1LCCA

Structure of the complex of lac repressor headpiece and an 11 base-pair half-operator determined by nuclear magnetic resonance spectroscopy and restrained molecular dynamics
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the complex of lac repressor headpiece and an 11 base-pair half-operator determined by nuclear magnetic resonance spectroscopy and restrained molecular dynamics.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords DNA (5'-D(*AP*AP*TP*TP*GP*TP*GP*AP*GP*CP*G)-3')
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1993-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1lccA00
1ZZ6A 2BNOA 3BDNA 3QYXA 1LLIA 2KEIA 2XCJA 3G7DA 1PRAA 4Z5DA 1OCTC 1ZZ8A 3OQNA 4X4EA 3CECA 3JXDL 1QQBA 2LCVA 2PUFA 5A7LA 2KEKA 2IU7A 3F51A 2BNNA 2KZ8A 4Y42A 1DW9A 1Y7YA 2IVBA 1LMB3 1B0NA 4X4DA 2XSDC 2MEZA 3H5TA 2JVLA 3RZZA 3EUSA 3OMTA 1JFTA 3OP9A 3SCHA 2R63A 4I6RA 4PU3C 3O9XA 3GN5A 2GZUA 4X4CA 1LQCA 2H8RA 1WH8A 1DWKA 3QQ6A 2LYPA 2LYLA 3B7HA 1XWRA 1ZS4A 1ZUGA 2HINA 1WIZA 4PU7A 3PXPA 3IVPA 1RIOA 1YSEA 1QPZA 2A6CA 4GQMA 2HSGA 4YBAA 2XIUA 3GN5B 2B5AA 2BJCA 4I6UA 1JWLA 4NDWA 4IVZA 4JQDA 3BD1A 1RZRD 2R1JL 2JCGA 1R63A 3U3WA 4J1XA 4MCTA 1WH6A 4YARA 1ADRA 4X4BA 4YG7B 1RPEL 1QQAA 1RZSA 1X2LA 4I6TA 2GRMA 2IVGA 3JXCL 2IVQA 2O49A 4JCXA 4X4GA 2AW6A 3LISA 2L49A 4O8BA 1ZVVA 3MLFA 1CQTA 2IV1A 2MQKA 2BNMA 1BDIA 2EWTA 2LYJA 3SCGA 3ZKCA 2CSFA 1JH9A 1JFSA 4Z59A 4YG4A 3KZ3A 3TRBA 1PNRA 1QP7A 2GRLA 2EF8A 3ZHIA 4Z5CA 1EFAA 1ZZCA 1OSLA 2AXUA 1L1MA 3SCFA 3QF3A 1WETA 4X4FA 1PRVA 2PE5A 1UXDA 4GHJA 1S7EA 4OB4A 2XJ3A 1BDHA 2AWIA 3L1PA 1E3OC 2PUDA 1LCCA 4FBIA 3R1FA 2PUBA 1GT0C 2CROA 2PIJA 3QWGA 1POUA 2LYQA 3FYMA 4MCXA 4Z58A 1PERL 1ZZ9A 3DNVB 2ICTA 4FN3A 1ZZ7A 4YG1A 3UFDA 2O4AA 2LYRA 4IA8A 2AXZA 1IC8A 3KJXA 3VK0A 1AU7A 3KXAA 1HF0A 1QP0A 3OQMA 1Y9QA 3BS3A 3FMYA 5K98B 4PU4C 2OFYA 1RZRA 4J1WA 2KEJA 1ZPQA 1NEQA 1QP4A 4X4IA 3LFPA 2ICPA 2KPJA 1PRUA 4X4HA 1SQ8A 1NERA 4PU8A 2PUGA 3HZIB 4JCYA 1O4XA 3CROL 2PUAA 2AXVA 3OQOA 1CJGA 3S8QA 1ZAYA 4I8TA 3F52A 3D1NI 4IWRA 3FYAA 1R69A 2OR1L 3ZHMA 2PPXA 1UXCA 2EBYA 2O38A 3GBFA 4Z5HA 2IUOA 3G5GA 2WUSR 1VPWA 2PUEA 1X57A 2FJRA 2LYSA 2XI8A 4F8DA 1ZZBA 2LYKA 2D5VA 3F6WA 2PUCA 3CLCA 2WIUB 3JXBC 2L8NA 1LCDA 1UTXA 2AUWA
chains in the Genus database with same CATH superfamily
2BNOA 2V3CC 4Z5DA 1ZZ8A 2LLVA 3JXDL 2LCVA 2PUFA 5A7LA 4ER7A 1Y7YA 2LLWA 3EUSA 3OMTA 3O9XA 4ER6A 3IVPA 3GN5B 2BJCA 3A9YA 5DT2A 2FFHA 3U3WA 2PXKA 1ADRA 2XXAA 1RZSA 1X2LA 4I6TA 4ER3A 2YBDA 4JCXA 4O8BA 2EWTA 2PXUA 3KZ3A 3NROA 3ZHIA 2AXUA 2JQEA 4EK9A 1WETA 1UXDA 3OKZA 4Q2JA 2AWIA 1E3OC 4FBIA 1GT0C 2CROA 1ZZ9A 4DE8A 2ICTA 5JUWA 2L1PA 4IA8A 3VK0A 1HF0A 1Y9QA 2PXFA 4HRAA 4ER0A 2KEJA 2KPJA 1SQ8A 4PU8A 2PUGA 1CJGA 3F52A 4IWRA 3ZPXA 3GBFA 2IUOA 3TFLA 2WUSR 4F8DA 2LYKA 3CLCA 3JXBC 2ODRD 1PRAA 1OCTC 4X4EA 2IU7A 3R09A 2IVBA 3H5TA 5GAGi 3A9ZA 3MEJA 4PU3C 3GN5A 3GUUA 3M9LA 1XWRA 1WIZA 3PXPA 4GQMA 4YBAA 4I6UA 1JWLA 2XXQA 4IVZA 1RZRD 4YARA 2PXQA 2LNMA 3ME5A 1QQAA 2HCNA 3DM5A 4X4GA 2AW6A 2IV1A 3ZKCA 3QOWA 2HFZA 5DSXA 1QP7A 2GRLA 5DTMA 3VWSA 1OSLA 3GZCA 1MFQC 2XXPA 3GZDC 3NXHA 2PE5A 4X4FA 2PUDA 3L1PA 1NW3A 1LCCA 4ER5A 3R1FA 2PIJA 3QWGA 4MCXA 4EKGA 1PERL 2AXZA 3KXAA 1QP0A 3BS3A 2MXDA 2OFYA 4X4IA 1PRUA 4JCYA 2PXBA 1O4XA 4DE9A 1ZAYA 3D1NI 1R69A 3KL4A 2PPXA 1VPWA 1X57A 1LCDA 2PXDA 1ZZ6A 3BDNA 3QYXA 1LLIA 2KEIA 2XCJA 3G7DA 3OQNA 1QQBA 2KEKA 3F51A 2KZ8A 4Y42A 1B0NA 4X4DA 2MEZA 2JVLA 1JFTA 2R63A 4I6RA 2GZUA 4X4CA 2H8RA 2PXLA 1WH8A 1DWKA 3SR4A 3B7HA 4EQZA 3UWPA 1RIOA 1QPZA 2A6CA 3A9XA 2PXVA 2XIUA 3BD1A 1R63A 1WH6A 2GRMA 2IVQA 5DTQA 3MLFA 2MQKA 2BNMA 1BDIA 2LYJA 3SCGA 2CSFA 1JH9A 1JFSA 4YG4A 1PNRA 1ZZCA 3SCFA 3QF3A 4OBMA 3LQXA 1PRVA 1S7EA 2XJ3A 2VEOA 1U2ZA 2LYQA 3FYMA 4Z58A 3UFDA 4YG1A 1ZZ7A 3QFIA 3KJXA 2PXTA 3OQMA 5K98B 3GZDA 4J1WA 1ZPQA 4X4HA 1NERA 3HZIB 2PUAA 3S8QA 4WVLA 2OR1L 2O38A 4Z5HA 2PUEA 2FJRA 2XI8A 1ZZBA 2PUCA 5GAHi 2WIUB 2M4HA 2L8NA 5DTRA 3CECA 2BNNA 3NZLA 1DW9A 1LMB3 2XSDC 2PXPA 4EKIA 3RZZA 3OP9A 5DRYA 3SCHA 1LQCA 3QQ6A 2LYPA 2LYLA 1ZS4A 1ZUGA 2HINA 4PU7A 1YSEA 2HSGA 3PE5A 2B5AA 4NDWA 4JQDA 3QOXA 2R1JL 2JCGA 4J1XA 4MCTA 2PXEA 4X4BA 4YG7B 1RPEL 2IVGA 3JXCL 2O49A 3LISA 2L49A 1ZVVA 1CQTA 3NDBB 4Z59A 3TRBA 2J7WA 2EF8A 1QZXA 4Z5CA 1EFAA 1L1MA 3TEPA 2J7UA 1QB2A 4GHJA 4OB4A 1BDHA 2PUBA 1POUA 3DNVB 4FN3A 2O4AA 4EZIA 2LYRA 1IC8A 1AU7A 1HQ1A 3FMYA 4PU4C 1RZRA 1QP4A 1NEQA 2HCSA 3LFPA 2ICPA 3CROL 3SX0A 3OWQA 2AXVA 3OQOA 4I8TA 3TELA 3FYAA 3G0TA 3ZHMA 1UXCA 2EBYA 3G5GA 2LYSA 5DRTA 2D5VA 3F6WA 1DULA 1UTXA 2AUWA
chains in the Genus database with same CATH topology
1ZZ6A 2BNOA 3BDNA 3QYXA 1LLIA 2KEIA 2XCJA 3G7DA 1PRAA 4Z5DA 1OCTC 1ZZ8A 3OQNA 4X4EA 3CECA 3JXDL 1QQBA 2LCVA 2PUFA 5A7LA 2KEKA 2IU7A 3F51A 2BNNA 2KZ8A 4Y42A 1DW9A 1Y7YA 2IVBA 1LMB3 1B0NA 4X4DA 2XSDC 2MEZA 3H5TA 2JVLA 3RZZA 3EUSA 3OMTA 1JFTA 3OP9A 3SCHA 2R63A 4I6RA 4PU3C 3O9XA 3GN5A 2GZUA 4X4CA 1LQCA 2H8RA 1WH8A 1DWKA 3QQ6A 2LYPA 2LYLA 3B7HA 1XWRA 1ZS4A 1ZUGA 2HINA 1WIZA 4PU7A 3PXPA 3IVPA 1RIOA 1YSEA 1QPZA 2A6CA 4GQMA 2HSGA 4YBAA 2XIUA 3GN5B 2B5AA 2BJCA 4I6UA 1JWLA 4NDWA 4IVZA 4JQDA 3BD1A 1RZRD 2R1JL 2JCGA 1R63A 3U3WA 4J1XA 4MCTA 1WH6A 4YARA 1ADRA 4X4BA 4YG7B 1RPEL 1QQAA 1RZSA 1X2LA 4I6TA 2GRMA 2IVGA 3JXCL 2IVQA 2O49A 4JCXA 4X4GA 2AW6A 3LISA 2L49A 4O8BA 1ZVVA 3MLFA 1CQTA 2IV1A 2MQKA 2BNMA 1BDIA 2EWTA 2LYJA 3SCGA 3ZKCA 2CSFA 1JH9A 1JFSA 4Z59A 4YG4A 3KZ3A 3TRBA 1PNRA 1QP7A 2GRLA 2EF8A 3ZHIA 4Z5CA 1EFAA 1ZZCA 1OSLA 2AXUA 1L1MA 3SCFA 3QF3A 1WETA 4X4FA 1PRVA 2PE5A 1UXDA 4GHJA 1S7EA 4OB4A 2XJ3A 1BDHA 2AWIA 3L1PA 1E3OC 2PUDA 1LCCA 4FBIA 3R1FA 2PUBA 1GT0C 2CROA 2PIJA 3QWGA 1POUA 2LYQA 3FYMA 4MCXA 4Z58A 1PERL 1ZZ9A 3DNVB 2ICTA 4FN3A 1ZZ7A 4YG1A 3UFDA 2O4AA 2LYRA 4IA8A 2AXZA 1IC8A 3KJXA 3VK0A 1AU7A 3KXAA 1HF0A 1QP0A 3OQMA 1Y9QA 3BS3A 3FMYA 5K98B 4PU4C 2OFYA 1RZRA 4J1WA 2KEJA 1ZPQA 1NEQA 1QP4A 4X4IA 3LFPA 2ICPA 2KPJA 1PRUA 4X4HA 1SQ8A 1NERA 4PU8A 2PUGA 3HZIB 4JCYA 1O4XA 3CROL 2PUAA 2AXVA 3OQOA 1CJGA 3S8QA 1ZAYA 4I8TA 3F52A 3D1NI 4IWRA 3FYAA 1R69A 2OR1L 3ZHMA 2PPXA 1UXCA 2EBYA 2O38A 3GBFA 4Z5HA 2IUOA 3G5GA 2WUSR 1VPWA 2PUEA 1X57A 2FJRA 2LYSA 2XI8A 4F8DA 1ZZBA 2LYKA 2D5VA 3F6WA 2PUCA 3CLCA 2WIUB 3JXBC 2L8NA 1LCDA 1UTXA 2AUWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZZ6 A;  2BNO A;  3BDN A;  3QYX A;  1LLI A;  2KEI A;  2XCJ A;  3G7D A;  1PRA A;  4Z5D A;  1OCT C;  1ZZ8 A;  3OQN A;  4X4E A;  3CEC A;  3JXD L;  1QQB A;  2LCV A;  2PUF A;  5A7L A;  2KEK A;  2IU7 A;  3F51 A;  2BNN A;  2KZ8 A;  4Y42 A;  1DW9 A;  1Y7Y A;  2IVB A;  1LMB 3;  1B0N A;  4X4D A;  2XSD C;  2MEZ A;  3H5T A;  2JVL A;  3RZZ A;  3EUS A;  3OMT A;  1JFT A;  3OP9 A;  3SCH A;  2R63 A;  4I6R A;  4PU3 C;  3O9X A;  3GN5 A;  2GZU A;  4X4C A;  1LQC A;  2H8R A;  1WH8 A;  1DWK A;  3QQ6 A;  2LYP A;  2LYL A;  3B7H A;  1XWR A;  1ZS4 A;  1ZUG A;  2HIN A;  1WIZ A;  4PU7 A;  3PXP A;  3IVP A;  1RIO A;  1YSE A;  1QPZ A;  2A6C A;  4GQM A;  2HSG A;  4YBA A;  2XIU A;  3GN5 B;  2B5A A;  2BJC A;  4I6U A;  1JWL A;  4NDW A;  4IVZ A;  4JQD A;  3BD1 A;  1RZR D;  2R1J L;  2JCG A;  1R63 A;  3U3W A;  4J1X A;  4MCT A;  1WH6 A;  4YAR A;  1ADR A;  4X4B A;  4YG7 B;  1RPE L;  1QQA A;  1RZS A;  1X2L A;  4I6T A;  2GRM A;  2IVG A;  3JXC L;  2IVQ A;  2O49 A;  4JCX A;  4X4G A;  2AW6 A;  3LIS A;  2L49 A;  4O8B A;  1ZVV A;  3MLF A;  1CQT A;  2IV1 A;  2MQK A;  2BNM A;  1BDI A;  2EWT A;  2LYJ A;  3SCG A;  3ZKC A;  2CSF A;  1JH9 A;  1JFS A;  4Z59 A;  4YG4 A;  3KZ3 A;  3TRB A;  1PNR A;  1QP7 A;  2GRL A;  2EF8 A;  3ZHI A;  4Z5C A;  1EFA A;  1ZZC A;  1OSL A;  2AXU A;  1L1M A;  3SCF A;  3QF3 A;  1WET A;  4X4F A;  1PRV A;  2PE5 A;  1UXD A;  4GHJ A;  1S7E A;  4OB4 A;  2XJ3 A;  1BDH A;  2AWI A;  3L1P A;  1E3O C;  2PUD A;  1LCC A;  4FBI A;  3R1F A;  2PUB A;  1GT0 C;  2CRO A;  2PIJ A;  3QWG A;  1POU A;  2LYQ A;  3FYM A;  4MCX A;  4Z58 A;  1PER L;  1ZZ9 A;  3DNV B;  2ICT A;  4FN3 A;  1ZZ7 A;  4YG1 A;  3UFD A;  2O4A A;  2LYR A;  4IA8 A;  2AXZ A;  1IC8 A;  3KJX A;  3VK0 A;  1AU7 A;  3KXA A;  1HF0 A;  1QP0 A;  3OQM A;  1Y9Q A;  3BS3 A;  3FMY A;  5K98 B;  4PU4 C;  2OFY A;  1RZR A;  4J1W A;  2KEJ A;  1ZPQ A;  1NEQ A;  1QP4 A;  4X4I A;  3LFP A;  2ICP A;  2KPJ A;  1PRU A;  4X4H A;  1SQ8 A;  1NER A;  4PU8 A;  2PUG A;  3HZI B;  4JCY A;  1O4X A;  3CRO L;  2PUA A;  2AXV A;  3OQO A;  1CJG A;  3S8Q A;  1ZAY A;  4I8T A;  3F52 A;  3D1N I;  4IWR A;  3FYA A;  1R69 A;  2OR1 L;  3ZHM A;  2PPX A;  1UXC A;  2EBY A;  2O38 A;  3GBF A;  4Z5H A;  2IUO A;  3G5G A;  2WUS R;  1VPW A;  2PUE A;  1X57 A;  2FJR A;  2LYS A;  2XI8 A;  4F8D A;  1ZZB A;  2LYK A;  2D5V A;  3F6W A;  2PUC A;  3CLC A;  2WIU B;  3JXB C;  2L8N A;  1LCD A;  1UTX A;  2AUW A; 
#chains in the Genus database with same CATH topology
 2BNO A;  2V3C C;  4Z5D A;  1ZZ8 A;  2LLV A;  3JXD L;  2LCV A;  2PUF A;  5A7L A;  4ER7 A;  1Y7Y A;  2LLW A;  3EUS A;  3OMT A;  3O9X A;  4ER6 A;  3IVP A;  3GN5 B;  2BJC A;  3A9Y A;  5DT2 A;  2FFH A;  3U3W A;  2PXK A;  1ADR A;  2XXA A;  1RZS A;  1X2L A;  4I6T A;  4ER3 A;  2YBD A;  4JCX A;  4O8B A;  2EWT A;  2PXU A;  3KZ3 A;  3NRO A;  3ZHI A;  2AXU A;  2JQE A;  4EK9 A;  1WET A;  1UXD A;  3OKZ A;  4Q2J A;  2AWI A;  1E3O C;  4FBI A;  1GT0 C;  2CRO A;  1ZZ9 A;  4DE8 A;  2ICT A;  5JUW A;  2L1P A;  4IA8 A;  3VK0 A;  1HF0 A;  1Y9Q A;  2PXF A;  4HRA A;  4ER0 A;  2KEJ A;  2KPJ A;  1SQ8 A;  4PU8 A;  2PUG A;  1CJG A;  3F52 A;  4IWR A;  3ZPX A;  3GBF A;  2IUO A;  3TFL A;  2WUS R;  4F8D A;  2LYK A;  3CLC A;  3JXB C;  2ODR D;  1PRA A;  1OCT C;  4X4E A;  2IU7 A;  3R09 A;  2IVB A;  3H5T A;  5GAG i;  3A9Z A;  3MEJ A;  4PU3 C;  3GN5 A;  3GUU A;  3M9L A;  1XWR A;  1WIZ A;  3PXP A;  4GQM A;  4YBA A;  4I6U A;  1JWL A;  2XXQ A;  4IVZ A;  1RZR D;  4YAR A;  2PXQ A;  2LNM A;  3ME5 A;  1QQA A;  2HCN A;  3DM5 A;  4X4G A;  2AW6 A;  2IV1 A;  3ZKC A;  3QOW A;  2HFZ A;  5DSX A;  1QP7 A;  2GRL A;  5DTM A;  3VWS A;  1OSL A;  3GZC A;  1MFQ C;  2XXP A;  3GZD C;  3NXH A;  2PE5 A;  4X4F A;  2PUD A;  3L1P A;  1NW3 A;  1LCC A;  4ER5 A;  3R1F A;  2PIJ A;  3QWG A;  4MCX A;  4EKG A;  1PER L;  2AXZ A;  3KXA A;  1QP0 A;  3BS3 A;  2MXD A;  2OFY A;  4X4I A;  1PRU A;  4JCY A;  2PXB A;  1O4X A;  4DE9 A;  1ZAY A;  3D1N I;  1R69 A;  3KL4 A;  2PPX A;  1VPW A;  1X57 A;  1LCD A;  2PXD A;  1ZZ6 A;  3BDN A;  3QYX A;  1LLI A;  2KEI A;  2XCJ A;  3G7D A;  3OQN A;  1QQB A;  2KEK A;  3F51 A;  2KZ8 A;  4Y42 A;  1B0N A;  4X4D A;  2MEZ A;  2JVL A;  1JFT A;  2R63 A;  4I6R A;  2GZU A;  4X4C A;  2H8R A;  2PXL A;  1WH8 A;  1DWK A;  3SR4 A;  3B7H A;  4EQZ A;  3UWP A;  1RIO A;  1QPZ A;  2A6C A;  3A9X A;  2PXV A;  2XIU A;  3BD1 A;  1R63 A;  1WH6 A;  2GRM A;  2IVQ A;  5DTQ A;  3MLF A;  2MQK A;  2BNM A;  1BDI A;  2LYJ A;  3SCG A;  2CSF A;  1JH9 A;  1JFS A;  4YG4 A;  1PNR A;  1ZZC A;  3SCF A;  3QF3 A;  4OBM A;  3LQX A;  1PRV A;  1S7E A;  2XJ3 A;  2VEO A;  1U2Z A;  2LYQ A;  3FYM A;  4Z58 A;  3UFD A;  4YG1 A;  1ZZ7 A;  3QFI A;  3KJX A;  2PXT A;  3OQM A;  5K98 B;  3GZD A;  4J1W A;  1ZPQ A;  4X4H A;  1NER A;  3HZI B;  2PUA A;  3S8Q A;  4WVL A;  2OR1 L;  2O38 A;  4Z5H A;  2PUE A;  2FJR A;  2XI8 A;  1ZZB A;  2PUC A;  5GAH i;  2WIU B;  2M4H A;  2L8N A;  5DTR A;  3CEC A;  2BNN A;  3NZL A;  1DW9 A;  1LMB 3;  2XSD C;  2PXP A;  4EKI A;  3RZZ A;  3OP9 A;  5DRY A;  3SCH A;  1LQC A;  3QQ6 A;  2LYP A;  2LYL A;  1ZS4 A;  1ZUG A;  2HIN A;  4PU7 A;  1YSE A;  2HSG A;  3PE5 A;  2B5A A;  4NDW A;  4JQD A;  3QOX A;  2R1J L;  2JCG A;  4J1X A;  4MCT A;  2PXE A;  4X4B A;  4YG7 B;  1RPE L;  2IVG A;  3JXC L;  2O49 A;  3LIS A;  2L49 A;  1ZVV A;  1CQT A;  3NDB B;  4Z59 A;  3TRB A;  2J7W A;  2EF8 A;  1QZX A;  4Z5C A;  1EFA A;  1L1M A;  3TEP A;  2J7U A;  1QB2 A;  4GHJ A;  4OB4 A;  1BDH A;  2PUB A;  1POU A;  3DNV B;  4FN3 A;  2O4A A;  4EZI A;  2LYR A;  1IC8 A;  1AU7 A;  1HQ1 A;  3FMY A;  4PU4 C;  1RZR A;  1QP4 A;  1NEQ A;  2HCS A;  3LFP A;  2ICP A;  3CRO L;  3SX0 A;  3OWQ A;  2AXV A;  3OQO A;  4I8T A;  3TEL A;  3FYA A;  3G0T A;  3ZHM A;  1UXC A;  2EBY A;  3G5G A;  2LYS A;  5DRT A;  2D5V A;  3F6W A;  1DUL A;  1UTX A;  2AUW A; 
#chains in the Genus database with same CATH homology
 1ZZ6 A;  2BNO A;  3BDN A;  3QYX A;  1LLI A;  2KEI A;  2XCJ A;  3G7D A;  1PRA A;  4Z5D A;  1OCT C;  1ZZ8 A;  3OQN A;  4X4E A;  3CEC A;  3JXD L;  1QQB A;  2LCV A;  2PUF A;  5A7L A;  2KEK A;  2IU7 A;  3F51 A;  2BNN A;  2KZ8 A;  4Y42 A;  1DW9 A;  1Y7Y A;  2IVB A;  1LMB 3;  1B0N A;  4X4D A;  2XSD C;  2MEZ A;  3H5T A;  2JVL A;  3RZZ A;  3EUS A;  3OMT A;  1JFT A;  3OP9 A;  3SCH A;  2R63 A;  4I6R A;  4PU3 C;  3O9X A;  3GN5 A;  2GZU A;  4X4C A;  1LQC A;  2H8R A;  1WH8 A;  1DWK A;  3QQ6 A;  2LYP A;  2LYL A;  3B7H A;  1XWR A;  1ZS4 A;  1ZUG A;  2HIN A;  1WIZ A;  4PU7 A;  3PXP A;  3IVP A;  1RIO A;  1YSE A;  1QPZ A;  2A6C A;  4GQM A;  2HSG A;  4YBA A;  2XIU A;  3GN5 B;  2B5A A;  2BJC A;  4I6U A;  1JWL A;  4NDW A;  4IVZ A;  4JQD A;  3BD1 A;  1RZR D;  2R1J L;  2JCG A;  1R63 A;  3U3W A;  4J1X A;  4MCT A;  1WH6 A;  4YAR A;  1ADR A;  4X4B A;  4YG7 B;  1RPE L;  1QQA A;  1RZS A;  1X2L A;  4I6T A;  2GRM A;  2IVG A;  3JXC L;  2IVQ A;  2O49 A;  4JCX A;  4X4G A;  2AW6 A;  3LIS A;  2L49 A;  4O8B A;  1ZVV A;  3MLF A;  1CQT A;  2IV1 A;  2MQK A;  2BNM A;  1BDI A;  2EWT A;  2LYJ A;  3SCG A;  3ZKC A;  2CSF A;  1JH9 A;  1JFS A;  4Z59 A;  4YG4 A;  3KZ3 A;  3TRB A;  1PNR A;  1QP7 A;  2GRL A;  2EF8 A;  3ZHI A;  4Z5C A;  1EFA A;  1ZZC A;  1OSL A;  2AXU A;  1L1M A;  3SCF A;  3QF3 A;  1WET A;  4X4F A;  1PRV A;  2PE5 A;  1UXD A;  4GHJ A;  1S7E A;  4OB4 A;  2XJ3 A;  1BDH A;  2AWI A;  3L1P A;  1E3O C;  2PUD A;  1LCC A;  4FBI A;  3R1F A;  2PUB A;  1GT0 C;  2CRO A;  2PIJ A;  3QWG A;  1POU A;  2LYQ A;  3FYM A;  4MCX A;  4Z58 A;  1PER L;  1ZZ9 A;  3DNV B;  2ICT A;  4FN3 A;  1ZZ7 A;  4YG1 A;  3UFD A;  2O4A A;  2LYR A;  4IA8 A;  2AXZ A;  1IC8 A;  3KJX A;  3VK0 A;  1AU7 A;  3KXA A;  1HF0 A;  1QP0 A;  3OQM A;  1Y9Q A;  3BS3 A;  3FMY A;  5K98 B;  4PU4 C;  2OFY A;  1RZR A;  4J1W A;  2KEJ A;  1ZPQ A;  1NEQ A;  1QP4 A;  4X4I A;  3LFP A;  2ICP A;  2KPJ A;  1PRU A;  4X4H A;  1SQ8 A;  1NER A;  4PU8 A;  2PUG A;  3HZI B;  4JCY A;  1O4X A;  3CRO L;  2PUA A;  2AXV A;  3OQO A;  1CJG A;  3S8Q A;  1ZAY A;  4I8T A;  3F52 A;  3D1N I;  4IWR A;  3FYA A;  1R69 A;  2OR1 L;  3ZHM A;  2PPX A;  1UXC A;  2EBY A;  2O38 A;  3GBF A;  4Z5H A;  2IUO A;  3G5G A;  2WUS R;  1VPW A;  2PUE A;  1X57 A;  2FJR A;  2LYS A;  2XI8 A;  4F8D A;  1ZZB A;  2LYK A;  2D5V A;  3F6W A;  2PUC A;  3CLC A;  2WIU B;  3JXB C;  2L8N A;  1LCD A;  1UTX A;  2AUW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...