1LC0A

Structure of biliverdin reductase and the enzyme-nadh complex
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
290
structure length
290
Chain Sequence
MITNSGKFGVVVVGVGRAGSVRLRDLKDPRSAAFLNLIGFVSRRELGSLDEVRQISLEDALRSQEIDVAYICSESSSHEDYIRQFLQAGKHVLVEYPMTLSFAAAQELWELAAQKGRVLHEEHVELLMEEFEFLRREVLGKELLKGSLRFTASPLEEERFGFPAFSGISRLTWLVSLFGELSLISATLEERKEDQYMKMTVQLETQNKGLLSWIEEKGPGLKRNRYVNFQFTSGSLEEVPSVGVNKNIFLKDQDIFVQKLLDQVSAEDLAAEKKRIMHCLGLASDIQKLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a biliverdin IXalpha reductase enzyme-cofactor complex.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Oxidoreductase
molecule keywords Biliverdin Reductase A
total genus 94
structure length 290
sequence length 290
ec nomenclature ec 1.3.1.24: Biliverdin reductase.
pdb deposition date 2002-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF09166 Biliv-reduc_cat Biliverdin reductase, catalytic
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 1lc0A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lc0A01
3ZDFA 5KVVA 1X14A 5JYFA 2W8ZA 4UREA 4UUNA 3IP1A 4CMEC 2Z1MA 3RKUA 4HNGA 3NX4A 2ZYDA 2VYVA 2GERA 4RORA 1Z7EA 4WCFA 1K6XA 2HMUA 3DBLB 3DMTA 2X0JA 3UICA 1M2WA 1DHRA 3AI2A 4OYRA 2FP4A 2YHIB 1N1EA 1O0SA 3GDFA 1M6WA 2ZIZA 4RQTA 5AYVA 1HZJA 3WYEA 4PIVA 3GHYA 4L74A 2ZTMA 1V3TA 2GF2A 1Q7GA 5L40A 1P45A 1Q0QA 1XEAA 3W4KA 4LCJA 3WYCA 1RM5A 2RBEA 3PHHA 2O3RA 4WNCA 1YVEI 2VZ0A 3VZRA 3A06A 4XB2A 4A26A 1HE5A 1Q7CA 4I5DA 1ULSA 4CQLB 3VPSA 3E5MA 1KEUA 5BT9A 3MJVA 3JD1A 3PGJA 1T2DA 1PZGA 5GMOA 1IHYA 5BNIA 1PGPA 3L77A 4HBGA 3GPDG 3FWZA 3HB4X 3VPHA 3PHJA 5IDQA 3U09A 4GMGA 4LSWA 4O6VA 3JQFA 4G65A 3OECA 3BYZA 3GA0A 1LLUA 2Y1FA 4YT8A 3WTCA 1DFGA 2NQ8A 4M86A 4KP7A 3Q6IA 4TZTA 1ISHA 3AFMA 5JCJA 2J3JA 3C1AA 2X4GA 1HDXA 1YOVB 1PQUA 3ZNNA 2CD9A 2POQX 5ICSA 3C7DB 5L9AA 1ENZA 4TMFA 3HDJA 1X7DA 1WMBA 2IZ1A 3OETA 3G0OA 4DWVA 3R3SA 3CTMA 4WCFC 5EQDA 2RHRA 2PV7A 3OJFA 2A35A 3WICA 4XZ3A 3RUFA 4F3YA 2JFHA 3G79A 3DOJA 4RCVA 4GBJA 1LU9A 3TDKA 3BMOA 3ZWBA 2AE1A 3NTQA 4ZRNA 4DVJA 5B1YA 3OJLA 4NK4A 1H93A 4CM9D 4CV2A 1YB1A 1G0NA 4CM6A 4DBVO 2IODA 3S55A 4G81A 1T25A 3D64A 3ZU5A 1LRLA 2DT5A 1VL6A 1C0KA 1HYEA 3SC6A 4NU5A 4EEXA 3JYNA 4RZIA 4ZQBA 1GZ3A 1LTHR 2B37A 2WEKA 3W4IA 4BO5A 4JP2A 3UAGA 3BMQB 1TB4A 1NAIA 2ZTUA 2EKQA 4ONEA 5AOVA 3ZV5A 2E49A 5M6DA 2FWMX 4MP3A 4BO2A 2HMSA 2Q49A 1WXDA 3GHHA 3AUTA 1P77A 3QSGA 2X23A 1BXGA 4PVCA 5IXSA 4EJ6A 1Z74A 3T7EA 5BR7A 2B36A 3VVCA 1QV7A 1GDHA 1P1RA 1XIVA 2VUTA 1XGKA 4NR0A 3ZHBA 2BELA 4LSMA 1GQYA 4BS9A 4XKJA 3GVHA 3KUXA 1UP7A 2X0RA 3I9LA 4E5NA 3QWIA 1VRWA 5GZ3A 3K96A 4XQGA 1YBVA 1MXHA 1LBEA 1T2CA 3MCVA 5G4LA 1EFKA 3UCEA 2H9IA 1NNUA 3N58A 1X7HA 4JJIA 3OA2A 4Z0HO 1UXKA 1U7HA 5F21A 2PK3A 5DT9A 1VLLA 1I32A 3GZNA 3I9NA 3HDYA 3PLRA 4CMIA 1FK8A 3MJTA 3LLSA 2DFVA 4INAA 3RWBA 1YGYA 2FZWA 4OSPA 1DXYA 4YWJA 5COQA 5EESA 1UXHA 5A02A 1T1RA 5HS6A 4ZD6A 3LK7A 1PGNA 1FJHA 4IGEA 3HSKA 4WLVA 2PR2A 2Q2QA 3DXFA 3QE3A 1WMAA 3GC6A 4D43A 2QX7A 5T8KC 3SLKA 1LDYA 4IZHA 4TVBA 4GMFA 1EBFA 1U1IA 1DAOA 3IUSA 2HMWA 4ZHSA 5L4NA 4I5GA 4RV9A 5BSEA 1RM3A 3TL3A 4D42A 1XLTA 4E2WA 5DOZA 1QYDA 1ULUA 3HN7A 3OP4A 5C7OO 1XDWA 4XR4A 1E5QA 3BTVA 1HYGA 2HK8A 3P2YA 3RC7A 4J43A 1R15A 2Y1OA 3VTFA 1E77A 1I3MA 4WLFA 4DIOA 3H3FA 3HE3A 5DBFA 3D4NA 3NJ4A 2IYPA 3D1LA 5IZCC 1PJLA 1RJWA 2Y66A 4KUGA 4WASA 2PD3A 4YJHB 4I08A 3GUCA 3W8EA 2I67A 5TRTA 1V6AA 1I0ZA 2BLLA 2F00A 4RO0A 1HDZA 2OBYA 2PD4A 4OO3A 5LCXA 3BA1A 4PZEA 1D1SA 3IJRA 2EERA 3RUHA 3E1KA 2FOIA 1DIHA 5A1TA 4L8VA 1KS9A 2HLPA 1QR6A 3MTGA 1ZFNA 4XQ9A 4BNVA 4CLRA 2X5OA 5JDCA 4OOFA 5L51A 3PFWO 1VL0A 1NAHA 3OIFA 3PHLA 3TN7A 7ADHA 3F9IA 1NYTA 2FRDA 5J23A 1GADO 4BO9A 5KVQA 3H65A 5BSHA 4RVDA 3S2FA 1T2EA 1HDCA 4KOAA 3SC4A 1PL7A 3UKOA 4CUZA 2EG9A 3E03A 5CDUA 3HNPA 2HRBA 1X0XA 1JN0A 3WFIA 2D3TA 5C7IO 1GEGA 2E48A 2EEZA 4BO3A 1UXGA 3GG2A 1RPNA 4FJ1A 4J16A 5CAEA 1TT5B 5G2OA 2DBZA 3UF0A 3PJFA 5CEEA 4ALIA 2D1YA 3JQ9A 3QVXA 3VOSA 1KEWA 3ROPA 5KTKA 1MA0A 1EVYA 1Q1NA 3DBLA 2CVZA 3GH3A 1ONPA 3CIFA 2PGDA 5I7FA 1UZMA 3VH3A 3NJ8A 2B5WA 1ZVMA 1ISGA 2ZB8A 4LISA 3JYLA 2PGJA 4JNKA 1WP4A 1ZW1A 1DLJA 1P74A 1JWAB 2VYNA 3QP9A 1PL6A 4CQMB 4YR9A 3H2SA 4J2OA 3F4LA 1WDLA 1LSOA 3WJ7A 1QYCA 5KVCA 2B4RO 3GK3A 2JD1A 1LDNA 3ZU3A 3ZWXA 1GCUA 3A9WA 1C14A 4GQAA 5AXAA 3TJRA 1I5RA 5COBA 1CQIA 2BI7A 4U8GA 2Q1WA 4M54A 2AHRA 1PSDA 1DB3A 3ABIA 3GDGA 2V6FA 1CEQA 1VKOA 1K89A 3JSAA 3FWNA 3NDJA 4UVDA 4UVHA 5K0ZA 1YJ8A 1UP4A 4XYGA 2NUAA 8ADHA 1UZNA 2CDBA 4ND5A 2GYYA 2GRAA 3MJEA 4O0LA 3RAJA 5I8WA 1WZIA 1P31A 2NM0A 2Y0EA 4DYDA 1M67A 5IJZA 3U4DA 4NZ9A 1I01A 3JQ6A 4YTEA 4MKXA 2NVBA 2I99A 1YO6A 1V8BA 4WNIA 2Q1UA 1R16A 4BGVA 3O8QA 1SOWA 2WJPA 4JJFA 4DMMA 2DFDA 4R16A 3O9ZA 1LC0A 4IPTA 3ONDA 4O59O 2J6IA 2JFGA 2NTJA 4DQUA 4XGKA 5K9ZA 4E2ZA 5JSFA 2WTBA 3DFZA 9LDBA 1W4ZA 1C1XA 2BFAA 1NWHA 5EIOA 2VWGA 5DULA 2XXBA 4Z0PA 5ER9A 1EQUA 1JVSA 1PJ4A 4F6LA 4J7XA 2RH8A 2NVWA 1NFFA 3FCOA 2BGKA 3LYLA 5AQ1A 2CF5A 3Q9NA 2QIOA 1LSUA 2XF8A 3OEWA 3FPCA 2IYOA 1BDMA 2JCXA 5JDIA 1ZK1A 4BKRA 1QXSA 4D7AA 1T4BA 4CLOB 4I8XA 1DLIA 1I33A 1Q7BA 1GCOA 4R68A 4UEJA 1LX6A 3OA0A 3GPIA 1UJMA 5COAA 4FIZA 2VT3A 4QFDA 4R54A 4CV3A 4M8SA 3PRJA 1O5IA 4R4JA 1F0YA 1FDUA 2DBVO 1E1NA 3INTA 4DBZA 1A7AA 5CG2A 4CV1A 1E3EA 2I65A 4RL6A 3B1FA 3C1OA 1NVGA 3K73O 3TZ6A 3IAHA 1G6KA 2CDAA 4LCEA 2HO5A 4ROSA 1PGOA 1Z75A 2G17A 3DHNA 5ILOA 4BHTA 5TJHA 3PDJA 4MIEA 1H0KA 4FCCA 3GLQA 1MB4A 3PWKA 4J4BA 4CMGA 2FZEA 4I9NA 4RPKA 1YQGA 5ENDA 4CMAA 1BHSA 3DBRA 3F46A 1JQBA 1H2HA 4L75A 1I3KA 5T5QA 3OIDA 3AUUA 1B3BA 5CPBA 3AFNA 1IL0A 4YBZA 3BMQA 5C5IA 2IEBA 3NUGA 4MVJI 4E2XA 2D2IA 1I2ZA 1DJQA 2H1SA 1BWSA 3WQSB 4MKZA 3R0IA 3KTDA 4MVJP 3ON5A 4JX8A 2DTDA 2EP5A 3K5PA 3E9MA 4Q3AA 4BB5A 3U49A 4CM3A 2O2SA 1RYEA 4FOSA 4R9SA 4TRNA 4HNHA 1GYPA 3NTRA 3V1UA 3NRCA 4EUFA 4OL9A 3WMXA 3KETA 1DC6A 1WDMA 4KQWA 5JAQA 2P9CA 4C7KA 5G4KB 3WG9A 1R37A 5G4KA 4DC0A 2O7QA 2R00C 1YBAA 2JKVA 4KTVE 1NQTA 4LMPA 4A5OA 1UXIA 3U62A 4CM7A 3WGIA 4ZQGA 3PLNA 4U0KA 1LSJA 1GZ4A 4IDFA 1WWKA 3DZFA 4YJGA 3JQ8A 5FFFA 1OI7A 3CUKA 3JTMA 3QIVA 2VNSA 3WTBA 1B2LA 1V0JA 2EXXA 1HE2A 4R3WA 3ANMA 4BNXA 1HT0A 2C29D 2R6JA 1PS9A 4FB5A 3Q2IA 3RC2A 4RDHA 3W1VA 4BKQA 1L7DA 4YVFA 3PZBA 2GR9A 4R1NA 5EL0A 3TZQA 1E1LA 3CXRA 1LEHA 4HKTA 1NP3A 3AY3A 4B79A 3KLMX 4J1SA 1UUFA 2FSVA 1I36A 4GGOA 2C5EA 5L95A 1U7TA 3ORFA 3DOCA 3K31A 5H83A 2W2KA 2EGHA 2JJYA 3Q2KA 1X1EA 5HRUA 3WR5A 1I24A 1BSVA 2EP7A 2YQ4A 3GAFA 3ANNA 5JNLA 3LT1A 3DO5A 4FW8A 3U0BA 1E7WA 3GDOA 1F17A 1LSSA 4CR7A 4YRBA 2X0IA 4BIIA 3EVTA 3QLJA 2SCUA 2B83A 4DTIA 3INGA 4XYBA 5ES3A 1KC3A 2FR8A 5HM8A 2DPHA 2PA3A 1NWCA 3C7CB 4IXWA 1PJTA 4RLHA 3EGOA 3PWZA 3AWDA 3JQGA 2R00A 1LA2A 4OKNA 3CH6A 3T4EA 4FFMA 1R6DA 2ZJ1A 4NBUA 2H63A 2PZLA 2Y1EA 5FI5A 4N5NA 3HQ4O 2IZ0A 4PLTA 4JN6B 1NQ5A 5G0VA 4TVOA 3WSWA 4B4VA 5TJ9A 4QTZA 1VJ0A 1TI7A 4Y6SA 1R4NB 2NWQA 4TSKA 2DU8A 5A9TA 2YZ7A 4UEKA 2ZQZA 4PGFA 1ZEMA 4J1QA 3ZGYA 1SOVA 1C1DB 4PLHA 1ZNQO 4PLWA 3ROKA 4PLFA 3LC2O 3C24A 1MGOA 5TX7A 4J1NA 2OORA 4ZQHA 3K2EA 9LDTA 3WDSA 2X7HA 4P4GA 4D41A 2Y1GA 2XOXA 4XX0A 1Y5MA 1U3TA 1PJ3A 1HL3A 3FBGA 2EWMA 4N5LA 4PCVA 3HWRA 3MWEB 4LK3A 4D0RA 3JQ7A 4FR5A 4YQZA 5B37A 1B8UA 3VDRA 5A9SA 1HSOA 4AJ2A 4JQCA 1Y8RB 2PH3A 2C07A 4DQXA 2AA3A 3GGOA 4PN3A 2NU7A 4AJIA 4YPOA 2J3HA 4XRGA 3ADPA 2A94A 5JCXA 3PWSA 1A72A 1E3IA 5I7EA 2Q22A 3RBXA 3G1UA 2XPCA 1EMDA 1EK6A 3VH4A 2QRLA 1SO8A 5THKA 4AJPA 1E0DA 2P91A 2VRCA 4AJ1A 1B16A 4J3FA 4CQMA 1U3WA 4FD3A 1VKNA 5THQA 2OHXA 4DPLA 5EQFA 2NSDA 4DLBA 4G5HA 1F8FA 4U6SA 3EW7A 1J5PA 2HMVA 3CSDA 3FNEA 3PIIA 5TT1A 5BQFA 3PZRA 1K2WA 1MP0A 4PVDA 1U8XX 3MWDB 5MDHA 5EN4A 3UUWA 4CMBA 4CMCA 2ZJ0A 3ITDA 3S8MA 4BO7A 5DBGA 2PNFA 2EV9A 4QFCA 1C0LA 3L6EA 3FN4A 4MDHA 4XRRA 3RASA 3NKLA 5ER6A 2QHXA 4L4SA 4RF5A 4E2YA 4MVJM 5DZSA 1H94A 1JKFA 3OQBA 1BXGB 3GFGA 1HF3A 1NFQA 1P3DA 4YAKA 1PGJA 1SB8A 1YS4A 2I9PA 3H9GA 4ZQEA 5F3RA 3ASUA 4L4XA 5HTOA 4JROA 1EE2A 3QWAA 4MVJH 4CM8A 1LJ8A 1R66A 5T73A 1X13A 4JK3A 3I9MA 3P2OA 4WK6A 4OJNA 3AU9A 1DC4A 1GUYA 1X0VA 4NU6A 1GYQA 1I3LA 1H6DA 2FSSA 5F5LA 2WM3A 3GNSA 4CR6A 1PX0A 4OH1A 5LDGA 4BNKA 5A4DA 4PLPA 4RGBA 3B1JA 1ENOA 1T4DA 3PK0A 4PRLA 4R1SA 3RUCA 2C7VA 1JTVA 4XDZA 1C1XB 5MGBA 3WSVA 1HWYA 4BGEA 4R69A 3LC1O 4GGPA 2D5CA 1MLDA 4J4HA 4K1LA 2B4QA 1NASA 3WQRA 1ZJZA 1GTMA 2F1KA 5T64A 4ALKA 1NBOA 2Y0CA 4BMVA 2NU8A 1KEPA 2JHGA 4N54A 4RVUA 5BNFA 4RZHA 1WDKA 4IGFA 3CE6A 1NHGA 1YQDA 5TC4A 4R5HA 1MV8A 2HU2A 5F1KA 3DZJA 4X54A 4B7XA 3HUDA 1UR5A 4J49A 3ZWAA 1X7GA 1EE9A 4P4NA 1DRVA 1PS8A 3K2BA 1AHHA 2IDZA 3PVZA 4IIUA 3BTUA 2QZZA 2ZB3A 4GAEA 5A03A 1AUPA 1WLYA 4BKPA 2JD0A 3WIDA 1IZ0A 2PZKA 2NTVA 3KM0A 3JV7A 1HSZA 3FNHA 3R3JA 2OO5A 4P22A 3IKVA 3UVEA 5CDTA 1A4UA 3GVIA 5DBIA 3DB2A 4AJEA 2E4AA 2X1HA 3Q9UA 3WJAA 1IHXA 5EERA 1CRWG 3BIOA 3C3XA 3TWOA 3SJUA 1DJNA 1UAGA 3ZNPA 1U4SA 3JQ7B 4P38A 5IDYA 2O3TA 4J0EA 7MDHA 2WD7B 3E9NA 3LLVA 5L7YA 1L7EA 1U5AA 1E3LA 3D0OA 3DZKA 2D5AA 3I52A 4UVIA 1ZBQA 3Q11A 4YAJA 4EGFA 1ZSNA 3E9QA 3L9WA 5CDGA 2BD0A 1ZK3A 3B70A 1PZHA 5EJ2A 1LRKA 3HDQA 4IMPA 4YYZA 1IOLA 1MFPA 3I6IA 1ID1A 1U5CA 4ZRMA 4A2CA 2FY8A 3IMFA 5IFLA 4MVJD 5JW6A 1PR9A 1YKFA 3GZNB 3UGKA 1E3WA 3PYMA 2UV8A 1P1IA 2D0IA 4ESOA 3RI3A 3KYDB 5JE8A 2JCVA 2Z5LA 4Z0TA 2ZKLA 3IP3A 1E6UA 3JQFC 3V2HA 2B69A 1BTOA 3RCBA 2YJZA 2AQIA 2X58A 5DOVA 1TXGA 1GV1A 5IDXA 4DIBA 1WZEA 4B8WA 1IULA 1K3TA 1ZXLA 3TSCA 1U28A 1ZIDA 2X9NA 5KJCA 3CZMA 3ZNQA 4EI2A 4UUPA 4CLRB 2OXIA 2W4QA 2J3IA 4OSOA 1YE3A 2OMEA 1I3NA 4FN4A 4W7IA 1SBYA 5L3ZA 3RQSA 1RWBA 4CMKA 5IAAA 3EK2A 4JBHA 1OOEA 4DXHA 5A3VA 3N7UA 2YYYA 1ZZEA 2AEMA 3CMMA 3G49A 4ZJUA 4BO4A 3LF2A 4IXTA 3RFTA 1LUAA 4IUYA 3WMWA 2AQ8A 4CUKA 3E8XA 4M87A 3BTOA 4I5FA 4RF4A 5U4QA 1YONA 1R0SA 1D4FA 3L6OO 2GN8A 3PQEA 1O95A 4BMSA 3V2UA 3G17A 4TKMA 5G0WA 1GUZA 4J91A 4I1IA 1GAEO 1SEPA 3RKRA 1E6WA 4NBWA 2PFGA 2Y68A 1PU2A 1Y8QA 5A06A 1OC4A 1BDBA 1J6UA 2HJRA 4AICA 3FSRA 3C1TA 3GAZA 4CLEA 5K6AC 1IPFA 3QHAA 3WBFA 3MJSA 4II3A 5TSDA 1VI2A 1ZUD1 3RBZA 1IY8A 1GZ6A 3DQPA 1WAMA 1A5ZA 2JCYA 5F1PA 5TGDA 5CP8A 5DCWA 3KYCA 2PKQO 4E5MA 5IDWA 3H9QA 4C4OA 4WEOA 1MFZA 3F6YA 3JQBA 1TEHA 3Q0EA 4PG5A 1RM0A 4YAEA 5G0UA 3TFOA 4YDRA 3FTPA 4R01A 1O94A 1Y81A 4Q39A 4UVEA 2ZCUA 4IS2A 1W73A 3VPXA 1H6AA 1AXGA 1KY5A 3AI1A 3KSUA 4F6CA 5JPIA 1YDWA 1PQWA 2NU9A 5LDHA 2HUNA 3NT2A 3WGGA 1UDBA 4A0SA 1DIBA 4LVUA 4YCAA 4L0QA 2BFMA 1IPEA 1YQXA 2UUPA 1CJCA 4CMJA 3GVXA 3HN2A 3ZV3A 5JS6A 2G0TA 2ZB7A 3ENKA 1E3SA 3CINA 1JDJA 3I83A 4OXYA 3K30A 3RU9A 1P1JA 3PP8A 3KYBA 1ZH8A 4HP8A 1MG5A 5I8ZA 5JXWA 5T8KA 4CL8A 4HFRA 2VHYA 5KKAA 5ENVA 4WCDA 4Z9FA 3UW3A 2RIRA 4R9RA 4YQYA 4E33A 2RAFA 3EVNA 3VTZA 1ZKMA 2QW8A 4ND3A 1P9LA 1O9BA 1T2FA 5JYDA 3JQGB 4OXNA 4LVCA 4CUJA 3KYDA 4RPLA 5I7SA 3UH1A 4L73A 2J8ZA 2P5YA 1DO8A 4KWHA 1LLDA 1I2CA 1MUUA 5ILGA 1HEUA 3KEQA 2GPTA 3VZQA 4YT2A 4W7HA 3NDIA 2BKAA 3FI9A 3UOGA 5IZ4A 1KBZA 1B15A 4N7RA 3V1TC 4BUCA 3F4BA 2Y1DA 4GVXA 3AW9A 1E7YA 1DFIA 1PIWA 2CZCA 2PWZA 3DHYA 4PLZA 4FS3A 5JYEA 4IMRA 4J1TA 4PG8A 5KJ6A 2VT2A 5HA5A 1AHIA 4N5MA 1IZ9A 4OXKA 3PJGA 1XWFA 4B7CA 4BNTA 4XYLA 1ISJA 3H9JA 1OFGA 4E6PA 1M66A 2PD6A 1HDGO 4RJTA 3AOEA 2WYVA 1JAYA 3R6DA 3ZHXA 3GRPA 4RPGA 4DA9A 1E92A 2YDXA 4RQUA 4YJHA 4E31A 4DGSA 3IC5A 3F3SA 4K6FA 3B1KA 5AVOA 3DL2A 3PTZA 1ORRA 4TRMA 4DLLA 1D8AA 3HHPA 2H6EA 4DL9A 3RUAA 4A7PA 4D3FA 4Z3KA 4J0FA 2EF1A 3EMKA 4NMHA 3IUPA 1EUZA 2AEJA 3O4RA 2W2LD 3OSUA 5I9LA 1Y8QB 4D44A 4OM8A 4R3NA 3W8DA 4DQVA 2O3JA 1MX3A 1E6EA 2WE8A 4H16A 1FDTA 5TNXA 2OFPA 3NT5A 4NPCA 3FR7A 2WMDA 4YRDA 3AJRA 4DPMA 4QQRA 1FDWA 2VRCD 2P5UA 1IB6A 3R1IA 1OAAA 2O2YA 3TF5A 5TF4A 6LDHA 2Q2VA 4JXKA 4NNJA 1OBFO 4II2A 1UAYA 4S1VA 2NQTA 4N18A 4W9NC 4PG4A 1C1DA 4YEDA 1KC1A 4TRJA 3NAQA 3PQDA 4QT0A 4CQLA 4A27A 2O3UA 1YRLA 2CVOA 3RU7A 4YRAA 2AQHA 4GKVA 1A9ZA 3DAFA 2C2YA 2UAGA 1GQQA 2Y67A 1ISIA 1TLTA 5TLSA 3PGXA 4CODB 1P0CA 2YHIA 2NVUB 1SZJG 3STHA 2TMDA 1IYZA 3FPLA 4PLYA 1EUCA 1I8TA 1JVBA 1ZK2A 3ASVA 4AJKA 3QW2A 5KKCA 3FR8A 3BMNA 1EZ4A 2O23A 1PWZA 4CM9A 3D3EA 5ITVA 3L07A 5IXYA 2G5CA 2PZJA 1LDEA 3KO8A 5C3MA 2DKNA 4IDGA 3C8MA 1M6HA 3WQQA 2Y1CA 3QWHA 1E3WB 1EK5A 1Q0LA 3MZ0A 2TMGA 2V7PA 4K26A 3U5TA 1HDRA 2BFPA 2DM6A 3P7MA 3O8QB 5JLAA 2AMFA 3ZWPA 4XIYA 4P4LA 3X2EA 3D7LA 3KRTA 4CLDA 4XGNA 1PL8A 4WGGA 3ULKA 1IE3A 4URFA 1MC4A 4L9RA 5C37A 2HCTA 3F5SA 3K6JA 3UFXA 2Z95A 3AK4A 3GG9A 3BXXA 3F1KA 4W9NA 4MIOA 2P4HX 4GSLA 1GYRA 4BNYA 1ENYA 2HK7A 3U9LA 1D7OA 4FGWA 2I5PO 1NPTO 4R1UA 3DWFA 2E37A 3MJ4A 4PZDA 4BO0A 4BO1A 4I9HA 1FMCA 1YBMA 4BKUA 1UXJA 3GEGA 5DCYA 3DMTC 2HRZA 3SJ7A 3EAGA 4BMNA 1UDCA 3S2IA 1BW9A 3V1YA 4RF3A 4MVJG 3D5QA 4FSHA 4E21A 3TQHA 1XU7A 3KLPX 5IN5A 1LLCA 1GEEA 4BQPA 4CLXA 2GNAA 3EY4A 1EVIA 3S2EA 3KV3O 1W0CA 2P68A 5JY6A 1QV6A 1F12A 4A73A 4H3VA 3ZW8A 4B3JA 5A5EA 3DBHA 1Z7BA 3JD3A 3X2FA 1E1KA 2CMDA 3I1JA 2BHLA 2QG4A 4WJZA 1KETA 3GOHA 3WGYA 4ND4A 4Z6KA 5JC8A 1WW8A 3SEFA 4DRYA 5DCUA 2G82A 2I3AA 2VUUA 3ZH2A 3CZRA 5K6AA 4ALJA 3OBBA 2Q99A 3H9UA 4JP3A 1U4OA 2VYVD 4RLSA 1EQ2A 3MEQA 1WNTA 2X86A 2JAPA 3AOGA 3H8VA 2PKQP 1J49A 3RSHA 2NVUA 3ZNOA 3AM4A 2DVMA 2PZMA 3ADOA 3IOYA 3M6IA 1ARZA 4CLHA 2I76A 1LQUA 4S3MA 4ZVVA 4HADA 3CEAA 3MOIA 4ND1A 1W8DA 3UCXA 2YV3A 1RYDA 3M2PA 3QJ5A 1ZXBA 4BGUA 4NFYA 4E12A 3FRJA 4GSKA 4NJMB 3WNVA 5TQVA 4ALMA 3I9KA 1LI4A 4FC6A 1DFHA 3INRA 1F06A 4MINA 4GX0A 4KWIA 3RUIA 1DDOA 2FPGA 3NV9A 3CKYA 4D45A 3JQ8B 5AXCA 4BOYA 3H2ZA 4G2NA 2UDPA 4K9DA 2VWPA 3TRIA 3PHGA 1SPXA 2GZ2A 5KVSA 3M2TA 3P5SA 2X0NA 4F45A 3BZUA 1LDMA 2C2XA 3H6KA 3SVTA 4KMSA 1HKUA 4RPHA 1PZEA 2AQKA 2UYYA 2EW8A 4UAGA 3BAZA 3RROA 1VC2A 2D8AA 4OOEA 3W6ZA 4EDFA 4TWRA 5DP2A 2D4AA 2X8LA 2CFCA 3H4VA 2JAHA 4WLEA 4WKGA 5JAIA 1KIFA 1ADBA 2CDCA 3WLEA 1SMKA 3WGOA 2QYSA 3HJAA 3NTOA 2YFHA 1PJSA 2CNBA 4JBGA 4XA8A 1NVTA 3G3EA 1Y7TA 2YFQA 3MJCA 3T4XA 4GX2A 3LZ6A 4Y6RA 2VTDA 3AY6A 2C82A 3OFSA 4YXFA 1Z6ZA 3U4HA 1ENPA 2BH9A 4XEHA 4Y6PA 3RC9A 5L53A 2DBRA 4QXMA 1U2DA 2JHFA 1CWUA 3WGHA 3RD5A 2EGGA 4WEQA 3H5NA 1XG5A 1N9GA 3LC7O 2PLAA 2A9FA 1HXHA 1YWGO 3L4BC 4O5OA 1R0LA 1PZFA 3TPCA 1WVGA 2FR0A 3PQFA 2IRWA 4DIFA 5H82A 3VAZA 4KDFA 1TT5A 5KJEA 3ZHYA 4BVAA 3PYXA 4XR9A 4EJMA 1EUDA 3VKVA 4GWGA 4YJDA 1ADCA 1YJQA 2O3SA 2QRJA 1BVRA 3DZBA 3L9XA 2OL4A 3A28A 3GN1A 4KUEA 3SBOA 3JQEA 1P0FA 4BB6A 5FI3A 1JWBB 4ZICA 5CDYA 4AG3A 2YHUA 5JMPA 1T1SA 4CQMD 5AXBA 2AG5A 4XGIA 3UN1A 2EJWA 2P9GA 2X5JO 1BGVA 3TL2A 3I6QA 4J7UA 3WNQA 4BQRA 3RVDA 3F1LA 1VPDA 1QMGA 3U4IA 4OAQA 4J2HA 4AJOA 1SAYA 1XHLA 1HE4A 1N2SA 3PXXA 1KVSA 3KEOA 4HFNA 2VOEA 5L7WA 4C7JA 4KTTE 1ZSVA 3HFGA 1LRJA 4XIJA 4F46A 5HS4A 1V3UA 1Q0HA 2V65A 3BHIA 4IBOA 2ET6A 5CEJA 3ZI0A 5CDSA 1DHTA 4QECA 2PGLA 2WSBA 1AGNA 1SC6A 2GCGA 3UXYA 2ZCVA 4D46A 4BNNA 1M75A 2B4TO 3GUYA 1W6UA 3LT4A 4HY3A 1ONOA 4E5YA 1C0PA 2AE2A 2W2KB 3KYCB 4CM4A 1MXFA 4LGVA 1B7GO 2VWQA 1N1GA 3AU8A 5EMHA 4BNFA 5IN4A 5A9RA 4LN1A 2EKPA 3NT4A 3S1LA 3VKUA 1I2BA 2V6BA 4ZU3A 1EBUA 1V3VA 1Z73A 3PIDA 3BHMA 2DTEA 4AL4A 1B8PA 2BFOA 4MP6A 1PTJA 3RJ9A 3QA9A 1O8CA 1HLPA 2ZK7A 4J4TA 2X22A 3BMOB 4FC7A 4IDEA 3K92A 3NGLA 4MVJE 4LW8A 3ST7A 4IJUA 3SLGA 3DHEA 1SNYA 2DPGA 4L76A 5ICMA 1A71A 2HSDA 3D5TA 4TQGA 1NM5A 4OKIA 2OGUA 1QP8A 2PKRA 4FGSA 4IDAA 4NI5A 1Y8RA 4K28A 4YT5A 4BNJA 2EKLA 2DAPA 1LC3A 1DRWA 3CPSA 4L4RA 2QZ9A 3I4CA 1KEVA 4BGIA 1RM4A 3NYWA 5DN9A 4J9VA 1R4MA 2IE0A 2AW5A 3COSA 3F47A 4LMRA 3GGGA 4M55A 4MJLA 2W2LA 4BV8A 3PJDA 4HUJA 4UULA 3OF2A 1EDZA 1JKJA 2CSUA 5CPFA 1ZSYA 1VSUA 5G0TA 4DYVA 3L4SO 2Q45A 3M1LA 1YL6A 2Y99A 4UUOA 3ZV6A 3RUEA 1VSVA 2IZZA 3VH1A 1DEHA 3BMNB 2VRBA 5L45A 5HWSA 5DNAA 1O6ZA 1R0KA 2PY6A 4IDDA 2DTXA 1KVQA 2VHWA 5DDIP 1VL8A 3QVSA 1QLHA 2JL1A 1HETA 4KUHA 4HWKA 2RCYA 4IQGA 4BNLA 3GVPA 3F5QA 3U4CA 4BKOA 3ZWWA 5A05A 4B8ZA 4Z9YA 3ZWVA 4E4YA 4WLOA 4FPXA 1JA9A 4E32A 2GASA 1AXEA 1NX6A 4W4TA 2O48X 4AJNA 4XJTA 2PH5A 1A27A 3DBVO 2JD2A 3OICA 3JD0A 2GN6A 4Y98A 2YQ5A 3ZCXA 2DUWA 2YV1A 3ROMA 1F14A 4MOWA 1Z82A 2J3KA 3T7CA 1T2AA 4BL5A 1PR3A 3H5AA 5G0SA 3IDSA 5DF1A 1XELA 2WD7A 4XWYA 4CLOA 4ALNA 3ZWNA 3EZYA 1EVJA 3I4FA 1AE1A 3JYOA 1U3VA 5T67A 4M49A 3JQCA 4WOJA 2GN4A 4R51A 1A9YA 4HV4A 2Y93A 2Q1TA 3WFJA 1E7MA 4IDCA 4DUPA 4EEZA 1U9JA 4PFJA 1BVUA 4B4OA 5TIIA 3D4OA 4B4UA 4CM5A 3ONEA 4NFSA 4HFJA 3OIGA 3WB9A 3DMYA 4B3HA 2VN8A 1PS0A 4AFNA 4D0SA 3TOZA 3FBTA 1DIRA 4Y8VA 1GY8A 1CIVA 2Q50A 3MOGA 1KVUA 5I9MA 4YA6A 4QO8A 3RUDA 1Z45A 3WGZA 3DZGA 3GT0A 1Y9AA 2OP1A 4AJJA 4JCOA 3DR3A 4Q9NA 2VQ3A 4YJGB 1H9AA 3W8FA 4BO6A 1J0XO 3NEPX 1OMOA 4PG7A 5L7TA 5JCJD 4W6ZA 1ISMA 1H5QA 1XU9A 4ILKA 2GGSA 3W4JA 1K6IA 1Y5RA 3V8BA 3BTSA 5C7LO 1GPJA 2O7SA 1LDBA 2I66A 3DFUA 1GUFA 1HDYA 2HKIA 4E0BA 1ZMTA 1CETA 3PEFA 3VH2A 2DUUA 4XCVA 2ZTLA 4YB8A 1DBVO 5HBRA 4GX5A 1D3AA 4PLCA 3PYLA 2B5VA 3ZV4A 1P1HA 1CYDA 5EPOA 5KJ1A 3RBVA 1B8VA 4RVFA 5ADHA 3TFQA 3ICPA 2VCYA 4CL3A 4IY1A 4WECA 1PGQA 1QLJA 3B20A 2ILTA 1P44A 4XYEA 3GEDA 5KNLA 4WOKA 4BNWA 4M1QA 2YY7A 2P2SA 3U3XA 1DIAA 2CY0A 3GR6A 4EUHA 3V5NA 1LLQA 1LQTA 3WWYA 3DAPA 3IS3A 5U1PA 3ZWMA 5L4LA 1JLLA 1GU7A 3VZSA 1HYHA 4IJVA 1GV0A 4WLUA 5IZCA 4ZQFA 5JMWA 3LT0A 3E5RA 3ROQA 2I3GA 3DTYA 4RDIA 5CG1A 1XCBA 2BF7A 2P9EA 4PZCA 4BNMA 3OHSX 1ZMOA 2ZYAA 5KIAA 2GN9A 4EBFA 2C59A 2X9VA 4CJXA 4QUKA 4ZGWA 4UEOA 4UUMA 5J9GA 4NDNE 3V2GA 2X6TA 4I5EA 1ML3A 3WS7A 1P1FA 1ISFA 4CM1A 5JDCC 3PHIA 1TA4A 3O03A 4IJWA 2GSDA 3EUWA 3DTTA 4QX6A 5IF3A 5GZ1A 3Q1LA 4TRRA 5F5NA 4RVSA 2J5QA 1UH5A 4PG6A 1GL3A 4E30A 3D3WB 3GVCA 4XQEA 4FFLA 5FWNA 1A4IA 1MG0A 1O89A 3FNFA 3OMLA 4UVGA 1Y9EA 2R2GA 2W90A 5LC1A 4R41A 4WUVA 1HZZA 1YB5A 2JFFA 3JCZA 3P19A 4FQ8A 4EYEA 5A04A 5FF9A 5A9SB 3PDUA 1X1TA 4B3IA 4CR8A 1WPQA 1BRMA 4Z9XA 3VPGA 4ALLA 3H5RA 3HG7A 4NH4A 1QSGA 1QYXA 1QYWA 3ZWCA 3E18A 3GGPA 3OEYA 2ZATA 2PTGA 1H6BA 5JO0A 4ND2A 4Q3BA 4U7WA 3ZW9A 1T26A 4MVJA 4KDEA 3EHEA 1V35A 1QRRA 2VWHA 2BGLA 3C7AA 3OJOA 4PLVA 2VYND 3IIEA 3LT2A 2V6MA 1SEVA 2NACA 5U9CA 1NR1A 6ADHA 3DZHA 3A1NA 3RFXA 1ADGA 3ZHZA 4NJMA 3AUSA 1BXKA 1N8KA 4GH5A 3OM9A 3AUAA 4GWKA 4HX5A 3LU1A 3GMDA 3OJ0A 3E82A 1N7GA 1K0UA 2WD8A 2HMTA 4JGBA 1E5LA 1CQJA 4D3SA 1EEHA 3I23A 4OQZA 1G1AA 4ITUA 2IEDA 3SXPA 1R4NA 1HE3A 3GQVA 3WIEA 2ZQYA 3G1TA 4KZPA 5T6BA 3GY0A 4IS3A 4E13A 1E3JA 4AJ4A 4CMIB 1DC5A 2HAEA 2VZ8A 4MIYA 1B26A 1XA0A 3H9EO 3WOHA 4DREA 3KBOA 1NR7A 1YL7A 3VC7A 4MVJF 4B4WA 3A14A 3WGQA 3BMCB 1TVEA 2EJVA 3LSYA 1PJCA 4EW6A 4NFHA 1U8FO 4D3DA 4JJGA 2UUOA 1ZO8A 4O63O 3BMCA 4A10A 1UZLA 1YB4A 2O4UX 1NHWA 4IINA 5KJFA 1QYVA 4ZA2A 3JQDA 3GRKA 1CF2O 4IQ8A 3DOOA 1QORA 1E1MA 3OQ1A 1FF9A 2IXAA 4Z3DA 4DC1A 3QV1A 1CERA 2X9GA 3QWFA 5JBIA 4XJSA 1OZAA 3H7AA 3TZHA 1DAPA 4FFRA 3SX2A 1YDEA 4CMHA 2I6TA 1R12A 3AY7A 4Y67A 5H81A 1P33A 2EIHA 4NBTA 1NTOA 4ID9A 4GLLA 2VNAA 2GDZA 1QKIA 1FDSA 1S6YA 4J90A 1N9GB 3LVFO 3WYBA 1U2GA 2P4QA 4GVLA 4JLWA 5KWEA 5JDIC 3DDNA 1ONNA 5F1OA 3AM5A 5B12A 3IKTA 1DIGA 1ZEJA 3QQPA 3JQAD 3EC7A 5T57A 3WWZA 1NPYA 4EUEA 1PJ2A 3QWBA 3RIHA 2D59A 3O26A 3B6ZA 2Q3EA 3H3JA 3Q3CA 2BRUA 4GL4A 3PJEA 4Q3DA 1YXMA 1IUKA 2WWRA 4BV9A 4IZIA 3QVWA 2G1UA 2WE7A 4EJ0A 2AEFA 4P8RA 1NQAO 3FHLA 3FD8A 4XYMA 1FXSA 4GLOA 3ENNA 5IG2A 3CMCO 2HK9A 2QRKA 1BG6A 3GNQA 1JAXA 2VHZA 4BNGA 3ZN2A 2HDHA 3IQDB 4CM4B 4YJFB 1MC5A 4W99A 3DONA 4YAIA 4LRTB 1H6CA 2AG8A 3K8ZA 4I9UA 4Q3CA 3TZKA 5ITWA 1FDVA 1ZK4A 3OH8A 4XD2A 5JO9A 1BMDA 4RVHA 5DP1A 1EFLA 1I10A 4HFMA 2YW9A 3PI7A 4TZKA 1YH3A 4MKRA 1GPDG 4AJHA 2XXJA 2LDXA 1SCUA 3KB6A 4FJ0A 1E7RA 3PPIA 5JAMA 1E7SA 2HQ1A 4GKBA 4TROA 2NNLD 4U6QA 2GLXA 3KXDA 5KCZA 1I30A 1XSEA 2NV6A 4IIVA 2Q2WA 4NK5A 1GD1O 2UVDA 1VM6A 4IM7A 4WCFB 4YT4A 2O3QA 1HRDA 2BI8A 1VJTA 5CFZA 2GD1O 4A03A 1PJQA 3O38A 3VDQA 3ZWOA 1DSSG 4FFOA 3D4PA 2Q46A 3ONFA 3GEMA 2FPPA 3GZ4A 3UHAA 1XQ1A 4BNZA 2OOSA 2LDBA 2ZB4A 4NJOA 1K6JA 4OGWA 2C7GA 3KOUA 5GY7A 5EINA 1T24A 3DBHB 2HJSA 3I9JA 1E7QA 2H5LA 3ETEA 4NQZA 5AXDA 3RFVA 3TZCA 1PWXA 5FEUA 2QYTA 3VVBA 3HDHA 5JY1A 3FTNA 4BNIA 3N74A 1U3UA 1JU9A 5GZ6A 4CPDA 3EDMA 2VTEA 2XAAA 1NPDA 4YAGA 1BW9B 3NDRA 3QRWA 2E82A 3L0DA 4GI2A 2EW2A 4YJFA 2G76A 4GPD1 1DOHA 1VJ1A 4B7UA 1KYQA 4ZN6A 3VHRA 4BNHA 2Y0DA 3JYPA 2ZYGA 1B0AA 1KVTA 1VE9A 4RVGA 4XDYA 1F8GA 4XQCA 2Z1NA 1DRUA 3A4VA 4RF2A 1D1TA 2BMAA 5B4VA 4JBIA 1XYGA 1QG6A 4EZBA 5I9NA 2C5AA 3JYQA 3RC1A 4KQXA 4E5KA 1B3RA 3I9OA 4MPDA 4E3ZA 4WE3A 1JKIA 4H15A 5B4TA 1YL5A 1XR3A 4QEDA 4AVYA 3PFFA 2NTNA 3KVOA 4PRKA 5CEFA 4EITA 1H2BA 1G0OA 2DLDA 3GMSA 3GFBA 3ANLA 4R5MA 3ETGA 4R1TA 4FBGA 5TS3A 2OUIA 3W6UA 2DQ4A 4NIMA 3S2GA 3NGXA 1NVMB 2VHXA 4PLGA 3EYWA 5A5FA 3DZIA 3DEYX 2OBNA 2YDYA 1GFSA 4K6CA 3GNTA 2NADA 1KY4A 4AJLA 4E5PA 2DBQA 4QO7A 3L6DA 1JW9B 1ZCJA 1PEDA 2C54A 4RPJA 2FMUA 1ADFA 1HLDA 3UCFA 3FF4A 1BXZA 2GZ3A 1HTBA 2YV2A 2VHVA 1UDAA 3WX0A 3C85A 2VOJA 4U0JA 2NLOA 3JD4A 3BHJA 3D3WA 4J9UE 4BNUA 4NBVA 3KSZO 3AOEC 1C3VA 2ZTVA 1X15A 3JQAB 2WYWA 3M1AA 2OZPA 4O1MA 2V6GA 3ICCA 1NXQA 3AM3A 4DPKA 5BSGA 1DPGA 4Q3EA 4NHEA 2E6UX 3E6AA 3ITKA 4D79A 4QSMA 4WLNA 1SB9A 1PJBA 1S7CA 2Q1SA 1H9BA 1P1KA 5JFOA 3HZZA 4WPGA 4CM8B 1K5HA 3AI3A 1Q2XA 1ZK0A 3JD2A 1AN9A 1EVZA 5B4UA 1N5DA 1HDOA 2NU6A 1B14A 1KOLA 2Q4EA 2EHDA 2J5RA 3GN2A 3LQFA 4H7PA 3IL2A 3HB5X 4OQYA 4GX1A 1A7KA 2C0CA 2RH4A 4JIGA 2J5KA 2OP0A 3OQ6A 3JQAA 5JAZA 1RKXA 2B35A 1N7HA 3WLFA 1XKQA 3LF1A 4MP8A 3TOXA 5JC1A 4YACA 4FFNA 4J6FA 4NBRA 1NQOA 4CV0A 3QVOA 4Y9DA 3JQBC 2AXQA 5L4SA 3L4BA 1NFRA 3GF4A 3HADA 1CDOA 2O50A 4IQ0A 2Q4BA 1R4MB 1DC3A 1J4AA 1Y1PA 2GUGA 1YOVA 1C0IA 1OC2A 3EZLA 1XQ6A 4DMLA 4TKLA 4W82A 1TT7A 5A3JA 4CMEA 3IJPA 5JYAA 5KOIA 3TNLA 3FNGA 3ZU4A 1ZJYA 2QQ5A 3I5MA 1EDOA 3VZPA 4BO8A 3RJ5A 3WBBA 4NG5A 4IDBA 3OJEA 2FR1A 3QVTA 1GR0A 2CUKA 2WYUA 2FHSA 4LRSB 5CHEA 4OMUA 2RHCA 2CVQA 4M89A 1LDGA 1KVRA 4IJKA 1L1FA 3QY9A 5BSFA 5BNTA 2DC1A 1N92A 2A92A 2WDZA 3ZWYA 3K9QO 4FJ2A 5I7VA 2X5KO 4FFPA 3I3OA 4DLAA 3KZVA 4HXYA 2GZ1A 5TT0A 2BGMA 3KSDO 1GQ2A 1Y6JA 4J7CA 3ZZNA 4U5QA 3JQ9C 1LXCA 5FYDA 3WXBA 1M76A 3WGTA 2W98A 3VPFA 2FN7A 2B0JA 3ETDA 2O4CA 2YUTA 4FDAA 2GO1A 1PQPA 4FOOA 4MO2A 2CF6A 4OHUA 3HFSA 8LDHA 2IXBA 3MTJA 1UP6A 4XB1A 2FPIA 3DC2A 2A4KA 3DAGA 2C20A 1LNQA 3E48A 2VUSA 3LDHA 3ZU2A 3DBRB 4Q3NA 3KHUA 2Y05A 1V9LA 2VZ9A 1KERA 4OIMA
chains in the Genus database with same CATH superfamily
2Y27A 3VR6A 4FWTA 4GZ3A 1VFPA 2W6OA 2PDAA 1DQZA 2E3JA 1X14A 4FCTA 4TTAA 1JR4A 5DLEA 5ALUA 4NCAA 4L6IA 3FPSA 1QH1A 2WUGA 2I87A 5B1IA 4RY8A 4M6WB 2ZOSA 4CDNA 3OC6A 3OUTA 4EYSA 3TLBA 3S8EA 1K6XA 2HMUA 2P0AA 4UHEA 5FULA 3STYA 1UIMA 1S5PA 1G9TA 5EWLA 3UG6A 4GR9A 1U5BB 1M2WA 2IEAA 4FILA 3KR9A 1E6LA 2NZYA 4OYRA 5EZYA 4CTMA 2A0XA 3L8FA 1O0SA 1E2NA 1QE0A 1R6BX 2FDXA 3L7NA 3NDPA 2BISA 5HQJA 3WYEA 4CGZA 3F7NA 1ZJ5A 3DE0X 3IBTA 1GSOA 1NC1A 2WF6A 2H92A 2GF2A 4PIVA 5EXTA 1Q7GA 5ES4B 1Q0QA 3A11A 3QQ5A 2XUAA 4LCJA 3W4KA 5B2FA 3WYCA 3X1XA 2RBEA 2RHWA 2O3RA 3FMGA 4CKEA 1FIUA 3VZRA 5B53A 3LQRA 4C0JA 3SP1A 1HE5A 1Q7CA 3LUBA 4HRYA 1PVDA 3VPSA 1TYCA 2YUIA 1Z4IA 1BMFA 1FNSA 5DYWA 3SSNA 2J9GA 2H51A 1EVEA 1SQSA 2V45A 1T2DA 2C4NA 2A0UA 2XJ4A 1YI0A 3R8XA 4C7VA 2ZIXB 3ECSA 1PGPA 4YPVA 4QHYA 2I7TA 1F4PA 3FWZA 4HBGA 3ORSA 4KFTA 3TZLA 4WKPA 3VPHA 1KGDA 1W46A 1J70A 1G41A 1QGZA 4MYTA 4G65A 2G80A 1Z34A 2QM0A 5MFZA 3TE7A 4Z4IA 3AJ8A 3BYZA 3O3CA 4Q24A 1WQ1R 1Z4JA 2NQ8A 2Q9UA 4RZSA 3WWEA 2ZYSA 3Q6IA 1IK6A 4TZTA 2H07A 1WMEA 3INYA 1L5ZA 2BJWA 1WPXA 4MWDA 3TE6A 1U0OC 2GCIA 5HIAA 2ZI9A 3PXCX 1FLNA 4AKGA 3ILHA 2HPVA 4LY9A 1LTQA 5A71A 2JVIA 2EJUA 3BWVA 3T4PA 2HLNA 3ZU6A 5BURA 2RK6A 3IPAA 4UC0A 5IBCA 3TW8B 3IPCA 3BRSA 1JDZA 4C43A 1AF7A 2Q4OA 2KS6A 2LCFA 1MDBA 2FQQA 1TAGA 2BP7B 2RHRA 5FOWA 2FPGB 5DXAA 2JGIA 4JLNA 4O1IA 5H80A 3WICA 5L3QB 2E4XA 2JFHA 2WP0A 3COZA 2PYDA 3RQIA 3P27A 3ZWBA 1QHGA 3BMOA 4Z86A 3G0GA 2AWOA 2LTAA 5JAUA 3OJLA 1EXWA 2N46A 4FR2A 4CM6A 3S55A 2IODA 1VIMA 4K6GA 1T25A 4CQNA 2DT5A 3OCCA 4MPJA 4EI9A 1HYEA 2CXHA 4GE3A 3M1YA 1JAZA 4RKRA 3U3RA 3IBFA 4P80A 4U7GA 3JYNA 3WMRA 5KBYA 1LTHR 2EX4A 2B37A 3N2LA 5JISA 4JLUA 3TUTA 4FSDA 4H08A 1KI1A 3BMQB 2X8JA 3IVRA 2Q29A 4JZYA 3TINA 1NAIA 2EKQA 4N65A 4ONEA 2E49A 4EA8A 2XNSA 3GLHE 1ODSA 4KBFA 4N3BA 1WMDA 3GEPA 1WXDA 3G68A 3GHHA 3M6WA 4OBBA 4ENRA 1P77A 1XK6A 2RHDA 3DDSA 3GI1A 3N6RA 3QSGA 4NMWA 2QTTA 4Q9LA 5SV2A 4RTKA 1U0BB 4EJ6A 3QLVA 1Z74A 5BR7A 4RDCA 4FYVA 5FCDA 1IJKA 1P1RA 3EWSA 3DA8A 1MDFA 2R86A 3UMMA 1K4YA 5AESA 2V1UA 2I7VA 3PR2B 2C99A 4BS9A 4XKJA 5B7NA 1M6VA 5DK6A 2W7TA 3WY9A 1ZAKA 2M1XA 1KAHA 3GBSA 3VI3B 5HF5A 3DYBA 3GT7A 4XQGA 1MAUA 2Z8YA 3N0XA 1MXHA 3Q98A 1E2FA 4GPBA 1VXOA 4U7TB 3HU5A 4RH0A 3T3OA 5G4LA 2IIBA 4DIDA 5IZCC 3DXZA 2WSIA 1NZDA 1YZNA 2R48A 1WU7A 4JJIA 3T7IA 1U7HA 2VUIB 3AEKA 1ZD2P 4C7BA 1YK1A 1I32A 3RYTC 1JH8A 1T34A 1Y98A 3CS3A 1V25A 3UWOA 3R7WB 3O8RA 4L07A 3WB2A 1X2EA 2XYQA 1DAHA 4HH0A 3M70A 1TF2A 1SHTX 3EVCA 3MJTA 3DTVD 3GL9A 3MPOA 4HNRA 3RWBA 2PLNA 3S4YA 1A1VA 5A0FA 2PVCA 2FZWA 1DXYA 3PXEA 3JWGA 2SBTA 2BFEB 1P2FA 3OM8A 4V0ME 5HS6A 4AZVA 1PGNA 1FJHA 4IGEA 3R9XB 1U4NA 2ZYUX 3LGAA 2J30A 4ZC1A 1KP9A 2VL7A 4B1FA 5HUQA 4X1OA 4ARUA 4AMGA 3GC6A 3KKEA 3PC2A 3I0NA 4DLUA 2QX7A 2BSAA 4FI3C 2ZVPX 3ZY4A 3EN0A 4GMFA 4AS2A 3STTA 4F2PA 1VBFA 1U1IA 1SG6A 4MRNA 2H2DA 3JQRA 3PXBA 2PPLA 4I5GA 1VRVA 3QMMA 1PR2A 3WZLA 1MAAA 3USES 4HXGA 1U9IA 3PDIA 4AZ0A 5ABPA 1RM3A 2PPVA 3O84A 1XLTA 2X2FA 4JJAA 4NE7A 5IH3A 3TL3A 2YXDA 2A67A 1ZBDA 1MEOA 4P0QB 3RREA 3NAMA 5DWQA 3BF8A 2DOKA 3GB9A 2B7BA 1Z6XA 2JH3A 4UOEA 4D4KA 2QI9F 4IXMA 2E87A 3TTTA 4YX9A 3SJZA 3EDRA 3GXBA 1I3MA 3OZDA 4PZ0A 2PMEA 3O1HB 5TV2A 4DIOA 3U1VA 2BN4A 3TKAA 5HCUA 2ZRQA 3LMKA 3RV3A 1BEUB 1PJLA 1RJWA 4WASA 4RL4A 2PV0A 1VP9A 2F3UA 3BB4A 1IK4A 2IX9A 4YS6A 4YONB 4E7OA 2O8FB 2R751 5DX8A 4C4YA 4KH0A 5EXSA 2PD4A 3C39A 3BXZA 4GW3A 4GKJB 1D2EA 3CC8A 4HDMB 1D1SA 1LW6E 2GN1A 3RUHA 3E1KA 1NQVA 1ZKDA 3HI6A 4B47A 2AX4A 2GRJA 3KTAA 2H1HA 1NBHA 1KS9A 2HLPA 2Z1DA 1U2RA 1NOJA 1KDPA 2RH9B 3MTGA 1ZFNA 4XQ9A 4CLRA 1E8NA 1YFLA 2DFTA 1AKEA 1URPA 1SBHA 5ALJA 4E14A 5L51A 2YQZA 1E2JA 2PSHA 1NAHA 1P5RA 3GIDA 3OIFA 1AMUA 4LNUA 4B74A 4DV5B 3PPVA 5E7MA 3SHOA 1VCMA 5DIFA 1NYTA 2I55A 5J23A 1NMSA 1FFEA 2OLJA 1SUCA 4KN5A 1K6MA 3IA2A 3A27A 3UAVA 2OG1A 4WKOA 4Q4AA 5ECGC 3S2FA 4OYLA 1YIDA 4CEHB 4NH0A 1PL7A 5B3JA 4B17A 5FV4A 1NN3A 5IKPA 3SICE 3O5AA 3Q8KA 3HNPA 4IDQA 4L57A 1U2PA 2JPDA 3IB6A 4KWTA 4P0TA 1W96A 1JN0A 1FXWF 2BV3A 3SI7A 2OD9A 1GEGA 4PGGA 4RFVA 2FZCA 3R0ZA 4PZAA 1XA4A 4ZVRA 3FAZA 3GUVA 2VG8A 2Q6OA 4X94A 2Q2OA 1CUGA 4FJ1A 4QNRA 4B3DA 1SVSA 4AIRA 1E96A 3KYJB 3KX2A 2J7PD 4ZEMA 3LGXA 5CEEA 8GPBA 2Z8XA 1WZCA 1XAHA 1US8B 1JT2A 4I2NA 3VOSA 5ALFA 4B83A 2JCSA 1MA0A 1Q1NA 1YZUA 3GH3A 3L5OA 3PD1A 1SKYE 1NN0A 2C9DA 2ZT8A 1RZ3A 3KFVA 3VH3A 4AULA 3OZCA 3WHLA 2B5WA 2BFDA 5CB8A 2XECA 2EQAA 3TW6A 4OU5A 2H0RA 3THYB 4LISA 2GM9A 3WRWA 2W6JD 3R2JA 4JELA 4JNKA 5CA0F 1ZW1A 3I53A 4G9GA 1TAUA 2IHTA 1P74A 3THWA 2VYNA 1MZVA 1XROA 3PFGA 3G1WA 1PL6A 1H22A 1UC8A 3TSZA 4YR9A 4K1XA 1HM5A 1NMQA 3FUCA 4J2OA 4LWQA 1C9YA 4AP6A 1LSOA 1YRWA 4ERXA 4YLYA 4NCNA 1ML4A 2TSYB 2B4RO 2WPDD 4ECAA 4KK3A 3BD6A 4B3XA 1JTEA 3OKAA 1B73A 2FTKE 4FK8A 3RS3A 1PCXA 4UXHA 3IP5A 1T8SA 5COBA 1IQUA 4Y3UA 2Y9PB 2K2QB 1TJ3A 3OOWA 4M54A 4PNPA 4R1OA 1EVQA 1NULA 3GEHA 4MWGA 3ABIA 3GDGA 3PNPA 1U0JA 2FOLA 1K89A 3JSAA 2GM3A 2HJVA 3NDJA 4LX0A 4RXTA 4UVDA 1YJ8A 2GQ0A 3QKRB 2JEZA 1W94A 2ORWA 3LKDA 3LYUA 4EFDA 1Y4ZA 2QP4A 2GYYA 2GRAA 1U1FA 4RFSA 5IAGA 3AERA 2NM0A 1AV7A 1P31A 3VOBA 1M67A 4NAVA 2HV9A 3A0UA 4TUYA 1P4RA 3R0QA 3ESYA 3N05A 3FOWA 4NL4H 4YTEA 4K9NA 1EJ0A 4DARA 5TMPA 4H1HA 4C0KA 2H4HA 1KZ1A 1TF5A 3HNRA 2Q1UA 4WNIA 1NMEA 2UYQA 3ZWKA 4E70A 1WHTB 5LP6C 3KXPA 4K88A 3SZRA 1GNPA 2X1VA 2CLSA 1UADA 1S2NA 3PS9A 2O06A 1CLEA 3JATA 5FBLB 5C4GB 2IBTA 3AHIA 2XI4A 2FOXA 3G02A 1LC0A 3ZTYA 4Q9JA 3ONDA 1Z2OX 3CLSD 3UJAA 1F2UA 1JJ7A 3VISA 1BC5A 2ZANA 1T0UA 4BMXA 4F4HA 2GSWA 1I51A 4MUIA 2FZVA 3IOEA 1SZDA 3K70C 4IVPA 3U7IA 3NIWA 4JS0A 3UUFA 4TXJA 2ZJYA 2V7XA 1NXOA 1JVSA 1UWKA 4WCVA 2LBPA 2XSZD 4F6LA 2AUTA 4MI3A 5ALIA 3GRYA 3VUEA 5HOQA 5AK4A 3EXAA 1PHRA 2NVWA 4WN3A 1ST3A 5IJ9A 3KSBC 1EDBA 1G5QA 1O3YA 1Z5NA 2XF8A 2V3VA 3L1JA 5C18A 5JECA 3UJ9A 1BDMA 1YHZA 5A7GA 1E79D 2F3QA 4BKRA 3GLSA 3ECAA 3H1FA 4AZ3A 3W9YA 1C9NA 4UZSA 2BBSA 4GBGA 1T4BA 1R10A 4JEIA 2GVZC 1D0VA 1FU7A 3L8ZA 4UEJA 3OA0A 4PSUA 3WL4A 4QFDA 2VT3A 5FV7A 5A3SA 4R54A 2ODTX 3BRWD 2Y8EA 3I73A 1GPNA 4CV3A 1O5IA 3GLFE 1T1IA 2BFCB 2J46A 3E7FA 1HT1E 2WLTA 1E1NA 2XLBA 3A4TA 2VBIA 3HBJA 2P4SA 2OAQ1 2ZPTX 3GFFA 3PFNA 1SCBA 1BGWA 2WG2A 3T41A 3ZZTA 5KQRA 1DCTA 2QGNA 2R6CA 1NVGA 3QXGA 3TW0A 2ZSJA 5DTIA 4WN9B 1PGOA 2DH6A 3MGGA 2G17A 1A97A 3PGVA 3ER9A 1WUHS 3S2YA 1MB3A 4J4BA 1JWLA 3FTFA 1JE0A 1I5OA 1W5SA 1QBKC 2HPZA 1G5FA 2FZEA 4HO1X 5K99A 5K3SA 3KE8A 1HLFA 1VYHA 2W8BA 1TRKA 1JQBA 1H2HA 1I3KA 4IR7A 1KEEB 1EHCA 1SUBA 3AFNA 5C80A 4YBZA 5BN5B 4A2PA 3AHFA 3K4HA 1RRCA 1QGUA 3I2KA 1ISPA 1JXOA 1PSZA 3ZE1B 4V38A 5D5HA 2CK3D 1DJQA 4DJTA 3AF4A 2FVXA 3PXUA 4E51A 3OEHD 3LDUA 4TKUB 5FUYA 3ZS8A 4ZYXA 1G8FA 2G9RA 2ZE6A 3HL4A 4PSAA 3U49A 2HWUA 4HTFB 5ALDA 3VR4A 2YOGA 2YNMD 1P1CA 1RYEA 2AG6A 3D4IA 4TRNA 4C0WA 4ZDJA 3NTRA 3NRCA 2XBLA 1K86A 4O25A 3WMXA 1WDMA 4IV0A 1RYYA 1VMDA 1G20A 2XT6A 3EIFA 3QVMA 3MILA 2O7QA 3QU9A 1CZUA 3UJPA 2HR1A 1RWNA 1YBAA 3M3HA 3ND9A 4MYUA 1IN4A 3GPCA 3CKKA 3KWFA 4KTVE 3SEAA 2O8EA 5KC8A 4LMPA 2VKQA 4NCJA 2G6TA 3HVJA 1GP2A 1EKXA 3ZDZB 2FSUA 2H17A 4H7JA 1RAEA 1H3NA 4ZAGA 1YIOA 5AMXA 5KWJA 1D4OA 4EIWA 2JZOA 2AMYA 4LECA 3QE2A 1OI7A 4KYVA 5J2UB 4E09A 4EAQA 1U31A 2O8VA 2GBIA 2XQJA 4H31A 1C7FA 3WTBA 4EFMA 5CFPA 1R0CA 2EXXA 2PUBA 1G5RA 2B6NA 4R3WA 3ANMA 3IDFA 4BFCA 3NM6B 1HT0A 4P9NA 4ZV4A 2C29D 2R6JA 5K0BA 4NWIA 3RC2A 4EB0A 2CFRA 4OBXA 2EATA 4L5BA 1BXRA 4RDHA 4WW0A 5TQ0B 3W1VA 4BKQA 4DDVA 5K8TA 2JGRA 3T5DA 3LXRA 1Q7EA 4B79A 4PTYA 1JRLA 2JI9A 1L5YA 3O82A 4DT1A 2EG5A 3W0LB 1WXXA 1BVYF 3O92A 3O2QB 1TZKA 3ORFA 4JB3A 1MVLA 2UZIR 2RC6A 3HYRA 1B42A 3QOWA 4TWIA 3F67A 2B6HA 5CU7A 2W2KA 2WSSD 2IYSA 1P29A 4HGRA 1L7NA 4GOMD 6NULA 1YTUA 1BSVA 1TK3A 1WP9A 2RHLA 4FW8A 3TNDA 5IYZB 3NVKI 5JFOA 4R8RA 4OI1A 2MINB 2X0IA 3JAWB 4BIIA 4BQQA 4C6TB 1D2RA 1AJEA 4WY5A 5K2OA 4DLWA 3CM0A 3INGA 1QGOA 4XUCA 2AZXA 3ICWA 4Q3OA 2H48A 2IDJA 3CX7A 3EUEA 4KNVA 2FETA 4EHDA 2DPHA 1G3UA 2PA3A 2L19A 4YXWD 3PNKA 4KWCA 1NWCA 2R5WA 4IXWA 1MGPA 2QLFA 3K94A 4DDUA 2IJGX 2QY9A 3BPSA 3M4NA 3HDTA 3DOEA 4L5YA 1XRNA 4EPYA 1UBJS 2D00A 4WXPA 5LQKA 1JDBB 1A2OA 1XYVA 4FUTA 3TDNA 3KJXA 4N5NA 4QELA 2IZ0A 3K4QA 4V0OA 3PQ7A 3CBQA 5B2ZA 1JDTA 1NLZA 1Y4UA 4KQHA 1QVWA 1Y1TA 1RVV1 1KAGA 4ROTA 3T35A 3BJRA 5TB5A 1R4NB 3EG9A 3L7OA 4PFKA 4TSKA 2P9JA 1S02A 3GLGB 1Q91A 2QU8A 1SVLA 2QYHA 2YZ7A 3VBEA 4TWBA 2FMIA 3DOUA 2PUGA 3NDBB 1XVVA 3VFDA 2J4DA 1SOVA 1Y89A 4JEMA 4PLHA 4PLWA 3CUTA 4TQAA 4PLFA 3SQWA 2AOUA 3ESBA 1MGOA 2BP7A 4FEEA 4GPTA 4J1NA 5TX7A 1PSWA 4D9IA 3K2EA 4TOIA 2QT9A 4D41A 5IVIA 1EFRD 1QTNA 3RYHB 3OT1B 2XUIA 5BMVF 1KEEA 1XALA 1U3TA 1FSSA 2JGKA 2PQMA 2R6DA 5F3WB 3UM9A 3FBGA 2EWMA 5K5EA 4PCVA 3HWRA 3MWEB 3ONNA 3Q40A 3DLTA 4HVTA 1HYBA 4D0RA 3M49A 4BVJA 2I2CA 1VE7A 2ST1A 2WWXA 5B37A 1HSOA 3ZIUA 1V1RA 8MHTA 4Z1MA 3I1YA 1V5IA 3P9NA 3WMGA 2C07A 3QE0A 5CNMA 2NZ8A 3ZQ6A 4YPOA 4PWYA 4AJIA 5F2OA 3WO0A 1DUVG 1F8YA 3O95A 3PWSA 1A72A 3EP6B 3MB5A 2QVXX 5I7EA 5EJ7A 2AKEA 2WFAA 1BD4A 2O2CA 4V0KA 3V4RA 1IEXA 4EPVA 1ESEA 1XTBA 3L1VA 5EIAA 5CB6A 2Z83A 1R4ZA 1B16A 4IOLA 4AJ1A 2YIMA 3TRJA 5HKBA 4OB7A 2FE1A 4DPLA 4LDJA 1XDDA 2NSDA 1NLUA 3LWDA 5ELMA 4DDTA 1JHMA 3CSDA 5TT1A 5CH5A 3FFBA 3H9BA 3DVAA 4NULA 3D2AA 1DX6A 2GM5A 2ERYA 1U8XX 1NVBA 4WSOA 5AUNB 5EN4A 3ML1A 4BMPB 4CMBA 3ITDA 3K0BA 4BO7A 3I12A 5DBHX 2WJYA 4BU1A 1C0LA 4MDHA 4XRRA 3NKLA 2OHOA 4M9CA 4ZWNA 4L4SA 1AKNA 2YVKA 4QEZA 1I9CA 5DBEX 4EVQA 4QUHA 1MPTA 2JFZA 5DMXA 2A1TS 1H94A 1JKFA 3OQBA 1BXGB 1DAFA 1HF3A 1NFQA 2Z2XA 3F96A 4QBGB 5B1HA 3H9GA 5F3RA 3D02A 3Q85A 4KAXA 1F0KA 2MR6A 4Z99A 1CULC 2XZTA 3EQ2A 2IK8A 4OJQA 4ZU1X 2DCUA 3H11A 3C5CA 5AQEA 5D87A 5T73A 1L1RA 2ECOA 4TXHA 3P2OA 5JZMA 3QYPA 1G5HA 4D9KA 3GLFB 1Z4QA 4M98A 2CLFB 4EF4A 3ZDXB 3B1XA 3GJTA 3PL1A 1P1BA 1MU0A 1J0DA 1I3LA 1ORIA 2CFOA 4NU6A 1L5GB 1Y34E 3VHXA 5F5LA 3ZBPA 1NP7A 1U6KA 3G7SA 3MCWA 4OJKA 4GPEA 2PSFA 2OSVA 4LOJA 1STOA 1PX0A 3AHGA 4OH1A 1AKMA 4PLPA 3GJ8A 4KMRA 3DGEC 2P35A 3B1JA 4FGUA 5SY9A 3U26A 3K5IA 1T4DA 2EZUA 2G1AA 1GWNA 2HCFA 2QMOA 2DPYA 2UVPA 3C7KA 3FFAA 3I28A 3JAKB 4IL5A 4IVNA 5DO9A 2XVAA 3W5VA 3CLTC 2Q8NA 2DF8A 3DXYA 1C1XB 2H18A 2CNLA 4FBLA 1L7VC 4BGEA 4R69A 4CXMA 4Q7LA 5A5VA 2EJBA 4OA5A 1S9HA 2FX5A 3BAFA 4MX8A 1IUOA 4MGIR 4IH1A 3WQRA 3O1IC 4MUHA 2F1KA 1KOJA 1EHIA 4ALKA 4JWKA 4L7QA 2BF4A 3FGZA 3WWCA 2NU8A 4LJ4A 5A9SA 1KEPA 4ZHQF 1TLLA 3I6BA 3WV5A 4HDMA 1T8UA 3P52A 4D9HA 5CGZA 1F6WA 2QR3A 1TD9A 2ZSKA 1KSJA 3N2ZB 3NCHA 3CE6A 3H1EA 1VMAA 4FZRA 3U31A 1PQ4A 1M6YA 3OTIA 4C2TA 1MV8A 2YWHA 4C6RA 4X54A 5J47A 4Z4FA 4B7XA 1J39A 5FL7D 5LXTB 3HUDA 3IUJA 1DRVA 1IM5A 1Z0SA 4MQEA 3T7RA 4IIUA 4WINA 1X80A 1KI9A 2ZB3A 1KTVA 4GAEA 4MLDA 3A1CA 1MVNA 5REQB 3LY8A 1X19A 3K9WA 1H2AS 1FJGB 3MXOA 2PXAA 2PZKA 4CKCB 3R3JA 4P22A 3FNHA 3MELA 4XUDA 4B81A 3LCMA 5KS2A 1AC5A 1IAQA 3OZWA 5IAOA 4OV6B 4AJEA 2E4AA 2X1HA 3AVWA 2ECQA 5DYGA 2BFFB 1CRWG 2O57A 3E05A 3UMBA 3TWOA 3SJUA 4PPYA 1UAGA 4QBFA 3ZNPA 4EHKA 1OH6A 1MO5A 4J76A 2O3TA 1RACA 4LY3A 4O2AA 3E9NA 3KVRA 5TQ2B 2CHUA 2BCGY 2D5AA 1H42A 4UVIA 1P80A 2FEXA 1DBQA 1ZSNA 4MV1A 1Q22A 4D0LB 3KBBA 1QDUA 3DVQX 2ACVA 3B70A 3HCDA 4HGNA 1JLHA 4KQCA 3AKDA 3HDQA 2P6OA 1UBCA 1UJ5A 1ZD1A 2OR3A 2RG1A 1U5CA 3DE4X 1FNMA 3HACA 4WXRA 4ZRMA 3VR2A 4A2CA 1RIFA 3L8GA 1DADA 4W1QA 1XP5A 3N7AA 1YKFA 5KOJB 3GZNB 2GPNA 3UGKA 1YAJA 4HDAA 4X64B 3Q8MA 4OB6A 3BXGA 1WABA 2D0IA 3PPYA 3A31A 1UBNA 4Z51A 4Z0TA 1OGJA 3FVRA 3PQ6A 2JASA 2ZKLA 3TMKA 3BGDA 4RY9A 3ZLVA 1EFUA 3P20A 4QUEA 5BSVA 1DKOA 1BTOA 3RCBA 2LWIA 4CDMA 1JIUA 2JGAA 4RTPA 3NM4A 4PPGA 3T8YA 4ZAFA 4UNRA 2AFIE 3AB8A 3A0RB 5DGDA 3IRVA 4O4JB 4F3NA 4CR8A 3NUQA 2OV6A 1EGHA 2PXHA 1U28A 1ZIDA 5KJCA 3CZMA 3A6KA 1MENA 4CLRB 3D7KA 2OXIA 5AM1A 1AKWA 2GHQA 5EJ4A 4AY4A 4OSOA 1AVTA 5FR2A 4FN4A 2YWCA 5FBZA 3D6TB 5IAAA 1T4CB 4UKDA 4JBHA 4IIJB 1WCYA 2WG0A 4N7MA 3RIYA 2OFXA 3A6GA 3A58B 4DXHA 3MJDA 2RG7A 1Q7TA 3JATB 2YYYA 3L0CA 4RS4A 4TL6A 4BEJA 5ALLA 4ZJUA 3B2NA 1XZKA 5BSMA 2C2ZA 3JASA 4M87A 3RSFA 4YCMA 3K8QA 2IYXA 1CC1S 3DE3X 4NS1A 3EVDA 4IDHA 5E6RB 3D31A 2H9YA 2HT6A 2IXEA 1M34B 4TKMA 4EG3A 4MCAA 1GUZA 4J91A 1U98A 4I1IA 1QGYA 4X6YA 3DMFA 1G55A 4G8JA 3ZC3A 4ODIA 1JYFA 1Y8QA 1TKCA 1GTRA 1ILEA 4AICA 4AG5A 5FQOA 3D0KA 1UJNA 4ZIRA 1ZN7A 4AP9A 3WK9A 3A9CA 1SKUA 4HB2A 4KYIB 5IX8A 4BTLA 3QHAA 1S8OA 5J4KA 4MLZA 2XTMA 3WBFA 2O2JA 3FZYA 1EX9A 4BLWA 2EJCA 4II3A 4E1BA 5TSDA 1NNEA 2BGJA 2FFBA 1IY8A 3CA8A 3Q3IA 1A5ZA 3HR4A 3DOFA 4WRRA 1PZNA 5BOVA 5C1BA 1VCNA 4GT1A 4EG7A 2HV8A 3L7LA 1UWVA 3KYCA 2PKQO 1EGQA 2WU4A 4E5MA 2O0KA 2CJXA 3UJCA 5HE8A 5IDWA 1U1EA 2IS2A 1Y1SA 2JJ2A 1GM5A 3JQBA 4GSYA 5KNDD 4QVKA 5EG5A 2OKGA 3ZZUA 2VDPB 4WTOA 3ETJA 2ZBQA 3H19A 1G5TA 4G5YA 4AZTA 4YAEA 3GDWA 3H8WA 2ZITA 3FTPA 3OZBA 2LCQA 3IIJA 1O94A 1WKBA 5HG0A 1QHYA 2REOA 2X2PA 4HLDA 4WN9A 2C31A 4UVEA 2ORED 3TD6A 3OTWA 5A2GA 5E6SB 1H6AA 1AXGA 4H18A 3ZEIA 4CHTA 3OKFA 2VLIA 4G8BA 3T3HA 5EVCA 4M53A 4LXTA 2UZAA 3NIDB 2HUNA 4V1CI 3NT2A 3QU4A 1UDBA 1YUMA 5T3UA 4LVUA 2I8CA 1U1DA 3DH0A 4DIUA 4KO8A 4YCAA 2OSBA 3WL7A 4BFVA 4FS8A 3H5VA 1SQ6A 4B87A 1HG0A 1L4KA 2PTHA 5DWDA 4OHZA 4ZYWA 5JS6A 5TS2A 2ZAIA 3K9CA 1GKYA 2EFEB 4UNQA 3I83A 2CLHB 3PP8A 4K0KB 1OLXA 1RWVA 1HUQA 1P7PA 4HP8A 3DV0A 1DAKA 5I8ZA 2O6HA 4HFRA 2WMYA 2QV7A 4FMCF 4PC6A 3EJWA 1E2LA 2PQ2A 2QVCA 4Z9FA 5ENVA 5JZOA 4MI6A 1CS4C 2I3ZA 2RIRA 3JZDA 3OU2A 2FQWA 2PCLA 1IBRA 1SHLA 1HBJA 4FUQA 2QW8A 4A6XA 3R6WA 1XWWA 3KL4A 4N5IX 1D5CA 3JQGB 3L7AA 4GDMA 3EZGA 2OB2A 1PNTA 3BXHA 2HD4A 3HWSA 2HA5A 3KYDA 2GT1A 3HBMA 4UD6A 1OXSC 4UW9A 4RPLA 3C97A 4MUYA 2GHIA 2P5YA 1C3OB 3KT0A 5ILGA 1VI5A 3KEQA 3V8QA 2QJOA 4MA0A 4KIGA 5FWXA 1JG2A 4O2BB 2BKAA 3FI9A 5B6JA 1S7GA 1T1JA 3UOGA 2C7QA 2NUBA 5IZ4A 1VJCA 1KBZA 2WC1A 2WFLA 1CQJB 2OLKA 3I6ZA 2PMCA 1SC4A 2NAPA 3AEZA 1C9KA 1PIWA 1O7JA 3D6VA 3MVEA 1DE0A 4PLZA 3UPTA 1B23P 3E53A 5JYEA 3DTNA 3GPBA 4RHXA 4XVCA 5G41A 5KJ6A 3F8SA 1XRLA 1WPRA 1J2RA 1AHIA 2HHHB 1CB0A 1IZ9A 1QG2A 1XWFA 2FXVA 2VK8A 2YVQA 4QTUB 4BRZA 3H9JA 3MA0A 5DM60 2R7LA 1YC2A 1M66A 2PD6A 1HDGO 5FUXA 3WYGA 5A3QA 3NC1C 3AOEA 3FY4A 4LBYA 2WYVA 4ZO6A 1Z5ZA 4HMOA 5I8PA 3CVVA 3PCTA 4TS9A 4MYHA 3T5BA 4DA9A 2E4YA 2I7XA 4RZXA 3QPWA 3QXSA 1QUFA 2ATCA 4RQUA 4AO6A 5EJFA 4D97A 4E31A 1E0AA 4AY5A 1EK0A 1ZMXA 1W29A 1BE8A 3M9XA 1W2GA 2L69A 3KIPA 1ZNYA 2YYSA 2FPWA 4UE2A 1RYNA 2JIPA 3HHPA 4Q01A 1KFKB 1J8YF 3PT5A 4CEIA 2RFLA 3PUKA 4EKYA 2BR5A 1T1EA 1V8PA 4DA8A 3SK0A 1ZW6A 1N77A 3EMKA 2OD7A 3UC5A 1EUZA 2CXQA 5JVDA 3ZUGA 3O4RA 2LV8A 3ZPXA 2R6FA 3OE7D 2P6UA 3MBKA 4X97A 1DXQA 1X3SA 4IDOA 4N9WA 3AZQA 4X60A 2ZQ5A 1E2EA 4MRVA 1G8GA 1J1IA 1MX3A 4TQ9A 2ZIFA 2RKOA 5DHQA 1ZCFA 2B0CA 2WE8A 1KU6A 2DRIA 1SM4A 3UA3A 4FFWA 4A91A 1GNRA 1G7SA 5TNXA 3QLUC 1DKQA 2OFPA 4UBIA 4LA4A 2ZBRA 3ZDRA 1N78A 1TD1A 2HDNB 4FLEA 2WMDA 4EG8A 4YRDA 3QU7A 4DPMA 2XHZA 3DT6A 3QVJA 5J2TB 1IB6A 1WV0A 2GCEA 3LDFA 4U2KA 1AU9A 2DQYA 2Q2VA 4P4UA 1OBFO 1UFRA 2VF8A 4II2A 5FPQA 2NQTA 2I0FA 1XZCA 2YJGA 1F3OA 4N18A 1ZLYA 5J1TB 3T5MA 1YFZA 1ZN9A 5B3LA 3EZFA 1IMOA 3NAQA 3MS2A 4PS0A 5H16A 1E9AA 3K05A 5TEVA 3O1LA 3VHLB 1QQAA 1W75A 5KYWB 1R7RA 1JSLA 1EWVA 2YHSA 3DCYA 4GKVA 1LBSA 2FFQA 1OBVA 3F98A 1J8FA 4RIFA 2QXUA 4Q93A 5BY2A 4P58A 1HI9A 4RZUA 2IP4A 1JLLB 2WDPA 3PF8A 5EHGA 3B5EA 4QXAA 4YAUA 5IT9A 3UOAB 5SZIA 1P0CA 2FP4B 1PR6A 2QNRA 4EELA 2VXBA 3FPLA 4P4SA 3ASVA 1ZK2A 1YI1A 2A7XA 2R2AA 4I36A 4AWAA 5LSAA 2PX0A 3AESB 3FR8A 1VDMA 2W2OA 2DT8A 1FFSA 1GXSA 3BMNA 1OXUA 2X3UA 2XRMA 2G7MC 3L1HA 1XZEA 1NM5C 2G5CA 3U3MA 1PAUA 3NXKA 5DNDA 5BWCA 1N36B 3JAWA 2YMQA 3IEMA 2GBLC 4P5EA 3UJBA 2HADA 4DV6B 1I4TD 1GNTA 2Y1CA 1I1OA 1YR2A 3QVKA 3SBDA 1EK5A 1YR7A 3CLUC 3I1FA 5EUQB 3UAZA 1KQ3A 3BIFA 5CCXA 4YY3B 3FMPB 4ESVA 2H5EA 2W6ZA 2UVQA 2AOTB 3U5TA 4GZMA 3IBSA 2IEZA 4KSYA 1JA1A 1VYTA 4XIYA 4P4LA 1T9GR 4D3ZA 3MTIA 2OC4A 3N0VA 3EGCA 3WRVA 2ECFA 2HU8A 3OZRA 3X2EA 4AS1A 2CMGA 4YREA 3QF4A 4XGNA 6GPBA 3WRYA 3BCHA 1OREA 1I7BB 2D0OB 4AW9A 3K70D 3GEIA 5C37A 4P32A 5JROA 3UFXA 1A5AB 2G70A 3AK4A 1VLHA 3SFTA 1W1IA 3REQA 3WKEA 4B6GA 4PRYA 1ENYA 3P9YA 2WJZB 2RGAA 2PQ6A 1D7OA 1M5UA 2PUHA 4LNHA 5HZHA 1Z4MA 3Q0IA 3L46A 1NPTO 1SIWA 3JWJA 1M2NA 3OLWA 1E5XA 2I29A 3DWFA 3MJ4A 2W2NA 4QVIA 1W0JD 4I9HA 2NT3A 2F62A 1FMCA 4FFDA 3AEQA 1RJFA 2J1LA 4BB0A 2PZEA 5EJ8A 3V1YA 4MICA 3BCUA 4IIXA 3DWGA 4E21A 1UC5B 1LLCA 1GEEA 2PUTA 3EXEA 2BGGA 4AJ9A 4DCCA 3MLBA 4UNPA 5EE1A 1NXXA 2K4MA 2OAGA 2WUFA 1LV7A 2BH2A 1MOZA 1OYOA 4H3VA 1OX4B 1Y5NA 1M1NA 1UMBB 3COVA 5FLEX 1G8YA 1MO3A 4DWOA 4BYGA 1XZPA 2FZGA 4OFZA 2BHLA 1TKRA 1RI5A 2QG4A 1KETA 1UBTS 2V54A 2LE0A 2OXRA 3GOHA 4FONA 4JGIA 4ND4A 4DSTA 3GPLA 4DRYA 4BP1A 4C0SA 4RABA 3WDLA 1N1DA 4R31A 1PTKA 3ZH2A 2QRMA 2ZSIA 1VSBA 2WLSA 3KFXA 3KP1A 3OBBA 4H7FA 4ALJA 5K6AA 3P0IA 4RLSA 3MWFA 3FPAA 3NO4A 1ADJA 5ALXA 2X86A 2RDMA 2JAPA 3PDWA 3ZUPA 4D9GA 4C5CA 2ZKIA 4KXYA 1UL1X 5LKRA 2DVMA 1QIGA 1E32A 1WUKS 2HU7A 3IOYA 4CLHA 4FXPA 4NABA 4AXBA 2C3OA 2AZMA 1UPUA 2IEYA 3I2IA 4A1FA 1CRPA 2J9XB 1GARA 2PIDA 2Q9AA 3ILVA 1RYDA 1G3QA 2QT0A 1G66A 5B7QA 1GRRA 3S40A 1K3UB 3FRJA 4RTRA 1UKZA 3T9BA 5TQVA 3W6PA 1THTA 5CT9A 1KMQA 3DHWC 4QWMA 1T9HA 2PSSA 4MUMA 1M2OB 3JZFA 3INRA 2C2HA 3EGDB 1F06A 4FNAA 1R4AA 4LYAA 1CE8A 4OI2A 4OLJA 2XDQB 4RZ3A 2ZWOA 3M89A 3TDMA 1XTIA 3VHQA 4B2LA 1GRNA 3JARB 4BQFA 2QMYA 3I42A 1L5RA 3EVBA 4I4NA 1JENB 2G71A 2V6JA 1UC4B 3M6MD 4G2NA 1ZHOA 3M4XA 3UYLA 4I1YA 1LD3A 2P6PA 1SPXA 3CUUA 3TRIA 2GZ2A 4DLYA 2XUDA 4RYDA 5JSQA 1LDMA 4YR7A 3RW9A 4KMSA 2OCGA 3MWYW 2IWHA 2X7JA 4FHZA 1PJAA 2VDMB 4CG0A 1SVMA 3CCCA 2R0QC 2CNWA 2VDVE 2VYFA 4KJXA 2X8BA 4DMKA 5F9HA 5A4KA 1WSDA 3ZK7A 4S05A 1VC2A 2D8AA 3IAM1 4OOEA 2G8NA 3W6ZA 3SYNA 1CCWA 4EDFA 2FSVC 5AW0A 1QK3A 1U63A 1C81A 1J9ZA 1ZOPA 4WLEA 4WKGA 2ZDHA 3A25A 5JAIA 4C2BA 1L5QA 2PU7A 2CDCA 2JJ2D 1JU3A 3HCPA 3WLEA 1X1DA 3WGOA 1QIJA 2QYSA 3CJRA 2IOFA 3UFXB 1Z8DA 4MWBA 1J1ZA 1J25A 2ETVA 1Y7TA 5KU1A 4DE5A 3LZ6A 3SSMA 3IKMB 2VTDA 4PEVA 3EASA 1RYFA 2C82A 3HUEA 1NLMA 1ZICA 4LDAA 3AYXB 4R81A 3I5UA 2E0IA 2VF4X 5DCLA 1ENPA 2IZ7A 7MHTA 3AF1A 3BEOA 3ICVA 4TM8A 1A8HA 5L8VA 2YC2C 5L53A 5LQRA 1J33A 1XAJA 3Q9LA 5EZSA 1U2DA 3ZCVA 4B2YA 2JHFA 1CWUA 4OU4A 3WGHA 2QTNA 1OW3B 2EGGA 4GYWA 2IHKA 1PE0A 4OBEA 3RD5A 4DSAA 3J80A 1RJEA 1KI3A 3H1PA 1WBJB 1A7JA 2PLAA 1P72A 3SIWA 4CFSA 1HXHA 4JKIA 1R0LA 1DKUA 1RWPA 1Z12A 1YZLA 2FR0A 2Z9CA 4RKQA 3ZQUA 3IV6A 5H82A 9ATCA 2QJFA 5CNKA 2WOOA 1PT6A 3OZFA 4M9SA 1MX9A 5C8YF 2KM1A 3JALB 1JKXA 1BKYA 1JG7A 4GWGA 1ADCA 3IA7A 4Q02A 3RLIA 1JR3D 2QRJA 1BVRA 4B32A 4D3XA 5I9BA 4ESHA 3GN1A 2PO5A 5E8RA 5A6SA 2AOTA 3HN6A 1CZRA 3OWHA 4G07A 3AF0A 4TMXA 5FI3A 3RSCA 4AUEA 3UT5A 3RS5A 4HRVA 4AG3A 2H59A 2YHUA 5CLHA 4GXTA 4YJ3F 1QKKA 5AXBA 4JQZA 3ZQJA 4AMUA 4BBZA 2AG5A 1YRBA 3OZGA 4YI5A 1CZHA 3CZ9A 1INLA 2PX3A 4BQRA 2WK1A 5EWMB 1XNGA 1CW2B 2WKPA 2XOKA 1GNLA 1QQ6A 4F5YA 1PT8A 2H00A 2LIPA 4HN9A 1SAYA 2VCEA 3UV6A 1N2SA 1YDMA 2O2IA 1FE8A 3GGDA 1KVSA 4P34A 3WLJA 4HFNA 2Z4RA 1VHJA 4OP2A 4WZZA 4R1PA 1YSCA 3EYAA 4L5CA 4KTTE 5F64A 3EIEA 4LV6A 4C7JA 2CB9A 3HFGA 4XIJA 5FLXA 4YAWA 3NBXX 1OZGA 4BJHB 4RBNA 1D8TA 3EB9A 4Y1RB 1AK2A 3KAQA 1MW9X 4RXUA 2RK3A 5M2QA 4DR3B 2ET6A 1ZOOA 2YYAA 5CEJA 4ARVA 5HGXA 3ZI0A 1T5DX 2O20A 1DHTA 4X91A 4LZAA 5CDSA 1KQPA 3ENZA 5J4VA 5F98A 4KHZA 5EIXA 2A6PA 2GCGA 3ID6C 13PKA 3WFZA 2ZPUA 2EL7A 3PTAA 1GSAA 1XL1A 3IAAA 2B4TO 1S0UA 5DNWA 1HORA 1YDFA 3I64A 3AR8A 1DC8A