1LCCA

Structure of the complex of lac repressor headpiece and an 11 base-pair half-operator determined by nuclear magnetic resonance spectroscopy and restrained molecular dynamics
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
51
structure length
51
Chain Sequence
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*AP*AP*TP*TP*GP*TP*GP*AP*GP*CP*G)-3')
publication title Structure of the complex of lac repressor headpiece and an 11 base-pair half-operator determined by nuclear magnetic resonance spectroscopy and restrained molecular dynamics.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
total genus 13
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1993-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1lccA00
2AXVA 3QQ6A 4Z5CA 2FJRA 1ADRA 1IC8A 1CJGA 1UXCA 1JFSA 2OR1L 4MCTA 3ZHIA 4Z58A 1JH9A 1RPEL 1BDHA 2O49A 4JCYA 1VPWA 2GZUA 3OQOA 4Z5DA 3HZIB 1SQ8A 3U3WA 3KZ3A 2PE5A 1QP4A 1AU7A 1JWLA 1ZZ6A 1DW9A 1WIZA 3MLFA 2PUAA 1JFTA 2PUGA 1E3OC 4JQDA 1L1MA 4YARA 2XJ3A 3CECA 3B7HA 3TRBA 1ZVVA 1R63A 3O9XA 1HF0A 1PRVA 2XI8A 4J1WA 3EUSA 3FYAA 2PPXA 2EBYA 1UXDA 2EF8A 2KPJA 1YSEA 2IUOA 1ZZBA 1B0NA 3GN5A 4X4CA 3F52A 4X4GA 2D5VA 3IVPA 4I8TA 3DNVB 2XSDC 1QP7A 2JCGA 1BDIA 3CLCA 1CQTA 4J1XA 2AUWA 2OFYA 2MEZA 1RZRA 1Y9QA 3GN5B 3QWGA 4YG4A 2CSFA 2AXUA 2KZ8A 4IA8A 4OB4A 1POUA 3OP9A 2ICPA 3L1PA 2AXZA 4PU4C 3CROL 2XCJA 2L8NA 4FBIA 2LYLA 4FN3A 1PRUA 1UTXA 3GBFA 4MCXA 3RZZA 1RZSA 2B5AA 3BS3A 1ZUGA 4X4IA 2IU7A 2WUSR 4JCXA 3LFPA 2HSGA 3FYMA 2PUDA 2WIUB 2EWTA 2BJCA 4IWRA 3G5GA 2PUCA 3JXCL 3KJXA 3LISA 2KEKA 3F51A 2LYSA 1ZS4A 3JXBC 2O38A 3OMTA 2LYKA 3R1FA 2HINA 2IVBA 2A6CA 4Z59A 2MQKA 4O8BA 1LCCA 5A7LA 2IV1A 2GRMA 2JVLA 1ZZ8A 4Z5HA 2IVGA 3OQNA 2LYJA 3QYXA 3OQMA 1QP0A 4I6RA 3BDNA 1PRAA 1NERA 1X2LA 4YG1A 2R1JL 2LYRA 3S8QA 4F8DA 3D1NI 1NEQA 2CROA 2LCVA 4X4FA 3G7DA 1OCTC 1QQAA 1ZAYA 4X4DA 1LQCA 2PUFA 1X57A 2AWIA 2BNNA 2R63A 4YG7B 1LCDA 1LLIA 4GHJA 3ZHMA 3ZKCA 3H5TA 4PU8A 4X4HA 4I6UA 2AW6A 2O4AA 1ZPQA 1OSLA 4PU7A 4IVZA 1QQBA 1S7EA 1ZZ7A 2BNOA 2L49A 2KEJA 4I6TA 2H8RA 4X4EA 1RZRD 1LMB3 2ICTA 3JXDL 2LYPA 2IVQA 1ZZCA 3FMYA 1RIOA 1GT0C 1PNRA 1QPZA 1R69A 3BD1A 2PIJA 1ZZ9A 1WH6A 2XIUA 2BNMA 3KXAA 2KEIA 2PUBA 2PUEA 1EFAA 3QF3A 4PU3C 2GRLA 1PERL 3PXPA 4NDWA 4YBAA 2LYQA 4GQMA 3SCGA 3F6WA 1WETA 1WH8A 1XWRA 3VK0A 3UFDA 3SCFA 4X4BA 1Y7YA 3SCHA 1O4XA 1DWKA 5K98B 4Y42A
chains in the Genus database with same CATH superfamily
2AXVA 1ADRA 1CJGA 2HFZA 1RPEL 2XXAA 4JCYA 4Z5DA 3U3WA 3KZ3A 1QP4A 1JWLA 2HCNA 4DE9A 3MLFA 1JFTA 2PUGA 3QOXA 4YARA 3B7HA 4J1WA 3EUSA 2PPXA 2EBYA 1UXDA 2EF8A 2KPJA 4X4GA 1ZZBA 3F52A 2J7UA 3DNVB 4ER3A 2PXLA 2AUWA 3QWGA 2KZ8A 1DULA 2YBDA 5GAGi 2L8NA 2LYLA 1PRUA 4JCXA 1ZUGA 3LFPA 2VEOA 1MFQC 3KJXA 2KEKA 3ME5A 3JXBC 2O38A 4Q2JA 2LYKA 1LCCA 2MQKA 2IV1A 2JVLA 1ZZ8A 2LYJA 4OBMA 3LQXA 3D1NI 1NEQA 2LCVA 4ER5A 2HCSA 2R63A 1LCDA 3H5TA 1ZPQA 4PU7A 1S7EA 1ZZ7A 1LMB3 2IVQA 2LLWA 3QF3A 4EQZA 3GUUA 3PXPA 3A9XA 2PXFA 3F6WA 3VK0A 3UFDA 4X4BA 5K98B 1IC8A 3QOWA 2L1PA 4EKIA 3ZHIA 1VPWA 3OQOA 3NZLA 1SQ8A 1DW9A 1E3OC 2LLVA 4HRAA 1ZVVA 1HF0A 5JUWA 2XI8A 4EKGA 2M4HA 2XSDC 2JCGA 3CLCA 2OFYA 3GN5B 5DSXA 2CSFA 2AXUA 2PXDA 3OP9A 1QZXA 3L1PA 2AXZA 4PU4C 3CROL 2XCJA 4FN3A 1UTXA 2IU7A 2WUSR 3G0TA 3QFIA 3R09A 4IWRA 2PUCA 5DTQA 3JXCL 1ZS4A 3R1FA 2HINA 2IVBA 2LNMA 4Z59A 4O8BA 2GRMA 5DRTA 3OQMA 2MXDA 3BDNA 1X2LA 3SX0A 2R1JL 3S8QA 2CROA 4X4FA 3G7DA 1ZAYA 1LQCA 1X57A 2BNNA 3ZPXA 4YG7B 2FFHA 1LLIA 5DRYA 4GHJA 3ZHMA 2PXEA 4X4HA 5DTRA 4IVZA 3PE5A 2BNOA 3TFLA 4I6TA 3VWSA 1RZRD 3JXDL 1RIOA 1WH6A 2XIUA 2BNMA 2PUBA 2PUEA 2GRLA 4YBAA 4GQMA 3SCGA 2JQEA 5DT2A 1O4XA 1DWKA 4Z5CA 2FJRA 3OWQA 2OR1L 1UXCA 1JFSA 4MCTA 3HZIB 1QB2A 1ZZ6A 1WIZA 2PUAA 1L1MA 5GAHi 3CECA 1NW3A 1PRVA 3FYAA 1YSEA 2IUOA 3GN5A 4X4CA 3IVPA 2XXPA 2V3CC 1QP7A 1BDIA 2MEZA 3KL4A 4OB4A 1POUA 2ICPA 1HQ1A 4WVLA 4FBIA 3GBFA 3RZZA 1RZSA 4X4IA 3BS3A 3FYMA 3DM5A 2PXQA 3LISA 3SR4A 3GZCA 4ER6A 3OMTA 2A6CA 3A9YA 5A7LA 3OQNA 4DE8A 1QP0A 2PXBA 4YG1A 2LYRA 1OCTC 4X4DA 2AWIA 1U2ZA 3ZKCA 2O4AA 1OSLA 1QQBA 2L49A 2KEJA 2H8RA 4X4EA 2ICTA 2LYPA 1ZZCA 3FMYA 1PNRA 3BD1A 2PXUA 2KEIA 3KXAA 1EFAA 4PU3C 3TELA 1PERL 3OKZA 4NDWA 2LYQA 1XWRA 3SCFA 4ER7A 1Y7YA 3SCHA 4EZIA 3QQ6A 2ODRD 3NDBB 4Z58A 1JH9A 2J7WA 1BDHA 2O49A 2GZUA 2PE5A 1AU7A 3GZDA 4JQDA 2XJ3A 3TRBA 2PXKA 1R63A 3O9XA 5DTMA 2PXVA 1B0NA 2D5VA 3NXHA 4I8TA 1CQTA 4J1XA 1RZRA 1Y9QA 3M9LA 4YG4A 4IA8A 2XXQA 4EK9A 4MCXA 2B5AA 2HSGA 2PUDA 2WIUB 2EWTA 2BJCA 3G5GA 3F51A 2LYSA 4Z5HA 2IVGA 3QYXA 4I6RA 3UWPA 1PRAA 1NERA 4F8DA 3MEJA 1QQAA 2PXTA 2PUFA 2PXPA 4PU8A 4I6UA 2AW6A 4ER0A 3A9ZA 3NROA 1GT0C 1QPZA 1R69A 2PIJA 1ZZ9A 3TEPA 3GZDC 1WETA 1WH8A 4Y42A
chains in the Genus database with same CATH topology
2AXVA 3QQ6A 4Z5CA 2FJRA 1ADRA 1IC8A 1CJGA 1UXCA 1JFSA 2OR1L 4MCTA 3ZHIA 4Z58A 1JH9A 1RPEL 1BDHA 2O49A 4JCYA 1VPWA 2GZUA 3OQOA 4Z5DA 3HZIB 1SQ8A 3U3WA 3KZ3A 2PE5A 1QP4A 1AU7A 1JWLA 1ZZ6A 1DW9A 1WIZA 3MLFA 2PUAA 1JFTA 2PUGA 1E3OC 4JQDA 1L1MA 4YARA 2XJ3A 3CECA 3B7HA 3TRBA 1ZVVA 1R63A 3O9XA 1HF0A 1PRVA 2XI8A 4J1WA 3EUSA 3FYAA 2PPXA 2EBYA 1UXDA 2EF8A 2KPJA 1YSEA 2IUOA 1ZZBA 1B0NA 3GN5A 4X4CA 3F52A 4X4GA 2D5VA 3IVPA 4I8TA 3DNVB 2XSDC 1QP7A 2JCGA 1BDIA 3CLCA 1CQTA 4J1XA 2AUWA 2OFYA 2MEZA 1RZRA 1Y9QA 3GN5B 3QWGA 4YG4A 2CSFA 2AXUA 2KZ8A 4IA8A 4OB4A 1POUA 3OP9A 2ICPA 3L1PA 2AXZA 4PU4C 3CROL 2XCJA 2L8NA 4FBIA 2LYLA 4FN3A 1PRUA 1UTXA 3GBFA 4MCXA 3RZZA 1RZSA 2B5AA 3BS3A 1ZUGA 4X4IA 2IU7A 2WUSR 4JCXA 3LFPA 2HSGA 3FYMA 2PUDA 2WIUB 2EWTA 2BJCA 4IWRA 3G5GA 2PUCA 3JXCL 3KJXA 3LISA 2KEKA 3F51A 2LYSA 1ZS4A 3JXBC 2O38A 3OMTA 2LYKA 3R1FA 2HINA 2IVBA 2A6CA 4Z59A 2MQKA 4O8BA 1LCCA 5A7LA 2IV1A 2GRMA 2JVLA 1ZZ8A 4Z5HA 2IVGA 3OQNA 2LYJA 3QYXA 3OQMA 1QP0A 4I6RA 3BDNA 1PRAA 1NERA 1X2LA 4YG1A 2R1JL 2LYRA 3S8QA 4F8DA 3D1NI 1NEQA 2CROA 2LCVA 4X4FA 3G7DA 1OCTC 1QQAA 1ZAYA 4X4DA 1LQCA 2PUFA 1X57A 2AWIA 2BNNA 2R63A 4YG7B 1LCDA 1LLIA 4GHJA 3ZHMA 3ZKCA 3H5TA 4PU8A 4X4HA 4I6UA 2AW6A 2O4AA 1ZPQA 1OSLA 4PU7A 4IVZA 1QQBA 1S7EA 1ZZ7A 2BNOA 2L49A 2KEJA 4I6TA 2H8RA 4X4EA 1RZRD 1LMB3 2ICTA 3JXDL 2LYPA 2IVQA 1ZZCA 3FMYA 1RIOA 1GT0C 1PNRA 1QPZA 1R69A 3BD1A 2PIJA 1ZZ9A 1WH6A 2XIUA 2BNMA 3KXAA 2KEIA 2PUBA 2PUEA 1EFAA 3QF3A 4PU3C 2GRLA 1PERL 3PXPA 4NDWA 4YBAA 2LYQA 4GQMA 3SCGA 3F6WA 1WETA 1WH8A 1XWRA 3VK0A 3UFDA 3SCFA 4X4BA 1Y7YA 3SCHA 1O4XA 1DWKA 5K98B 4Y42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXV A;  3QQ6 A;  4Z5C A;  2FJR A;  1ADR A;  1IC8 A;  1CJG A;  1UXC A;  1JFS A;  2OR1 L;  4MCT A;  3ZHI A;  4Z58 A;  1JH9 A;  1RPE L;  1BDH A;  2O49 A;  4JCY A;  1VPW A;  2GZU A;  3OQO A;  4Z5D A;  3HZI B;  1SQ8 A;  3U3W A;  3KZ3 A;  2PE5 A;  1QP4 A;  1AU7 A;  1JWL A;  1ZZ6 A;  1DW9 A;  1WIZ A;  3MLF A;  2PUA A;  1JFT A;  2PUG A;  1E3O C;  4JQD A;  1L1M A;  4YAR A;  2XJ3 A;  3CEC A;  3B7H A;  3TRB A;  1ZVV A;  1R63 A;  3O9X A;  1HF0 A;  1PRV A;  2XI8 A;  4J1W A;  3EUS A;  3FYA A;  2PPX A;  2EBY A;  1UXD A;  2EF8 A;  2KPJ A;  1YSE A;  2IUO A;  1ZZB A;  1B0N A;  3GN5 A;  4X4C A;  3F52 A;  4X4G A;  2D5V A;  3IVP A;  4I8T A;  3DNV B;  2XSD C;  1QP7 A;  2JCG A;  1BDI A;  3CLC A;  1CQT A;  4J1X A;  2AUW A;  2OFY A;  2MEZ A;  1RZR A;  1Y9Q A;  3GN5 B;  3QWG A;  4YG4 A;  2CSF A;  2AXU A;  2KZ8 A;  4IA8 A;  4OB4 A;  1POU A;  3OP9 A;  2ICP A;  3L1P A;  2AXZ A;  4PU4 C;  3CRO L;  2XCJ A;  2L8N A;  4FBI A;  2LYL A;  4FN3 A;  1PRU A;  1UTX A;  3GBF A;  4MCX A;  3RZZ A;  1RZS A;  2B5A A;  3BS3 A;  1ZUG A;  4X4I A;  2IU7 A;  2WUS R;  4JCX A;  3LFP A;  2HSG A;  3FYM A;  2PUD A;  2WIU B;  2EWT A;  2BJC A;  4IWR A;  3G5G A;  2PUC A;  3JXC L;  3KJX A;  3LIS A;  2KEK A;  3F51 A;  2LYS A;  1ZS4 A;  3JXB C;  2O38 A;  3OMT A;  2LYK A;  3R1F A;  2HIN A;  2IVB A;  2A6C A;  4Z59 A;  2MQK A;  4O8B A;  1LCC A;  5A7L A;  2IV1 A;  2GRM A;  2JVL A;  1ZZ8 A;  4Z5H A;  2IVG A;  3OQN A;  2LYJ A;  3QYX A;  3OQM A;  1QP0 A;  4I6R A;  3BDN A;  1PRA A;  1NER A;  1X2L A;  4YG1 A;  2R1J L;  2LYR A;  3S8Q A;  4F8D A;  3D1N I;  1NEQ A;  2CRO A;  2LCV A;  4X4F A;  3G7D A;  1OCT C;  1QQA A;  1ZAY A;  4X4D A;  1LQC A;  2PUF A;  1X57 A;  2AWI A;  2BNN A;  2R63 A;  4YG7 B;  1LCD A;  1LLI A;  4GHJ A;  3ZHM A;  3ZKC A;  3H5T A;  4PU8 A;  4X4H A;  4I6U A;  2AW6 A;  2O4A A;  1ZPQ A;  1OSL A;  4PU7 A;  4IVZ A;  1QQB A;  1S7E A;  1ZZ7 A;  2BNO A;  2L49 A;  2KEJ A;  4I6T A;  2H8R A;  4X4E A;  1RZR D;  1LMB 3;  2ICT A;  3JXD L;  2LYP A;  2IVQ A;  1ZZC A;  3FMY A;  1RIO A;  1GT0 C;  1PNR A;  1QPZ A;  1R69 A;  3BD1 A;  2PIJ A;  1ZZ9 A;  1WH6 A;  2XIU A;  2BNM A;  3KXA A;  2KEI A;  2PUB A;  2PUE A;  1EFA A;  3QF3 A;  4PU3 C;  2GRL A;  1PER L;  3PXP A;  4NDW A;  4YBA A;  2LYQ A;  4GQM A;  3SCG A;  3F6W A;  1WET A;  1WH8 A;  1XWR A;  3VK0 A;  3UFD A;  3SCF A;  4X4B A;  1Y7Y A;  3SCH A;  1O4X A;  1DWK A;  5K98 B;  4Y42 A; 
#chains in the Genus database with same CATH topology
 2AXV A;  1ADR A;  1CJG A;  2HFZ A;  1RPE L;  2XXA A;  4JCY A;  4Z5D A;  3U3W A;  3KZ3 A;  1QP4 A;  1JWL A;  2HCN A;  4DE9 A;  3MLF A;  1JFT A;  2PUG A;  3QOX A;  4YAR A;  3B7H A;  4J1W A;  3EUS A;  2PPX A;  2EBY A;  1UXD A;  2EF8 A;  2KPJ A;  4X4G A;  1ZZB A;  3F52 A;  2J7U A;  3DNV B;  4ER3 A;  2PXL A;  2AUW A;  3QWG A;  2KZ8 A;  1DUL A;  2YBD A;  5GAG i;  2L8N A;  2LYL A;  1PRU A;  4JCX A;  1ZUG A;  3LFP A;  2VEO A;  1MFQ C;  3KJX A;  2KEK A;  3ME5 A;  3JXB C;  2O38 A;  4Q2J A;  2LYK A;  1LCC A;  2MQK A;  2IV1 A;  2JVL A;  1ZZ8 A;  2LYJ A;  4OBM A;  3LQX A;  3D1N I;  1NEQ A;  2LCV A;  4ER5 A;  2HCS A;  2R63 A;  1LCD A;  3H5T A;  1ZPQ A;  4PU7 A;  1S7E A;  1ZZ7 A;  1LMB 3;  2IVQ A;  2LLW A;  3QF3 A;  4EQZ A;  3GUU A;  3PXP A;  3A9X A;  2PXF A;  3F6W A;  3VK0 A;  3UFD A;  4X4B A;  5K98 B;  1IC8 A;  3QOW A;  2L1P A;  4EKI A;  3ZHI A;  1VPW A;  3OQO A;  3NZL A;  1SQ8 A;  1DW9 A;  1E3O C;  2LLV A;  4HRA A;  1ZVV A;  1HF0 A;  5JUW A;  2XI8 A;  4EKG A;  2M4H A;  2XSD C;  2JCG A;  3CLC A;  2OFY A;  3GN5 B;  5DSX A;  2CSF A;  2AXU A;  2PXD A;  3OP9 A;  1QZX A;  3L1P A;  2AXZ A;  4PU4 C;  3CRO L;  2XCJ A;  4FN3 A;  1UTX A;  2IU7 A;  2WUS R;  3G0T A;  3QFI A;  3R09 A;  4IWR A;  2PUC A;  5DTQ A;  3JXC L;  1ZS4 A;  3R1F A;  2HIN A;  2IVB A;  2LNM A;  4Z59 A;  4O8B A;  2GRM A;  5DRT A;  3OQM A;  2MXD A;  3BDN A;  1X2L A;  3SX0 A;  2R1J L;  3S8Q A;  2CRO A;  4X4F A;  3G7D A;  1ZAY A;  1LQC A;  1X57 A;  2BNN A;  3ZPX A;  4YG7 B;  2FFH A;  1LLI A;  5DRY A;  4GHJ A;  3ZHM A;  2PXE A;  4X4H A;  5DTR A;  4IVZ A;  3PE5 A;  2BNO A;  3TFL A;  4I6T A;  3VWS A;  1RZR D;  3JXD L;  1RIO A;  1WH6 A;  2XIU A;  2BNM A;  2PUB A;  2PUE A;  2GRL A;  4YBA A;  4GQM A;  3SCG A;  2JQE A;  5DT2 A;  1O4X A;  1DWK A;  4Z5C A;  2FJR A;  3OWQ A;  2OR1 L;  1UXC A;  1JFS A;  4MCT A;  3HZI B;  1QB2 A;  1ZZ6 A;  1WIZ A;  2PUA A;  1L1M A;  5GAH i;  3CEC A;  1NW3 A;  1PRV A;  3FYA A;  1YSE A;  2IUO A;  3GN5 A;  4X4C A;  3IVP A;  2XXP A;  2V3C C;  1QP7 A;  1BDI A;  2MEZ A;  3KL4 A;  4OB4 A;  1POU A;  2ICP A;  1HQ1 A;  4WVL A;  4FBI A;  3GBF A;  3RZZ A;  1RZS A;  4X4I A;  3BS3 A;  3FYM A;  3DM5 A;  2PXQ A;  3LIS A;  3SR4 A;  3GZC A;  4ER6 A;  3OMT A;  2A6C A;  3A9Y A;  5A7L A;  3OQN A;  4DE8 A;  1QP0 A;  2PXB A;  4YG1 A;  2LYR A;  1OCT C;  4X4D A;  2AWI A;  1U2Z A;  3ZKC A;  2O4A A;  1OSL A;  1QQB A;  2L49 A;  2KEJ A;  2H8R A;  4X4E A;  2ICT A;  2LYP A;  1ZZC A;  3FMY A;  1PNR A;  3BD1 A;  2PXU A;  2KEI A;  3KXA A;  1EFA A;  4PU3 C;  3TEL A;  1PER L;  3OKZ A;  4NDW A;  2LYQ A;  1XWR A;  3SCF A;  4ER7 A;  1Y7Y A;  3SCH A;  4EZI A;  3QQ6 A;  2ODR D;  3NDB B;  4Z58 A;  1JH9 A;  2J7W A;  1BDH A;  2O49 A;  2GZU A;  2PE5 A;  1AU7 A;  3GZD A;  4JQD A;  2XJ3 A;  3TRB A;  2PXK A;  1R63 A;  3O9X A;  5DTM A;  2PXV A;  1B0N A;  2D5V A;  3NXH A;  4I8T A;  1CQT A;  4J1X A;  1RZR A;  1Y9Q A;  3M9L A;  4YG4 A;  4IA8 A;  2XXQ A;  4EK9 A;  4MCX A;  2B5A A;  2HSG A;  2PUD A;  2WIU B;  2EWT A;  2BJC A;  3G5G A;  3F51 A;  2LYS A;  4Z5H A;  2IVG A;  3QYX A;  4I6R A;  3UWP A;  1PRA A;  1NER A;  4F8D A;  3MEJ A;  1QQA A;  2PXT A;  2PUF A;  2PXP A;  4PU8 A;  4I6U A;  2AW6 A;  4ER0 A;  3A9Z A;  3NRO A;  1GT0 C;  1QPZ A;  1R69 A;  2PIJ A;  1ZZ9 A;  3TEP A;  3GZD C;  1WET A;  1WH8 A;  4Y42 A; 
#chains in the Genus database with same CATH homology
 2AXV A;  3QQ6 A;  4Z5C A;  2FJR A;  1ADR A;  1IC8 A;  1CJG A;  1UXC A;  1JFS A;  2OR1 L;  4MCT A;  3ZHI A;  4Z58 A;  1JH9 A;  1RPE L;  1BDH A;  2O49 A;  4JCY A;  1VPW A;  2GZU A;  3OQO A;  4Z5D A;  3HZI B;  1SQ8 A;  3U3W A;  3KZ3 A;  2PE5 A;  1QP4 A;  1AU7 A;  1JWL A;  1ZZ6 A;  1DW9 A;  1WIZ A;  3MLF A;  2PUA A;  1JFT A;  2PUG A;  1E3O C;  4JQD A;  1L1M A;  4YAR A;  2XJ3 A;  3CEC A;  3B7H A;  3TRB A;  1ZVV A;  1R63 A;  3O9X A;  1HF0 A;  1PRV A;  2XI8 A;  4J1W A;  3EUS A;  3FYA A;  2PPX A;  2EBY A;  1UXD A;  2EF8 A;  2KPJ A;  1YSE A;  2IUO A;  1ZZB A;  1B0N A;  3GN5 A;  4X4C A;  3F52 A;  4X4G A;  2D5V A;  3IVP A;  4I8T A;  3DNV B;  2XSD C;  1QP7 A;  2JCG A;  1BDI A;  3CLC A;  1CQT A;  4J1X A;  2AUW A;  2OFY A;  2MEZ A;  1RZR A;  1Y9Q A;  3GN5 B;  3QWG A;  4YG4 A;  2CSF A;  2AXU A;  2KZ8 A;  4IA8 A;  4OB4 A;  1POU A;  3OP9 A;  2ICP A;  3L1P A;  2AXZ A;  4PU4 C;  3CRO L;  2XCJ A;  2L8N A;  4FBI A;  2LYL A;  4FN3 A;  1PRU A;  1UTX A;  3GBF A;  4MCX A;  3RZZ A;  1RZS A;  2B5A A;  3BS3 A;  1ZUG A;  4X4I A;  2IU7 A;  2WUS R;  4JCX A;  3LFP A;  2HSG A;  3FYM A;  2PUD A;  2WIU B;  2EWT A;  2BJC A;  4IWR A;  3G5G A;  2PUC A;  3JXC L;  3KJX A;  3LIS A;  2KEK A;  3F51 A;  2LYS A;  1ZS4 A;  3JXB C;  2O38 A;  3OMT A;  2LYK A;  3R1F A;  2HIN A;  2IVB A;  2A6C A;  4Z59 A;  2MQK A;  4O8B A;  1LCC A;  5A7L A;  2IV1 A;  2GRM A;  2JVL A;  1ZZ8 A;  4Z5H A;  2IVG A;  3OQN A;  2LYJ A;  3QYX A;  3OQM A;  1QP0 A;  4I6R A;  3BDN A;  1PRA A;  1NER A;  1X2L A;  4YG1 A;  2R1J L;  2LYR A;  3S8Q A;  4F8D A;  3D1N I;  1NEQ A;  2CRO A;  2LCV A;  4X4F A;  3G7D A;  1OCT C;  1QQA A;  1ZAY A;  4X4D A;  1LQC A;  2PUF A;  1X57 A;  2AWI A;  2BNN A;  2R63 A;  4YG7 B;  1LCD A;  1LLI A;  4GHJ A;  3ZHM A;  3ZKC A;  3H5T A;  4PU8 A;  4X4H A;  4I6U A;  2AW6 A;  2O4A A;  1ZPQ A;  1OSL A;  4PU7 A;  4IVZ A;  1QQB A;  1S7E A;  1ZZ7 A;  2BNO A;  2L49 A;  2KEJ A;  4I6T A;  2H8R A;  4X4E A;  1RZR D;  1LMB 3;  2ICT A;  3JXD L;  2LYP A;  2IVQ A;  1ZZC A;  3FMY A;  1RIO A;  1GT0 C;  1PNR A;  1QPZ A;  1R69 A;  3BD1 A;  2PIJ A;  1ZZ9 A;  1WH6 A;  2XIU A;  2BNM A;  3KXA A;  2KEI A;  2PUB A;  2PUE A;  1EFA A;  3QF3 A;  4PU3 C;  2GRL A;  1PER L;  3PXP A;  4NDW A;  4YBA A;  2LYQ A;  4GQM A;  3SCG A;  3F6W A;  1WET A;  1WH8 A;  1XWR A;  3VK0 A;  3UFD A;  3SCF A;  4X4B A;  1Y7Y A;  3SCH A;  1O4X A;  1DWK A;  5K98 B;  4Y42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...