1LC0A

Structure of biliverdin reductase and the enzyme-nadh complex
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
290
structure length
290
Chain Sequence
MITNSGKFGVVVVGVGRAGSVRLRDLKDPRSAAFLNLIGFVSRRELGSLDEVRQISLEDALRSQEIDVAYICSESSSHEDYIRQFLQAGKHVLVEYPMTLSFAAAQELWELAAQKGRVLHEEHVELLMEEFEFLRREVLGKELLKGSLRFTASPLEEERFGFPAFSGISRLTWLVSLFGELSLISATLEERKEDQYMKMTVQLETQNKGLLSWIEEKGPGLKRNRYVNFQFTSGSLEEVPSVGVNKNIFLKDQDIFVQKLLDQVSAEDLAAEKKRIMHCLGLASDIQKLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a biliverdin IXalpha reductase enzyme-cofactor complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Biliverdin Reductase A
total genus 94
structure length 290
sequence length 290
ec nomenclature ec 1.3.1.24: Biliverdin reductase.
pdb deposition date 2002-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF09166 Biliv-reduc_cat Biliverdin reductase, catalytic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1lc0A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lc0A01
3STHA 3TL3A 3ZU2A 3Q2IA 1U2DA 5BSGA 2NUAA 1RKXA 2I99A 4YJHA 3WGYA 1XU7A 4RV9A 3BA1A 4AJKA 4A03A 1Q0LA 1X1TA 4FFNA 3OFSA 4EYEA 3NT2A 1F12A 2W98A 2XPCA 4FS3A 1VLLA 1C0PA 1U4OA 4J3FA 5HA5A 3I83A 4LN1A 3AOEC 3O8QA 4XWYA 1H9AA 3VAZA 1U3VA 1ENPA 1ML3A 1G1AA 4LRSB 1N92A 5FF9A 4YACA 3RUHA 5ITVA 2EW2A 2W2LA 3R3SA 3RI3A 1ZFNA 2HO5A 4GQAA 1GUFA 2Q4BA 4YAJA 4MVJP 4FGSA 4DC1A 1VPDA 3DFUA 2B69A 5B4VA 5KJCA 2P9GA 1CERA 2D3TA 4XYBA 2JD0A 4PRLA 1I36A 3DBVO 4AJ2A 2DPGA 5TSDA 3DOOA 3EHEA 4IS3A 3ENKA 3K92A 4N5NA 3QWHA 4AJEA 3UCXA 3V1UA 2X86A 3PHIA 3VVBA 1DC4A 1LDNA 3PIIA 2BRUA 1J4AA 4NK4A 2YY7A 3JQ8A 2V65A 1C1DB 2O2YA 1P1JA 3ORFA 4GL4A 3QW2A 2AE2A 3H5NA 5C7OO 4AJLA 3COSA 3JQBC 4D7AA 1WP4A 3GDFA 2DAPA 3RUEA 1ZXBA 2C0CA 3DZBA 3ANNA 4YT4A 4IUYA 4XX0A 5G2OA 5AXBA 4CL8A 4JJFA 1PX0A 1JKIA 4DTIA 2EGGA 1EE9A 1PWXA 2HK9A 2LDXA 2DFVA 1KEVA 3I4FA 1ONPA 1DIBA 1P33A 3C1TA 3CZRA 1ZMOA 3Q9NA 4D44A 5BT9A 1JVBA 4IMRA 4AJOA 5FEUA 4BNNA 5HTOA 2GN6A 1CQJA 4NBWA 3U62A 3NT5A 3RC9A 3CMMA 1KC3A 3B6ZA 3DAFA 3PJEA 4J7CA 3U0BA 1A72A 3I52A 2C20A 1PU2A 2Y05A 1HKUA 2J8ZA 2C29D 4UUOA 4ZRMA 2FN7A 1W4ZA 3N74A 2NQTA 4ZA2A 2VWGA 4R9RA 2P4HX 1HLDA 2X7HA 5THKA 3VKUA 4NQZA 4GGOA 4B4WA 1I2BA 1KEWA 2BMAA 1PQWA 5KKCA 3MWDB 3JYNA 4TMFA 2NSDA 4M49A 1YH3A 4GMFA 2OBNA 1AUPA 5DDIP 2NTNA 4B79A 2UYYA 1E3EA 3VOSA 4ND2A 3SLKA 2VHXA 4IIUA 4DPMA 1BDMA 4GBJA 2AG8A 2DBQA 1U8FO 2UV8A 4L4SA 4U0KA 4CV0A 1ZMTA 3K6JA 2JJYA 4JGBA 2HMTA 4RF4A 3O38A 4ZD6A 1YDWA 3KLPX 3LF1A 2CD9A 1UAGA 1NHWA 4HFRA 3E9NA 3F5SA 2PGJA 4PG5A 3WBBA 4BV9A 1HSZA 2NVUA 3IC5A 3UAGA 4L73A 4E12A 4DL9A 4ESOA 1HT0A 3SX2A 4BGEA 1P0FA 1UXGA 3QA9A 1O0SA 2C54A 2D5CA 2OBYA 4BO4A 1I32A 1TXGA 4WECA 1KY4A 1MB4A 3FR7A 4W9NC 4BNHA 2EG9A 4M55A 1KVUA 3K9QO 1NFRA 2D4AA 2O3JA 5CG1A 3ZN2A 4J91A 1HYEA 2EF1A 5IXYA 4PRKA 2PLAA 1QYVA 4L75A 3GPDG 1UXIA 1GCOA 1P77A 1WLYA 5IFLA 2EGHA 1IHXA 2EIHA 2JAHA 2Y0DA 3ZHYA 5JDIA 3WB9A 2PZKA 2ZATA 3QIVA 1LDEA 2B4QA 1X1EA 3BAZA 4WLEA 1R6DA 4MIYA 3TOZA 3GF4A 2FSVA 3PZBA 5JPIA 1FDWA 3FNGA 5J23A 2C2YA 4XQCA 3V2HA 5B4UA 1C1DA 1PGNA 1VKNA 2ZK7A 5T6BA 1HE2A 4JX8A 4LVUA 5FYDA 3CMCO 5JLAA 2OGUA 2POQX 3JQCA 1JTVA 5JAZA 1LUAA 4CM8B 4BNMA 1WMAA 3RFVA 5CAEA 4BMVA 4D45A 1NWHA 1ZBQA 3WSWA 2O4CA 4R68A 5J9GA 3WNQA 4E13A 5EERA 1MV8A 1KOLA 4FB5A 1D8AA 3DR3A 3MJSA 3L9XA 4GWKA 2C82A 1J5PA 3BTSA 3QY9A 5JMWA 1DC5A 2VWQA 3H8VA 4E31A 2E6UX 5GZ3A 1UXKA 2W8ZA 4I08A 1LLCA 4WNCA 1K89A 1CQIA 1P0CA 2ZYDA 1T4BA 1GUYA 2H63A 3IL2A 1TEHA 3OIDA 3FPCA 2CSUA 3GN1A 5ILOA 4BO8A 1HDOA 4CUZA 3BMCA 4XYGA 4R5HA 5JYFA 4JCOA 4JP3A 2DQ4A 3WGIA 3WQQA 4I1IA 1R12A 1N8KA 1U3TA 4BNLA 4R1TA 3PWZA 1T2FA 2WMDA 1VJ0A 3O03A 3WDSA 4B3HA 3DHEA 2JHFA 5HRUA 2GN9A 2A94A 4JBGA 3IAHA 1MG5A 3VPFA 3RUIA 3VH4A 5LC1A 4BV8A 5IZCA 1M76A 3JD0A 4R69A 2JD2A 5IN4A 3DFZA 2IDZA 3QHAA 4CLHA 3QQPA 2CMDA 2CNBA 3OF2A 3CUKA 3DWFA 3VH2A 4K9DA 4IS2A 1VL0A 1OZAA 4R9SA 1DAPA 3FNFA 2CVOA 4DYVA 2NU8A 2BLLA 3UW3A 5AXDA 4FC6A 4PGFA 4AJJA 3ZV3A 4F46A 5BSFA 5GY7A 2NVBA 3S55A 4E2WA 4YCAA 1QP8A 3Q9UA 4XJTA 3EMKA 4PLHA 1O5IA 3HN7A 3VH1A 4LVCA 3CKYA 3OQ6A 4WLOA 3FD8A 4A7PA 3V8BA 3MCVA 3INRA 2X9VA 4Q3EA 4PG8A 2ZCVA 2PGLA 4Y9DA 5IJZA 4CLRA 4AJ1A 5JAIA 3MJCA 5DBGA 4Y8VA 4R51A 3LQFA 2VHZA 3OA0A 2IZZA 1LQUA 1CETA 1YB1A 2VZ0A 4IQGA 4WLNA 1WNTA 1DSSG 4WLUA 1KEPA 3NJ4A 4P4GA 5BNTA 4GWGA 4M54A 4I9HA 4EI2A 3A06A 4BO0A 1E92A 4JK3A 1WW8A 3F47A 1QRRA 1GUZA 2AXQA 2Q2QA 4B7CA 2O4UX 4F6LA 1G0NA 4D3FA 4MVJI 1JU9A 3KB6A 4HKTA 5IAAA 3DZGA 4GKVA 4KUGA 3C1AA 2C7VA 1ZIDA 4FCCA 3DAPA 3JQFA 2B36A 4OIMA 5EINA 1SBYA 4TSKA 4J1SA 3K31A 4EUFA 4YA6A 5KJ6A 3O8QB 3ICPA 1JWBB 3ZW8A 3TFOA 4PFJA 2QRJA 2QYSA 4JJGA 4NNJA 1R15A 1PQUA 1GCUA 1UJMA 5EQFA 3E5MA 4CLDA 1OI7A 2EHDA 3GVCA 4LMRA 3BMCB 5FWNA 3ZWXA 2VWHA 3PDJA 2XF8A 2AMFA 3JQFC 3VPSA 1WMBA 2HMVA 2PK3A 4GSLA 4ZQFA 5I9LA 3RROA 4HWKA 2YYYA 2Y1EA 3OECA 4KDFA 1DIAA 2PZLA 3PEFA 3W4IA 1W73A 2CUKA 1H6AA 2W2KB 4ALMA 1A4IA 1YOVA 3WTCA 2VUUA 3Q3CA 5TX7A 5L40A 1LC3A 1LRKA 2H9IA 1DRUA 3PHGA 1ADGA 3JQ7A 4WCFB 1V8BA 5DP2A 3H3FA 3UKOA 3KSZO 1A7KA 2J5QA 1Q7BA 1VJ1A 3M2TA 5BNFA 5KCZA 1N1EA 2AQ8A 5F1KA 1C14A 2RH4A 3MJEA 1E1NA 3L0DA 2OP0A 2ZTLA 5IF3A 1QYXA 4IGEA 1B7GO 4FOOA 3KYCB 3RWBA 1MUUA 4HXYA 3L77A 1B16A 2DC1A 3KM0A 3A9WA 3FWNA 3LYLA 2EEZA 3M6IA 1DXYA 2TMDA 2V6GA 3JCZA 2JD1A 1O94A 4P38A 4WCFC 5DBFA 4HNGA 1ENYA 4MJLA 2Y1DA 3KYDA 3WFIA 1ZJYA 4G81A 2ZQZA 2Y68A 3PVZA 2O3QA 4BGIA 3FRJA 3H7AA 3PLNA 5ER6A 4PCVA 3WGQA 1E3LA 1HDZA 1Z73A 2DBZA 5CEEA 4CLRB 5TJ9A 5H81A 2R2GA 3KLMX 3QWFA 4XYEA 3QP9A 1LJ8A 4RDIA 1HE5A 1SMKA 3WGGA 2O3RA 3KSDO 3UCEA 4RPGA 2PD4A 1PR9A 2R00C 2X0JA 4YR9A 2C7GA 2Q45A 2JL1A 9LDBA 5BSEA 2YHUA 3I9MA 4XQ9A 4K26A 4YXFA 3RUDA 2CDAA 1LI4A 3AU9A 3P19A 1X13A 4R3WA 1JQBA 4W82A 3RVDA 1U5AA 1T4DA 2CVQA 2NLOA 3U5TA 5CPFA 2O2SA 4TVOA 3VDRA 5CDGA 5ITWA 3RAJA 3HG7A 4J1TA 3GG9A 4CM7A 4CMCA 3QV1A 2HUNA 1MX3A 2H6EA 3NV9A 1Y6JA 2OUIA 3CH6A 3G49A 1HF3A 3LDHA 2Y1OA 4NJMA 5ES3A 2D59A 4JROA 2EV9A 3H9EO 3E6AA 2D5AA 1P1RA 5KVQA 1AHHA 1BTOA 1Z74A 2P68A 2PTGA 4A27A 5B12A 3NAQA 1PSDA 3WYBA 5TLSA 2R00A 1T1SA 2GGSA 4IQ8A 4GMGA 1T24A 4RCVA 1HDXA 3F1KA 4GH5A 2ZJ1A 2VZ8A 1GYQA 3E82A 3MOGA 4II3A 3WMXA 5CDSA 4QTZA 1DFIA 3VC7A 1LDYA 3KOUA 4IIVA 3JD2A 4KTVE 3M1AA 3QVSA 1RPNA 4GX1A 4RVSA 2YZ7A 5TJHA 4OXKA 1PL6A 4J49A 2X5JO 2X0RA 3U49A 1YBMA 3U09A 4E30A 4MVJD 1WWKA 3IOYA 4RQUA 3R3JA 4BKRA 1LC0A 3CIFA 1ULSA 4ZGWA 1NR7A 4YBZA 3EK2A 5JCJD 1IUKA 3TF5A 1YONA 4D0RA 2VTEA 1GEGA 5A04A 1EVJA 1XLTA 1U2GA 1H9BA 4NHEA 4E5KA 1PQPA 3ITDA 1VC2A 1H94A 1MC5A 2C59A 2EW8A 1AE1A 1CJCA 3BMNB 3JYQA 5K6AC 2X6TA 3AFNA 3WS7A 4JQCA 2YQ5A 3GHHA 4GPD1 2F00A 4JXKA 1UAYA 2HK7A 4CMAA 2F1KA 5KJ1A 5HM8A 3P2OA 2VTDA 3JD3A 4OOEA 2AEJA 3WICA 3QVTA 4E6PA 3FCOA 4PVDA 1OAAA 4U6QA 4J7UA 1UP4A 1S7CA 4YVFA 1LSJA 1SPXA 3OEYA 3D4PA 3HDYA 4D42A 3EVNA 4BB6A 2PNFA 2DT5A 1E5QA 5G4KB 4CV3A 1EUCA 1I3MA 2Q2WA 2Z95A 2QG4A 5CPBA 1NQOA 1EZ4A 5L95A 5TC4A 1AN9A 3OJ0A 2HQ1A 3TZCA 4YRAA 1NVGA 2P9EA 1W6UA 1TB4A 2B35A 3KZVA 4LISA 2EJVA 1F06A 2O50A 5ADHA 2IXBA 3ONEA 3I23A 3KRTA 1V6AA 1D7OA 2PD6A 5F1PA 1VJTA 2RHCA 2FHSA 4UREA 1R4MA 3HDQA 5A5FA 2FPIA 5L7TA 1ZUD1 1T2AA 2PR2A 3W4JA 3F46A 3U4DA 3GQVA 4AJ4A 3ETGA 3CINA 3IP3A 4G5HA 1EBFA 1YWGO 4HFJA 4EJ0A 1K6XA 2XXJA 3RC1A 4PZEA 3HZZA 3BIOA 2BFAA 4LW8A 3VPXA 2I76A 1HETA 4MVJA 1RM4A 4J1NA 1NVMB 3T7EA 4YTEA 4RPJA 1LDMA 4XQGA 4BNTA 4DMLA 1O9BA 2G5CA 3LC2O 4NFSA 3JSAA 1RWBA 2FP4A 3MZ0A 2J3HA 3TZKA 3QSGA 1D4FA 3HN2A 4PLVA 2Z1NA 4Y6RA 2OMEA 3GMSA 4ND1A 4XA8A 4XIJA 2ZJ0A 2ZQYA 3D7LA 3GUCA 5KTKA 2DFDA 2X5OA 1R66A 3ZWCA 3NTQA 1VRWA 3ZWWA 1K6JA 1JVSA 2I3GA 3L4BA 1GEEA 2Y99A 1NFFA 1YO6A 2I6TA 3DBLB 2GUGA 3UF0A 4IMPA 3JTMA 1KVQA 3OH8A 1E1KA 2EKQA 4Q39A 1NR1A 3FNHA 1ISIA 1YL6A 2X58A 4U6SA 3ZNNA 4BNWA 1EFKA 1O8CA 3WLEA 2PKQO 4HBGA 1IPFA 3DXFA 4BIIA 4EITA 4WOJA 4JP2A 2O3SA 2OO5A 1H2BA 3AUAA 2E49A 3FHLA 4AG3A 2AQKA 4UULA 1S6YA 5TGDA 3E18A 2BFPA 3RKRA 1GYPA 3ROKA 3DMYA 3WSVA 1YGYA 1O6ZA 3FF4A 3HUDA 3K8ZA 3AFMA 5AYVA 1MFPA 4AJHA 3C85A 2BD0A 3VZQA 4DBZA 3KEOA 2EKPA 4KQWA 3PGJA 4Y6SA 1A27A 1B8PA 4Q3DA 4A5OA 3JQ9C 1SB9A 1QMGA 1GV1A 2YHIA 3ZNQA 1GD1O 4FDAA 5JE8A 4W9NA 4YDRA 2AEFA 1ZEJA 4XKJA 2G17A 4X54A 5G0SA 3FTPA 3JQ6A 4K28A 3JQAD 1ADFA 2AQHA 5KVVA 4M8SA 4AVYA 1DOHA 5JNLA 3WBFA 4NBRA 4QQRA 1XEAA 1YQGA 1P3DA 1WVGA 2AE1A 2BFOA 5EN4A 1YKFA 4QT0A 4PG4A 3TPCA 4AJNA 3GDOA 1ADBA 2XAAA 3H3JA 3ZV4A 1C3VA 1N9GB 4B8ZA 1NNUA 4OL9A 1RYEA 3GGOA 1IY8A 1EFLA 1P31A 3WWYA 1A71A 2FR8A 1K0UA 2DKNA 1FJHA 5I9MA 3ZH2A 2GZ1A 3TL2A 3KXDA 3ZU4A 1P74A 1GPDG 2FPGA 4BMNA 2JCVA 2IEDA 3HFGA 3EY4A 4GLLA 1PTJA 4O6VA 3ROMA 1UZMA 3S2GA 5MGBA 3DZJA 1I3LA 2X0IA 2AA3A 1HL3A 1XGKA 1PS0A 2A9FA 2CDCA 3KYCA 3PYXA 4PZCA 3U3XA 1NVTA 3Q0EA 2IODA 3QE3A 5EQDA 4IBOA 5JAQA 4CMHA 2GLXA 4I5DA 4MKZA 4NI5A 1ISFA 3QLJA 4M87A 5U4QA 3NRCA 3VZPA 3INTA 1XG5A 4N5LA 1ZW1A 2QW8A 2ZTMA 1DFHA 3C8MA 1FK8A 2DVMA 4J16A 4PLCA 1JAYA 3WNVA 2Y0CA 3NT4A 3QRWA 2NADA 5JS6A 4Q3AA 1ZK1A 4A73A 5TT1A 1Y8QA 4CMIA 3FI9A 4PZDA 2I67A 4K6FA 3TDKA 5EIOA 1CF2O 3OA2A 5A9RA 1XR3A 1GL3A 5GZ6A 1YJQA 5HS4A 3GOHA 3OBBA 4DQUA 1KBZA 1PIWA 4RVFA 4EJ6A 4A0SA 1LRJA 1ZK4A 4FJ1A 3IQDB 2R6JA 5JC8A 5KVCA 5AVOA 3JQGA 3RBVA 1GU7A 4CQLA 2OP1A 1U9JA 1KVSA 2EKLA 3HJAA 4UVHA 5L45A 2I3AA 3B20A 1DIRA 3DHNA 3WYCA 3I5MA 4FC7A 3VPHA 1KYQA 4MVJH 1EEHA 3GAFA 5ENVA 5DCUA 4QUKA 4G65A 4CM4B 1NP3A 2VQ3A 1QLJA 2A4KA 2PY6A 1LDBA 1NM5A 3ITKA 5F3RA 4DBVO 2IXAA 4DIBA 4MP8A 4HUJA 1HWYA 4KDEA 3AUTA 4XIYA 4EUEA 4IM7A 4KOAA 1IE3A 3ZWAA 3PK0A 4BQRA 1D1SA 5AXCA 5CDUA 1Y5MA 1LDGA 1SAYA 2Q99A 5TT0A 3DZFA 2D8AA 4OOFA 3JYPA 4CMEC 1FDVA 1UDAA 5DN9A 3A14A 4CM1A 4DUPA 3S1LA 1M66A 4ROSA 4Z9XA 4FPXA 4R3NA 3UH1A 3WFJA 1PS9A 1YS4A 3RASA 1LXCA 1K3TA 2WYWA 5ILGA 3QJ5A 4Q3BA 4FFOA 2VYVA 1IZ0A 1I01A 5CHEA 4LCJA 5L4NA 2DLDA 1T1RA 3GT0A 1XHLA 1E3IA 5A5EA 3DZHA 3RKUA 5C5IA 3H9UA 2O3TA 4I9NA 3MEQA 5JY1A 2WD7A 2J3IA 3C7DB 4E0BA 4J4HA 4QFDA 2FPPA 2RIRA 4L74A 3NTRA 3AI1A 3IJRA 3G1UA 1NQ5A 2G76A 5JSFA 4BHTA 4CQMB 4P22A 2NTJA 3NDIA 1ISGA 3C7AA 1YB5A 4ND3A 3ULKA 4WNIA 4FOSA 2WYVA 3A1NA 5JFOA 1C1XA 1D1TA 5T67A 1HDGO 4K1LA 2IE0A 1B26A 4YT5A 2Y93A 4I5FA 3RBZA 5K0ZA 2V7PA 3GH3A 1U4SA 1GZ6A 1N9GA 3PQEA 3EDMA 3ZW9A 4N18A 5T8KA 2Q49A 3NDRA 4JBHA 4GVXA 4FJ0A 1LSOA 2HAEA 4B3JA 3TZ6A 5JDIC 2AQIA 2G82A 2GN8A 1SCUA 1N1GA 1NQTA 3X2FA 3T4EA 1UZNA 3I9NA 3GVIA 4J90A 4BS9A 1Y5RA 2NQ8A 2QRLA 3JD1A 2Q3EA 4WJZA 5JDCA 2J5KA 3E9MA 5THQA 3GN2A 4Z0PA 3G17A 1AGNA 4LSWA 4MPDA 5JAMA 4PLWA 4YJHB 1YBAA 4WLVA 4PG6A 4JNKA 4YPOA 4QEDA 3LLVA 2BI8A 3AU8A 3SXPA 2D2IA 3DMTC 2JKVA 1KETA 1KEUA 1DC3A 3F5QA 4RZHA 2YFQA 5FI3A 4OKNA 2O7QA 1OC2A 3DDNA 4HFMA 1U1IA 7MDHA 3TRIA 4CPDA 1WDKA 2V6MA 4E3ZA 1FDUA 3EZYA 2ZTVA 3NGXA 5T8KC 1OC4A 3VZRA 2WE7A 1PJTA 3F3SA 1MFZA 2E37A 1IHYA 2ZKLA 2B5VA 1HEUA 1Y81A 2CDBA 4IDCA 5EJ2A 2PKQP 1AXGA 3JYLA 5U9CA 1F17A 1EDZA 2G1UA 3KEQA 3BMNA 1AHIA 4ZQBA 2GZ2A 3IUPA 4WKGA 1SOVA 2HMUA 3QWAA 3ZWMA 4B4VA 5DBIA 4EJMA 2C5AA 2VHWA 5KKAA 2VRBA 1MXFA 1ENOA 2I9PA 1ZK0A 5T64A 3PYMA 5IN5A 3V5NA 3BMQB 4FW8A 3F4LA 3DBLA 5JW6A 3JQ8B 3GNQA 3NTOA 2VT2A 4BB5A 2UVDA 3HSKA 1BG6A 1P44A 3KSUA 2V6BA 1B0AA 2PA3A 2RCYA 2Y1CA 3E1KA 2WEKA 4IGFA 3RUFA 4DC0A 2C07A 2VCYA 3BMOB 3H2ZA 5L7YA 3DOJA 3L4SO 2HRZA 4K6CA 5BQFA 4JJIA 5IDWA 1PGQA 1UP6A 2Q2VA 1ADCA 4PN3A 5JXWA 4XR4A 1U3UA 3H4VA 4TRNA 3GAZA 1M6WA 3WX0A 1BDBA 4E2XA 1DPGA 3IUSA 3GEMA 4II2A 1L7EA 2OOSA 4OYRA 3AM5A 1DJNA 1V3VA 1DB3A 1YQXA 3OJOA 4NPCA 4P8RA 2B4RO 3QVWA 1IOLA 4R1SA 2NTVA 3OHSX 1GYRA 3VTZA 4KWHA 1EMDA 1TA4A 5A9TA 4ZVVA 4UUPA 4RDHA 2UUPA 1UDCA 3PGXA 1P1IA 1H93A 3PQDA 1VSUA 5F5NA 4CM3A 3QWBA 1DLIA 2OORA 4BNUA 4IQ0A 3TZQA 1J0XO 3KO8A 1LA2A 3PQFA 2EXXA 4LK3A 3F9IA 4H15A 4M1QA 2W4QA 4MP6A 4R1UA 4EDFA 1HDRA 2VWPA 4NDNE 3L6OO 1EVYA 4OQZA 4XYMA 5KNLA 1QV6A 4Y67A 4L76A 4CV2A 3I4CA 5ER9A 1Y7TA 2GASA 1I24A 4GX2A 4KTTE 1EK5A 1VE9A 3SJ7A 5M6DA 4BGUA 1F0YA 2X4GA 3PPIA 4HV4A 3PJDA 3PWSA 3ONFA 3DOCA 3OIGA 5JDCC 3EYWA 4H16A 1H0KA 5IG2A 2D1YA 4WASA 5ENDA 2VYND 1JKJA 2A92A 3PI7A 1KVTA 4YAEA 4MVJF 3TWOA 2ILTA 1WZIA 4ZU3A 5G4LA 1A5ZA 4J2OA 3CPSA 1W0CA 3DEYX 2SCUA 4TQGA 2EERA 3ETEA 4RVHA 1UXHA 1ZK3A 4IJVA 5KWEA 1XELA 1P45A 4GX5A 1ZH8A 3FN4A 1QKIA 1BW9A 4TRMA 2HRBA 3FBGA 4S3MA 1UUFA 2E82A 3RU9A 4LRTB 2FZWA 3V1TC 4JIGA 3UN1A 4ZN6A 4Z6KA 4QXMA 1LSUA 3FWZA 1UR5A 4CUJA 3E48A 2P9CA 2RAFA 3RQSA 5IDQA 1JWAB 5IXSA 1QLHA 3D5TA 1N7HA 3QVOA 4L4XA 1P1HA 3HHPA 3SBOA 4B4OA 1ZNQO 1Y8RB 1ID1A 4CM9A 1E7SA 3D3EA 1LEHA 4YRDA 5A3JA 1CWUA 5A02A 4L0QA 3HFSA 4RORA 1YE3A 1LRLA 2WYUA 3RIHA 3LT0A 4D3DA 3O9ZA 1UXJA 5L53A 4CM9D 5TQVA 1ZKMA 3E03A 5JO0A 3R1IA 4BNFA 1SB8A 4EBFA 4R1NA 1PJLA 5I7SA 4MO2A 3EW7A 3UHAA 5KOIA 4BO2A 3DHYA 4RVUA 5DULA 4E33A 4XDYA 1HLPA 1BMDA 1TT5B 2J5RA 4KMSA 2FR0A 3EVTA 3PYLA 2W90A 2X23A 5CP8A 5CFZA 2VYVD 4E4YA 5C37A 2WJPA 1PS8A 5JYDA 2P4QA 4QO8A 4FR5A 3ROPA 4XJSA 4CLEA 1Q7CA 1ZSNA 3I6QA 3FPLA 2X0NA 4MDHA 3VPGA 1OOEA 2TMGA 2PH5A 3K73O 1DAOA 1OFGA 3KV3O 1A9YA 4YAIA 2HJSA 3B1KA 3WGHA 2YV1A 3IP1A 4INAA 2CZCA 5I8ZA 4YJFB 5LCXA 1JDJA 3I9KA 3D3WB 3H2SA 5CDYA 1PGOA 1CRWG 3GMDA 4IDBA 4HX5A 3F4BA 4PLYA 3MTGA 1PGPA 1IYZA 1NAHA 1M6HA 1EK6A 4UVIA 2JFFA 3DC2A 1XWFA 2YDXA 1I30A 3ZHZA 3BMQA 5LDGA 4DGSA 1P9LA 3GVPA 5AQ1A 1HXHA 4NBUA 1BXZA 3DBHA 4CQMD 4J2HA 5MDHA 2DBVO 3ETDA 1E3JA 4OXYA 3UXYA 5CG2A 3JQAA 1Z7BA 1RM3A 4IINA 1HYHA 2O48X 1C1XB 2OFPA 2VOEA 2PZJA 1EE2A 1GQQA 1QSGA 3FNEA 1PJ3A 1R4NB 1NPDA 1YB4A 3W1VA 4OSOA 1NAIA 3GRPA 4J1QA 1J6UA 3WXBA 3PJGA 1ZJZA 4A10A 2V6FA 4WEQA 4NJOA 3NX4A 4RO0A 1PZHA 3D1LA 2GR9A 3DTTA 1BHSA 3IS3A 4DYDA 4N54A 5H83A 5DZSA 5HS6A 1GFSA 3ZWPA 4W7HA 3DONA 1VI2A 4WCFA 1GQ2A 1X7GA 4RZIA 3V2GA 3W6ZA 4DLBA 2IZ0A 1GADO 4I5EA 3V1YA 2WWRA 1E1MA 3LT1A 2CVZA 2QQ5A 4NR0A 1VL6A 3U9LA 2GD1O 1DJQA 1V9LA 2HSDA 3GEGA 4ITUA 4DQXA 2JAPA 2NNLD 2YV2A 2Y67A 3AI3A 3A28A 2Q50A 2NACA 4MKRA 2O23A 1MP0A 3W6UA 4AJIA 1ISHA 1ZEMA 4L8VA 3JQDA 4OJNA 1KS9A 2QZ9A 3Q11A 1I2ZA 2OHXA 4DIOA 4DVJA 2NM0A 1U28A 3NEPX 1NASA 3BTOA 4R5MA 3ANMA 4J7XA 4HP8A 2DPHA 1BRMA 1DEHA 4Z3KA 3NKLA 3TZHA 2GZ3A 4H3VA 2B4TO 3AY6A 2EJWA 5A06A 1PWZA 1R4NA 3ZI0A 4FFMA 2DUWA 1HSOA 2XXBA 1ZO8A 1E1LA 4I8XA 4M86A 2CY0A 8LDHA 4TVBA 2PH3A 2BKAA 3GPIA 4OMUA 3UVEA 4QSMA 2ZB7A 4D0SA 1JW9B 4XD2A 2WD7B 1XCBA 4ALLA 4GLOA 1GPJA 2Q4EA 3OMLA 3DZIA 3HE3A 2JFGA 1ZCJA 4IDEA 1X15A 3GG2A 2IZ1A 4ONEA 4J9VA 3LVFO 1BW9B 4DREA 3PP8A 3KTDA 4FD3A 4IY1A 2Y1GA 3GFBA 4FIZA 1RM5A 3KUXA 2HMWA 4G2NA 3RD5A 1V35A 1CDOA 1UDBA 3K30A 4L9RA 4TKLA 5F21A 4CMIB 3LT2A 2BELA 3D5QA 4PVCA 3R0IA 5DNAA 1I5RA 3CZMA 3C24A 2QX7A 3AY3A 3W8FA 3ZU3A 5BSHA 3KBOA 3ZWNA 2VNSA 3Q1LA 4R4JA 4TROA 3JQAB 2FSSA 2IYOA 3Q2KA 5BR7A 5I9NA 4WE3A 2B0JA 1TT7A 5A9SA 4LSMA 3PIDA 1WXDA 1I3KA 3I3OA 1LBEA 4J4BA 1XYGA 3QWIA 5COQA 1OBFO 4NBVA 2VNAA 1Z6ZA 1K2WA 4OM8A 1BGVA 4IDDA 3IIEA 3CTMA 1E3WA 4GAEA 4CMKA 4BGVA 3GLQA 1NPYA 2DU8A 4OXNA 3T4XA 4ALIA 4E5YA 2VHVA 5C7LO 1IZ9A 1WDLA 3S2IA 4CMBA 1Z7EA 2NV6A 1IB6A 4UEJA 4DPKA 3RJ9A 2P2SA 4GI2A 1C0KA 1SEVA 1GTMA 5JCJA 3I6IA 3IMFA 3IDSA 3KVOA 4RJTA 3VZSA 1QR6A 3KETA 4C7JA 3OQBA 4FFRA 4BOYA 3L4BC 4E2YA 1VSVA 2C2XA 5I7EA 1DIHA 3WLFA 5I7VA 3F1LA 3C7CB 4CM4A 3WR5A 1DRWA 3I9JA 4ZICA 1PJBA 1Y8QB 4EZBA 4DPLA 4NU6A 1B2LA 2CF6A 3HB5X 1A7AA 1K5HA 3ZHBA 1X0VA 3K5PA 4MVJE 4P4NA 3K96A 4PLZA 4FQ8A 4JBIA 1F14A 3PLRA 4P4LA 1Q1NA 1H5QA 3BHIA 4NFYA 2YQ4A 3RJ5A 5GMOA 3ZNPA 4W7IA 4IJKA 3WIDA 1DC6A 4MVJG 2YJZA 2Q22A 4FFLA 4C7KA 2GYYA 2VN8A 1QYCA 4RLHA 4TKMA 3GVHA 2FY8A 1GY8A 3DQPA 1SZJG 4IXWA 5IZ4A 1CEQA 4RPLA 1E3SA 1GZ3A 4RGBA 1EDOA 5JBIA 4BNXA 4RF2A 1H6CA 4R41A 4ALNA 3E5RA 4XRGA 1SEPA 5C7IO 4ZJUA 2X5KO 2I5PO 1NXQA 4XRRA 2Q46A 2NWQA 1MLDA 2IRWA 2ZB4A 3AM4A 3UUWA 1T25A 3ASVA 3EC7A 3GDGA 4S1VA 2BH9A 3GZNB 3AOGA 5COBA 1TLTA 1B14A 1LTHR 3BHMA 3D64A 3HNPA 1XQ1A 5DT9A 1NYTA 2X8LA 2GN4A 3ZWVA 1XDWA 3D0OA 3TOXA 5T5QA 3OM9A 2HKIA 1VL8A 4H7PA 4N5MA 2OZPA 2RH8A 4CODB 1E6WA 3WGOA 4RVGA 5GZ1A 4DXHA 2NVUB 1R0KA 1T2DA 2RHRA 3OETA 2Z5LA 4ZQGA 7ADHA 1NPTO 3I9LA 5A03A 3G3EA 3K2EA 5ICSA 1CIVA 3PDUA 5C3MA 3ST7A 4CR6A 3JYOA 1JLLA 3DL2A 1MGOA 4NIMA 2VZ9A 4J0EA 2AHRA 1X14A 5K6AA 2C5EA 4PG7A 1E7QA 2NU6A 4NZ9A 4W6ZA 4KZPA 4CR8A 2Q1TA 4GSKA 2J3KA 2Q1SA 3OQ1A 4UVDA 5DOVA 3JD4A 4B4UA 4LGVA 3H5RA 1P1KA 3ICCA 3PZRA 1M2WA 1WPQA 3ZNOA 2EP5A 4IDGA 3RCBA 3P2YA 2YFHA 3DBRB 5A3VA 3NYWA 3BXXA 3JQGB 4NFHA 3S8MA 4O59O 1DLJA 2JCYA 1FMCA 3WYEA 4IJUA 4J0FA 3TFQA 1O95A 3BHJA 2GCGA 3D3WA 5ICMA 1N2SA 3LF2A 1T2EA 5G0VA 6ADHA 2E4AA 3H65A 3HDJA 5COAA 2W2LD 3TSCA 4C4OA 2A35A 2FR1A 2NVWA 1SNYA 2J3JA 2JFHA 4R54A 4BNIA 1FDTA 1B3RA 4BNVA 2VT3A 4QO7A 3GFGA 1KVRA 2VUSA 2WD8A 2QYTA 4KQXA 4EGFA 3WG9A 2YUTA 1XU9A 4UEOA 3B1JA 1M75A 4YT8A 2HJRA 3LU1A 4I9UA 3ZWYA 4GKBA 1WAMA 4J4TA 1EQ2A 1LU9A 1LNQA 4DQVA 3FSRA 5AOVA 4YWJA 3PFWO 4B7UA 3GY0A 1B3BA 1SC6A 1BVUA 1KY5A 2PV7A 4DIFA 4CV1A 4ZHSA 1B8VA 1IULA 4WCDA 4IDAA 3IKTA 1RM0A 3GZ4A 2HK8A 1E6UA 1R0LA 4MP3A 2BGMA 4UAGA 1E7MA 5U1PA 3WQSB 4AL4A 4ZQHA 2DTEA 2G0TA 4DWVA 4DRYA 3UGKA 4CMEA 3ZWBA 1YDEA 4FN4A 3PWKA 3JV7A 4F45A 2W2KA 3NDJA 5JC1A 4Y6PA 5L9AA 2CF5A 3LLSA 4E5NA 1HZZA 2GRAA 2DM6A 2GPTA 2X9GA 1PZGA 1PJCA 4D43A 1ISJA 2HMSA 2IEBA 4YQZA 3GGGA 2RBEA 3GC6A 3P5SA 5L7WA 2DTDA 4RPKA 2PD3A 1K6IA 3G79A 4HFNA 4IJWA 2NU9A 4TWRA 5L51A 3MOIA 3AM3A 3OEWA 4WLFA 2WE8A 5L3ZA 5BNIA 2H1SA 1X7HA 1NTOA 1LLUA 4PLFA 2OXIA 1G6KA 1EVZA 5I7FA 3ZCXA 2UUOA 4DLAA 2YDYA 1NWCA 1BXKA 4B3IA 3GA0A 4M89A 3SVTA 4RQTA 1PJ4A 1HTBA 4Z3DA 3VTFA 4NMHA 4QX6A 3D4NA 3LZ6A 4BKUA 1PJSA 4WUVA 4CM6A 3LC1O 2VRCA 3EUWA 3BZUA 1NQAO 4OQYA 3O26A 3ROQA 1M67A 3VVCA 1MA0A 1TI7A 3WGZA 1JKFA 3JQEA 1JAXA 2PFGA 4WEOA 4NJMB 5H82A 5FI5A 4YJDA 1LSSA 1Q0HA 1T2CA 4CQLB 4BO1A 3PHJA 1PEDA 4KP7A 1U8XX 4TRRA 3TN7A 4YEDA 4ND5A 1I10A 3GZNA 3BTVA 2DUUA 1U3WA 5DF1A 1GAEO 1R4MB 3DZKA 4ZQEA 5JCXA 1B8UA 4EEXA 4OH1A 2X22A 2FMUA 4BUCA 2FZEA 3TNLA 4GX0A 5G0TA 3HB4X 1R0SA 3OJLA 4WK6A 1H6DA 1A9ZA 4FSHA 1L1FA 4PLPA 1BXGA 1F8GA 4RPHA 2HLPA 4MKXA 1T26A 3PFFA 3N58A 3OJFA 3MTJA 2QZZA 4WGGA 1LLQA 3TJRA 2OL4A 4I5GA 1E5LA 4BO7A 1ZK2A 4D46A 1JA9A 4IDFA 3NUGA 4TZTA 1AXEA 5EL0A 3Q6IA 1NBOA 4IXTA 1RYDA 5JYAA 1I3NA 4URFA 2HCTA 2ZB3A 5T57A 3OSUA 3WGTA 1YXMA 4CMJA 4D79A 3WJAA 4BQPA 1KIFA 5T73A 3F6YA 4J6FA 4CJXA 2Y1FA 3DAGA 3U4HA 5EESA 3C1OA 4BVAA 2X9NA 1CYDA 3ZHXA 2EP7A 2PKRA 1F8FA 4MIEA 3AK4A 3RU7A 3UICA 4CR7A 1EVIA 3BMOA 1NX6A 1Y9AA 2GNAA 5F1OA 4IZIA 4RL6A 4XGKA 3AOEA 3B70A 3SC4A 5CEFA 3N7UA 1E77A 4BNYA 4B8WA 4NU5A 4MIOA 1XQ6A 2AEMA 4BO9A 4YQYA 3FBTA 4XEHA 1PZFA 5HBRA 3ADOA 4BNKA 1I0ZA 4W99A 3VH3A 3WTBA 4LCEA 4BKPA 3GGPA 1QORA 3W8EA 3H9GA 5EMHA 2QIOA 3CE6A 2DBRA 3DO5A 5KVSA 2P91A 3OIFA 5DCWA 3ZWOA 1BSVA 3PHLA 3ZV5A 4J9UE 3GUYA 3BYZA 1E7YA 3UOGA 4E5MA 1C0IA 2CFCA 2BGKA 1V3UA 4CMGA 4NBTA 1N7GA 4PLTA 1RJWA 1YJ8A 1XIVA 2PZMA 3MJTA 3SJUA 5L4LA 4MVJM 4OSPA 4Z9YA 4XR9A 5A4DA 4E21A 2Q1UA 1E3WB 2DTXA 1ZSYA 1HYGA 3ZZNA 5L4SA 2BF7A 2WM3A 1X0XA 3AW9A 1DHRA 4RF3A 1PGJA 1HDCA 4YJGB 5JMPA 4ALJA 4A2CA 3AI2A 5B1YA 1MC4A 2WTBA 3U4IA 4ALKA 1X7DA 5FFFA 4DMMA 5A9SB 1I8TA 1OMOA 3ZDFA 4FGWA 2ZTUA 1I2CA 2EWMA 2I66A 4Z0HO 2ZYAA 4ZRNA 3VHRA 1PJQA 4HY3A 3ENNA 3RBXA 5IDYA 3LK7A 5KIAA 5IDXA 3R6DA 1UZLA 2VOJA 4J43A 3EGOA 4D3SA 1EUZA 4WOKA 1HZJA 3RSHA 3HADA 2Y0EA 4W4TA 2GF2A 1YL7A 5G0WA 1L7DA 1NFQA 3DMTA 1XA0A 1B15A 2X1HA 4R16A 2ZYGA 5B4TA 1TVEA 5KJEA 2Y66A 1HDYA 2I65A 3CXRA 1EBUA 2YHIB 1W8DA 4KUHA 2VYNA 1P1FA 3PTZA 2PWZA 2ZCUA 2GO1A 4XGIA 3GNSA 2Q1WA 4AJPA 4BL5A 1VKOA 3EAGA 4CM8A 1C0LA 1FDSA 1ZVMA 4YRBA 3QVXA 4CLOA 1YVEI 1EQUA 2Z1MA 3GRKA 4OHUA 2ET6A 4UUMA 3HWRA 3NJ8A 4XDZA 5G0UA 4BNJA 1ORRA 4GVLA 3FR8A 1HE3A 1Y1PA 4BMSA 2LDBA 2VHYA 1IL0A 4QFCA 1DIGA 4FJ2A 1Y9EA 5CDTA 4YB8A 2IYPA 5A05A 4IPTA 1YOVB 3SLGA 4CL3A 1YQDA 1DHTA 3X2EA 4YYZA 1FF9A 2B37A 5JYEA 3AY7A 4U7WA 4UVGA 1LQTA 3U4CA 4YJFA 3ZU5A 4YT2A 2J6IA 1GDHA 1ULUA 1ZSVA 3PHHA 5TS3A 1ZZEA 3BTUA 3AUSA 1ZXLA 1NHGA 1WZEA 5TRTA 1DFGA 5K9ZA 2PGDA 2GDZA 4UUNA 1U7HA 4XYLA 1HRDA 1QG6A 4BKOA 3L6EA 3WIEA 3IJPA 3MJ4A 1DRVA 1BWSA 3T7CA 3HQ4O 3ADPA 2BI7A 1PL8A 3AUUA 1KERA 1TT5A 2WDZA 2JCXA 5A1TA 1I33A 2FOIA 4YAKA 4PLGA 1A4UA 4U8GA 1VM6A 1PZEA 3D4OA 3MWEB 3VKVA 3M1LA 1U7TA 3GNTA 3ZV6A 2UDPA 3B1FA 1PL7A 2AW5A 3AWDA 3NGLA 4ND4A 4E2ZA 4EEZA 1DO8A 2AG5A 4N7RA 4QECA 1Z75A 3UFXA 1DBVO 3RFXA 3TQHA 1Q0QA 3PRJA 4Q3CA 4BKQA 3AJRA 1U5CA 1LX6A 3WQRA 1O89A 3DBHB 5TF4A 3OJEA 3PJFA 4YAGA 4Q9NA 4OAQA 4Z9FA 3GK3A 4AICA 4B7XA 3JQ9A 3GR6A 4JLWA 9LDTA 4RLSA 8ADHA 1G0OA 4EW6A 4F6CA 1KC1A 1YBVA 1FXSA 4O5OA 1SO8A 5IZCC 4Z0TA 3OICA 1ONOA 3MJVA 3UCFA 3H9JA 3FTNA 4AFNA 3IKVA 1SOWA 1BXGB 3DTYA 2VUTA 4CM5A 3KHUA 1WDMA 3O4RA 4FFPA 3SC6A 1GV0A 4NH4A 1ISMA 3DB2A 1E0DA 3ONDA 2FWMX 4A26A 3HDHA 3RUCA 2B5WA 1GZ4A 2O7SA 4OO3A 1MG0A 3RUAA 4CUKA 4HADA 4L4RA 4YJGA 3ON5A 4EUHA 1YL5A 5KJFA 1D3AA 5G4KA 5JO9A 4XCVA 3GVXA 3S2EA 4O1MA 4CQMA 4NG5A 4DLLA 2BHLA 3GEDA 2BGLA 4E32A 1EUDA 3M2PA 1QXSA 4F3YA 2QRKA 4FBGA 3WJ7A 1IPEA 4XB1A 5F5LA 3W8DA 4MINA 3E8XA 3LSYA 3H6KA 3I1JA 1N5DA 5CEJA 1XSEA 3JQBA 4OGWA 1V3TA 3LT4A 4NK5A 2YV3A 3H9QA 3I9OA 1ENZA 4IZHA 4XB2A 4JN6B 4CLOB 2B83A 5AXAA 2GERA 1ARZA 1E7RA 4XZ3A 2UAGA 3S2FA 5I8WA 4MOWA 3V2UA 5LDHA 3L6DA 5DP1A 3INGA 1UH5A 3E9QA 4GGPA 1QYWA 4OKIA 4XGNA 3A4VA 1GR0A 1J49A 3PXXA 4HNHA 4KWIA 5B37A 4Q3NA 1E7WA 2JHGA 3L07A 3WWZA 1Z45A 2GSDA 4CLXA 5TNXA 5HWSA 3LC7O 1Y8RA 3OP4A 2VRCD 1MXHA 2QHXA 3H5AA 1XKQA 3DBRA 2P5UA 1HE4A 4WPGA 4U5QA 3W4KA 4TRJA 2ZIZA 1QV7A 4UEKA 3G0OA 4LMPA 5EPOA 2NU7A 3WOHA 3CEAA 3KYDB 4BO6A 1R37A 4R01A 4BO3A 3C3XA 4ILKA 4Y98A 3GHYA 3RFTA 1YRLA 3CSDA 2D0IA 3L9WA 1ONNA 2HDHA 1JN0A 1Q2XA 5JY6A 3K2BA 3ANLA 3EZLA 2ZB8A 4KUEA 4BNZA 6LDHA 4DA9A 3P7MA 4UVEA 1Z82A 1Q7GA 4O63O 2H5LA 3SEFA 3ABIA 3VDQA 3WMWA 4O0LA 3ZGYA 3RC7A 4XQEA 4ID9A 1BVRA 4TZKA 4E5PA 4D41A 2WSBA 1UP7A 2HU2A 2O3UA 3G1TA 1GQYA 1LLDA 2XOXA 1V0JA 5DOZA 3KYBA 3ASUA 2BFMA 4BNGA 1E6EA 3JQ7B 4RVDA 4BO5A 2FRDA 1QYDA 1DDOA 1PJ2A 4RF5A 5TIIA 1H2HA 4PIVA 2P5YA 2YW9A 5DCYA 1PR3A 3RC2A 4U0JA 2E48A 1H6BA 1R16A
chains in the Genus database with same CATH superfamily
2YWFA 5D86A 3STHA 4CLQA 1M6VB 4CKBA 3CC8A 3Q2IA 1SQSA 4UJ3A 2WYIA 4GE3A 1H1LB 3DT9A 3A70A 4O2AA 1GR1A 4HMOA 4AJKA 1W1WA 1E94E 1X1TA 1OY1A 2WYOA 4EYEA 2I6QA 4QUHA 4FMPA 2XPCA 1GGEA 4FOLA 1IDOA 4FS3A 5EXPA 4DHEA 1VLLA 5HW0A 2I34A 4KQIA 2Z30A 1MPXA 3AF1A 1U4OA 1I6MA 3IT2A 4J3FA 4JSRA 3FDJA 4OLHA 3AOEC 2FPMA 4AUNA 1M8KA 2D1TA 4AC9A 4BEWA 5JARA 4PRYA 1ML3A 1G1AA 3UQZA 1N92A 2XRFA 5BVHB 3I8SA 3JWGA 3LUFA 3Q3GE 1KPIA 4IGIA 4QBIA 3RUHA 5ITVA 2R8XA 3R2JA 3R3SA 2GPWA 3TKYA 3WL8A 5AI8A 5SYMA 2HO5A 3HI6A 4GQAA 2CVFA 4HAXA 2D2EA 4LMAA 1GUFA 3BH7A 3EAQA 1OASA 4MMZB 3L6CA 1JZSA 3TW6A 1WUTA 5IM4F 2OOKA 2UZ0A 3KNZA 3PKZA 3TXYA 4E07A 2DWQA 4GPEA 1N36B 4MW5A 2AB0A 1L3BA 2W6ID 4DDMA 1MAAA 1N4DA 3T9CA 2CNLA 2QBYB 3MAJA 4C7OA 3DBVO 3HK2A 4GNKA 5IUNC 1PKXA 1CJUC 4DLSA 2XQGA 3DOOA 4NATA 1GPWB 3ENKA 4OAOA 2FF5A 4WDQA 1ZD1A 5HQ3A 2A58A 5KCMA 3QTBA 4AJEA 5JNTA 3E53A 3A1FA 4OVKA 3OEEA 1V9SA 5IWCA 4M7OA 3VVBA 4NK4A 2YJGA 1ZIYA 4RZSA 3RRZA 1C1DB 2PZFA 1KQPA 3ORFA 3P0RA 4MRNA 5J63A 2AE2A 2P65A 2VLIA 1UQRA 1MKYA 4OQPA 5SZHB 1OZFA 3COSA 4JVMA 4QNNA 3TEMA 2AZ4A 1NI4A 1WP4A 2QAJA 3P0FA 1DKQA 2I4NA 2J9GA 5KINB 2W4IA 1CF4A 4IHJB 1H2AS 4NHOA 3WYGA 3IEXA 4AS3A 1RQNA 3O31A 4IUYA 4PNHA 5G2OA 3K0EA 2WT4A 3RYCA 1PX0A 2EGGA 1C9MA 1BCSB 1EE9A 3MT7A 1KZ1A 4W1PA 2XRMA 2DFVA 2X8JB 4XXHA 4UCQA 4YLGA 1NOKA 2QN2A 1O8BA 3DEJA 4JJ6A 2C9DA 3R6GA 1PW5A 3PCTA 4UD6A 1F6BA 2PE5A 5IANA 3KT3A 4PCAA 1ZMOA 3Q9NA 3V8RA 4D44A 1JVBA 3NXKA 5DM0A 4AJOA 3ZGNA 1GLNA 3ICQB 4OQEA 3J7TA 3MXOA 3NT5A 3HCOA 3RC9A 3QPBA 1KC3A 1Y5NA 3SDBA 3DAFA 2B3TA 2BM1A 1QG2A 2CVHA 3CNOA 3U0BA 4AZSA 2Z98A 4B3XA 4CCYB 4EUKA 3I52A 3TGLA 2Y05A 2DCUA 4DGQA 1QPGA 2FFAA 3N0VA 3OHPA 5EWLB 5HG0A 1R0RE 1ZJ6A 4X44A 2WIFA 4CEIA 3EXG2 4UUOA 2C4MA 4Z8YA 4ZRMA 5EKUA 4CCAA 2FN7A 1YDMA 4ZAZA 1A9XB 1I7MB 2A9RA 1CUVA 4JUBA 5J2UF 4R9RA 4YRTA 3ORQA 3VKUA 1YC2A 3RJMA 3LH5A 1C4XA 1U8TA 1B2RA 5EUMA 2Y1WA 2R6DA 3O75A 1IXKA 3JATB 4R31A 3RC3A 3AVWA 5K3BA 1X38A 1JLRA 3BSFA 3QVVA 1WULS 4BNDB 3JYNA 4TMFA 2PSFA 3DXXA 4Z2YA 3BVPA 5FWXB 2OBNA 1AUPA 3BGSA 3NRJA 5DDIP 1JJBA 2IVFA 4GM0A 4OHCA 1ZRNA 2UYYA 3IDQA 2RGYA 3NPMA 5F12A 3SY8A 1DWOA 3U3JA 2ZT7A 4ZDJA 1SXJD 1QK4A 4A36A 2BEWB 3QVMA 3SLKA 2VHXA 1PFWA 4ARZB 4QELA 4ARSA 5BUQA 2ZBQA 1XMXA 1BDMA 4N5IX 2AKYA 3JQQA 4F2PA 2FN3A 2P2YA 1QQ6A 3WMEA 4U0KA 5FB3A 3DYVA 4CV0A 4JI4B 3HEBA 4JGBA 2PUGA 4ZD6A 4MB0A 4C03A 3ZGVA 1VG8A 1RQRA 3KSMA 2P1ZA 3TAHA 4H7HA 1G3IA 3ZDQA 4C6HA 4LDPA 3DE2X 5BNZA 1KEEA 2CYBA 1SXJB 1VLVA 4E2FA 2PGJA 2NZJA 3CO0S 3KZ1E 4JLMA 1FMTA 3TYXA 4BV9A 4DANA 3QUAA 2QZ4A 3Q40A 1KDVA 3FAKA 3W6PA 4ESOA 4ZV7A 3SXJA 2OCXA 1Y3AA 1UXGA 1BKYA 1HTTA 3PVCA 4G5XA 4JSYA 4OEHA 5BWBA 2ASEA 2VJYA 3HBFA 1O0SA 1J09A 2C54A 2D5CA 2EBUA 4K81B 1OREA 5AT1A 4BO4A 3P0JA 3T1QA 3MG9A 4BNHA 1ILEA 5CLQA 2VPPA 5GV7A 2EG9A 1WSWA 1KVUA 2ZSAA 3FPHA 4M55A 4I3FA 3MPOA 1BKSB 3CH4B 2D4AA 2O3JA 1OYOA 1KI7A 3ZN2A 4GIBA 4UOEA 1MAHA 3HP1A 1O87A 1U3CA 1FDIA 3E7DA 1C5KA 4DV1B 2AUNA 4MJ3A 4M0FA 3EUFA 4JJAA 1QZZA 2HL6A 3T95A 1Z4QA 4OJKA 4MS4A 1VKJA 3HACA 3B1ZA 4G4GA 4WK2B 4TL7A 1KI8A 1V1RB 3CW8X 3KOYA 4KR9A 3SZLA 4PRKA 5JHGB 1QYVA 1Y3DE 1R5JA 2IEYA 2R8OA 3GPDG 1MZVA 3ILVA 4IIFA 5C7YA 2EJUA 2ZTSA 3GV0A 1IHXA 5DIFA 7MHTA 4CDGA 2PZKA 2ZATA 3A05A 4C2AA 1PN3A 5A7HA 4ZCSA 4WLEA 3BAZA 1L8XA 1AK2A 1GSAA 1R6DA 5IKOA 4MIYA 3TOZA 2FDRA 3F78A 4X90A 4UOQA 5ALVA 2CUZA 3ZCRA 2TECE 2Y71A 4P33A 1FXUA 1X1BA 4O4JA 2Q6OA 3V2HA 2BBSA 5I7UA 3BQNB 4IVQA 1PGNA 2XMGA 4S1NA 1HE2A 1SUDA 4JX8A 2N3ZA 1V6CA 4Y2UA 3EP5B 2ZREA 2UZIR 3DJFA 4KSYA 3U6KA 3IHKA 2C31A 2ANBA 2OGUA 1HQDA 2YMLA 1W0KA 3G2JA 1SKAA 4HDMA 2NN3C 3X3HA 2ZRMA 1G3QA 4YMSA 2WP8J 4CM8B 3RFVA 3A2LA 3HSYA 1XD2B 1V8ZA 1W4LA 4DLXA 1FNDA 3HBLA 2HCBA 5BMVA 3WSWA 4R68A 2FOLA 3OQHA 4HNQA 1CNFA 5EERA 1T4MA 3PNOA 4HSEA 4PZ9A 4UUBA 1KOLA 2Z9CA 4YECA 5LQCA 1SHLA 4NONA 2RGCA 4GUDA 2H7VA 1AH2A 4PAGA 3BIJA 1N0VC 3GIWA 3NHRA 4PBSA 5FAKA 1QVAA 2VWQA 1K66A 5GZ3A 1Z9BA 1V11B 4WA8A 3UMBA 3CCFA 3JU3A 1T9GS 2V45A 4HK4A 2QM8A 1T4BA 4HTFA 2XQKA 3LY8A 3T1VA 4ZOLF 5PGMA 4CE6A 1PHRA 3FFTA 5D1NA 1CJKC 1IIBA 4R1PA 3FSGA 4R8VA 3FPCA 2ZRBA 3GROA 1J9GA 3O2QB 4MS4B 3GN1A 5JIBA 2F4NA 1MEJA 5ILOA 3S28A 3H1PA 4E1AA 1QMPA 2ZUDA 5HFAA 2BVNA 1RQPA 2WQZA 4UHCA 4WUTA 3I42A 4FZJA 4D0GA 3D8HA 1N8KA 2QU8A 4NCIA 2GH1A 2GMWA 3PWZA 2JZNA 2AWOA 2OGWA 2W11A 3D6HA 1OVGA 4B3HA 3UB3A 2B6NA 5AM2A 5HP4A 1MABB 3KAJA 1TJ5A 3QMWA 2GN0A 1R6UA 2Q29A 3DUFA 2A94A 4FK8A 2HZBA 2IY7A 4P54A 5JPCA 1S01A 1JMVA 2NO5A 2Y77A 3AHDA 1GFWA 4YRQA 1JNXX 1GQFA 1M76A 1MABA 3G5MA 4R69A 4UBKA 4AK9A 4EMTA 4PC1A 5IN4A 1JMKC 4ZMBA 4JJKA 3ZEAA 1XTVA 2GPYA 1V4VA 2B8NA 1JHVA 4QFMA 3TBKA 2QIPA 4R9SA 3VU9A 2HHLA 3A9UA 3X1ZA 3I5AA 4DYVA 4KR2A 4U02A 5KNBH 2BLLA 3GPCA 3UW3A 3I6MA 3E23A 3BDVA 2C84A 4PGFA 1WL8A 4WDRA 1G8FA 4ZT7A 3R0JA 2AZTA 2ZRKA 2IHJA 3NASA 2PRIA 1OV4A 3REGA 4E2WA 2COKA 4TTQA 3HPQA 3C6XA 5EFOA 3L0SA 5HJ5A 4WAUA 3EMKA 3MGAA 1SXGA 4PLHA 1O5IA 4F5YA 2FPIB 1R8XA 3VH1A 2ZSDA 2Z2IA 4WLOA 3FD8A 4A7PA 4E51A 3I5YA 1YQ9A 3FCCA 2DR0A 3Q7QA 3H4TA 4M37A 4B0PA 2NAPA 3DDUA 5C81A 4CLRA 2JZCA 4EFDA 3MPUA 4AJ1A 1A5AB 3MJCA 4JI7B 5DBGA 2IZZA 3U44B 4CKYA 2C57A 2FE1A 1TCVA 1WNTA 1ZONA 2KI5A 3AB7A 5BNTA 3AZPA 3BXHA 3I76A 4GWGA 4L5CA 4P3XA 3UV7A 3DMRA 3SQNA 4EI2A 1L5MA 3LDGA 1D7AA 2Q5OA 2R7KA 4M1ZA 2P6OA 3FMPB 4UUAA 4BO0A 5CYOA 5JVDA 3AVYA 4QOFA 3K09C 1EKXA 1GUZA 1SC4A 2GZAA 4R2LA 2NUTA 3WO0A 1G0NA 1QO9A 3N2GA 3O1HB 4P9NA 1UT8A 3KB6A 5IAAA 3DZGA 4KUGA 2DHRA 3WNZA 2C7VA 1ZIDA 3DVSX 2ZPUA 1FTWA 2GFQA 4U39A 1BWQA 4E11A 4GLFA 5H80A 2JFXA 4C06A 3V00A 4WKNA 4BFZA 1N8TA 5AVYA 4KXMA 3RU3A 4AF7A 5FUBA 2B25A 3CRW1 3BFXA 3L7KA 3O8QB 2O1XA 3ADBA 4HLQB 4WSOA 3MXTA 5IYZA 4PFJA 2QRJA 2AYZA 4NNJA 2X8WA 1R15A 3RSQA 1E2IA 4KGZA 1FX0B 1BAPA 1GAJA 3OEED 1MPTA 5FWNA 1OI7A 3GVCA 4LMRA 1NG1A 10MHA 3VNUA 3ZWXA 1Y63A 4LGMA 2VP6A 2XF8A 2Q8NA 3JQFC 1WB9A 2PK3A 2Z6QA 3WAKA 4IHJF 3WRVA 3AHFA 3FI0A 3H97A 4MUJA 4TTVA 2WR8A 5CM9C 2YYYA 2FMKA 2Y1EA 3UC5A 3KEFA 4K03A 1W73A 2ZZKA 3QF7A 2QX4A 4H7FA 4H1TA 5J1TB 4E4TA 2W9XA 1YOVA 4R1OA 3Q3CA 5DNVA 5TX7A 1LC3A 1LRKA 1JG4A 2FWPA 4A0QA 3T5BA 1E1RA 1WCIB 3PHGA 3JQ7A 5EIAA 4RELA 4F3NA 5DP2A 3ZY6A 2QNIA 5E38A 2DKFA 5EJMA 4EATA 1A7KA 2F3PA 3E84A 4FEGA 4QJ4A 2J5QA 5FULA 4CIAA 1SBQA 5EWLA 4ZEOA 4ASUD 3D6UA 3Q7PA 4DR2B 16PKA 5F1KA 4ZT5A 1Q84A 3GBVA 3HH8A 2RH4A 4WBNB 3L0DA 1W85A 2OP0A 5I4IA 4ERNA 2YKGA 4JUCA 1B7GO 3OZTA 2QQFA 1NF3A 3U4QB 3KYCB 4PZUA 2C94A 3ACCA 2XCUA 3GQBB 1MC8A 5CRIA 4ZEMA 5KSYA 2NP6A 4HXYA 3PJRA 5TQ2B 2LVBA 3M6IA 5IX8A 4BVGA 4G1FA 4WCFC 3OQNA 1OX4A 2EFCB 5DBFA 4HNGA 4KXQA 2H4XA 2V03A 2Y1DA 4OTZA 3SE0A 1W9HA 3TGPA 1B0ZA 3RSGA 3PVZA 1LPSA 4G9BA 1DRJA 4BGIA 3TAXA 4WY8A 1CZOA 3AUFA 3RK4A 1E3LA 1HDZA 5HRCA 5CEEA 3LRTA 3H1AA 5H81A 3QWFA 4DBLC 4HV4A 2CFSA 3QP9A 1LJ8A 4JKIA 1RYZA 4RDIA 3S2SA 4HF7A 4B33A 2O3RA 1FEZA 1QRDA 4CBVA 4RPGA 3L01A 2PD4A 3AV0B 2VT6A 3EPPA 2X0JA 4O2AB 2N1MA 4X1YA 1XPJA 3BGIA 4W1QA 1W25A 4M1OA 3V4ZA 2O54A 2PN1A 2JL1A 2O5CA 4CL2A 2FW6A 2ORIA 4Y1RA 5E95A 2O9JA 3ROXA 2BCEA 2YHUA 3FCAA 3KUDA 5DGIA 2Y1KA 3HR7A 4XQ9A 1SZCA 1ABEA 1TJ3A 4YXFA 4FUTA 2XZDA 1E2FA 3AU9A 4BXOB 2DUMA 4AMVA 4QICA 4Y1RB 2ZJBA 2CHGA 2V8OA 4YCSA 3GLGB 3TLJA 2G1KA 5CXUA 1U5AA 2J0VA 2NLOA 1D04A 3I2HA 3UM9A 3U5TA 5LP6A 5CPFA 4DILA 4P6VF 5E1BA 4TVOA 3VDRA 1J39A 1XDDA 5CDGA 5ITWA 1QTRA 1E3MA 3QV1A 1LK0A 2I78A 3BF7A 3ESAA 1J8FA 4PZ0A 1CD5A 1LNSA 2H6EA 3NV9A 3QMMA 1Y89A 3V55A 2BGIA 3CH6A 1NR5A 2PX0A 3NBFA 4TV8B 5DV9A 2Y1OA 1I79B 3OCVA 4NJMA 3UMVA 1H1TA 4DDKA 3C8DA 2OQRA 1C9NA 1E20A 1KKUA 1S89A 2P3OA 2HSGA 1E2LA 3RREA 1P1RA 1Z74A 1AHHA 2P68A 1KRWA 5B12A 2ZDGA 3EIWA 3NAQA 4BDTA 4D82A 4GW3A 4YC7A 1PSDA 2V3CC 3WYBA 2QE6A 1G3UA 2GGSA 1JDTA 2MJLA 4LJ7A 3T34A 5A4IS 2ZJ1A 2WIDA 3E82A 1ZESA 1RFGE 1Y4SA 1DFIA 4XB6B 3T9AA 3KOUA 5LZ2A 4KTVE 1RPNA 4RJ2A 2PUTA 3U1VA 1PNQA 4RVSA 2YZ7A 3E2IA 4RH1A 4OXKA 3TDMA 1N3BA 5BURA 4YI3A 1TIBA 1AKTA 1IAVA 1JXAA 2ID4A 2YN0A 3OO1A 1AGYA 4MI6A 1SCUB 3IVAA 3NUQA 2B9EA 3S7ZA 5AM3A 4YN3A 4YRKA 2ZR9A 3IOYA 1WWKA 2G72A 4RQUA 4UJ5A 1LC0A 4FDVA 4Z8XA 3UC9A 2FPXA 1CRPA 1RWVA 4KE6A 4LBVA 3WL4A 4JITA 3DLAA 4KCGA 4D0RA 1W6RA 1GGKA 2QENA 3OT1B 2A0WA 3TH5A 1W75A 1T9GR 4IKOA 1U2GA 4NHEA 1STOA 1HORA 2VP0A 3LWZA 4J0QA 2FYTA 3ITDA 5FWYB 1VC2A 2YWEA 3KQVA 2GFIA 5ERGB 1CJCA 1ZQ9A 4AS2A 2YJ3A 3QGMA 3I3SR 1AB6A 2WWGA 4FWIB 5DHQA 1QMHA 1DUVG 1NY5A 2CSXA 1TUEA 2HK7A 2PX6A 1U81A 2F1KA 4GDMA 1D0IA 3TDNA 1N6LA 4D9BA 3EGXA 3NEAA 4P4SA 2M98A 3G6KA 4LGYA 3EZ6A 3ZD8A 3QVTA 2A86A 2AN3A 2J87A 2FN4A 1LH0A 4Q1VA 3L7AA 5BVHA 3A1CA 2YRFA 1LSJA 1T3LA 3OEYA 3D4PA 3DEFA 1A9SA 3PV0A 4YVFA 5CBKA 1BD4A 4MLPA 1J7JA 2PNFA 2YXDA 1DELA 3TTUA 4DDHA 1E5QA 4F6RB 1G19A 3MBOA 5G3YA 3R20A 3WSTA 2V5VA 3D7SA 5H3HA 3V4RA 2IYAA 3TLAA 4UTNA 3FW1A 1I3MA 3CZ9A 2WJIA 4LYHA 1Q3TA 2Z95A 4BLRA 1EZ4A 5C8YB 4I55F 2HIGA 1SIOA 2CT8A 2H48A 1X77A 3TLEA 1NVGA 2P9EA 2ZS8A 3ENZA 1G9XA 2IYLD 4EYGA 1XLVA 2EJVA 4C3UA 5ADHA 2IXBA 3UY4A 4CKWB 3I23A 5ESXA 2JDIA 1R4ZA 1D7OA 4WXEA 2VJAA 5F1PA 4Z54A 3A2MA 2P4SA 3N1UA 4RTNA 1L7AA 2P35A 5FH9A 3EIXA 2Z9BA 4OM7A 5L7TA 4O8ZA 4OQFA 2W93A 3QOWA 1W5BA 2C1EA 5GINE 1BDJA 4C4ZA 1P4JA 4DJDC 2DP4E 3GQVA 2CLKB 3PXAA 5KB3A 3CINA 1MO5A 1TZMA 1V5EA 1WQ1R 2PJUA 2YTZA 3BCHA 3R09A 1YWGO 1L8QA 3ZX4A 1TM7E 5C53B 1K6XA 2VL7A 4PZEA 5EJ8A 3K8QA 1CV2A 3BIOA 1HA3A 1UFKA 3C70A 3VPXA 1SXJE 2I76A 5LZ8A 1YZQA 1YJXA 5CM8B 1JHMA 3LCRA 4D9JA 5I7OA 3B9BA 1EI9A 1M1NA 3HV2A 4Q6BA 3T7EA 4YTEA 2ZVPX 4RPJA 4XSVA 4XQGA 4BNTA 2D2XA 2NXWA 5ICGA 2BCGY 4MUMA 1W85B 3LC2O 5AVXA 1BCRB 4IWNA 3ND9A 1N9KA 2V7VA 3RS9A 2VK2A 5K8VA 2FP4A 3U3DA 1SKMA 3TZKA 1CDDA 1P6QA 2Z1NA 3E1SA 3F71A 4Y6RA 2BZ0A 4ND1A 4P81A 1P0PA 1O5OA 2A78A 2DY0A 3C3CA 3I2KA 4BWGA 3L7OA 2ISCA 3NTQA 3PR2B 1VRWA 4PIPA 3ZQKA 3ZWCA 2FQ1A 1K6JA 5CFNA 4HWOA 1JHRA 3RVBA 1TTQB 3L4BA 4KKXB 4EI7A 2Y99A 5K8IA 1NFFA 4KLAA 3NIBA 3DBLB 3GPLA 3KZXA 1CUWA 4QYMA 1B23P 3JTMA 1KVQA 4XTCS 3NOVA 4O1HA 5DGCA 3ROZA 4Q82A 4C5BA 3Q3EA 3CKLA 3Q10A 4K9NA 3C4QA 1GAWA 1N5MA 3QHQA 4FYKA 2AKEA 1H4QA 3L1KA 1O8CA 1QC5A 2PKQO 4KQ6A 1UKCA 3BB1A 3DEIA 1NBME 4HBGA 1IPFA 3UW1A 3DXFA 4OI2A 3S29A 4BIIA 4WOJA 2CJXA 2CXOA 4ZVMA 4EITA 4DDWA 4GOOD 4BMCA 2WKRA 3WYAA 3AUAA 2E49A 3EY9A 2IZ7A 3ED5A 1XKXA 2WUFA 1IZZA 5TGDA 2BFPA 4I46A 3RKRA 3QUQA 4K0RA 5B7QA 3ROKA 4DDTA 1VSQA 4HL6A 1B1CA 1O6ZA 3W2FA 4Z2AA 1C8KA 1FNCA 1WXEA 3EQ9A 3BK2A 3ZIDA 4A2QA 1AUOA 3L0YA 3TG2A 2J9XB 4PYRA 3K70D 2QTLA 1JDUA 4EFMA 3VZQA 3A6PC 2EKPA 4KQWA 3R3ZA 2XMPA 1X9GA 2VDLB 3R76A 3MQ2A 4DOMA 4YP0A 4Q3DA 4A5OA 4LY6A 1VL5A 2YHIA 4EABA 4BXOA 1DQPA 3CR3C 5JE8A 2O8DB 4DSTA 1SXJA 2C8JA 3F90A 1KAEA 1ZEJA 2AEFA 1ZI9A 2G17A 3FM9A 1QVRA 4X6YA 1WPGA 3FTPA 4JZYA 1NBEA 4Y9SA 5E9QA 3OP1A 1XNRB 4MV6A 3AETA 3K8OE 4AVYA 1DOHA 2PVCA 1TF5A 1M1ZA 3EZ2A 1KOFA 4I4LA 4NBRA 3PEWA 2BMVA 1X94A 1TYZA 3EFEA 3IOBA 1JXMA 1PG5A 5H59A 3I2IA 4TKVA 3VNSA 4QT0A 3AL0C 3R6WA 1LNZA 1Y3CE 2XAAA 3F5MA 1NNUA 1HDEA 4Q4AB 4OL9A 3PC4A 3DAOA 5BUSA 3GXOA 2QL7A 1EFLA 1X9HA 1YQEA 3IPAA 2A14A 1USWA 2VQFB 3SNKA 2FR8A 1ESZA 1K0UA 1X8XA 2I87A 2PMBA 1FOEB 1FJHA 2DKNA 2PPLA 3BGWA 3DA8A 3NBMA 5BN4A 3TL2A 3KXDA 4WBNF 3OKFA 2FQYA 4FGZA 2G9RA 2FPGA 1Q0SA 5JCPA 2C00A 3NOOA 5L3SB 1GILA 2HRDA 4QJ3A 3EY4A 5F98A 1PK8A 1PTJA 1P6XA 4WADA 1UZMA 2Z57A 1T0BA 4P34A 3DZJA 1RADA 4RGYA 2I7CA 5IAGA 3W2GA 2PZAA 2PGOA 3ZE7A 3I61A 1HL3A 1WMDA 1FU8A 3KYCA 2A9FA 3NYQA 4HRAA 3CR8A 4RIFA 3U3XA 1NVTA 2R3SA 4CMHA 4CF6A 1EESA 4GOKA 2BV3A 2IUFA 5IP5A 4N9WA 4JZKA 4JOSA 2DHQA 2PX5A 4NI5A 1NU8A 4M87A 5KOHA 5AVUA 1KYIA 3WRYA 1USVA 1F0NA 1W34A 2PAFA 3T61A 1FU7A 2EOAA 1SUFA 2RHHA 3INTA 2UZAA 4B4OA 2IW3A 2POCA 2QE7A 2FPPB 4N5LA 4ZMRA 3UJHA 2QSUA 4AMGA 2RONA 1JAYA 3WNVA 4PR3A 1FP1D 1K92A 2PKCA 2R4TA 3QRWA 5FA8A 2DHEA 3N75A 3VYTB 1VB5A 4J03A 5E6SA 4A73A 4MGHA 3A4MA 5FLYA 3OTHA 2EFJA 3C3AA 1X3LA 1YQUA 3FOBA 4H1VA 5J2TB 1G6Q1 1W29A 4K6FA 3TDKA 4Y18A 3C2QA 5HFNA 1FNMA 3VR0A 1CF2O 5A9RA 3TG8A 1DBIA 4RFSA 4ZPJA 3R7WB 2F3TA 2DG2A 4B31A 4EX6A 3DZ8A 3RVMA 4O2BB 3OBBA 4ZV9A 1NDQA 3SS7X 3KZMA 3NAMA 3EEYA 5FPQA 1GA6A 4TYNA 4DIEA 3NVDA 4A0SA 1LRJA 4FJ1A 2BEJA 5FO1A 4L8FA 3IQDB 2H0RA 3ROFA 3E9ZA 2QDKA 3I9V6 2ODPA 2JEYA 4OY3A 1Z7GA 1GU7A 3F8WA 3O8OA 3ZUGA 3DF7A 1WD7A 3CVJA 3IUYA 5C8DA 3LLUA 3ZDBA 3CXUA 3FVRA 1KVSA 1MJ5A 4M9XA 3K05A 4ZOAA 1K2VN 3IBGA 1ZXXA 2Q4OA 4WBSA 5DYTA 1N5KA 6YASA 3DHNA 4ZXFA 3N2GB 2OC9A 4RMNA 2GBFA 1EEHA 4BYMA 5DCUA 4HMQA 1WM1A 1P7WA 1SUWA 2PSEA 1CZUA 3OCUA 4G65A 1OI4A 4DSUA 1NP3A 1NBIA 4ETNA 4YAFA 1QLJA 2VAPA 1LDBA 3ITKA 3BGOS 1JTEA 3MLAA 4RV4A 5HJ2A 3RG8A 2IXAA 2J7KA 4HUJA 2WU1A 1OAOC 5EUBA 2UYGA 3P9NA 4KOAA 4QDJA 1C7EA 1D1SA 1TM3E 2O0HA 1Y5MA 4OL0A 4WHMA 2QTRA 3STXA 1QIJA 2WSMA 5TT0A 3C3PA 4XX1A 1RYMA 3SAJA 2AX3A 2I2DA 3IQHX 1BMFA 4CMEC 3BFVA 1KOGA 1P2VA 3RR2A 3A14A 1R6VA 1YDFA 3S1LA 4ROSA 4RKRA 4HWSA 2W6OA 3O8LA 1UBGA 2I1WA 4FYVA 3WFJA 5BR4A 1YS4A 2QTTA 5E7MA 3RASA 4QDKA 4WINA 2YIDA 3ZKWB 2ZAIA 4Q3BA 3A3OA 1UODA 1P5RA 1KI4A 5DKFA 5I47A 5ALHA 1I01A 3C5VA 2OHJA 4MV1A 5DCLA 2LCIA 1XHLA 2JGDB 4ME6A 4C7MA 1EYZA 2BEUA 3KT6A 4ZK2A 3PA6A 1R0CA 1FA9A 1VI5A 1QTIA 3INNA 4HQOA 4F4FA 5F23A 4RTRA 1LCIA 2EWWA 3MSXA 5ALMA 1EGQA 4N0QA 1XMQB 2BDEA 2P90A 3C7DB 2WIBA 3REFA 3CPHA 4AQDA 4QEKA 1PJAA 1N2OA 4L74A 5K2MA 3AHIA 3IJRA 4BZXA 3G1UA 1XTPA 2G76A 5K8JB 3BJIC 1BOOA 5CYGA 3LIPA 5ABPA 3SIWA 3FZGA 3OPMA 1YB5A 5EJ9A 1NLUA 3D6MA 4WNIA 5D2CA 1TMYA 5IEJA 1RW4A 4FINA 2WYVA 1TVKA 4ZALA 4AX8A 5JAMA 1GLVA 1D1TA 2KMLA 1NYLA 2IE0A 3IALA 5F3WB 5F5XA 4DWWA 5T7BA 2V7PA 3GH3A 4IJQA 2RAUA 4K9PA 4U7PB 2ZU0C 4JC4A 2AYXA 3W6OA 4EB6A 4NSNA 3KWLA 4CT4B 5C18A 4GVXA 2ZSUA 2E7ZA 3EIEA 3GARA 2IW1A 5I4CA 3LBYA 1OB5A 3K9FC 1XRLA 1UINA 2OCLA 1XT6A 2GD6A 3GYBA 3I09A 5JSKA 2IUTA 4PTYA 3RJZA 3GL9A 2HA2A 3PEUA 3QJYA 3ECCA 1R8QA 4BS9A 4EHJA 1Y5RA 4F4IA 5CDFA 3KXPA 4G07A 1CCWA 3E9MA 1ISRA 2QQ0A 4P2GA 4LJKA 2QN9A 1VG9B 4CTKA 2V7QD 3MC1A 1XZKA 3U3OA 4DSNA 1AGNA 2R1VB 1J2YA 2WLTA 1BQ4A 1W49A 3CS3A 3DXZA 3H19A 4FVTA 3D6TB 3AR6A 2N0SA 4MPDA 4PLWA 4YJHB 1JTFA 2C4WA 4EGSA 3CVWA 4B6EA 3VU9B 2BI8A 3SXPA 3KQOA 1XQ9A 4KW7A 2OBXA 5M3BA 2JKVA 1VGVA 2NO7A 1KEUA 4FZ5A 3L0IB 1ZA2A 1OC2A 3DDNA 4DUZB 4HFMA 1BHQ1 1XVUA 1R5NA 1ZJ4A 1WDKA 2V6MA 2XMBA 2CLCX 4E3ZA 3BXZA 1VCNA 4DKJA 4BWVA 3IWCB 3EZYA 2ZT5A 3BUSA 5BW6B 4YIHA 3ZJ4A 4RABA 3VZRA 1P91A 1IUOA 2PH7A 3E7FA 4EB0A 1NI3A 1X7YB 2P9ZA 2WE7A 3F3SA 5E1OA 1N6PA 4L4UA 3EOAI 4N49A 4PC6A 1RT9A 2B5VA 1OLUA 2XITA 3F6CA 3T9DA 1TM4E 2GPJA 5EVJA 1Y81A 1YCHA 4FFBB 3V7FA 2CL7X 1AXGA 1UCFA 1RLOA 5MN5A 2G1UA 5SY4A 1KPGA 3KEQA 1AZSC 3BMNA 4M21A 4ZQBA 4CHTA 1ECGA 3BWBA 3IUPA 3WIUA 3OPXA 2XMZA 1OFUA 3HYNA 2JI8A 4DQDA 1OFUX 4D6YA 4KL8S 1T9DA 4JJ7A 5D3MA 3N2KA 1FTNA 1LVGA 2C5AA 1J1IA 5KKAA 3ZGXA 1CVIA 1XCJA 5EXXA 4Q19A 3A9CA 4G6ZA 1I2AA 1P7VA 1P4GA 1PT9A 1TMOA 1ZK0A 2FF7A 2GPAA 3DP9A 3GLVA 3I73A 2NUBA 4TKUB 4QGSA 1QKJA 2Y4NA 3BMQB 3QUBA 3GA7A 3F4LA 1J0BA 3L18A 1TKRA 3TD2A 1TF7A 5KBYA 4BB5A 3NVAA 5JAOA 2GAAA 1PP4A 3V34A 3C3DA 1R5OA 3TBHA 4GP9A 5CA0B 1Z29A 3TW0A 1Q91A 1Z83A 1ETUA 5CK4A 3G13A 3QPVA 3DV0B 3V9PA 3UJBA 4ZT4A 2C83A 2EEPA 3N2YA 4E7OA 3DGEC 5L7YA 3W04A 4EMBA 1XAGA 1DUIA 4JJIA 4BE4A 3STWA 5EIFA 5JXWA 2FQQA 3OUUA 4TRNA 3GAZA 4MUFA 3ZW9A 4OG2A 1OIVA 1DPGA 2N75A 3NALA 3OEHA 1BU5A 1BIFA 5FPSA 1JJFA 3VU8A 4XWWA 4II2A 3H87A 2KE5A 3QELB 1SQ5A 3TBFA 2KBEA 5HSGA 4C3VA 3AVOA 3ET4A 4M9ZA 1ZDMA 2VBGA 2HUPA 3B7WA 4PR0A 3I6BA 1PO7A 2WM8A 1RLTA 5AO9A 5F78A 2B99A 2B4RO 3IMEA 3LUGA 3D7MA 1RWQA 1RXEA 3BWVA 3FZQA 4R1SA 4CG0A 3L49A 2XT6A 1GG2A 4K40A 3VTZA 1NDHA 5KPJA 3O3MB 1EMDA 1TA4A 2G77B 5IC4A 5B1IA 4RGVA 4UUPA 1X7ZA 2P2ZA 1K98A 3Q7EA 3SEZA 3VYUB 4CM3A 4NZNA 1DX6A 3UYKA 3TQFA 2OORA 2JA1A 1DT5A 1FYWA 3FLEA 4EG4A 5F2NA 4IQ0A 3TZQA 1CB7A 1J0XO 2AFHE 3COZA 3HCDA 3KO8A 2O8EA 1GAXA 1L4MA 1HEIA 4H15A 2W4QA 4G36A 1P7YA 4JI1B 4GRIA 4X9XA 1XD9A 4MICA 2R5FA 2Z2JA 4RKQA 4IH4A 5C8XA 5IH7A 1SXJC 3AHJA 4JS0A 4L76A 4Y67A 2REQA 4AMUA 4B6JA 1PBTA 3CE9A 5ER9A 3WGJA 1Y7TA 7REQB 4EJ2A 3H5TA 5DK6A 5J4KA 4KTTE 5J1SB 5AKKA 1B8OA 1VE9A 1DUSA 2E4ZA 1VIDA 2ZUWA 4OFXA 4EGCB 1EFHA 4O89A 2JGKA 3UWPA 1L6IA 1XLWA 5T3UA 5JTTA 5IT9A 1G20B 1VRVA 2D1YA 4HMPA 3ES9A 1JKJA 4RE5A 1ZNZA 2AJBA 3H2GA 1KVTA 3EZ7A 1MJNA 1L4FA 2PWBA 4S0XA 3RSCA 4DB4A 1GZSA 5ALZA 3TWOA 4BU1A 3BWEA 1TUBB 4UBLA 7ABPA 3SN6A 2HDNB 2HA5A 1JB1A 1ACMA 1REQB 2PXCA 4BLOA 2R8EA 1U0GA 2X1VA 1RHMA 3N6XA 5CX4A 4YUVA 4NJEA 1N5IA 3ELBA 3WYFA 4XLLA 4LOIA 2SCUA 3K09A 4M1TA 3EPRA 1KDTA 3M6FA 3ETEA 1XZLA 1ZITA 1MIOA 1UXHA 1ZK3A 5FWAA 1PNOA 3CRMA 4ZJPA 4O4HF 5K7SA 5KWEA 1JF8A 1B0PA 2WT9A 1UDWA 2RJOA 3NM4A 1PD0A 2VUHB 2ZSKA 3FN4A 4FR2A 4I1VA 5DLEA 3E81A 3KKQA 1H2EA 3T15A 1JQEA 5JNRA 4S3MA 3H0VB 2X0EA 5LKRA 2IGBA 1BXRB 2OZVA 4M1MA 2CV1A 1LF5A 1PHPA 2WU3A 3FUCA 3V1TC 4HS4A 4UDOA 4JIGA 3ZJVA 1J33A 1BH2A 1DPFA 1Q74A 2WA1A 4ZN6A 4QXMA 3NWEA 1GG5A 1RKQA 1NSTA 4HBZA 4ZHQA 3I2GA 2P9CA 1HI9A 2AG6A 3I9FA 2OHVA 4A9AA 2J41A 1N7HA 1P1HA 1T1GA 3HHPA 4HRVA 3T5AA 1ID1A 3N2IA 4R0NA 3NHSA 2B1IA 3OCYA 4RK7A 1FNBA 4ITVA 3B85A 1NKSA 5B55A 1DCTA 3PE4A 3R8CA 4B6QA 1WS6A 3BE6A 1LRLA 3OFND 1DQYA 2WYUA 3H1EA 5DTQA 4YUXA 3ETCA 4OF4A 4IVRA 3LT0A 3RIHA 3O9ZA 1UXJA 3I5XA 1IM2A 3P9ZA 5DM4A 3E03A 5ARCA 4L07A 1SB8A 4EBFA 2QG6A 3ZKAA 5I7SA 3EW7A 1V5GA 4BO2A 2ZIVB 2XUIA 1GU1A 1WU8A 4C14A 1PUXA 1VE5A 3RKSA 2FR0A 3E9YA 3PYLA 2X23A 4H0NA 3DAYA 5BW5A 3N2LA 3B5IA 3KZOA 1PS8A 2AK2A 5ALQA 1MDFA 3TRFA 1YVPA 2RD2A 3KUCA 1Q7CA 3I6QA 3WYNA 1V2GA 3FPLA 3OU7A 1N5JA 4KC0A 3V80A 4HQLA 1SXPA 1DAOA 4K6OA 4CNBA 1Y6ZA 4Q1CA 1A9YA 4PO9A 2Y4OA 4W9RA 5CGZA 5FOSA 3J81k 4DSZA 1TZBA 5FBLB 2BMWA 5KVCA 3IP1A 5KTMA 4MLZA 1EJ0A 4QC2A 2OV8A 1Z6YA 4YRNA 3N5CA 1IEVA 1VLMA 4QDXA 1PGOA 3L46A 3GMDA 3KQUA 4HX5A 2BOVA 5MN4A 1U0NA 3EQ8A 2O6HA 1XWFA 1SBIA 2ZJOA 4MPJA 3QX7A 5H68A 4F3TA 3QKUA 3LO8A 3KQPA 1DP4A 3ZHZA 4QG7A 4IMIB 5LDGA 1P9LA 3GVPA 3KPWA 5AQ1A 3EZNA 1P17A 4NBUA 3Q41A 4AP5A 3DBHA 4C6SA 2OENG 1V1MA 2MTBA 4CQMD 3NNDA 1II0A 3ZE2B 2IY9A 2C2KA 2NZYA 4JGGA 3FDFA 3QLUC 3LKZA 4OIFA 1FSZA 1ZHOA 1GG8A 5CG2A 3FOWA 3JQAA 1KMNA 1MENA 4UBMA 4IINA 1QH1B 1HYHA 3FIJA 4KHZA 2OFPA 3IEKA 3OPYI 1CUIA 1EE2A 3A6HA 4PS0A 5CH5A 5COAA 4AZVA 2TMKA 1NPDA 4PXAA 4YUZA 1BHO1 1OBVA 3V33A 1NAIA 3GRPA 2L19A 2XNSA 3PJGA 3FIUA 2EJCA 2VS1A 1S7GA 1EFUA 1ZJZA 4RSGA 3AH8A 3CLHA 4EB3A 2FWBA 4MA5A 2I54A 2L42A 3D2CA 4JB2A 3VR4H 4BZZA 3KSBC 4DV7B 2ATIA 2OAQ1 3EOZA 3NX4A 4K9QA 2OFOA 4B83A 3F6PA 3KT8A 3D1LA 2GR9A 4N54A 1PT7A 2Z0MA 1ZGBA 2G8LA 2ONZA 1H9CA 4LZNA 5HS6A 1GFSA 1B73A 3HO8A 4JLJA 2X7XA 1VI2A 3DC7A 4LTDA 3IGFA 1X7GA 2NQ2C 3W6ZA 4F5WA 2EKBA 1KZ9A 2K5UA 1GADO 3AF0A 4LDJA 2FWAA 3Q0IA 4MWZA 3C48A 3V1YA 2QE7D 2WWRA 4J6EA 5CH3A 2A4MA 2H9AA 3A7EA 3O9VA 4NH0A 5AQEA 1N1MA 1VL6A 1YS6A 4L57A 2B5OA 3PNMA 4IWXA 2IEIA 2HSDA 3GEGA 4DQXA 2C7PA 3WLAA 2J08A 3G0HA 2R97A 4AYXA 3QG5A 3MCWA 2JAPA 2OPBA 1JT2A 3KR0A 1FDRA 1YHZA 5AKIA 1Y6FA 4LQDA 1DAIA 4RAQA 1SUIA 3U3KA 1JFVA 4CTJA 4HXGA 4ER0A 4LYAA 4BEBA 4AQ7A 1MP0A 3AVTA 1E2BA 3W6UA 4OJNA 3JQDA 5C35A 3AZQA 4HLUC 2QZ9A 1E9SA 2N42A 3BRCA 4DIOA 2IHZA 1UBEA 3VMFA 2RGXA 2HBQA 1LS6A 5JS7A 3LUBA 4JUIA 2YS7A 4UE2A 3NEPX 5EMNA 3KOXA 4GI5A 1FFEA 5JD4A 1G4AE 1ZHHA 2G5PA 3L02A 4PYIA 5CJPA 3W2IA 1RAIA 1ITZA 1RXUA 4DNQA 1DEHA 1EM8B 3AJAA 2NO0A 3D4LA 2NV0A 3C43A 3KJHA