1LCDA

Structure of the complex of lac repressor headpiece and an 11 base-pair half-operator determined by nuclear magnetic resonance spectroscopy and restrained molecular dynamics
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
51
structure length
51
Chain Sequence
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the complex of lac repressor headpiece and an 11 base-pair half-operator determined by nuclear magnetic resonance spectroscopy and restrained molecular dynamics.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation/dna
molecule keywords DNA (5'-D(*AP*AP*TP*TP*GP*TP*GP*AP*GP*CP*G)-3')
total genus 11
structure length 51
sequence length 51
ec nomenclature
pdb deposition date 1993-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00356 LacI Bacterial regulatory proteins, lacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 1lcdA00
4FBIA 2XI8A 1JWLA 3QWGA 2WIUB 2LYRA 3FYAA 3PXPA 2PUDA 2BNNA 1UXCA 4FN3A 1LLIA 2PUBA 4MCXA 2IV1A 1CJGA 1ZS4A 3B7HA 2ICPA 2L8NA 1O4XA 2WUSR 2AUWA 2BJCA 1IC8A 2LYPA 1R69A 3GN5B 3QF3A 1POUA 4PU7A 3OQNA 2LCVA 2PPXA 3H5TA 3JXCL 1QP7A 2AXZA 4OB4A 3JXBC 1Y7YA 1ZZ7A 3L1PA 1QQBA 1NERA 1Y9QA 1SQ8A 4F8DA 1RIOA 4I8TA 1XWRA 2KEKA 4I6TA 3LFPA 1QP4A 3F6WA 1RZRD 2OR1L 2XJ3A 3MLFA 2JCGA 1UXDA 2CSFA 3QQ6A 4YG1A 2XSDC 2HSGA 4Z59A 3ZKCA 1PNRA 2PUAA 1WH8A 3GBFA 1ZVVA 4PU4C 3SCHA 2LYJA 2IVQA 4NDWA 3VK0A 4IA8A 4X4DA 3QYXA 1QPZA 3BDNA 2CROA 2O38A 5K98B 3BS3A 1GT0C 1LCDA 2GRLA 2L49A 3F52A 2KEIA 3D1NI 3OP9A 4GQMA 4O8BA 4X4BA 1LMB3 1X2LA 4YBAA 1DWKA 3F51A 1LCCA 2O4AA 3RZZA 3OMTA 5A7LA 2KEJA 2PE5A 3CROL 4MCTA 1BDIA 2LYKA 1JFTA 1OSLA 1ZZBA 4I6UA 2R1JL 4JCYA 1UTXA 2PIJA 2FJRA 4IVZA 1S7EA 1PRAA 1X57A 1ZZ8A 2MEZA 2A6CA 1ZZ9A 2GZUA 2OFYA 2EBYA 4Z5CA 3U3WA 3G7DA 2LYLA 4Z58A 4X4FA 4X4IA 3OQMA 1ZPQA 2ICTA 2AXUA 2EWTA 3TRBA 4Z5DA 1ZZ6A 2EF8A 3JXDL 1BDHA 2LYQA 3ZHIA 4X4GA 3EUSA 3OQOA 1WETA 4J1XA 1LQCA 3ZHMA 3SCFA 3FYMA 3FMYA 3GN5A 3IVPA 4YG4A 2KZ8A 1EFAA 1HF0A 4GHJA 3CECA 3KZ3A 1PERL 1QQAA 2IVGA 2XIUA 1L1MA 2PUFA 2HINA 2BNOA 2AXVA 2MQKA 1VPWA 1E3OC 4J1WA 2JVLA 1B0NA 1CQTA 3KXAA 4X4EA 2PUEA 3SCGA 4JQDA 1QP0A 4IWRA 4X4HA 2LYSA 1AU7A 3R1FA 2AWIA 4Y42A 1ZZCA 2O49A 2KPJA 1RZRA 1JH9A 3G5GA 1PRVA 4YARA 4X4CA 1RZSA 4YG7B 3LISA 1WH6A 3BD1A 4I6RA 2PUGA 1NEQA 1YSEA 3S8QA 2IUOA 4JCXA 1RPEL 3CLCA 2IU7A 2AW6A 2XCJA 2BNMA 4PU8A 1WIZA 2IVBA 2B5AA 3UFDA 1ADRA 4Z5HA 2H8RA 4PU3C 3O9XA 1JFSA 2D5VA 1ZAYA 1ZUGA 1PRUA 2GRMA 1OCTC 1DW9A 3DNVB 3KJXA 1R63A 3HZIB 2R63A 2PUCA
chains in the Genus database with same CATH superfamily
4FBIA 2MXDA 2LYRA 2BNNA 2ICPA 4PU7A 3JXCL 2AXZA 4OB4A 3QOXA 2J7UA 1QP4A 2KEKA 3GZCA 2OR1L 3MLFA 3QQ6A 4YG1A 3ZKCA 3VK0A 1QPZA 2LLVA 3QYXA 2PXPA 2YBDA 1GT0C 2L49A 3D1NI 1QZXA 1LMB3 1X2LA 3OMTA 5A7LA 2KEJA 2FJRA 2PXKA 3OQMA 3TRBA 2EWTA 1ZZ6A 2EF8A 1BDHA 4X4GA 3OQOA 1QB2A 1U2ZA 3FMYA 1EFAA 1HF0A 3KZ3A 1PERL 2PXBA 2HINA 2PXFA 1B0NA 4X4EA 1ZZCA 4YARA 4YG7B 4JCXA 3CLCA 2AW6A 3ZPXA 2H8RA 4PU3C 3O9XA 1ZAYA 3OWQA 1ZUGA 1HQ1A 1OCTC 3DNVB 3KJXA 2R63A 2JQEA 2WIUB 4EKIA 1ZS4A 3B7HA 1O4XA 2WUSR 1R69A 4WVLA 2LCVA 2PPXA 1QP7A 4ER3A 2PXTA 1Y7YA 1RIOA 4I8TA 4I6TA 4ER0A 1UXDA 1ZVVA 3DM5A 4NDWA 4IA8A 4X4DA 3BDNA 2CROA 1LCDA 2L1PA 2PXVA 4EQZA 3QFIA 3UWPA 4GQMA 4O8BA 2LLWA 2O4AA 1DWKA 3F51A 3RZZA 2PE5A 2LYKA 1JFTA 1OSLA 2R1JL 3MEJA 4IVZA 2LNMA 1X57A 1PRAA 2OFYA 1CQTA 2A6CA 1ZZ9A 2GZUA 4Z5CA 2EBYA 3G7DA 4Z58A 2PXLA 2AXUA 4Z5DA 2HFZA 3ZHIA 3EUSA 1WETA 4J1XA 3A9XA 5DTMA 3SCFA 3GZDA 3GN5A 4YG4A 2KZ8A 3TEPA 1QQAA 2IVGA 2XIUA 2BNOA 2AXVA 1E3OC 4J1WA 3KXAA 1QP0A 2VEOA 2LYSA 3QOWA 3ME5A 4X4CA 1RZSA 3BD1A 4I6RA 2PUGA 3S8QA 2IUOA 2XCJA 4PU8A 3M9LA 2B5AA 2D5VA 3G0TA 1PRUA 2GRMA 5DTRA 1DW9A 1R63A 2PUCA 3QWGA 3TELA 2PUDA 2V3CC 4FN3A 1LLIA 2PUBA 4MCXA 2IV1A 3NZLA 2AUWA 2BJCA 2LYPA 3GN5B 1POUA 2PXEA 3JXBC 5GAGi 1ZZ7A 3L1PA 1NERA 1NW3A 1Y9QA 3LQXA 3LFPA 3F6WA 1RZRD 3A9YA 2JCGA 3SR4A 4EKGA 2XSDC 2HSGA 4Z59A 1PNRA 2PUAA 2LYJA 2IVQA 4DE8A 3PE5A 2GRLA 2XXAA 3R09A 1LCCA 3CROL 4MCTA 1BDIA 2HCSA 3SX0A 4I6UA 4JCYA 4ER7A 1ZZ8A 2MEZA 2PXDA 2LYLA 4X4FA 4X4IA 1ZPQA 3JXDL 2ICTA 2LYQA 1LQCA 3ZHMA 3A9ZA 1MFQC 2HCNA 3CECA 2PUFA 1L1MA 3OKZA 4DE9A 2JVLA 2PUEA 3SCGA 4JQDA 4EZIA 2PXUA 3GUUA 4IWRA 1AU7A 3R1FA 4Y42A 2O49A 1RZRA 4Q2JA 3G5GA 1PRVA 1NEQA 1YSEA 1RPEL 2IU7A 2BNMA 5GAHi 4Z5HA 1JFSA 4ER6A 3HZIB 2XI8A 1JWLA 1DULA 2XXPA 3FYAA 3PXPA 1UXCA 1CJGA 5DTQA 2L8NA 2J7WA 1IC8A 3QF3A 3OQNA 3KL4A 3H5TA 1QQBA 4F8DA 1SQ8A 1XWRA 2XJ3A 3GZDC 3TFLA 2CSFA 3VWSA 2M4HA 1WH8A 3GBFA 3NXHA 4PU4C 3SCHA 4ER5A 3NDBB 2O38A 5K98B 3BS3A 4EK9A 3F52A 2KEIA 2FFHA 3OP9A 5JUWA 4X4BA 4YBAA 2PXQA 1ZZBA 1UTXA 5DRTA 2PIJA 1S7EA 5DRYA 3U3WA 2XXQA 4OBMA 3FYMA 5DT2A 3IVPA 3NROA 4GHJA 1VPWA 2MQKA 4X4HA 2AWIA 2KPJA 1JH9A 3LISA 1WH6A 4HRAA 1WIZA 2IVBA 3UFDA 1ADRA 5DSXA 2ODRD
chains in the Genus database with same CATH topology
4FBIA 2XI8A 1JWLA 3QWGA 2WIUB 2LYRA 3FYAA 3PXPA 2PUDA 2BNNA 1UXCA 4FN3A 1LLIA 2PUBA 4MCXA 2IV1A 1CJGA 1ZS4A 3B7HA 2ICPA 2L8NA 1O4XA 2WUSR 2AUWA 2BJCA 1IC8A 2LYPA 1R69A 3GN5B 3QF3A 1POUA 4PU7A 3OQNA 2LCVA 2PPXA 3H5TA 3JXCL 1QP7A 2AXZA 4OB4A 3JXBC 1Y7YA 1ZZ7A 3L1PA 1QQBA 1NERA 1Y9QA 1SQ8A 4F8DA 1RIOA 4I8TA 1XWRA 2KEKA 4I6TA 3LFPA 1QP4A 3F6WA 1RZRD 2OR1L 2XJ3A 3MLFA 2JCGA 1UXDA 2CSFA 3QQ6A 4YG1A 2XSDC 2HSGA 4Z59A 3ZKCA 1PNRA 2PUAA 1WH8A 3GBFA 1ZVVA 4PU4C 3SCHA 2LYJA 2IVQA 4NDWA 3VK0A 4IA8A 4X4DA 3QYXA 1QPZA 3BDNA 2CROA 2O38A 5K98B 3BS3A 1GT0C 1LCDA 2GRLA 2L49A 3F52A 2KEIA 3D1NI 3OP9A 4GQMA 4O8BA 4X4BA 1LMB3 1X2LA 4YBAA 1DWKA 3F51A 1LCCA 2O4AA 3RZZA 3OMTA 5A7LA 2KEJA 2PE5A 3CROL 4MCTA 1BDIA 2LYKA 1JFTA 1OSLA 1ZZBA 4I6UA 2R1JL 4JCYA 1UTXA 2PIJA 2FJRA 4IVZA 1S7EA 1PRAA 1X57A 1ZZ8A 2MEZA 2A6CA 1ZZ9A 2GZUA 2OFYA 2EBYA 4Z5CA 3U3WA 3G7DA 2LYLA 4Z58A 4X4FA 4X4IA 3OQMA 1ZPQA 2ICTA 2AXUA 2EWTA 3TRBA 4Z5DA 1ZZ6A 2EF8A 3JXDL 1BDHA 2LYQA 3ZHIA 4X4GA 3EUSA 3OQOA 1WETA 4J1XA 1LQCA 3ZHMA 3SCFA 3FYMA 3FMYA 3GN5A 3IVPA 4YG4A 2KZ8A 1EFAA 1HF0A 4GHJA 3CECA 3KZ3A 1PERL 1QQAA 2IVGA 2XIUA 1L1MA 2PUFA 2HINA 2BNOA 2AXVA 2MQKA 1VPWA 1E3OC 4J1WA 2JVLA 1B0NA 1CQTA 3KXAA 4X4EA 2PUEA 3SCGA 4JQDA 1QP0A 4IWRA 4X4HA 2LYSA 1AU7A 3R1FA 2AWIA 4Y42A 1ZZCA 2O49A 2KPJA 1RZRA 1JH9A 3G5GA 1PRVA 4YARA 4X4CA 1RZSA 4YG7B 3LISA 1WH6A 3BD1A 4I6RA 2PUGA 1NEQA 1YSEA 3S8QA 2IUOA 4JCXA 1RPEL 3CLCA 2IU7A 2AW6A 2XCJA 2BNMA 4PU8A 1WIZA 2IVBA 2B5AA 3UFDA 1ADRA 4Z5HA 2H8RA 4PU3C 3O9XA 1JFSA 2D5VA 1ZAYA 1ZUGA 1PRUA 2GRMA 1OCTC 1DW9A 3DNVB 3KJXA 1R63A 3HZIB 2R63A 2PUCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FBI A;  2XI8 A;  1JWL A;  3QWG A;  2WIU B;  2LYR A;  3FYA A;  3PXP A;  2PUD A;  2BNN A;  1UXC A;  4FN3 A;  1LLI A;  2PUB A;  4MCX A;  2IV1 A;  1CJG A;  1ZS4 A;  3B7H A;  2ICP A;  2L8N A;  1O4X A;  2WUS R;  2AUW A;  2BJC A;  1IC8 A;  2LYP A;  1R69 A;  3GN5 B;  3QF3 A;  1POU A;  4PU7 A;  3OQN A;  2LCV A;  2PPX A;  3H5T A;  3JXC L;  1QP7 A;  2AXZ A;  4OB4 A;  3JXB C;  1Y7Y A;  1ZZ7 A;  3L1P A;  1QQB A;  1NER A;  1Y9Q A;  1SQ8 A;  4F8D A;  1RIO A;  4I8T A;  1XWR A;  2KEK A;  4I6T A;  3LFP A;  1QP4 A;  3F6W A;  1RZR D;  2OR1 L;  2XJ3 A;  3MLF A;  2JCG A;  1UXD A;  2CSF A;  3QQ6 A;  4YG1 A;  2XSD C;  2HSG A;  4Z59 A;  3ZKC A;  1PNR A;  2PUA A;  1WH8 A;  3GBF A;  1ZVV A;  4PU4 C;  3SCH A;  2LYJ A;  2IVQ A;  4NDW A;  3VK0 A;  4IA8 A;  4X4D A;  3QYX A;  1QPZ A;  3BDN A;  2CRO A;  2O38 A;  5K98 B;  3BS3 A;  1GT0 C;  1LCD A;  2GRL A;  2L49 A;  3F52 A;  2KEI A;  3D1N I;  3OP9 A;  4GQM A;  4O8B A;  4X4B A;  1LMB 3;  1X2L A;  4YBA A;  1DWK A;  3F51 A;  1LCC A;  2O4A A;  3RZZ A;  3OMT A;  5A7L A;  2KEJ A;  2PE5 A;  3CRO L;  4MCT A;  1BDI A;  2LYK A;  1JFT A;  1OSL A;  1ZZB A;  4I6U A;  2R1J L;  4JCY A;  1UTX A;  2PIJ A;  2FJR A;  4IVZ A;  1S7E A;  1PRA A;  1X57 A;  1ZZ8 A;  2MEZ A;  2A6C A;  1ZZ9 A;  2GZU A;  2OFY A;  2EBY A;  4Z5C A;  3U3W A;  3G7D A;  2LYL A;  4Z58 A;  4X4F A;  4X4I A;  3OQM A;  1ZPQ A;  2ICT A;  2AXU A;  2EWT A;  3TRB A;  4Z5D A;  1ZZ6 A;  2EF8 A;  3JXD L;  1BDH A;  2LYQ A;  3ZHI A;  4X4G A;  3EUS A;  3OQO A;  1WET A;  4J1X A;  1LQC A;  3ZHM A;  3SCF A;  3FYM A;  3FMY A;  3GN5 A;  3IVP A;  4YG4 A;  2KZ8 A;  1EFA A;  1HF0 A;  4GHJ A;  3CEC A;  3KZ3 A;  1PER L;  1QQA A;  2IVG A;  2XIU A;  1L1M A;  2PUF A;  2HIN A;  2BNO A;  2AXV A;  2MQK A;  1VPW A;  1E3O C;  4J1W A;  2JVL A;  1B0N A;  1CQT A;  3KXA A;  4X4E A;  2PUE A;  3SCG A;  4JQD A;  1QP0 A;  4IWR A;  4X4H A;  2LYS A;  1AU7 A;  3R1F A;  2AWI A;  4Y42 A;  1ZZC A;  2O49 A;  2KPJ A;  1RZR A;  1JH9 A;  3G5G A;  1PRV A;  4YAR A;  4X4C A;  1RZS A;  4YG7 B;  3LIS A;  1WH6 A;  3BD1 A;  4I6R A;  2PUG A;  1NEQ A;  1YSE A;  3S8Q A;  2IUO A;  4JCX A;  1RPE L;  3CLC A;  2IU7 A;  2AW6 A;  2XCJ A;  2BNM A;  4PU8 A;  1WIZ A;  2IVB A;  2B5A A;  3UFD A;  1ADR A;  4Z5H A;  2H8R A;  4PU3 C;  3O9X A;  1JFS A;  2D5V A;  1ZAY A;  1ZUG A;  1PRU A;  2GRM A;  1OCT C;  1DW9 A;  3DNV B;  3KJX A;  1R63 A;  3HZI B;  2R63 A;  2PUC A; 
#chains in the Genus database with same CATH topology
 4FBI A;  2MXD A;  2LYR A;  2BNN A;  2ICP A;  4PU7 A;  3JXC L;  2AXZ A;  4OB4 A;  3QOX A;  2J7U A;  1QP4 A;  2KEK A;  3GZC A;  2OR1 L;  3MLF A;  3QQ6 A;  4YG1 A;  3ZKC A;  3VK0 A;  1QPZ A;  2LLV A;  3QYX A;  2PXP A;  2YBD A;  1GT0 C;  2L49 A;  3D1N I;  1QZX A;  1LMB 3;  1X2L A;  3OMT A;  5A7L A;  2KEJ A;  2FJR A;  2PXK A;  3OQM A;  3TRB A;  2EWT A;  1ZZ6 A;  2EF8 A;  1BDH A;  4X4G A;  3OQO A;  1QB2 A;  1U2Z A;  3FMY A;  1EFA A;  1HF0 A;  3KZ3 A;  1PER L;  2PXB A;  2HIN A;  2PXF A;  1B0N A;  4X4E A;  1ZZC A;  4YAR A;  4YG7 B;  4JCX A;  3CLC A;  2AW6 A;  3ZPX A;  2H8R A;  4PU3 C;  3O9X A;  1ZAY A;  3OWQ A;  1ZUG A;  1HQ1 A;  1OCT C;  3DNV B;  3KJX A;  2R63 A;  2JQE A;  2WIU B;  4EKI A;  1ZS4 A;  3B7H A;  1O4X A;  2WUS R;  1R69 A;  4WVL A;  2LCV A;  2PPX A;  1QP7 A;  4ER3 A;  2PXT A;  1Y7Y A;  1RIO A;  4I8T A;  4I6T A;  4ER0 A;  1UXD A;  1ZVV A;  3DM5 A;  4NDW A;  4IA8 A;  4X4D A;  3BDN A;  2CRO A;  1LCD A;  2L1P A;  2PXV A;  4EQZ A;  3QFI A;  3UWP A;  4GQM A;  4O8B A;  2LLW A;  2O4A A;  1DWK A;  3F51 A;  3RZZ A;  2PE5 A;  2LYK A;  1JFT A;  1OSL A;  2R1J L;  3MEJ A;  4IVZ A;  2LNM A;  1X57 A;  1PRA A;  2OFY A;  1CQT A;  2A6C A;  1ZZ9 A;  2GZU A;  4Z5C A;  2EBY A;  3G7D A;  4Z58 A;  2PXL A;  2AXU A;  4Z5D A;  2HFZ A;  3ZHI A;  3EUS A;  1WET A;  4J1X A;  3A9X A;  5DTM A;  3SCF A;  3GZD A;  3GN5 A;  4YG4 A;  2KZ8 A;  3TEP A;  1QQA A;  2IVG A;  2XIU A;  2BNO A;  2AXV A;  1E3O C;  4J1W A;  3KXA A;  1QP0 A;  2VEO A;  2LYS A;  3QOW A;  3ME5 A;  4X4C A;  1RZS A;  3BD1 A;  4I6R A;  2PUG A;  3S8Q A;  2IUO A;  2XCJ A;  4PU8 A;  3M9L A;  2B5A A;  2D5V A;  3G0T A;  1PRU A;  2GRM A;  5DTR A;  1DW9 A;  1R63 A;  2PUC A;  3QWG A;  3TEL A;  2PUD A;  2V3C C;  4FN3 A;  1LLI A;  2PUB A;  4MCX A;  2IV1 A;  3NZL A;  2AUW A;  2BJC A;  2LYP A;  3GN5 B;  1POU A;  2PXE A;  3JXB C;  5GAG i;  1ZZ7 A;  3L1P A;  1NER A;  1NW3 A;  1Y9Q A;  3LQX A;  3LFP A;  3F6W A;  1RZR D;  3A9Y A;  2JCG A;  3SR4 A;  4EKG A;  2XSD C;  2HSG A;  4Z59 A;  1PNR A;  2PUA A;  2LYJ A;  2IVQ A;  4DE8 A;  3PE5 A;  2GRL A;  2XXA A;  3R09 A;  1LCC A;  3CRO L;  4MCT A;  1BDI A;  2HCS A;  3SX0 A;  4I6U A;  4JCY A;  4ER7 A;  1ZZ8 A;  2MEZ A;  2PXD A;  2LYL A;  4X4F A;  4X4I A;  1ZPQ A;  3JXD L;  2ICT A;  2LYQ A;  1LQC A;  3ZHM A;  3A9Z A;  1MFQ C;  2HCN A;  3CEC A;  2PUF A;  1L1M A;  3OKZ A;  4DE9 A;  2JVL A;  2PUE A;  3SCG A;  4JQD A;  4EZI A;  2PXU A;  3GUU A;  4IWR A;  1AU7 A;  3R1F A;  4Y42 A;  2O49 A;  1RZR A;  4Q2J A;  3G5G A;  1PRV A;  1NEQ A;  1YSE A;  1RPE L;  2IU7 A;  2BNM A;  5GAH i;  4Z5H A;  1JFS A;  4ER6 A;  3HZI B;  2XI8 A;  1JWL A;  1DUL A;  2XXP A;  3FYA A;  3PXP A;  1UXC A;  1CJG A;  5DTQ A;  2L8N A;  2J7W A;  1IC8 A;  3QF3 A;  3OQN A;  3KL4 A;  3H5T A;  1QQB A;  4F8D A;  1SQ8 A;  1XWR A;  2XJ3 A;  3GZD C;  3TFL A;  2CSF A;  3VWS A;  2M4H A;  1WH8 A;  3GBF A;  3NXH A;  4PU4 C;  3SCH A;  4ER5 A;  3NDB B;  2O38 A;  5K98 B;  3BS3 A;  4EK9 A;  3F52 A;  2KEI A;  2FFH A;  3OP9 A;  5JUW A;  4X4B A;  4YBA A;  2PXQ A;  1ZZB A;  1UTX A;  5DRT A;  2PIJ A;  1S7E A;  5DRY A;  3U3W A;  2XXQ A;  4OBM A;  3FYM A;  5DT2 A;  3IVP A;  3NRO A;  4GHJ A;  1VPW A;  2MQK A;  4X4H A;  2AWI A;  2KPJ A;  1JH9 A;  3LIS A;  1WH6 A;  4HRA A;  1WIZ A;  2IVB A;  3UFD A;  1ADR A;  5DSX A;  2ODR D; 
#chains in the Genus database with same CATH homology
 4FBI A;  2XI8 A;  1JWL A;  3QWG A;  2WIU B;  2LYR A;  3FYA A;  3PXP A;  2PUD A;  2BNN A;  1UXC A;  4FN3 A;  1LLI A;  2PUB A;  4MCX A;  2IV1 A;  1CJG A;  1ZS4 A;  3B7H A;  2ICP A;  2L8N A;  1O4X A;  2WUS R;  2AUW A;  2BJC A;  1IC8 A;  2LYP A;  1R69 A;  3GN5 B;  3QF3 A;  1POU A;  4PU7 A;  3OQN A;  2LCV A;  2PPX A;  3H5T A;  3JXC L;  1QP7 A;  2AXZ A;  4OB4 A;  3JXB C;  1Y7Y A;  1ZZ7 A;  3L1P A;  1QQB A;  1NER A;  1Y9Q A;  1SQ8 A;  4F8D A;  1RIO A;  4I8T A;  1XWR A;  2KEK A;  4I6T A;  3LFP A;  1QP4 A;  3F6W A;  1RZR D;  2OR1 L;  2XJ3 A;  3MLF A;  2JCG A;  1UXD A;  2CSF A;  3QQ6 A;  4YG1 A;  2XSD C;  2HSG A;  4Z59 A;  3ZKC A;  1PNR A;  2PUA A;  1WH8 A;  3GBF A;  1ZVV A;  4PU4 C;  3SCH A;  2LYJ A;  2IVQ A;  4NDW A;  3VK0 A;  4IA8 A;  4X4D A;  3QYX A;  1QPZ A;  3BDN A;  2CRO A;  2O38 A;  5K98 B;  3BS3 A;  1GT0 C;  1LCD A;  2GRL A;  2L49 A;  3F52 A;  2KEI A;  3D1N I;  3OP9 A;  4GQM A;  4O8B A;  4X4B A;  1LMB 3;  1X2L A;  4YBA A;  1DWK A;  3F51 A;  1LCC A;  2O4A A;  3RZZ A;  3OMT A;  5A7L A;  2KEJ A;  2PE5 A;  3CRO L;  4MCT A;  1BDI A;  2LYK A;  1JFT A;  1OSL A;  1ZZB A;  4I6U A;  2R1J L;  4JCY A;  1UTX A;  2PIJ A;  2FJR A;  4IVZ A;  1S7E A;  1PRA A;  1X57 A;  1ZZ8 A;  2MEZ A;  2A6C A;  1ZZ9 A;  2GZU A;  2OFY A;  2EBY A;  4Z5C A;  3U3W A;  3G7D A;  2LYL A;  4Z58 A;  4X4F A;  4X4I A;  3OQM A;  1ZPQ A;  2ICT A;  2AXU A;  2EWT A;  3TRB A;  4Z5D A;  1ZZ6 A;  2EF8 A;  3JXD L;  1BDH A;  2LYQ A;  3ZHI A;  4X4G A;  3EUS A;  3OQO A;  1WET A;  4J1X A;  1LQC A;  3ZHM A;  3SCF A;  3FYM A;  3FMY A;  3GN5 A;  3IVP A;  4YG4 A;  2KZ8 A;  1EFA A;  1HF0 A;  4GHJ A;  3CEC A;  3KZ3 A;  1PER L;  1QQA A;  2IVG A;  2XIU A;  1L1M A;  2PUF A;  2HIN A;  2BNO A;  2AXV A;  2MQK A;  1VPW A;  1E3O C;  4J1W A;  2JVL A;  1B0N A;  1CQT A;  3KXA A;  4X4E A;  2PUE A;  3SCG A;  4JQD A;  1QP0 A;  4IWR A;  4X4H A;  2LYS A;  1AU7 A;  3R1F A;  2AWI A;  4Y42 A;  1ZZC A;  2O49 A;  2KPJ A;  1RZR A;  1JH9 A;  3G5G A;  1PRV A;  4YAR A;  4X4C A;  1RZS A;  4YG7 B;  3LIS A;  1WH6 A;  3BD1 A;  4I6R A;  2PUG A;  1NEQ A;  1YSE A;  3S8Q A;  2IUO A;  4JCX A;  1RPE L;  3CLC A;  2IU7 A;  2AW6 A;  2XCJ A;  2BNM A;  4PU8 A;  1WIZ A;  2IVB A;  2B5A A;  3UFD A;  1ADR A;  4Z5H A;  2H8R A;  4PU3 C;  3O9X A;  1JFS A;  2D5V A;  1ZAY A;  1ZUG A;  1PRU A;  2GRM A;  1OCT C;  1DW9 A;  3DNV B;  3KJX A;  1R63 A;  3HZI B;  2R63 A;  2PUC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...