1LC0A

Structure of biliverdin reductase and the enzyme-nadh complex
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
290
structure length
290
Chain Sequence
MITNSGKFGVVVVGVGRAGSVRLRDLKDPRSAAFLNLIGFVSRRELGSLDEVRQISLEDALRSQEIDVAYICSESSSHEDYIRQFLQAGKHVLVEYPMTLSFAAAQELWELAAQKGRVLHEEHVELLMEEFEFLRREVLGKELLKGSLRFTASPLEEERFGFPAFSGISRLTWLVSLFGELSLISATLEERKEDQYMKMTVQLETQNKGLLSWIEEKGPGLKRNRYVNFQFTSGSLEEVPSVGVNKNIFLKDQDIFVQKLLDQVSAEDLAAEKKRIMHCLGLASDIQKLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Biliverdin Reductase A
publication title Crystal structure of a biliverdin IXalpha reductase enzyme-cofactor complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
total genus 94
structure length 290
sequence length 290
ec nomenclature ec 1.3.1.24: Biliverdin reductase.
pdb deposition date 2002-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF09166 Biliv-reduc_cat Biliverdin reductase, catalytic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1lc0A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lc0A01
3NJ8A 2DU8A 4DRYA 7MDHA 5CG2A 4JROA 4E13A 3HWRA 3QRWA 3DBRA 1GU7A 2Z5LA 5IJZA 2WYVA 2E48A 3DWFA 3IUSA 4CLRA 2GDZA 2GN4A 3AUTA 3VPFA 3WOHA 2YDXA 3LDHA 1PWXA 1EK6A 1R4MA 2NWQA 3E8XA 4OQYA 1PGPA 4DXHA 1NQTA 1QR6A 2A94A 3MJSA 3DZHA 1YDWA 4WLVA 1PJTA 2OOSA 3ANNA 2X86A 3JQ8A 4WJZA 2IE0A 1R6DA 5JBIA 1E1KA 2B83A 2C2YA 3TPCA 1K6XA 2D1YA 3I9JA 2JD2A 1K3TA 5ES3A 3GLQA 4P4LA 2VHYA 4TKLA 4IXWA 1Y5RA 3BTOA 4HFJA 4E5YA 5L4LA 5B37A 4AJEA 2UV8A 3GEMA 5T8KA 3ZWYA 1GDHA 1KY4A 3OP4A 2O2SA 1XR3A 4YT4A 5JDIC 1BGVA 5CPBA 3SEFA 1JTVA 4PLVA 4XR4A 3PFFA 3TFQA 2DLDA 3MTGA 1E7WA 1KY5A 4K1LA 4YAEA 1NHWA 2EKLA 4ZRNA 5TT0A 3MEQA 4A27A 2HQ1A 3IIEA 5G4LA 1CIVA 3F6YA 3BMOB 1KC3A 3L6OO 2B4QA 2CFCA 1I3NA 5ICMA 4QSMA 4TROA 3WICA 4DGSA 3PQDA 3GUYA 3S2FA 4GBJA 4LSWA 3VTZA 1U2GA 4M8SA 5JY1A 3VHRA 1RM4A 5AXCA 3ZWCA 5I7EA 2XXBA 3D1LA 3C7AA 3G79A 3ONDA 3TZHA 2WDZA 5F1KA 3FHLA 1HLPA 4Z0PA 4JBIA 1D7OA 4CLHA 3FNEA 4CM4A 1OFGA 1EBFA 1PJ4A 4RL6A 1I5RA 4KWHA 1XEAA 3CEAA 3WSVA 4M54A 4RO0A 4UUOA 3HUDA 3GZNB 1SO8A 4YYZA 4IDDA 1GYRA 1OMOA 3JYLA 4OAQA 3WJAA 1PL6A 1Y8RA 3L6DA 1R66A 1J0XO 1HEUA 2DBZA 5JY6A 2JAPA 1R4NA 3WX0A 1PGNA 2Y1GA 3PJGA 3EGOA 3OMLA 3NDRA 5CHEA 3BHIA 3QE3A 4YAJA 1ENPA 4RCVA 4B7UA 5CDTA 2AQ8A 1IY8A 2QQ5A 1RKXA 4RPKA 4DC1A 1O94A 3QVOA 1B7GO 3GG2A 4PIVA 4EJ0A 1EE2A 5I8ZA 5DOVA 3ASUA 1P0CA 3RSHA 3H9EO 4KTVE 4EUFA 3I6IA 1NR1A 5THQA 3GK3A 4CM8B 5CPFA 2EIHA 2I3AA 5A4DA 4CMAA 4WLOA 3TL2A 5JAQA 1YQXA 1HDGO 2X5OA 4P22A 1CQJA 4YPOA 3NTOA 2C54A 3JQFC 1IPEA 2X5JO 4TMFA 1LEHA 4U0KA 1P3DA 3VPHA 4YAKA 1PQPA 3P19A 3D0OA 1HXHA 1AHHA 3JQCA 4ZQEA 4KOAA 2EP7A 3H9QA 4L4SA 1UUFA 2BFPA 4CM5A 3BHMA 3U9LA 3SC4A 3INRA 3MWEB 2CF5A 5KJFA 4ILKA 4DQXA 1NQ5A 1K0UA 4BNKA 1N1EA 2QRKA 4B7XA 1CRWG 4NI5A 2GRAA 3OJ0A 1FDUA 2VYVA 2VTDA 4U7WA 2RHRA 5KVCA 3FTPA 2EP5A 2RCYA 3SBOA 1H6DA 2CZCA 3RC7A 1PGQA 3IP1A 4E6PA 1Q0LA 3ZU4A 2C29D 2IXBA 3W6UA 5IXSA 1YB5A 4L73A 4NJOA 1E3JA 2PZLA 3FTNA 1IB6A 4R01A 3MZ0A 4OJNA 3F47A 5FI5A 1WMBA 2JFGA 1I3MA 3PRJA 3ZNNA 2PA3A 3K6JA 3DBHA 5JNLA 3W1VA 1ZMOA 1X7GA 5TRTA 1LQUA 1NVMB 1NQAO 1ZFNA 3LLVA 4ESOA 1HYEA 4L76A 4Y67A 2GPTA 3DL2A 3ZWWA 1F06A 1U4OA 3VTFA 1JA9A 1PZEA 4DLBA 5K9ZA 2YV2A 4RDIA 3NKLA 2UDPA 4HFRA 3O4RA 3JQFA 4MIEA 4BNFA 2HJRA 2A9FA 4G2NA 1PR9A 4PVCA 4QXMA 2WTBA 3T7CA 5A3JA 1QYVA 5HRUA 3KEOA 3A4VA 1BRMA 3K96A 2GSDA 1UP7A 2GERA 3IOYA 4FIZA 1QG6A 4HFNA 4P4NA 5FI3A 3ZNOA 4YT8A 4E2YA 5JAMA 1UXHA 4CLEA 2FR1A 3ZWAA 2O4UX 3VC7A 2DUUA 2RIRA 2X23A 1XQ1A 2J6IA 4XGKA 2X0NA 5DNAA 2JL1A 2WYWA 4IGFA 3TZ6A 4H3VA 3Q9NA 5H82A 1XU9A 1BW9B 3C7DB 4CUJA 1PWZA 4PLFA 5JMPA 4R16A 4OOEA 1LA2A 4BO1A 4J49A 1T4BA 1ZXBA 3OQ1A 4W7HA 1RM3A 1JN0A 2VCYA 4FFOA 4FJ0A 1UXIA 4XQCA 4BNHA 1D8AA 1Y1PA 2C20A 2E82A 3VZRA 3OSUA 4ONEA 3WSWA 2F00A 2AQIA 1LRJA 2VHWA 3H9JA 8ADHA 1BXZA 2H6EA 5BSGA 3RIHA 1SNYA 1WZEA 2HMTA 3ZU3A 2GZ2A 4TRNA 4YJDA 3NRCA 5KKAA 1D3AA 4KZPA 1H6BA 2IYOA 1ZJYA 4CM9A 3KYCB 5CAEA 4J4BA 1LSSA 5DBGA 1LBEA 3GUCA 5FF9A 2IZZA 3OIDA 2NUAA 3UFXA 1ONOA 2CD9A 4OM8A 3JYOA 5L51A 2Q4EA 2HK8A 3DBLA 5EL0A 4IINA 5TNXA 4DA9A 2E6UX 4BVAA 2WWRA 3WWYA 5DZSA 3WYEA 3OHSX 3UW3A 1HDZA 2JFFA 3OEYA 1O9BA 1GEEA 3JD4A 3S2GA 4CL3A 1LX6A 5TS3A 1DIBA 2PFGA 4EI2A 4DUPA 2G17A 2R6JA 2Y1CA 3AFNA 5KJ1A 5TT1A 4YJGA 5IF3A 3MJEA 3VKUA 3HB4X 1LTHR 1K6JA 5HS6A 2EJWA 3BIOA 3JD2A 3GN2A 2CDCA 1W6UA 1ZSNA 2ZB8A 2PH3A 3LU1A 1HT0A 3R3SA 5G0WA 3PHGA 4Q39A 1O6ZA 1HZZA 3U4DA 4MP6A 3PWSA 3I6QA 2OBNA 4DQVA 3U3XA 1EZ4A 4XGIA 1A5ZA 4R4JA 1UAYA 1WDKA 1YBVA 5JO9A 4TVOA 1XIVA 4W4TA 3DONA 4BGUA 3ETGA 4DC0A 1B8VA 1V3VA 2WSBA 1O5IA 2WMDA 2AQKA 4IDBA 1FXSA 3KUXA 4XJTA 3RJ5A 1UJMA 4RF3A 4KQWA 1Z73A 3JQBC 4XRRA 3X2FA 1GQQA 2VUUA 4M55A 3ASVA 3I52A 2W90A 3FR8A 1C1XA 4BNXA 2F1KA 3ZU2A 4JIGA 1LDYA 1SAYA 2HCTA 2FWMX 2D0IA 5B12A 3PJDA 2PWZA 1K6IA 2BGMA 2FR0A 4WCFA 2PZJA 3GGGA 5JE8A 2J3HA 2NADA 4AG3A 4KDEA 4O6VA 3BAZA 2CDAA 5ITVA 4B4UA 4CLOA 2EXXA 3JQ7A 3LSYA 1T26A 4IQ8A 1ORRA 4MKRA 3AI1A 5L9AA 1M6WA 1X13A 4E5NA 4NG5A 4IMPA 4BKOA 5BNTA 2FSVA 2X0JA 1UDCA 4BNVA 4IY1A 1LU9A 2GZ1A 1R15A 3R0IA 3RROA 3UF0A 2DC1A 4CQLB 4WOKA 2ZTVA 3KEQA 4OKIA 3ZHZA 3WMXA 2EKPA 2D2IA 1E5QA 5JC8A 1ADGA 5IZCC 4DIFA 1M6HA 4R68A 3UOGA 1DXYA 2YFHA 5DULA 4IQ0A 3JD3A 3OJEA 4J90A 1K89A 2EV9A 2DPGA 1DJQA 1ZNQO 1LNQA 3PDUA 3UH1A 1V3UA 1PSDA 4JX8A 1R0LA 4CV3A 4RVSA 4JP3A 4Y9DA 2Q22A 2D5CA 1BHSA 3IDSA 4GI2A 2HDHA 4RZIA 3JQBA 1DAPA 4LRTB 4RQTA 2WE7A 2DKNA 4YDRA 1W73A 4GQAA 4FPXA 1CDOA 5LDHA 2CF6A 3OBBA 1NX6A 3ROKA 3FR7A 1ONPA 2QIOA 3COSA 5K6AA 2E4AA 3DHYA 2EGHA 2Y1EA 5F3RA 1MG5A 4XX0A 4D0SA 4YT5A 3RQSA 3WIEA 4AVYA 3AOEA 4B3IA 1YQDA 4MIYA 1P74A 2JHGA 4Y6SA 3U49A 4EEXA 2IYPA 4GX1A 3EY4A 4GH5A 5F1PA 3RUDA 3GH3A 3HN7A 3PXXA 1U2DA 4BNLA 1GQYA 4EDFA 3DBLB 1YH3A 5H81A 3B1KA 1K2WA 3TZQA 3GHYA 4XRGA 1MFPA 2EHDA 3OH8A 5BT9A 3VKVA 4GWKA 4HUJA 1CF2O 1UXJA 3F4BA 4DMLA 2QG4A 3HFSA 2IZ1A 3PLNA 4BGVA 1DFIA 1GQ2A 4K6CA 1NASA 1UR5A 1W0CA 4FOOA 4I8XA 5IZCA 3V5NA 1DIGA 1KVQA 2O3SA 2HMUA 4BQRA 4RGBA 1ARZA 5KJ6A 5G2OA 1CEQA 2YZ7A 1XHLA 2NVBA 3WLFA 2QYTA 4FR5A 1AXGA 3JV7A 2GCGA 4AFNA 3UAGA 5LCXA 5A9SA 2ZYGA 1VKNA 3RUIA 2X58A 1PIWA 3FPCA 4HNGA 4ZU3A 3HADA 1OC4A 4WEOA 4BIIA 1PJCA 1J4AA 3L77A 1ADFA 2QYSA 1EUCA 4FCCA 1TT5A 4QTZA 2H1SA 4KTTE 1I2CA 5CDSA 4CV0A 4Q3NA 1ISIA 4MKXA 3WGZA 1JAYA 2DBRA 3C3XA 3QWIA 1I3KA 3NTQA 3G1TA 3O8QA 5DDIP 4XYMA 2B37A 4LN1A 4XDZA 4H7PA 1GPDG 5LC1A 3KSZO 3KHUA 2ZCUA 3GNQA 4ND1A 4CMJA 1IUKA 1KEWA 2V6FA 4IDAA 1I8TA 4AJOA 3TZCA 1SOWA 1A72A 1MB4A 4MVJI 2Q1WA 4W6ZA 1GCUA 1W4ZA 1Z74A 1B16A 4UEOA 2AG5A 4MDHA 1GL3A 4UEJA 1WAMA 1NFFA 3HFGA 4J1QA 2PH5A 3JQDA 1MC4A 1E6UA 3S2IA 1A4IA 1U3TA 4RPJA 4XQ9A 4ROSA 1Y5MA 4WCFB 3LF1A 3CXRA 2FY8A 2EGGA 4DLLA 3FCOA 1C1DA 2VRCA 2GASA 2C59A 4BO8A 1DDOA 1JKJA 3DZGA 3KBOA 2HLPA 3A1NA 3JQ7B 4GMGA 3UCFA 4YVFA 5TQVA 3VPSA 4AJIA 4FS3A 5C7IO 3OECA 4OSPA 1SEVA 1ZO8A 3WFIA 4NJMA 1H5QA 4YA6A 3M1AA 5CDUA 5EPOA 1ZJZA 2DBQA 4RF2A 1XA0A 3ADPA 2C0CA 2JCXA 3LT4A 1KS9A 1V3TA 4I9UA 1K5HA 4DTIA 4MVJA 2EJVA 1DAOA 5JCJA 3BTUA 1OC2A 4IPTA 3RUHA 5JYDA 3ITKA 1IHXA 1NPDA 1DIHA 1UDBA 3V1TC 3GG9A 2JHFA 3MJTA 2HRZA 3ZNPA 4BNIA 3MJ4A 1X7DA 4CQMB 1E7MA 1PJQA 3SJ7A 5G4KB 3RBZA 3FNFA 3NT4A 1HLDA 3D5QA 1U1IA 3WGQA 3GY0A 2NVUB 4BNGA 1DO8A 4O5OA 1NFRA 4ZRMA 5JC1A 2Y0CA 1MG0A 5COAA 2DUWA 3EDMA 2X9VA 5F5NA 4Q3BA 1LUAA 4CR8A 4J7XA 1D1TA 3GVCA 3NEPX 1DBVO 3QWBA 1LDGA 1H9BA 2AG8A 1I32A 3HG7A 5TIIA 4MVJG 2VZ9A 3E9NA 5TSDA 4RLHA 3GA0A 4L74A 3DB2A 3KLPX 1B8PA 5A9TA 2J8ZA 3AI2A 2AW5A 4FFLA 1O89A 2IEBA 1E6WA 4AJKA 4Q3DA 4ZN6A 4R69A 2ZKLA 4A73A 3GNSA 1MLDA 2IZ0A 5AVOA 3GOHA 2NTVA 4NNJA 3RU7A 3H65A 1ZIDA 5G0TA 1VC2A 2I3GA 3HN2A 3PIDA 1JKFA 4EGFA 1N9GA 1Y9AA 3B70A 1ID1A 4E3ZA 5CP8A 3CKYA 3LLSA 1B26A 2NU9A 4M1QA 1FF9A 2WM3A 1PGJA 4DREA 3L9WA 4IIUA 3I9NA 3IKVA 4B4OA 2JKVA 1EE9A 3HJAA 2Y93A 4CMBA 4C7JA 4PFJA 3WBBA 4QFDA 1LRLA 1VJTA 5JAZA 3OIFA 5TLSA 4QECA 5K0ZA 5DOZA 4D46A 4ZICA 1KIFA 2NM0A 2Y1OA 4PG6A 4B4WA 3E5RA 4NFHA 1P1IA 4YJHA 3ANLA 4PLYA 5TX7A 2P68A 2C82A 2C2XA 3QLJA 4DYDA 3FSRA 1FDTA 3ZI0A 1I36A 4YAGA 5ITWA 1OOEA 3TRIA 5HA5A 2O2YA 2AMFA 3I4CA 1VM6A 4YXFA 1M75A 1UP4A 3WWZA 1U3VA 1NQOA 3WGGA 3BTSA 1PJSA 1DLJA 1ZEJA 4P4GA 3OQBA 1JQBA 2NTNA 1U7HA 4BKPA 2P9GA 3O8QB 3RBVA 2VRCD 3CMCO 3CSDA 2BHLA 4NQZA 1E3WB 3EC7A 2FN7A 3RC9A 4RVUA 1TXGA 5JPIA 1F8GA 4A03A 1EUDA 3ON5A 1LDEA 4E30A 4BKRA 3WXBA 4BO6A 4U5QA 3A9WA 4N5MA 1KVUA 3RU9A 2W2LD 1DRUA 3LK7A 4ALMA 4HBGA 5U4QA 3TOXA 2Q50A 3EYWA 3BMNB 3P5SA 4L9RA 5DN9A 3ANMA 3GPDG 1NBOA 4MVJD 2OP1A 4NZ9A 1JW9B 4IJUA 4RV9A 4D41A 2W2KB 5JCJD 4PCVA 1C0LA 1C1DB 4ND4A 2V6BA 1EDZA 2W4QA 3U4IA 3G49A 4Q3AA 3CIFA 3JQGB 3QQPA 5DCUA 4A26A 5AYVA 1QLJA 1DOHA 2ZIZA 5DT9A 4OXYA 5THKA 2EG9A 1JKIA 3V2GA 2A35A 5T6BA 2WJPA 5JCXA 3PDJA 2P2SA 1E3IA 2AEFA 3R3JA 5ENDA 3P2OA 2NTJA 3PI7A 5G0UA 2O3JA 3LZ6A 4GSLA 2RH4A 3WGOA 1WZIA 4JJGA 4PLZA 5L95A 5F21A 4E5PA 1H0KA 2HK7A 2HJSA 1VPDA 4I9HA 2Q1UA 3ZV4A 3B6ZA 3JQAA 1PQWA 1BSVA 1F8FA 1MV8A 4K6FA 3NT2A 2VTEA 2J5QA 5L7WA 4RZHA 3MWDB 3ICCA 3EW7A 5AQ1A 1N1GA 3ETEA 4P38A 2NU7A 4XEHA 3QA9A 5ER6A 5JDIA 4OL9A 2XPCA 4YCAA 2D3TA 1VL0A 5JYAA 3KO8A 1GV0A 4YWJA 2OMEA 1TI7A 4FGWA 4CMEC 3WFJA 4E0BA 1BXKA 2PD3A 3U5TA 1EK5A 1P0FA 2VZ0A 3GMDA 1GEGA 5ILOA 4J16A 1HE3A 2DFVA 1B14A 3K31A 4R1UA 3WMWA 3ITDA 2HMVA 3QIVA 3PHHA 3LF2A 4GLOA 4BO2A 5AXBA 3AY6A 2I66A 3F9IA 2LDXA 3RFXA 4ALIA 1HWYA 1NPYA 2V6MA 1ULSA 3PQEA 4F46A 3Q0EA 4F3YA 2WD7B 4PRKA 4FGSA 4FOSA 3I9KA 4IXTA 4J2OA 1MXFA 1N8KA 2ZYDA 3GVHA 3ZHBA 2EKQA 4ZQBA 1EDOA 4E12A 3Q2KA 4MPDA 1QXSA 5CEFA 1RYEA 3MOGA 4LMRA 2EEZA 1VL6A 1BVRA 2E49A 3DBRB 5JO0A 1ISGA 2PGDA 2FMUA 2GYYA 3K2EA 4CLRB 4NBRA 4FW8A 3QSGA 4TQGA 1QKIA 3HZZA 3ZCXA 4WLFA 5B1YA 1R4MB 3F4LA 2B35A 5C7OO 3U09A 3TOZA 3U4HA 3PQFA 4IGEA 4YJHB 3NX4A 5AOVA 4R41A 3RUEA 4CM1A 4Z6KA 4KUGA 3UGKA 1KYQA 2XOXA 3X2EA 4A2CA 3JQ8B 4NFSA 4IZIA 1PX0A 4N5LA 4CMEA 1DRVA 3LVFO 3NJ4A 3KETA 3PHIA 4WK6A 3GAFA 5AXAA 2ZYAA 4U8GA 2HK9A 4BO0A 1SPXA 2Q45A 3L07A 2AE1A 3IAHA 4OYRA 4CV1A 4BNUA 4D3FA 1GUFA 5L7TA 4CPDA 3QY9A 2OXIA 4C7KA 2HRBA 5KKCA 1X1TA 3INTA 1EVIA 2ZB7A 6LDHA 3D3WA 3NGLA 1FDWA 4WLNA 5BNFA 1EVYA 4QQRA 1S6YA 1YBMA 1IULA 3R1IA 5ENVA 1GY8A 5KJCA 5U9CA 2JD1A 3NDJA 4BNNA 1SC6A 1PZGA 1L7DA 4ALJA 2CDBA 3A28A 2OGUA 4JBHA 3GVPA 4OH1A 2P9EA 4HADA 4RPLA 3JQAD 3KYDA 4AJ1A 3UUWA 2QX7A 2PD4A 3KSUA 3WIDA 4BS9A 1QV6A 4D43A 4RLSA 2YHUA 1Q7BA 4HXYA 4UUMA 1F0YA 2Q49A 4DLAA 1VJ0A 4GVXA 1SB8A 1WW8A 4WLEA 4ZD6A 2YHIA 5FFFA 1AHIA 2DTXA 2OUIA 4CM4B 4Q9NA 4RPHA 1T4DA 3MJVA 2YDYA 4BNZA 2Q3EA 1O8CA 1UZNA 3EVTA 3FN4A 3DDNA 1E1LA 2X8LA 3DO5A 2YJZA 4QFCA 2I65A 1AE1A 1WP4A 4RORA 3DZFA 3ENNA 2YYYA 4F6CA 2EW8A 1GYQA 1EFLA 4GPD1 2NQ8A 2ZQYA 2ZTLA 4BUCA 4PZEA 1PS8A 3VH4A 1Y8RB 4DPLA 2VWPA 3D7LA 3DZKA 2RBEA 2QRLA 8LDHA 1HYHA 1R4NB 4IJVA 3BZUA 1X0VA 5J9GA 3QVXA 3I23A 2P5UA 3OJOA 2B36A 5JDCC 2R2GA 5BSHA 3OA2A 2NV6A 4J43A 1ZKMA 4N5NA 3EHEA 4LISA 3ZV3A 1Z45A 2DTEA 2DVMA 2YQ4A 4R9SA 5C5IA 1J5PA 3N74A 2J5RA 3O03A 4CM7A 2OP0A 4WOJA 4GAEA 1ISMA 4TRRA 5JAIA 2J5KA 4C4OA 4GKBA 1EEHA 2CVZA 1WPQA 3E48A 4PVDA 3DAFA 1ZSVA 3ONEA 5KCZA 2I99A 2Y99A 4YJFA 4IQGA 5A5EA 1YVEI 2CUKA 2PGLA 4K28A 5L3ZA 1NTOA 1T2EA 1JAXA 1ULUA 1U3UA 2G5CA 4U6QA 4GGOA 3C8MA 2Q2QA 3DEYX 3DXFA 1TEHA 3JQ9C 2CNBA 1MA0A 3GEDA 3M6IA 4KWIA 4S3MA 1NM5A 1RM0A 3S1LA 1S7CA 4WASA 4CV2A 3DHEA 1DC6A 5BR7A 1GAEO 3RUCA 1CYDA 4CUZA 4J1TA 1V8BA 3L4BC 4P8RA 3EAGA 1AXEA 4E5MA 4JQCA 4ID9A 3RKUA 3E9QA 4E2WA 3PYXA 3STHA 3GRPA 2TMGA 4UVIA 3KYBA 5HBRA 3FBGA 1XG5A 1CWUA 4JJIA 3K73O 4UUPA 4UULA 3W4KA 4BV8A 2YY7A 4CLDA 2D4AA 5EN4A 4Z0HO 1CETA 1GZ4A 2PK3A 2AQHA 2BLLA 4ZQGA 4URFA 3PIIA 5JDCA 3K30A 2VNAA 1Y9EA 1TA4A 4W9NC 4N18A 1YOVA 4D3SA 3GR6A 3ZDFA 5KVVA 2H9IA 1LLCA 1H6CA 4G81A 4GLLA 4A5OA 4OHUA 4NH4A 2XF8A 1NYTA 3PEFA 3DBHB 5IG2A 4CMIA 1AGNA 1BDMA 1Y7TA 2GUGA 1DIRA 1E1MA 1ZMTA 9LDBA 1YKFA 3TFOA 4L8VA 3VPXA 2SCUA 4GX5A 4TVBA 2G1UA 5KOIA 3MTJA 3PHJA 5DCWA 4NMHA 2JJYA 3T7EA 3D3WB 2GO1A 5B4UA 3M1LA 3W8FA 1RJWA 3ZW9A 1U5AA 3KOUA 3JQ9A 3RKRA 3DOJA 1E6EA 3QJ5A 1YB4A 3SLGA 5HWSA 3P7MA 1O0SA 1FK8A 1Q7GA 3H8VA 4BGIA 1BDBA 4II3A 4U0JA 5A3VA 1QRRA 2O23A 4YAIA 3QVSA 3GT0A 3GC6A 2CMDA 2PV7A 1GFSA 3D5TA 5FEUA 1IOLA 1X15A 1I01A 1MGOA 1SCUA 3PVZA 4YRBA 4N54A 4AJLA 1Y8QA 1A27A 4XDYA 4KQXA 3NUGA 2VT3A 4BNJA 3W4JA 1G6KA 1M76A 5I7SA 3I4FA 2HUNA 1U7TA 4I9NA 1JWBB 1GCOA 1P44A 2W98A 4W9NA 3RFVA 2Q2WA 1Q7CA 4LCJA 5L45A 3GGOA 4BL5A 3L4SO 2YQ5A 4B3JA 4DWVA 3U62A 1BVUA 5CEEA 1YO6A 1P9LA 1N7HA 2Y1DA 1IZ0A 3OJLA 3RFTA 3UCXA 5KTKA 3A14A 3M2TA 5A02A 1HDRA 3ZWOA 1ENZA 2I76A 1TVEA 2O7QA 4ND2A 4DQUA 1SEPA 3WQQA 2HU2A 5TJHA 1VE9A 3FRJA 2FOIA 4QO7A 2R00C 2OHXA 1YJQA 4ZA2A 4M87A 1GADO 1P1RA 4FDAA 3MCVA 3QVWA 1TB4A 2P91A 4YT2A 4IDGA 1U3WA 4Q3CA 3R6DA 1C14A 1YRLA 1EQ2A 4NBUA 2NU8A 3ZW8A 3GF4A 2HO5A 2GR9A 3LC1O 4BHTA 3FBTA 3ZV5A 1NFQA 1F14A 4RF4A 3RI3A 4OSOA 4XIYA 5EJ2A 3UICA 3FPLA 1KEUA 1Q0HA 2P4HX 2FP4A 1ZZEA 2X9NA 3CE6A 3RJ9A 2ZCVA 3NV9A 3JCZA 4J9UE 4NU5A 5EERA 4Z9XA 3W8EA 5MDHA 1MC5A 3IL2A 3PYMA 5GMOA 3E03A 1M66A 3HSKA 4R5HA 4OXKA 1E7SA 1PJBA 4N7RA 4YJGB 5F1OA 4Z3KA 3PK0A 3DAGA 5MGBA 2O3QA 1P1JA 1QORA 3H4VA 3DAPA 3HDJA 4GVLA 4CMGA 2QZ9A 1MFZA 3OF2A 1EUZA 3RBXA 3S8MA 2JFHA 1J49A 1LSOA 2DAPA 3AY7A 3DC2A 1YDEA 3QWAA 3VVCA 4B4VA 3LQFA 3JD1A 2VHVA 1GTMA 2XAAA 4NBVA 2NNLD 2HSDA 4FC7A 2H63A 1C3VA 3CINA 2Q1TA 5AXDA 3JD0A 1NR7A 4MVJE 3F1LA 1I0ZA 4PG7A 1B3RA 4W7IA 3H9UA 3WBFA 4XQEA 1DEHA 2V7PA 4PLTA 1I24A 1YE3A 3VH1A 3HE3A 2R00A 1RM5A 4UUNA 3ROQA 1DC3A 5CFZA 2YFQA 3DBVO 1ZSYA 4GWGA 1P33A 1SMKA 1YXMA 4CODB 3VPGA 2ZTUA 4CL8A 3G1UA 1W8DA 3ZHXA 5IZ4A 2VWHA 1PR3A 1V9LA 4XCVA 1WWKA 2H5LA 2O7SA 3Q9UA 4ZGWA 1C1XB 2OORA 5FWNA 1QMGA 3BYZA 3K8ZA 5BNIA 4JK3A 1QLHA 1U8XX 1ADBA 1KOLA 3TJRA 2ZJ0A 4X54A 3RC1A 3U0BA 1X7HA 2V65A 3PWZA 4ALNA 1C0IA 2BI8A 3HDHA 3C1TA 4BO5A 1XWFA 3HHPA 4K9DA 4IDCA 3UXYA 1XSEA 1XDWA 4CLOB 2GF2A 2EWMA 2DPHA 1E7RA 1QV7A 2O3TA 1N7GA 3HNPA 3N58A 1Z6ZA 2O50A 4J0FA 4DPKA 2VRBA 4ZHSA 2DTDA 2VOEA 2W2LA 1OZAA 1T1RA 4L4RA 2DQ4A 1FDVA 3OM9A 3TL3A 2Q1SA 2FPPA 2HMWA 3BMOA 1CQIA 4W82A 4FJ1A 4QUKA 4F6LA 4XB1A 1I30A 4JN6B 1KEVA 4YRAA 2BFOA 4BMSA 3QP9A 3QV1A 3AU8A 2ET6A 1YBAA 9LDTA 3LT0A 1Y8QB 1LDMA 3E18A 3OFSA 3BMQA 4TZTA 3ZV6A 3EMKA 4XGNA 1MXHA 2C7GA 4PG8A 1Q1NA 1XLTA 4PLHA 3KVOA 4R9RA 1L7EA 4E2XA 5IDXA 2XXJA 3VOSA 4XR9A 1A4UA 2I9PA 5DP1A 1ZVMA 3GVXA 4INAA 4YRDA 2WE8A 3GFBA 5U1PA 3GAZA 2WD8A 3ZNQA 1PL7A 2O4CA 1QP8A 2CVQA 3Q6IA 5C37A 4NK4A 2A92A 2OL4A 2DFDA 1Z7EA 4XB2A 5KVSA 4Y98A 2BFMA 4NPCA 2POQX 3PWKA 4IS3A 5A06A 1PQUA 1BTOA 3G3EA 4Y8VA 5DCYA 3U4CA 1ZK0A 2AEJA 1U8FO 1ENYA 3ENKA 3E1KA 3TDKA 1YJ8A 2HAEA 4YQYA 2GN9A 3F5QA 4O59O 4J3FA 5BSEA 2RAFA 2Z1MA 4FQ8A 5C3MA 4J7UA 4MINA 1LQTA 1HF3A 2FRDA 2YW9A 4JBGA 3GPIA 3VZSA 3CMMA 3VDRA 2VYNA 1PEDA 2FPGA 4J1NA 3ADOA 4FFRA 2NACA 3D4NA 1ZUD1 3NYWA 3WTBA 2UVDA 3TWOA 1YWGO 1ML3A 2Y0DA 4HV4A 4CM8A 1VSVA 3GGPA 2IXAA 4DVJA 1PJ2A 4IDFA 3EZLA 3L6EA 1SZJG 3I3OA 3QWFA 1LLQA 4BGEA 4IZHA 4O0LA 1UXKA 3AUUA 1BMDA 3PZBA 3IUPA 5EIOA 1DIAA 2JD0A 5A9SB 2D5AA 1WNTA 2VUSA 3PP8A 3P2YA 1X0XA 1DC5A 1BWSA 3GDOA 5JFOA 6ADHA 1TT5B 1YL5A 3IKTA 4J9VA 4K26A 1LI4A 1ISHA 1KVTA 1Z75A 1QYXA 2X4GA 5KJEA 1PTJA 5JS6A 3KB6A 2BKAA 1XQ6A 3SVTA 1H6AA 5M6DA 1OBFO 1JVBA 5T67A 1E92A 3V1YA 3GRKA 4CUKA 5EINA 2FR8A 5A1TA 4O63O 2FZEA 1SB9A 3KV3O 4FD3A 1T24A 2GGSA 3CZRA 1A71A 5CDYA 3ZWNA 4QEDA 2VZ8A 4ND5A 1C0PA 4TZKA 4PGFA 4YTEA 2Y05A 3H6KA 2PR2A 3DMTC 2NSDA 2X6TA 3ORFA 2OFPA 1I33A 2UYYA 1Y81A 1XGKA 3B1JA 3AFMA 3TF5A 2JAHA 4EYEA 3D4OA 4KDFA 5COQA 1G0NA 3VDQA 1LDBA 4KMSA 4JCOA 5F5LA 1OI7A 3C24A 3IS3A 3ROPA 4HWKA 1HDYA 4JJFA 1DHTA 4IM7A 4MP3A 3MJCA 5L7YA 1QYCA 3QVTA 4RVGA 5TF4A 1Q0QA 2YV1A 1HL3A 4NJMB 3E6AA 1E3EA 1L1FA 4L4XA 4I5DA 4EUHA 3K92A 2X9GA 4PLGA 1YONA 5IXYA 1B3BA 3O9ZA 4GX0A 4LK3A 4E33A 1VKOA 4MVJF 3ICPA 1P1KA 5GZ1A 4YEDA 1B0AA 4B79A 1VJ1A 4JGBA 4ALKA 2Q4BA 1Z7BA 1GZ6A 3FD8A 5G0VA 2PKRA 4JNKA 1LSJA 3BMQB 4HKTA 4R5MA 1VRWA 5LDGA 2EERA 4PLPA 5I9LA 5L4SA 1GR0A 3FNGA 4E5KA 4PG4A 3PFWO 4A10A 4MVJH 4PRLA 4RPGA 4J4TA 4M86A 5GZ3A 4J91A 2C7VA 1B8UA 3GNTA 4RDHA 3VH2A 1BW9A 4IBOA 2AEMA 3IC5A 2VYND 1DPGA 2HMSA 2PKQO 4HX5A 3IMFA 3I5MA 1NNUA 2VWQA 3DMTA 3DOCA 1TLTA 5A05A 3W8DA 1CJCA 2VN8A 1XKQA 2ZQZA 4KUHA 4DBVO 4QT0A 5EMHA 2NVWA 2C5AA 1DFHA 1UXGA 1OAAA 5HM8A 2J3IA 1IYZA 4ALLA 1O95A 4DPMA 4UAGA 4GMFA 3CPSA 4TRJA 2GLXA 2QZZA 3PGJA 1T2CA 4Z9YA 1IL0A 3K9QO 3KYCA 1EVZA 2I67A 1H93A 4AICA 4MP8A 3KRTA 4D3DA 3Q1LA 1HKUA 1DC4A 1HSOA 4D45A 1UZMA 4D79A 1N9GB 4BO3A 2B5WA 1WVGA 3HDQA 3TZKA 4FFMA 1XU7A 2E37A 3D64A 4OOFA 2EF1A 4MIOA 1GPJA 4IDEA 3WGYA 4WNIA 2VUTA 4LVCA 2B0JA 3DR3A 3JTMA 4WKGA 5DP2A 2VT2A 3B1FA 1PL8A 4LCEA 3H3JA 1E7QA 4PN3A 2BH9A 1FDSA 2GN8A 2J3JA 4GX2A 4UREA 2RHCA 1G0OA 1LJ8A 4RJTA 1QYWA 3OEWA 2OZPA 1GUYA 3M2PA 3H5NA 2DM6A 3GEGA 3PJFA 3FF4A 4LW8A 4G5HA 4I1IA 2J3KA 3OICA 3JQ6A 1HTBA 1WMAA 4AL4A 5B4VA 4D7AA 4QO8A 4IS2A 2TMDA 3C85A 2Q2VA 4AJHA 3UN1A 3K2BA 3F3SA 3WB9A 1Y6JA 2JCVA 3E82A 2PZKA 4CR7A 3WQSB 4FFNA 3AM5A 1NP3A 3FI9A 4FBGA 1LXCA 3UCEA 1UAGA 2BGLA 2QHXA 4WCDA 5JXWA 4Y6RA 3BMCA 1EMDA 1YGYA 1VLLA 1FMCA 1R37A 4EBFA 2X7HA 5A9RA 4UEKA 3FWNA 1U28A 4MO2A 1YL7A 2Q46A 3IP3A 4G65A 4OGWA 2OBYA 4BNYA 3Q11A 1I3LA 2Y68A 3SJUA 4CMHA 3ABIA 4J2HA 4L0QA 3H2ZA 4E32A 5IFLA 4HNHA 4IIVA 4IMRA 2RH8A 1U4SA 3BXXA 3CH6A 2PTGA 3CUKA 1KETA 4BB6A 2ZATA 4NBTA 1LDNA 1IHYA 3QWHA 4WLUA 4BO9A 5JSFA 2O3RA 2B4TO 4BO7A 2WYUA 3Q2IA 1QYDA 1P31A 4NHEA 1PS0A 4ZQHA 4CQLA 2AXQA 4TSKA 1RYDA 3JQAB 5DBFA 5C7LO 5HS4A 3WYBA 4XJSA 4NDNE 1I10A 2HKIA 5ADHA 3QHAA 4J7CA 3K5PA 3DZIA 1T2FA 2X1HA 1EFKA 7ADHA 3JQEA 2UUPA 4Y6PA 1SBYA 4ZJUA 1DB3A 4FFPA 1E5LA 4R51A 4I08A 4EJ6A 1T2DA 1D4FA 3E5MA 5DBIA 1AN9A 3PZRA 3HDYA 1UH5A 5I9MA 1P45A 1JVSA 2IEDA 1H9AA 3AJRA 5T5QA 4J4HA 2Y66A 3ZWBA 4NR0A 1T25A 1XELA 3GDFA 1EQUA 4BV9A 3GMSA 5T73A 3GN1A 4IJWA 4B3HA 4LSMA 4DBZA 1JU9A 2BI7A 3ONFA 4E4YA 3ZZNA 1X14A 4EJMA 1BG6A 3AW9A 1TT7A 4PZDA 3WG9A 4OQZA 5I7FA 3ZHYA 5KIAA 4I5GA 1YQGA 1ZCJA 3RUAA 4R1SA 3F5SA 4M49A 1E0DA 5TJ9A 5T64A 1GUZA 1LLDA 2FHSA 3ZWPA 1UDAA 4OMUA 1R12A 3AM3A 4A7PA 3NT5A 4D44A 4IUYA 5J23A 1KC1A 4PLCA 1GD1O 4BNTA 1R0SA 4BMNA 1NAHA 1IZ9A 5TGDA 3H5AA 4GSKA 3WGHA 2PZMA 1NPTO 4MOWA 3W4IA 3DTYA 1A7AA 1GV1A 1GZ3A 4WCFC 3WS7A 3DZJA 4WNCA 4EEZA 3DZBA 1E3LA 2BGKA 4AJJA 1A7KA 2VYVD 1A9YA 3GQVA 4F45A 3GFGA 1VI2A 2UUOA 3E9MA 3LT1A 4XKJA 5B4TA 3BHJA 4WECA 2PGJA 3OJFA 3ZGYA 2C07A 1M67A 3NTRA 3RUFA 1PS9A 4ND3A 1YS4A 2FZWA 4TRMA 4CM3A 1CERA 1ZK2A 3WDSA 1YL6A 1NAIA 1PJ3A 4Z0TA 1F17A 5GZ6A 1N5DA 3OIGA 4II2A 2IRWA 4YB8A 3S2EA 3JSAA 4GKVA 3VAZA 4ZQFA 1KBZA 3Q3CA 1N92A 1X1EA 3RAJA 2FSSA 4WEQA 3RWBA 4DIOA 3INGA 4CJXA 1E3SA 1LSUA 5DF1A 3TQHA 1EVJA 5JW6A 2X0RA 4EZBA 1E77A 2ZB3A 1IE3A 3N7UA 2X22A 4YR9A 2B69A 1Z82A 4XQGA 4HFMA 3BMCB 2D8AA 1V35A 3C1OA 4QX6A 1VL8A 3WLEA 4CM6A 2I5PO 3SX2A 1NXQA 4GL4A 2GNAA 3VVBA 1LLUA 1FJHA 4J0EA 2PLAA 5ER9A 4OXNA 1JDJA 1MP0A 3L4BA 4CMKA 5K6AC 3KYDB 3I9LA 4YQZA 3ZU5A 2VNSA 3A06A 3CZMA 1UZLA 2CVOA 1HE4A 2NQTA 1ZK3A 2ZTMA 3G17A 3JYNA 5JYEA 4TWRA 1VSUA 2YV3A 1ADCA 4NU6A 2GN6A 1UP6A 3AOEC 1AUPA 5A03A 5JMWA 5FYDA 1ZK1A 3ZWMA 1XYGA 1ZXLA 4PLWA 2Q99A 2BRUA 4J6FA 2YHIB 5ILGA 4UVHA 1EBUA 1PZFA 4XIJA 4U6SA 3V2HA 3AU9A 1IPFA 2B4RO 2FPIA 2IODA 2Z1NA 3D3EA 3IQDB 3CTMA 1HDCA 3KXDA 4GGPA 4JXKA 3AOGA 1XCBA 3T4EA 1DFGA 4BKQA 3G0OA 1HETA 4YBZA 5H83A 1HE2A 4A0SA 4WUVA 4J1SA 4UVGA 1MUUA 3L0DA 1ZW1A 4E21A 5IN4A 4Q3EA 4B7CA 3I1JA 3OA0A 3WNVA 1NHGA 1T1SA 2EW2A 4FN4A 1GYPA 1G1AA 2VHXA 2Y1FA 1R16A 2VHZA 3EK2A 3EUWA 4CM9D 3RC2A 2ZJ1A 3ST7A 3WR5A 5G4KA 4CQMA 3NGXA 5ICSA 3AWDA 1DSSG 3DMYA 4OKNA 3BTVA 2NVUA 4I5EA 3WNQA 4WPGA 2BFAA 5BSFA 1BXGA 4BKUA 3DTTA 4NIMA 1MX3A 2QW8A 4DMMA 1SOVA 2BF7A 5I9NA 4YACA 1JLLA 1ZK4A 2CY0A 3JYQA 3PYLA 5EQFA 5IDQA 2P5YA 3TNLA 3ULKA 3W6ZA 2PY6A 2ILTA 4I5FA 3PJEA 5EQDA 3H9GA 1HRDA 3L9XA 5JLAA 2NLOA 4YJFB 3UVEA 3BA1A 4PZCA 2JCYA 4R3WA 5JYFA 3V2UA 3PPIA 4AJNA 1M2WA 3H3FA 3I9MA 3TN7A 4HY3A 1HDOA 1LRKA 1WXDA 2BD0A 2I6TA 4JLWA 1I2BA 4Z3DA 3DQPA 4BQPA 2P4QA 4R54A 2QRJA 4AJ2A 3GVIA 3FNHA 1NWHA 2DBVO 3O26A 3DHNA 4EITA 1E1NA 3JYPA 4RVDA 3WYCA 3ZWXA 5L53A 1HZJA 1KVRA 1ISFA 3WTCA 1I2ZA 1PJLA 3WGIA 3AY3A 3D4PA 2D59A 4L75A 4O1MA 1YB1A 3GZ4A 2GZ3A 2VOJA 5A5FA 3NAQA 4NBWA 2Z95A 4HP8A 3AK4A 2WEKA 1E7YA 4BMVA 1WDMA 3KM0A 4XWYA 4DIBA 2A4KA 3QW2A 3B20A 3HB5X 1D1SA 1WDLA 4D0RA 1ZEMA 3AUAA 4TKMA 4FC6A 3VZQA 1YOVB 4FJ2A 1KERA 3S55A 5HTOA 1PZHA 3HQ4O 4FB5A 3KZVA 2OO5A 1ZH8A 3T4XA 5G0SA 1DJNA 5CEJA 5IDWA 1LC0A 3OQ6A 1B15A 2YUTA 3C1AA 1NWCA 4CMIB 1P1FA 3DFUA 4UVEA 4XD2A 3C7CB 1A9ZA 1V6AA 5T57A 4EUEA 5I8WA 4MVJM 4WE3A 3LT2A 1ZBQA 4OO3A 1PGOA 3TSCA 4RVFA 4LGVA 3KLMX 1E3WA 2PKQP 3I9OA 2ZK7A 1DLIA 1Q2XA 4NFYA 4AJ4A 1LC3A 3EZYA 3AI3A 4RF5A 3UKOA 4E2ZA 4H15A 5IAAA 4R1NA 5IN5A 3V1UA 3F46A 1U9JA 4BNWA 5A04A 2PD6A 3NDIA 4M89A 4MKZA 1DHRA 2Y67A 5GY7A 1R0KA 4AJPA 4IJKA 4B8ZA 4LRSB 4DYVA 3BMNA 5KNLA 5KVQA 2V6GA 2W2KA 3V8BA 3RCBA 4KUEA 1DRWA 4BB5A 2GD1O 3GHHA 2B5VA 5CDGA 2G0TA 3JQGA 4R1TA 1PU2A 3H5RA 1KVSA 5I7VA 3PLRA 4DL9A 3VH3A 3RASA 3SXPA 1P77A 4CQMD 4XYEA 4JP2A 4OIMA 4RVHA 3ZH2A 4UVDA 2UAGA 3AUSA 4FSHA 3H2SA 3ZN2A 1T2AA 3UHAA 3EVNA 2P9CA 3PTZA 1H2BA 3H7AA 4RQUA 1C0KA 1HE5A 1ISJA 1QSGA 3RVDA 4XYGA 1RWBA 4XZ3A 1HDXA 1HYGA 4KP7A 4MJLA 5EESA 3ETDA 2DT5A 4EW6A 3GZNA 1WLYA 4H16A 3ROMA 1KEPA 2CSUA 5CG1A 1N2SA 3RD5A 3OETA 2VQ3A 3IJRA 1HSZA 1ONNA 4NK5A 5BQFA 3MOIA 3O38A 1RPNA 3PHLA 3GDGA 1H94A 4BOYA 3LYLA 3KTDA 3FWZA 4S1VA 2O3UA 3SLKA 1B2LA 1BXGB 5L40A 2BMAA 2VWGA 3SC6A 4R3NA 2G76A 3WGTA 4WGGA 4D42A 4E31A 5KWEA 1ENOA 2NU6A 5IDYA 5TC4A 4B8WA 4ZVVA 4BNMA 2O48X 2PNFA 4MVJP 3AM4A 3DFZA 2AHRA 4ITUA 4Z9FA 5L4NA 1NVTA 1J6UA 5COBA 5T8KC 3ZWVA 1NVGA 4LMPA 2X5KO 4XYBA 4XA8A 3WJ7A 1H2HA 1JWAB 1F12A 3WQRA 2C5EA 2BELA 2Y0EA 4LVUA 2AE2A 2W8ZA 3PGXA 1V0JA 2WD7A 3KSDO 3I83A 3VZPA 2LDBA 2IDZA 2G82A 3F1KA 3LC2O 2ZB4A 2X0IA 3DOOA 4XYLA 4PG5A 4CMCA 3IJPA 4CLXA 2AA3A 4W99A 3LC7O 4CR6A 4BO4A 1U5CA 1P1HA
chains in the Genus database with same CATH superfamily
2BGRA 2CE2X 3O0TA 4QIHA 3SYNA 5CBPB 7MDHA 3PNSA 5AW5A 2LTAA 2E4XA 3OQPA 3DBRA 1SWWA 1B2RA 1GU7A 2Z5LA 5EHIA 5DI3A 1ECLA 1TUIA 2II6A 4RD6A 4CLRA 2GMWA 1CJBA 3VPFA 1U2GC 3M6WA 3WOHA 1M2VA 2CHQA 2O2GA 3HNOA 2BZ0A 2NWQA 3E8XA 3FTDA 1ZOIA 3PEEA 4OQYA 3SQWA 3TH5A 2DMRA 1EK1A 2J45A 2XDQA 4DXHA 2QUBA 1T5IA 5MFPA 1HOTA 1M1YB 1W5SA 3MJSA 3DZHA 3UK1A 3AKCA 3O9MA 2AN1A 3UWPA 1FNBA 1XTSA 2AMVA 2P40A 2W8BB 4E94A 3GLHE 1ODIA 3ANNA 3HJUA 4WJZA 1W0KD 2IE0A 2EKZA 5EGNA 4ZANA 1I4OA 1T5SA 3L7KA 1L9XA 3QLTA 2C1ZA 4ESVA 1T13A 4LKOA 2JIDA 3A6EA 3MQFA 2V3WA 5ES3A 2NZJA 4Q1EA 2FSFA 3KD2A 4NE7A 4TKLA 5LXTF 1GKYA 2IXEA 3COVA 2UUCB 4BZXA 3LG2A 2YXDA 3OCWA 4JKIA 3BH6A 3LX5A 4GEKA 1GDHA 3BFVA 1XR3A 3RTAA 5JDIC 3HNRA 3GLFA 1IONA 1QC5B 5CPBA 2PLRA 5E2IA 1JTVA 3AHDA 1BH2A 1AKUA 1ZM9A 3DNFA 3PFFA 3PUZA 4PLVA 4YMVA 4BVJA 3ELDA 1E7WA 3C98A 1SBZA 1NHWA 1QRUA 3UAWA 1ECBA 2G1AA 4ZRNA 1FS4A 2R86A 4ZYYA 2EKBA 4IV5A 5TT0A 1P5JA 1EG2A 3HBJA 3WLNA 1A7UA 3OF3A 2GPNA 4FBMA 2CKMA 1MAVA 2CKDA 1UOQA 2HQ1A 3IIEA 4H1HA 4HAZA 4UE2A 3ZK7A 1VFNA 4UTPA 3BMOB 1O6GA 3SN6A 2RBGA 1CQIB 1GGNA 2JLRA 5EJAA 2V55B 4D4KA 3MM4A 2IQ5A 4QTXA 4UD2A 1RZRD 4GM1A 3U0VA 2AKYA 4MR8B 2HCRA 1D2MA 3BL8A 3LKVA 5DLQC 4ZMBA 2BFDA 1A82A 1WTAA 1SBQA 1LJUA 1X1CA 2YRFA 3NPMA 3R5HA 4LUCA 5EOVA 3WDKA 4URHA 3PNBA 4LSWA 3VTZA 4DJEC 1G2OA 1QLWA 1W4RA 3LCVB 3EEBA 3SIRA 4ASUD 2Q4DA 2W5UA 5JY1A 1JEYA 1WVIA 3ZWCA 1RJFA 4EJSB 1YBFA 5IT9A 3TZHA 2XH8A 1GAWA 1M2HA 2XEXA 5A71A 5GADl 3ZJTA 5HIIA 2B92A 2Z5GA 2ZBFA 1OFGA 2IS4A 4U1RA 1A3CA 1PJ4A 3AUKA 4PR0A 3U3OA 5AW4A 1XEAA 2G8NA 4KYTA 1JLMA 3K94A 2B61A 3CONA 2WJYA 5EKSA 4N0MA 2ZWVA 4RO0A 4FZVA 3F90A 3DFKA 3HUDA 4JU8A 1SO8A 3KP1A 4IDDA 1NMYA 3DZDA 3WJAA 2YZ2A 1P7WA 2RG1A 3AJ8A 3L6DA 1R66A 2I3BA 1BKSB 3AF3A 3AG5A 2DBZA 3HHEA 5C80A 4MCIA 3CH5A 1WXQA 1VCHA 1N5RA 3BFKA 2JAPA 2OD9A 5DNEA 4RU1A 3KTFA 4H0NA 2BW0A 2WV7A 5E3JA 1NOJA 2ZSBA 1CBUA 2ORYA 1NBAA 1GIAA 5CHEA 1GARA 4K86A 4OMCA 3BHIA 3L92A 5FUWA 5K0EA 4YAJA 1UBNA 1AK1A 1H2AS 3BREA 4FT4A 1OAOC 4IIEA 2DX7A 4XQ0A 2KB0A 2AQ8A 1OH6A 1NC3A 3K70B 2JFQA 3ZXYA 4BIMA 3LCCA 3S2SA 4DC1A 1O94A 1WB6A 5ALUA 1B7GO 3GG2A 5CMLA 2EFYA 4FW9A 3N0VA 1VP3A 5EJ4A 5I8ZA 4XSGA 4RQBA 4P3OA 1P0CA 1SOAA 2X42A 1OR8A 4F9GA 3CO5A 1OT5A 5BQOA 2PXAA 5IJ9B 1E6KA 1BOFA 3BAFA 3DLBA 5A4DA 4MWTA 3HABA 2BGIA 3TL2A 1YQXA 3UENA 1C7FA 1BCSA 5C4GB 4P22A 4YPOA 4RTMA 2GTIA 5A1JA 2BEWA 4D5EA 221PA 2X5JO 3VPHA 4X62B 3LRPA 3ANXA 2NO9A 4FWBA 3TQOA 4RD2A 3BORA 2OXTA 3J7TA 3H9QA 3AR9A 1OU0A 1M5RA 1M9NA 5IAKA 5HEKA 1Q7EA 3S0JA 4F7DA 3ZJVA 2PFKA 3W6PA 3MWEB 4MLDA 2CF5A 3TLZA 4ILKA 3VM6A 2YNMA 4BE4A 3PQ2A 2CXNA 3PWTA 4ZYVA 1N1EA 3TR0A 3WLOA 5FFMA 1S3GA 3ZE0B 2RI0A 2GFIA 1B6GA 1KAQA 1Q57A 1I1OA 2GRAA 2RHLA 1VI6A 2C96A 4X20B 4BJ6A 1QGZA 3U61B 4Y2VA 4GI1A 2VTDA 4O4HA 4R0VA 1KJ9A 1QYRA 1DTSA 1Q95A 5BN4B 4DA8A 2EP5A 2D1SA 2PMCA 3STWA 1Z8NA 4HS9A 1TX4B 2CZCA 1RFGE 4KAXA 3VX4A 2HA7A 3IP1A 4WOCA 4E6PA 2IYAA 1DARA 1G8MA 1KK1A 3EIWA 1X1QA 1YB5A 3G2MA 3O5AA 5JSKA 1RQGA 2H8KA 1XVUA 2K2WA 2PZLA 3F5DA 4TX1A 4X6LA 2G1KA 2QRPA 4OJNA 5IMBA 3F47A 5FI5A 3MUFA 4I5IA 3CRMA 2ZIGA 4Z7JA 3ZNNA 3HXQA 3MERA 1J0DA 1X7GA 5TRTA 4HI0E 4QGGA 3T4UA 5CXQA 2WAAA 5IJWA 4OK3A 2I6GA 3KD3A 1US8B 1C41A 3QI7A 3IIMA 2PSFA 2GPTA 4KE8A 5H80A 1U4OA 2N0SA 3KT8A 3VTFA 1JALA 2VDWA 4DLBA 2NUTA 4QRIA 3UUEA 4EO4A 4NCNA 3D6UA 4MYCA 2UDPA 2QBYA 2JJMA 4LWZA 3G8YA 5FPKA 2GPYA 5AMXA 2AFRA 4J03A 5EQTA 3T9EA 4REOA 4G0ZA 2OM2A 4Y6LA 4P33A 3RF6A 2WMYA 4N9QA 2WTBA 4YAOA 1E66A 5JATA 4HB3A 4EW1A 2Q3MA 4EY4A 1UPBA 3ABRB 5IASA 1OXVA 2O1EA 5AM5A 1QYVA 2FXVA 3CVYA 2HSGA 3WGJA 2GSDA 3NKVA 4PC7A 1G2PA 4FIZA 1QG6A 2RGAA 3ZNOA 4QPJC 2R9VA 1KO5A 4E2YA 3TGLA 3H11A 3IVGA 1UXHA 1IZYA 1E2KA 1M6NA 4CLEA 3IMGA 3ZWAA 4JLVA 4ENSA 2V9ZA 2HCFA 2O4UX 1NM5C 3V1KA 3LA8A 3VC7A 2DUUA 1N3BA 3JWEA 2PRSA 1R0BA 2X0NA 1CK4A 5AKKA 4GZ5A 4EO9A 3J81k 1FUUA 1ZD8A 4IEIA 5LNK1 4M21A 1F1BA 2Q21A 3EMBA 5J4VA 2WPNA 3AGPA 3C7DB 3ZI4A 4PLFA 4OU5A 2SNIE 3TIGA 1OLOA 1VLQA 3HKBB 3MQ4A 3W5JA 3C70A 1E1RA 4MX8A 4FYWA 2Z2YA 2EQBA 2WAOA 3SZLA 2HYDA 4FFOA 3PFHA 3KQWA 2XT0A 2IFTA 3K16A 2E82A 4LDJA 1ZM2A 4TVSA 5IF9A 4PQGA 4ONEA 2F00A 3C74A 2WIDA 3DKPA 2VHWA 8ADHA 2HDOA 1PLJA 1U65A 4OXQA 5AHRA 4C05A 2ZPTX 1SNYA 3HJRA 2OKCA 5A4MS 2AOUA 2HMTA 3D2AA 4QGBA 4IYRA 3NIWA 1PBNA 1SHUX 1NUSA 5JV5A 3LO5A 4BPBA 2GT1A 2J08A 1ESEA 4PFKA 1KY2A 5FFNA 1GVHA 1ZIOA 3PC2A 5FAKA 3L05A 5DBGA 4V02A 3GUCA 3VR4H 3GJYA 1I7DA 2NUAA 4JBWA 5TQ2A 4EG5A 4WBNB 1P2SA 4WBNF 2B98A 4OM8A 5AOAA 1ZUNB 3PE3A 4DV1B 2WMOB 1BC5A 2HK8A 3B52X 3DBLA 1OJ7A 3L4EA 2TRSB 2E6UX 2XCOA 2WWRA 4NKRA 5EL0A 1VGQA 4XGRA 3WWYA 3WYEA 4DSZA 3UW3A 1HDZA 1LQ2A 2FQQA 2G25A 4L6IA 4EHIA 1ZW6A 3C3AA 3HSSA 1OX4A 5FNVA 3IPLA 4C2BA 4LECA 4QPDA 3SYLA 1LX6A 5F35A 3U31A 3S2YA 1XF9A 3U3MA 3T7DA 1WR8A 3JW8A 4UJ3A 1XK7A 1KXZA 5BQPA 4MR9A 1OYYA 3C7KA 5F7XA 1FUYB 3HB4X 4ZAFA 2WKSA 2XNDD 4ISBA 2FX2A 2WV9A 3C16C 1KEEA 3FVQA 2HH9A 2HM7A 4NEQA 5HS6A 1Z5OA 3IEPA 3JD2A 4F4CA 3P26A 3GGCA 3FPKA 1W6UA 1IN6A 1HT0A 1P19A 1MCZA 2IHBA 1WOYA 1SU4A 1YU9A 3A3YA 4G8BA 3VR5D 3W5UA 1VYHA 1H0HA 4MP6A 3PWSA 3I6QA 4OHCA 5JISA 5BSEA 3UMCA 2B7CA 2IA5A 2LNDA 4XGIA 1A5ZA 2CXHA 1CYEA 1YBVA 2BKLA 2ZQ5A 4JBYA 4TVOA 4XCXA 2FCRA 1Z5ZA 3MCAA 4BMPB 4RAQA 4KLNA 2HWXA 3OE5A 1NP7A 4LJ9A 4OJYA 2KMLA 2GHQA 1XHFA 3ETGA 4LZLA 3M9XA 3R40A 5HTKA 4YQEA 1V4NA 3QOXA 4G0QA 1V3VA 2A0YA 2AN3A 2XRMA 4PC1A 4AMGA 4EFKA 2AC4A 1K8ZB 5HGJA 1UJMA 3BJMA 3TK1A 1ZUWA 3JQBC 4Q16A 1POXA 3O0DA 4OEHA 5JNSA 2VUUA 1LNZA 3V3TA 1AU9A 5K0GA 2JJ8A 3TDNA 5JASA 1DL5A 4YRPA 2GJSA 1Z63A 3ZU2A 3MPOA 2VDJA 3HZRA 4JIGA 5EIEA 2G04A 2HCTA 3QE4A 2JI9A 1IJEA 1TM5E 2D0IA 1R8XA 1YUMA 4A2QA 4Q6WA 1QHIA 3GW8A 2BFCB 2ZJ5A 2BGMA 1L5GB 2FR0A 3OBIA 4X84A 4DDKA 3MBKA 4Y1RA 2FEAA 5JE8A 3HK2A 3GQBA 2XMQA 4AG3A 1QX3A 2FMTA 3DXZA 2P9YA 4X3PA 1XWWA 3M4NA 5J5VA 2V0GA 4GPEA 1A9OA 4B4UA 5BP7A 4CLOA 4DDWA 2PS1A 3AP2A 1X8LA 3B1WA 2QZ4A 4IQ8A 3JQ7A 4GR5A 3AI1A 4MKRA 5BYKA 1M6WA 3H5VA 1I13A 4E5NA 1ORDA 2VS1A 2PKYX 4M0FA 2Y2VA 4A92A 5IT5A 3QYAA 2ZGVA 2FSVA 4YIKA 1EFRD 3D6JA 4BNVA 3GD7A 1XN4A 4IY1A 2HUPA 2GZ1A 2RMKA 2ZUDA 4PBSA 3D6FA 5DXJA 1ZWKA 2QLNA 2ZTVA 3KEQA 3TYXA 3ZHZA 4BX8A 4CTKA 5J43A 5JS8A 1X7YA 3RU3A 3X2SA 2NAPA 5EJ7A 3EODA 4L27A 5JC8A 1ZJ4A 3V4VB 3UOGA 1XQVA 3FKSD 1J00A 4R68A 1E9EA 1O4WA 5EMLA 4CU2A 1P7ZA 1DXYA 2O8EA 4TZ6A 5DULA 4JT8A 3ZIAA 3ERCA 2O06A 1TYEB 3L6RA 4NAUA 1MENA 3FLBA 3OJEA 2IW1A 4LHZA 4RH3A 2WHXA 3ZI7A 4EMTA 4H1WA 2EV9A 1ZC4A 1A8PA 3SI7A 1WUTA 3UH1A 1I80A 1EP3B 2VPYA 5AVQA 3EPJA 1OWNA 5BSUA 3CN7A 4W5RA 1BHSA 4V3CA 3GL9A 2RCNA 3H99A 2WOOA 2HDHA 1GLNA 4RZIA 3HSYA 4Q19A 1DAPA 1WXWA 4FYIA 4TTSA 5E9AA 4EPWA 1K92A 4CF3A 1KZ7B 4RE6A 2FX5A 1CDOA 3EHDA 1UBSB 5LDHA 3OBBA 1XROA 3F3KA 4OXIA 5FTJA 1NX6A 1CUWA 4PGGA 4DT1A 1U04A 3E2PA 5DPMA 3RSFA 3D4LA 1COWD 2E4AA 4ACAA 2OWDA 3T35A 3R7SA 3SQDA 1XTKA 2N46A 5K7SA 3W6OA 5F3RA 5ALXA 4D0SA 3KUKA 3RQSA 3WIEA 3M5CA 2VA8A 1OZHA 3JYHA 5I9BA 4B3IA 1P74A 1ZINA 3SJZA 2ODTX 2AWNA 2ZVQX 4N5IX 1MQ9A 1JG2A 4EEXA 4GH5A 2JDID 2QM8A 4NNPA 2ZRLA 1E18A 2CJWB 4MGZR 2PKXA 3EYAA 3G8DA 1R9JA 1JMYA 1JHDA 3PGA1 2OORC 4INOA 1E89A 1R5BA 1YH3A 3CUTA 3FZEA 5F78A 3S27A 1E58A 3B6KA 5KSOA 4Q82A 1MFPA 4YWHA 4HWRA 2LR0A 2B1IA 1F0PA 4H1TA 1QFYA 3PX3A 2EJTA 3N2GA 4IVQA 5BT9A 3CEMA 2QLLA 4HUJA 1YRQA 4ZOCA 1CP2A 3JWHA 3PCXA 2IZ1A 3PLNA 4FGLA 1DFIA 1IBRA 3RIEA 1JXMA 3VZCA 2GYWA 3Q88A 1GQ2A 4BDTA 4K6CA 1XX6A 4RPCA 5H9VA 5IZCA 3ZBUA 1OZGA 4YPVA 3NYRA 4DLYA 3B9BA 3IVMA 1BDIA 5KNDA 2F1OA 1FVOA 1WHTB 4MCAA 3QXCA 2ZBPA 3I2YX 4X95A 1LVGA 4EKEA 421PA 3ZXXA 1CEQA 1XHLA 5LZ8A 1YS7A 2GBLC 3JV7A 2DHCA 2OV3A 3L46A 2BP7B 4J0JA 3UWOA 4DA6A 1Y8ZA 2BJHA 5A9SA 4BYMA 3F0TA 2R48A 4O4IB 4O4IF 1RIFA 1R5JA 1WJGA 4KAFA 4ZU3A 5IH3A 4DRZA 1OC4A 3TZBA 4BIIA 1PJCA 2WWXA 1CSEE 5B1DA 4QXOA 3FYSA 1TT5A 1G5FA 3OLWA 1YAJA 3KXLA 4KTTE 2OCAA 3TB4A 2O8BB 3GELA 3QVJA 1A8IA 3UJNA 3DLAA 3IP6A 1EESA 3QWIA 4AY2A 1IK4A 1I3KA 1OT3A 4DAEA 4P0TA 1UANA 4L57A 3RPEA 1UMDB 5LJIA 2C78A 2O8FB 3ZKWB 4XDZA 4H7PA 2IP1A 3VMFA 1GSIA 1CUXA 4KWEA 2MINA 4H6VA 3GEEA 5TPZD 4WMLA 3T1OA 4L8FA 2ENUA 4CMJA 1OFUX 2OUKA 2RSLA 3ODPA 4Y9UA 2Z3WA 3FYTA 4DEXA 4MVJI 1MW8X 4HYQA 1GCUA 1K3UB 1Z74A 4I4TB 3ZE9A 1U31A 9ATCA 1W0KA 5BV7A 1JFFB 3VU8A 3JQQA 2C97A 4UEJA 5CH8A 1PLLA 4OL0A 1NFFA 3HFGA 4J1QA 1NDQA 1R6BX 4LV8B 4Q7LA 2DB3A 3L8CA 5KC8A 1U3TA 4RTLA 3KSBC 4KW7A 4ROSA 3LF1A 5KQLA 3CXRA 2ACKA 4DLLA 2I29A 1F6WA 1T8YA 2NPFA 5K45A 3K1AB 1JKJA 1K8RA 3KBOA 1Q84A 4HDRA 2YQZA 2WVGA 4QODA 1MABB 5KWSA 5KYWB 1T9CA 1P18A 5TQVA 3VPSA 3FUUA 3HO6A 3WRYC 3OECA 2VPPA 4NJMA 3C2QA 1UMKA 1WCIA 1RKQA 4GRIA 5IVHA 4YA6A 4YCDA 1YSCA 3EGEA 2DBQA 4PWZA 3OO1A 3WVNA 3PQ7A 4HHEA 4F7WA 2C0CA 1PN3A 4A6XA 3DDZX 4I9UA 3ZCVA 2OECA 5F7OA 1VDZA 3H0KA 4M6WA 3KQKA 2E4WA 3V34A 3QMVA 1F2UA 4Y2PA 3BTUA 2EFGA 1V3QE 3F9RA 3SKVA 3F7OA 3IIJA 4DBLC 2AYZA 5JSQA 2X9LA 1LTQA 5LDDC 2H7VA 1L5SA 5DASA 5JYDA 1RZRA 4MSUA 4F4JA 1UYJA 5CR9A 1V6SA 2I6SA 3LQ4A 4EVIA 1BE0A 2C4NA 3I6MA 3GG9A 2BH2A 3ZNPA 2V97A 4BNIA 1SHKA 1KIMA 3R3XA 2D62A 3N8GA 4CQMB 4EG8A 3SJ7A 3KT6A 3H42B 3E9YA 4C04A 3AZQA 3NT4A 2VDUE 3WGLA 1FBTA 5HOEA 3U4QB 1VZ2A 1HLDA 3D5QA 3ZCRA 3WGQA 3M9WA 1NY5A 2XNCA 4BNGA 2GFHA 1Z6AA 4WZBB 5FULA 5IBCA 4JI8B 4ZRMA 3QJGA 4O33A 1CJKC 3ZZUA 4Y2YA 3NANA 1LUAA 1P0PA 1W96A 1Z6PA 2H29A 4IH4A 4TLDA 1SC9A 3NG1A 1SZCA 3A4IA 1IRIA 1AS3A 1LDGA 3QWBA 4M9UA 3PLAE 2A5YB 2VZ9A 2BONA 3E9NA 3E4CA 5TSDA 4ENQA 4R8RA 5KWVA 3IV9A 3VXKA 4XX0B 4HSGA 2G67A 4ZJPA 3BFJA 3NH6A 3AZPA 1KAHA 3B9QA 1E6WA 5B30A 3UAZA 4A73A 1QH1B 2IZ0A 4PAWA 1QV9A 1M0SA 3J7AC 5DYTA 3TGPA 1NE7A 1NQUA 3CKLA 3RU7A 1E2FA 3ETCA 3H65A 4WVLA 1NRXA 1GZ5A 1M34A 1ZIDA 1VC2A 2I3GA 2XB4A 5G0TA 3HN2A 1PI3A 1X8JA 1YE5A 1X8KA 2QTGA 5E9JA 5CP8A 4E3ZA 2G07A 4GE3A 1KH1A 4WA8A 3FOBA 3ZYCA 1FF9A 5DK6A 4DREA 2Y9MB 3L9WA 5EXTA 5K8UA 4GI3A 3B89A 3HC7A 4TXNA 2Y93A 4YECA 3RW9A 3IEVA 4E11A 4YP9A 4NPHA 1LRLA 2AMYA 1HT2E 3WRXA 1VJTA 5JAZA 1BZYA 1CZLA 2HNBA 1QZZA 1XB2A 3E70C 3M81A 5ARCA 3VU9A 5DOZA 4TTJA 1G7TA 1C1YA 2D3WA 4IX9A 4KNWA 1SHJA 4Z0NA 4D46A 2ZIUB 4EI7A 4CTMA 3E5RA 1OUMA 1LTKA 4NFHA 1P1IA 1CULC 2QE6A 2R2AA 4NFLA 2QTFA 1YTLA 5HIJA 2XJ9A 3SHQA 2P68A 1ES9A 3GJ0A 4MUBA 1L7VC 4QPCA 3WA6A 4COKA 4KVZA 3F5FA 3G0GA 2WZDA 4B74A 1BYUA 1I36A 3BB1A 5ITWA 2P90A 2KLBA 3D1JA 3TRIA 1EM8A 2AMFA 1VM6A 2X6QA 1R3UA 1M75A 1PG5A 3GO4A 1D2EA 4A2WA 4UATA 5LA6F 1GXSA 3WGGA 2EYUA 3BTSA 4FX5A 1DLJA 4P4GA 2GZMA 1P81A 4YP1A 1U7HA 1GZUA 1U0FA 4NZNA 4PTYA 4W7SA 5CW2A 4ZEOA 4Z8YA 1NMEA 3SHTA 2AFHB 4V39A 4WA7A 1P4JA 1RHMA 1E3WB 2F3RA 5AK6A 1TXGA 2PX3A 5HKLA 1F8GA 1V25A 4XE5A 5GIOE 1OW3B 1AJEA 2JIQA 1KAEA 4BKRA 1LX7A 5FPQA 5CLIA 4LDPA 2CDRA 4G23A 3WO0A 1QCYA 2GM9A 2ZYSA 1DRUA 3G7UA 1UC8A 3FXAA 1C7QA 4FE3A 4BJ1A 2Y27A 4B48A 1RJEA 2IHYA 3TOXA 5IWCA 3P5SA 2VH1A 2A9KA 4EYGA 1IN5A 1YI0A 2ZBGA 4O8ZA 4RV9A 3VPDA 4CCWA 2YW2A 3ND7A 5HYVA 3WIBA 4FWTA 1T4CB 1C0LA 2EGUA 2WHEA 4IIYA 2CXPA 1KZ9A 1CU1A 3OPQA 4JNCA 2B1QA 2V6BA 4RK6A 1ZRSA 2W4QA 4FHDA 3DDHA 1AS2A 2AJ8A 3OIUA 4KMOA 4L5JA 1YCGA 3QQPA 5E0KB 1H1DA 1JDPA 2WG2A 4RFLA 1IUNA 1H2FA 1Z39A 1RCFA 5DT9A 5AESA 2B1JA 3GJ3A 1TQ2A 5DSZA 1TU0A 1PNRA 1Y1TA 4PE5B 3HCEA 3MS7A 2EG9A 4C4YA 1HOXA 5JCXA 1O9HA 2QD5A 3LZCA 3PDJA 2P2SA 5GV8A 5TB5A 1NC1A 1TJYA 1AGRA 1FMTA 5ENDA 4UZEA 4YAWA 1J33A 2NTJA 4EFNA 2JI8A 2HGZA 3IAM6 2A7QA 4DOMA 5LR6A 1CG6A 3SC3A 4GSLA 2WT9A 5F77A 1DAEA 2RH4A 4PLZA 3AESB 1QRAA 2QSYA 4M1TA 4MICA 5LQMA 4HZUA 2D8MA 2HK7A 5DMXA 2FAXA 3KKNA 2G0AA 2FOLA 1CR1A 4XDHA 3WNZA 3JQAA 4Q4AA 4WT7A 8GPBA 4OXRA 1TUEA 1MV8A 4Q9DA 2VTEA 2J5QA 4WERA 3ICCA 2VK1A 4WVFA 2HWUA 4WINA 4MUJA 5AQ1A 1N1GA 2IEAA 2OHGA 3ETEA 4P38A 5JG7A 1C3XA 2ZRFA 4I81A 4XEHA 3E0XA 4AG6A 1XU4A 2C9YA 1H8EA 5AKYA 2QGNA 3A3OA 2YJ4A 4MAMA 2VXBA 1JKXA 2XPCA 4HDCA 5HHTA 3OF5A 1VL0A 3CF6R 2W2MA 4YWJA 5A3SA 4U3JA 1KBOA 3DA8A 5BY2A 1RDFA 5ESDA 1JFRA 1KSGA 1HNXB 4E0BA 1JR3E 2Y71A 1OLSA 4JFAA 1EIZA 2I62A 3A8TA 1A50B 1P0FA 4IXDA 4MPPA 4ER7A 4RX1A 2VZ0A 3GMDA 5ILOA 4DXAA 4RHTA 4I2VA 1A77A 4X71A 4FGJA 2FE1A 3TLBA 1Z0FA 4R1UA 5CYFA 3UTCA 3IAAA 2HMVA 3PHHA 3LF2A 3Q0TA 2GEUA 4GLOA 2QM3A 3AY6A 1GVNB 1G21E 2GPSA 4UHFA 3V00A 3E9ZA 1IIBA 4R0MA 3M6FA 4V0ME 1NPYA 3PQ6A 1KZ4A 2V6MA 1ULSA 4UEQA 4BZZA 5BWMA 1D6SA 1J23A 3RSZA 3MXTA 1M8PA 1MIOA 5EMJA 3I9KA 4KK3A 4KR9A 1JSLA 1PJ8A 2VP9A 5H3CA 1MXFA 1UKCA 1CNMA 1SRQA 1GTSA 3NWBA 3PDCA 4FHEA 5HCIA 4Z4EA 2NPIA 1ZI9A 2Z6UA 1CJUC 2YVUA 2YWGA 4MPDA 4HLDA 5CEFA 2VIIA 3HACA 4X60A 5CVEA 1UBOS 2DFPA 2G9RA 2Q0XA 4JAVC 3O90A 2EEZA 3C3JA 1SC1A 2OXFA 2E49A 4H17A 1XMJA 3IEKA 1G6HA 4JL6A 4ZT3A 4HAYA 2JGNA 2FMUA 3ISTA 3VDMA 4DIMA 4FW8A 1AZWA 3QU9A 2VDOB 1Q0PA 1L5FA 4MUXA 3UV6A 1TIKA 5B1YA 2LE0A 1R4MB 3F4LA 1ZLYA 1KWGA 4GXRA 3QU5A 3WSTA 2DGDA 2RC6A 3O8DA 1KDYA 2QVZX 3PQFA 5KEIA 3C6ZA 2VF7A 1NKSA 3LT5A 4CM1A 1FP7A 4Z6KA 2FXIA 1YA8A 3NBQA 2QJOA 4P4SB 2JLCA 3EDCA 5JH7A 1R4AA 2IUFA 3MAGA 1MH9A 2AJCA 3PI6A 4A2CA 1L4MA 4DXDA 1IPHA 1F8YA 4N5LA 1YKSA 3ZLVA 4OHYA 1DRJA 5F51A 3KETA 2FZVA 3VR5A 3WKCA 4DNFA 1V16A 6AT1A 3FCYA 2B3DA 3GAFA 5AXAA 2ZYAA 4XM1A 4KH0A 1SPXA 2A0KA 1DQSA 2UZ3A 5AT1A 1EUYA 1EWVA 1B23P 2HBQA 3IAHA 3OJCA 4HAWA 1XT6A 5DN6A 4P86A 4BNUA 3DDSA 1U0RA 3FVWA 4CPDA 2AZTA 2HRBA 4LXTA 3BPSA 5IM5A 1LW7A 4M9RA 1W44A 1ZKDA 3UBTA 3MCTA 5SYNA 1V8OA 4L0MA 4WLNA 1FDWA 4ARIA 2HRRA 5JFGA 1JPJA 3HCOA 2QTVB 1EJ0A 3KJXA 1C7JA 3RANA 1HO3A 2O8CB 1SQSA 3BE5A 2PUJA 5M3BA 1W36B 2XDYA 1GRCA 3MINA 4LV5B 3GVPA 3TCNA 3ZQJA 3ZD7A 5HGXA 4OH1A 2QVBA 1KI3A 4RPLA 5JJ5A 2ONKA 2YIVX 1I5EA 3EQ8A 3KYDA 2I1WA 5DYNA 4GLJA 2ONJA 3OOYA 4AJ1A 3UUWA 2LRHA 2FFRA 5CT4A 4AF6A 3Q3HA 2QLMA 3KSUA 3LDGA 1AKNA 4BS9A 1L6IA 1JA1A 4WN9B 1GCAA 2F43A 4M7PA 4QQ8A 4R8KA 5GJCA 4D3YA 2MYNA 1RRMA 1AC5A 4LJRA 1KYWA 3P9CA 2QKYA 1H65A 2Q49A 3AFOA 1VJ0A 3IUMA 3M34A 4URWR 5DU2A 1IBKB 3ETHA 1U8AA 5JPCA 1WW8A 4ZD6A 1XZ8A 2YHIA 3MB5A 1XA3A 2QQ0A 5FFFA 2W2XA 4PV7A 3REGA 4CM4B 1V37A 1Y42X 4N4AA 4QUBA 3O92A 2IWHA 4P31A 5JQGB 3AL0C 4B3MB 3FN4A 1E1LA 1KRHA 3DO5A 4QFCA 2VKTA 4MB2A 2I65A 5CNIA 1EFRA 3COWA 4FYXA 4MLZA 1XNGA 2FJUA 3TKLA 1TVCA 1VE1A 1VKRA 1WOMA 4KKXB 5LVAA 2VC2B 4K03A 1ZVKA 4PZEA 1KQOA 3AEYA 4M99A 1PFKA 4B81A 2IXGA 7REQB 1E63A 3I2KA 1KNQA 2RBEA 3K6KA 1YZNA 1MHPA 2HT6A 3CHYA 4JB2A 5T4FA 1EDEA 2G9UA 2IU6A 3PUHA 3FKSA 2C2GA 2X5NA 4RJLA 4D3XA 1M6VB 4V38A 2VJOA 4KQJA 5J9GA 1X0VA 3QVXA 2ZG6A 4H08A 2VDPB 4A6PA 3OJOA 2IPNA 5JLJA 4KEAA 2A30A 3OT1A 3O83A 2QGFA 4P5PA 5HFAA 1RT9A 4ZGBA 2R66A 3A2NA 3D8NA 2P0YA 4C0WA 2HL6A 3OIVA 1JH8A 3H1BA 1KDOA 1DTEA 1ZICA 5A7GA 3T7SA 4C6TB 3O1LA 1MGPA 2Y1LA 2ZSHA 1GWNA 3B8EA 4D9EA 1J5PA 4HNVA 5C5IA 5D3QA 5I3ZA 1QQAA 3PVSA 1S7GA 3PRHA 1AUQA 3DE0X 2XWPA 1NF9A 4QWWA 5CNKA 2I2CA 4L4UA 4N0QA 4S0ZA 4GKBA 1M5TA 4JLMA 4EABA 1W93A 1N2OA 2ZIXA 4ZEVA 3NIGB 2Q5CA 4IQFA 4G41A 3E48A 2PMWB 3DAFA 4PHGA 3RVOA 4EB6A 3U19A 1TDJA 3JY6A 2XCTB 2VTVA 1COWA 1NTOA 2ZRKA 3KKPA 2QMYA 5ANRB 5A6VA 2G5CA 2QL5A 4U6QA 1VHQA 3H0EA 5BQ3A 3B82A 3CWCA 1FBNA 3AW8A 3E2MA 1ZGCA 3PQ8A 4Y9RA 4G5YA 5JRDS 1P0MA 2WU0A 5CW1A 3ZHUA 4JKYA 3M6IA 3TBFA 5I3CA 3AVWA 3GA7A 1RM0A 3TE7A 2JKZA 3EXIB 3S1LA 5BSMA 2CGEA 1JTEA 3KKKA 5BSWA 1LZKA 1C50A 1NUTA 2JDIA 5K0LA 2MSNA 3W8RA 4GT1A 4LWQA 3HDTA 4CRWB 2C7OA 1OLXA 3DZ4B 1CYDA 2Z9DA 3G0IA 4J1TA 3UMJA 4C4ZA 2Z8XA 1UZUA 4CN9A 4P8RA 5JWOA 1QFJA 4E5MA 1B1AA 3RKUA 1ECPA 2QN7A 2X2FA 4E2WA 4OHWA 3PYXA 3FA2A 4RZUA 4KN8A 3DUFB 4XD7D 4EIWA 5K4HA 4TL7A 2PJZA 3D4BA 3KL2A 1PQYA 4HLNA 3TLGA 1UM9B 3G0DA 2OK7A 3KQHA 5HBRA 1STOA 1WUKS 2F9LA 1SVKA 1DQYA 3AEXA 4P82A 4RLFA 4BAGA 2VBIA 5BO5A 2XT6A 1LPAB 2YY7A 4AY4A 4CLDA 2PK3A 3PQ4A 1RRVA 4QM7A 4PPYA 5JDCA 3PIIA 4QZVA 2OYRA 2VNAA 4QPNA 2NXCA 4JZKA 4N18A 2R4TA 3PEVA 1HNZB 5C8XA 3DHWC 3R7WA 2G1PA 1O4VA 2FK8A 1JI0A 2VDMB 1LLCA 1OFUA 2FZLA 2R7MA 2QR5A 2VHEA 3CX6A 3CUUA 5E9QA 4OD0A 1EWYA 1CRZA 3MFYA 4LI3X 1BE1A 5HKAA 1NULA 4N41A 3OOHA 3GJ7A 3MLBA 5EXPA 1AN0A 2H9YA 5IG2A 1Y9ZA 1JHRA 1UPCA 1HQKA 1E1MA 1HFEL 4YUWA 2FETA 4LBZA 5D6OA 3BJIC 3V4PB 2BZ1A 3SDSA 1JKMA 3H16A 3AVYA 1G38A 3GJQA 2SCUA 2BOVA 4MDFA 4TVBA 4CKCA 1NBHA 4KXVA 3T3NA 2AXEA 4MW2A 5EIHA 2IP4A 3MTJA 3UMVA 6PFKA 3HM9A 1VE5A 3IR6A 3HYTA 3T7EA 2B1GA 2FW9A 1BE6A 1U9IA 2RIPA 2VZLA 1G3IA 3CX8A 3M1LA 1YQUA 1KH3A 4ATNA 1TRHA 3UY4A 4LHEA 1PK9A 3FZQA 3R9WA 3FFXA 4PX9A 3AIIA 2ZROA 3QJ5A 3EGDA 4R2JA 4PPGA 4RPIA 3K4HA 1L8OA 5CIQA 5K3FA 3T1HB 1Z4IA 5DBHX 1E2IA 2X8BA 3TRHA 4II3A 5ESXA 4BBPA 4CIDA 1Y9DA 5LN1A 1F60A 1WE2A 2GNPA 5A3VA 2ZJ4A 1QRRA 1G5TA 1U6KA 5E4TA 4DABA 1GFSA 4AW9A 4DRXA 5DLYA 1P73A 2XMCA 1YASA 1IOLA 1FEZA 3JAKA 4V1CA 1MGOA 3ZEIA 1RQ2A 3ET5A 1JB9A 1T8WA 3O3NB 4LV6A 1J56A 1DZIA 3LPLA 1K3FA 2PL9A 1Y8QA 4FKBA 4XDYA 2J59A 1KOFA 4KQXA 3U7QA 1K75A 1XTZA 1CB7A 4TLBA 3TUZC 1G6KA 5I7SA 4ZVKA 2QE7D 4V0NA 4PC2A 3RNOA 4DSUA 1PK7A 2R4QA 1P44A 2A2ZA 2FTKE 4MQFB 2WM2A 2QSJA 2YQ5A 4DWVA 3WAJA 1TUBA 3CUEF 3U62A 1U2SA 4FR0A 1FLDA 2ON6A 4JC8A 1IZ0A 3QKRA 3A14A 4AB1A 1JZSA 1ENZA 4WKBA 1TVEA 4REQB 4DKJA 2O7QA 4ND2A 1SCKA 4BB9A 2BWJA 2DFNA 4Q1DA 5HFJA 2VHQA 2X8JB 2HU2A 5D87A 1NI4B 3FRJA 3RV3A 4BWYA 4QO7A 2OHXA 3LBYA 4ARVA 5LZ4A 4O8JA 3ZVRA 1X7WA 1TPZA 5JSUA 1YD7A 5E7IA 2OQVA 1GADO 1Y82A 2NO1A 4RACA 5L3QA 2WLSA 1A69A 3Q72A 2YR0A 5EMNA 4XPZA 1WHSB 4LIPD 4LXGA 1NBMD 1IY2A 1CUSA 3UBMA 4JXZA 4RETA 2MTBA 1D5WA 4A6DA 3UFXB 1VE7A 3R6DA 4Z51A 1W5AA 1EQ2A 3TLEA 3TJMA 3LC1O 3RTDA 1BNCA 1F14A 3IO5A 4NZOA 4I4IA 1CJTC 4RF4A 2IU0A 1E2UA 3PKJA 3UICA 4CU5A 4O4JF 4F3CA 2P4HX 3QOYA 4X8HA 2IIBA 2X9NA 1FP4A 1P5FA 5KOYA 4DLXA 3BEOA 2JLBA 2H1HA 2HBYA 3MBOA 3PDWA 4Z9XA 1MC5A 3PUWA 3E03A 1VPEA 4JOCA 4R5HA 1PJBA 1YBHA 3T5MA 4BUJA 1P91A 4CKZA 4TXMA 4Y30A 1K86A 4ZODA 2C03A 5EI5A 1HL7A 2O3QA 2PWYA 2WU1A 3KT3A 3HDJA 2AOWA 4DSOA 3QVGB 3RRYA 4CMGA 4XUGB 3OF2A 1RYNA 5I7UA 1Y34E 2I4IA 2OXEA 2XOKD 3DCNA 3HU3A 3T9BA 3RBXA 1XZKA 1QPZA 4KBFA 1BX3A 1EINA 5DHUA 5JXIA 1LF0A 1N5MA 2YHBA 2QM7A 1G18A 3DC2A 1YDEA 4L2IB 2W93A 2GYUA 4WDQA 4FSXA 5JMOA 1X3SA 2ECPA 1OWOA 2VHVA 3VR1A 2ZVPX 3KWMA 3ZZTA 3KOOA 4F85A 4U7DA 3NCTA 4PXYA 2H63A 4MS4B 3CINA 5AXDA 2ADFA 2ZE8A 1P8AA 2IU3A 4MVJE 2WFZA 3PHCA 5B2ZA 3DLPX 1AY0A 1T9KA 1U0GA 2JIZD 3PVCA 4XQEA 3MCZA 2V1UA 4HWOA 4PLTA 3W5DA 4GQBA 3QMWA 3VH1A 1RM5A 4KQ9A 1DC3A 5CFZA 3DBVO 1ZUHA 3AKZA 4GWGA 1C29B 1XZPA 3A37A 4LJ5A 4EHKA 3VC3A 4FFWA 4JUFA 5LMUB 2HXSA 2GJKA 3X1DA 1EE1A 3ZHXA 4Y1FA 3ITEA 1W0JD 2XVAA 1ULTA 1C4OA 5AVZA 3E8MA 1K8QA 2O7SA 1TD9A 3K0BA 5KSYA 1VLZA 1DBSA 1C1XB 1UFQA 3ESXA 4MV3A 5LA6A 1TF7A 1QMGA 3BYZA 3C6YA 4QFBA 2Z57A 1TJ5A 3OZCA 3D8BA 1G20A 4KC0A 3WADA 3WGKA 1TUGA 1XO1A 2QUIA 3P9ZA 3SCZA 4P2GA 1IQRA 1F0NA 4B3FX 4X65B 5LM3A 4QE3A 3T3OA 3PWZA 3DR5A 2C3YA 2QZPA 4NU0A 5TGZA 4IJ5A 1P4SA 4LY0A 4O5AA 3NJRA 3HDHA 4ALNA 3K0CC 3ZCSA 5K0SA 3RYCA 4BO5A 1XWFA 4C06A 4FKMA 2FWBA 4IDCA 4RK1A 3UXYA 1XSEA 1M0EA 1UMCB 1H5NA 1NF8A 2IUTA 1Z08A 3MWGA 1CZNA 4ZPXA 5A7HA 3X0DA 1HE8B 1LCIA 2O3TA 2XTZA 4UXHA 1QJCA 3IBYA 3LXUX 4Q03A 3W5VA 3ZOZA 4A5SA 2P78A 2VSXA 4RNCA 3SZOA 5IAOA 4RVOA 2PT6A 2DTDA 1P61B 1D6NA 2ZJ8A 4HF7A 4I55B 4LDAA 5EIBD 3J81A 5AM4A 4LYAA 4V24A 3WISA 4AAYA 1E2GA 2ADMA 2HMWA 3KAJA 1FP6A 3PC6A 3WQBA 1EGAA 2HRCA 4GOND 3PA8A 3N2YA 2BFOA 4JMLA 1VLVA 3QP9A 4JP5A 5LBIA 2HA0A 3VO9A 3G59A 4PZZA 4V0KA 3CCCA 2AOTB 3I61A 4L6AA 4NDZA 4W63A 1Y0BA 2AN9A 2IHJA 2