 1SVMA 1NI4A 5JSUA 3U7HB 4BKUA 4EF5A 1I4OA 1NT2A 4YY3B 1MNQA 2CKMA 1BZYA 4B33A 1AK2A 4LJ5A 2A0WA 1Z8HA 1C9NA 2IYAA 4FMDF 1W36C 3E9MA 1M10A 3C8ZA 3S2GA 3V2UA 1R0XA 5E6UA 4PAGA 5THQA 3AP2A 4QBGB 3MMZA 1ZVJA 5DTJA 2DETA 1K75A 3PWZA 1HX7A 1R9JA 1ISIA 2AIRA 3DZ2B 1IXSB 3P94A 4U2BA 4CR6A 1N8KA 4CM4A 3A6LA 1N2IA 1XHLA 2WIBA 3IUSA 3OPVA 4KQWA 4MR8B 1YBVA 2OHIA 1CRQA 2NUBA 4ZVLA 2FPIA 4IZIA 4MVWA 2BZSA 3BK7A 1IBSA 3B13B 2PM8A 3NAGA 4ZCSA 5H82A 5LCXA 4CT0A 1U9CA 4BLWA 1NNEA 5TXGA 5AK5A 5DCLA 1T6YA 4B3JA 2IUUA 2VYVA 5JPIA 3UH1A 3WK4A 4X9XA 1BAPA 1SUCA 4D25A 1OASA 3ILYA 3ABIA 1VQ1A 3RWBA 4KAJA 3TIVA 3W2FA 2BN4A 4MEAA 3ZY6A 2C84A 3O0TA 4F9FA 2FW8A 3FLAA 4CIAA 3CW8X 2ID7A 4BC0A 2IA5A 5JOQA 1AUQA 1ZNYA 4A6PA 4B74A 1N6LA 4CEJB 2VHQA 1N3BA 1JLRA 3CWQA 1G4AE 1ORWA 3PTAA 3O1JC 4DWOA 4Z7JA 3O90A 3IKJA 4AY5A 2ATXA 4F5ZA 1ZRNA 2X9GA 1R9MA 4DR5B 3O3OB 3PPVA 2FW9A 4DEVA 2E1PA 4DR3B 4TYPA 2V6IA 1GU1A 3WQBA 2ZRJA 3AKZA 5K0CA 2B1IA 2JH8A 3KQHA 1VC2A 1OX6A 1JFTA 2HQ1A 4GSYA 5K8UA 1FVOA 1HRDA 2Y2VA 2ZCJA 1QIEA 4R8MA 1GDHA 1FNDA 3NPMA 1WLSA 1UBKS 3OTGA 1R9GA 2E5LB 3QF7A 4NFSA 5JXIA 3PFFA 2FPUA 3DVSX 3GRFA 2WKSA 3Q3VA 1JQ5A 1OPRA 3TMYA 3PUIA 1JFSA 1STOA 4PBSA 3HRHA 2N75A 2W6IA 2YMMA 4JL6A 1BC5A 3C3PA 1U8EA 5BWCA 5H4HA 5HZHA 5K5EA 3DHYA 3RC9A 4DDMA 2O57A 5BW6B 5C4GB 4CKCB 4H1WA 2Z3WA 3BAZA 3OJLA 4MV8A 4CKYA 3EXEB 4BO5A 1G16A 1R64A 4B3DA 1I94B 4CLOA 1SULA 1P31A 2G71A 2XVAA 3NBMA 4HH3C 5IDXA 4UUNA 1PJ4A 4J1TA 2SBTA 1FTYA 1MQ8B 5FUBA 4M37A 4CKWB 4AJLA 1JDNA 2HMUA 3QEAZ 4X1OA 2BBTA 4FJ2A 3SJZA 3JQ7B 4LWQA 2Q6VA 1H2EA 2Y67A 4PX9A 4WOCA 3GIDA 1ZGZA 2C5GA 2AI2A 3MQFA 4YA6A 5DTEA 2G8NA 3Q8LA 4PZDA 3FPKA 1T6ZA 1WP4A 2BGMA 1GCUA 2ZOSA 3HR7A 4DIKA 3A11A 3GBVA 4JJ8A 1BQ3A 1PT9A 3GLTA 2C2WA 5E7QA 2BEUB 1PJQA 2ORVA 2QPTA 4K0RA 4L8LA 2WDPA 4PNHA 5WRFA 2ETVA 5HIAA 5FX2A 3LTNC 2FSIA 5DHAA 4D80A 3QBVA 5FTLA 2WA1A 1JAZA 1NUHA 3TSYA 1SXJC 4ZO8A 4PLWA 1A7JA 4BE4A 1S7GA 1BH6A 4H3VA 2GERA 4R83A 5DP1A 2DRIA 3C7TA 1DADA 1PQUA 1JS1X 1N9GA 3D1LA 2ZE8A 3ZGLA 3ZWXA 3SWWA 2V4MA 4C4SA 5SY9A 3WP1B 2H00A 3H1FA 2LCFA 3QWBA 4C0SA 4L4SA 3LX6A 3OOWA 3UK6A 3KYBA 1RMQA 2A1UB 1P73A 1YOVA 4UHJA 1W2WB 4QHSA 4O2AB 3VPSA 1DFGA 2RGDA 1ULZA 2VK8A 2QX8A 2GVNA 3DCJA 4TTIA 4EHJA 5KWVA 3NC0C 3UPTA 4KXYA 3R5XA 1XIVA 1ISRA 3NHLA 4KXMA 2GZ2A 2YJ3A 4WDRA 2AL7A 4LC1A 3OF5A 5GONA 1USUA 3WGTA 1SZJG 5H80A 1BYUA 2XUFA 4JQSA 4YV2A 3RSLA 9LDTA 5HW0A 1QJCA 2VJDA 3AEQB 1ZIOA 2BMVA 3KQSA 3A1UA 4FDMA 4R1SA 1O8BA 9LDBA 1CNMA 2G0NA 3WGKA 4BLTA 4I55A 2Q3EA 2WUWE 1P3DA 4OHUA 3VPBA 4KZKA 5I7RA 2EYUA 1OXUA 4PFKA 3FYCA 3G7NA 2KWIA 5JH7F 2QUHA 4KBFA 3OECA 1SK9A 2CLFB 3ZZUA 4IKEA 1XZPA 2DZDA 3CLUD 5JQWA 1KMIY 3KV1A 4KI7A 3T52A 3JQBA 1T4DA 3H65A 3RQSA 2A88A 4K9SA 1W52X 4N49A 1V71A 1Z8FA 2XCQA 4HGZA 4ZVOA 3PV0A 4X8HA 3KOYA 5I9TA 1MUUA 1O57A 2H2FA 4ENPA 1QYRA 4K9OA 4HV4A 1WW3A 3A1TA 2YY6A 2PWZA 4IH9A 1EBFA 3EEFA 5AVUA 2RHOA 3CSSA 2J7PD 1H6CA 5FCDA 1UMCA 5ICFA 3ZWWA 4CRWB 2P78A 3PUYA 3ADOA 3F3MA 3Q5EA 1TVMA 1JHUA 4N5LA 5IULC 2V98A 1P77A 4HOYA 4JI3B 5CJPA 5FUVA 3GJ0A 5JZOA 3PDJA 4B75A 1FW6A 2PKEA 3AF1A 4DIBA 3H4MA 3LX4A 1SVWA 3SVZA 3EGCA 1KTVA 2FN9A 3N58A 4F1WA 4QBIA 4S1PA 4MWDA 3IDZA 4F3TA 1LVHA 4BB0A 3AQ4A 2G83A 1EFPA 1IIBA 4I1OA 2R6R1 1Q5PA 3GD7A 4I5DA 1JW9B 3V1MA 5K03A 5L51A 2AXQA 4MJLA 1H2YA 1G5FA 2H5EA 2P4HX 1Y6GA 2YHIB 2NZUG 2VP4A 3BWCA 4GBGA 1J8FA 3W6ZA 2GHIA 1X8LA 2BCJQ 2HCTA 4Q93A 2VJBA 1Q3KA 4EY7A 3V1NA 3DE6X 5REQA 2QJWA 2C57A 3CVJA 2WHRA 2V5VA 4KODA 4OBWA 1K2VN 4PQYA 1HDRA 1W34A 1RJGA 2O3JA 2XDQA 1QDUA 3QFRA 1W8IA 4P7KA 4GXRA 4ZVNA 4OHWA 3HWRA 2ZETA 1GG9A 4LZJA 1PVVA 5C1BA 1DTSA 1RSZA 1Y5RA 1BWQA 1JFLA 2VDVE 3C43A 3NJRA 4GRAA 3PF8A 3VX3A 5IASA 5FI5A 4QJ5A 2VDWA 1DKUA 2A14A 1EUCB 1P2SA 4QYWA 3NDIA 2HLNA 1U0GA 4HTAA 4Q6WA 4ZU1X 1EQAA 3M1AA 2X8WA 1REQB 2OWEA 1Q1AA 4INOA 1NXOA 1R6AA 3QE2A 3SYNA 1ARZA 1L6RA 4HAXA 3FPHA 1QB8A 5IJ0B 3TNFA 3IAS6 1YS6A 4LF6B 2P11A 2PRZA 1T10A 3RWOA 2ZB4A 4NC9A 1DAPA 1M0EA 2UXDB 3EMVA 2WJWA 5CJ2A 1CQJB 1RRKA 1U3TA 2IE8A 1AM4D 5IJXA 2X3YA 4I1IA 3TKYA 4DQKA 2GJ4A 2QRVB 5CP8A 3W5JA 4IRMA 4OUKX 1XKLA 1MGOA 1O4WA 1DWQA 1NQXA 3BERA 1U2EA 1QIDA 2P27A 3HPQA 4FSDA 1HC7A 3OJCA 4KSCA 4BEJA 1TAUA 5AKGA 2GX6A 2PLAA 2EWMA 2VPQA 1OFIA 4KO2S 3VKUA 1HYHA 3AUUA 2ZRNA 1T8WA 3R24A 5FL7D 5JDCA 4IXTA 1WNFA 3OPMA 2HWXA 3G8CA 4B3GA 3VHXB 4QT0A 3BSSA 5B58T 1GSAA 2CWWA 1I7QB 1TJ3A 3KOMA 3B8EA 2AEFA 2W43A 1II9A 3E03A 2C5LA 3E0XA 4PONA 4RAQA 4ER7A 5MFZA 2OCPA 5G0VA 3IP6A 4JU8A