1LCLA

Charcot-leyden crystal protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
141
structure length
141
Chain Sequence
SLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSOPHOSPHOLIPASE
publication title Crystal structure of human Charcot-Leyden crystal protein, an eosinophil lysophospholipase, identifies it as a new member of the carbohydrate-binding family of galectins.
pubmed doi rcsb
molecule tags Serine esterase
total genus 36
structure length 141
sequence length 141
ec nomenclature ec 3.1.1.5: Lysophospholipase.
pdb deposition date 1996-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lclA00
1C4RA 1DLLA 3AZZA 1KDMA 1GV9A 3O0VA 3WG3A 1WLCA 3LCPA 2EF6A 3U4XA 1BXHA 3AJYA 5CAZA 1ULFA 2A71A 2NZ9A 4AWDA 4H55A 3RS6A 4M3CB 2W39A 2FMDA 3WV6A 3H0OA 2CY6A 2UWAA 3AZVA 4YG0A 1WW6A 1YIFA 1N1YA 1GICA 1MZ6A 1U0AA 2VY0A 3M1HA 4FPHA 2V5YA 5EWSA 3FFZA 1QU0A 3MW3A 1D2SA 2PHFA 2ZGLA 4NOTA 5H9PA 1HQLA 4FP3A 1GZWB 4C1WA 2ARXA 4DS0A 2NMNA 2P37A 4XBLA 3PVOA 2DV9A 3HR9A 2E7QA 1NXD1 3POWA 1LHVA 5CBLA 1G9DA 3JU9A 3IN9A 1W6NB 4Y1UA 2AGSA 4Y20B 4DPNA 5GLZA 3B69A 1Y7BA 4BPZA 4WVWA 1UZYA 2HYKA 4XJ9A 3SH4A 4Y22A 2JECA 4DQAA 4YZ2A 1V6LA 4YW5A 4Q27A 5JOYA 5F9TA 1CR7A 4JC1A 1S1AA 2A5ZA 1GNHA 3WHUA 2DU1A 2DTWA 3DUIA 3WG4A 4UW5A 5L73A 5DUXA 5GLVA 2EALA 1VIWB 3ZXLA 1HLCA 2A70A 4R9BA 5DG2A 4GKXA 4XJ8A 3UK9A 5JOXA 1SACA 1CPMA 5GJ6A 3AP7A 3OY8B 1QOSA 2NM1A 3AJZA 2ZHMA 2GN7A 4K1ZA 1WD4A 3UJOA 1W6OB 3O12A 1SLAA 4WZFA 1C57A 1MACA 1S0JA 1XQNA 2VH9A 2W52A 2P3KA 2AENA 1LCLA 4CZSA 1SBFA 1QOOA 1V6KA 1F31A 2D6NA 2W08A 4LBMA 2KM2A 5E88A 1IKPA 5E8AA 2UWCA 3UL2A 1FNYA 1UL9A 3ZXFA 3V65A 5T5LA 3WDXA 4YW4A 2A6ZA 5T54A 2DVAA 5E89A 4AYUA 3I4IA 1RINA 5EYXA 1FX5A 1LHOA 1V6NA 4M3CE 1MS8A 3IMNA 3OJBA 2VUAA 1QOTA 2D43A 4I30A 2OW4A 3VKOA 2ARBA 2CWSA 4R9CA 3B9CA 1CONA 3USUA 1W6MB 3FLTA 3UJQA 2RHPA 5T55A 4YGDA 3B3QE 3POSA 4FPCA 1CN1A 1QMJA 1V00A 2ZHLA 4RA0A 1DZQA 2SLIA 4YZ1A 4TZDA 3WCSA 1BYHA 3DGTA 3AXDA 4FPLA 4ATEA 2LTNA 1LGNA 3BODA 1VAMA 2DUQA 4XIKA 5T52A 3M3OA 2ZGMA 3LSEA 1S0GA 1W0PA 4FPOB 1V6JA 4YG6A 4JCKA 1A3KA 1EPWA 4IQPA 1V6MA 4YM0A 5LK5A 1Q8VA 2P3JA 1LU2A 5EXOA 1OKQA 3WDYA 2YY1A 1C1LA 1FV2A 4DRVA 3WHTA 1D0HA 4YW3A 3SH5A 1WLWA 3FBYA 2VW2A 4RL7A 2ES3A 3V0AA 1IS3A 1ULCA 4W65A 2Q5TA 1AXZA 3VUOA 2NMOA 5H9QA 3SNMA 3ZPYA 2CTVA 4XOGA 1A8DA 1JYIA 1YO8A 1KJLA 1SCSA 1PZ7A 1Q8QA 1G8WA 2GDFA 3V0BA 3AZYA 4LBQD 1X50A 1AZDA 1DBNA 5CNAA 1MS3A 3ENRA 3R05A 3GNEA 2PHUA 3AP5A 2P34A 2JE7A 1O4YA 2ZA9A 3W58A 1G86A 3INAA 5GM0A 3ZXEA 3CNAA 1MS9A 2AR6A 3AZWA 4BMBA 2YZ4A 1WW5A 2TEPA 3NV1A 1KITA 2WLQA 1LOAA 4P9WA 4YM3A 2BQPA 3APBA 4R9DA 4YM1A 2VW1A 5DUUA 3VKFC 1CPNA 3AYDA 1S0BA 2GNDA 2I2SA 4M3CF 3AYCA 1GZCA 2D3RA 1S0DA 2E6VA 5EYYA 4BM8A 1VLNA 3IPVA 4GALA 4XXAA 2E53A 5JLVA 3LSDA 1V6IA 4P9XA 4U36A 4Z8BA 1SLIA 4Y26A 3B01A 3PMEA 1UX6A 2EAKA 1SLBA 3SLIA 2WSVA 4XBNA 2ZABA 1CQ9A 1URXA 2A6YA 4GKYA 2R1DA 1WUVA 1QNYA 3OPZA 4PBPA 3M3CA 1YI7A 5DUWA 4LBKA 2DU0A 1JXNA 3PVEA 4YW1A 2ZHKA 3NV3A 2ZMNA 4F83A 4DRRA 2GNTA 2A6WA 1AXYA 1AJOA 1W6QB 2EXJA 2D6OX 2GALA 1W6PA 4P14A 1DFQA 3M3EA 1UN1A 2H0BA 1DQ0A 2YROA 3M2MA 4GA9A 3AYEA 2V73A 3VKLA 5GLWA 5KXBA 3N3HA 3T1LA 2EXHA 3MW4A 1AX0A 1UZZA 3PJQA 4ATFA 1ENRA 3AP4A 1H30A 4XJZA 4UW4A 3NV4A 1ULEA 4PF5A 1SLLA 1LGBA 2G4IA 1HKDA 2E7TA 1ONAA 3AX4A 1QGLA 2AREA 2OVUA 3N36A 2ZGRA 3O0XA 1KQRA 5KXCA 5CA6A 1LECA 1KRIA 1G7YA 2NYYA 1YYNA 2ZGPA 3ZXKA 2FHRA 1N3QA 4YGCA 3NV2A 3C2UA 1GKBA 1N47A 2AYHA 3ZSLA 2ZGTA 1GANA 1LENA 2GMEA 3WDTA 1AX2A 4Q26A 3ZYRA 4XYXA 3WNXA 3AXEA 1IS5A 2PHTA 3POYA 3B00A 3HMYA 4XJWA 5JMCA 4LBQB 1I1EA 4Q8LA 1R1ZA 2A6XA 2EXIA 1DQ5A 2A3XA 3TAYA 2DTYA 2JE9A 2WT2A 1ZM1A 1KDKA 1KJRA 1GYKA 4AGRA 4CRQA 1LTEA 1H9WA 5GZDA 1H9PA 2D6PA 4XJUA 1LOGA 3VKMA 2AUYA 3AK0A 4FVVA 1NLSA 5GZCA 1WD3A 2R16A 1CVNA 2VXRA 3O0WA 4AGVA 5IUQA 2R1BA 4XMAA 1YXWA 2NP0A 1Q8OA 3BTAA 3MPPG 1V6OA 3WLUA 1PZ8A 2OUHA 4GWMA 1LULA 2JD4A 2GNBA 2WJSA 2WSUA 4FOVA 3VV1A 1GSLA 2C5DA 4M3CA 4XHBA 3W59A 1MVEA 4NO4A 3OBRA 4WVVA 3BOPA 1FYUA 3AP6A 3D5OA 3MW2A 5H9RA 5JOWA 5DXDA 1DQ4A 4BLIA 1ZA4A 4FQZA 4YLZA 2PHXA 4XTMA 2DYCA 2SBAA 2VU9A 1LOCA 3PVNA 5DZFA 3IKWA 3AYAA 1GZWA 1G9AA 2ZGSA 4Y22B 4YGEA 3SH3A 1Z78A 3N7JA 3VKNA 1PZ9A 1W6NA 1IS6A 4Y1VA 3O5SA 4ISRA 2ZGUA 3OYWA 3NWKA 4BLJA 1MS5A 1C1FA 3ZVXA 3FLRA 1JUIA 2CWMA 1O4ZA 1AVBA 1N3OA 4Q1PA 1BZWA 4Y1XA 3ZYPA 3RRDA 1LGCA 2CYFA 2AH2A 2ZGKA 4FPEA 1WW7A 1QNWA 2LALA 3WDWA 2P2KA 3WCRA 2WT1A 2DVBA 2ZGQA 2YV8A 1IOAA 5GLTA 3ZXJA 1HQWA 1LOBA 3N7KA 4LBLA 5T50A 4HL0A 5T5JA 3OY8A 4UW6A 3QLQA 1W0OA 1FATA 2ZAAA 3AP9A 1I3HA 4PQ9A 5JVVA 2A3WA 1CJPA 4DFSA 2WNEA 5F5QA 5H9SA 5SV8A 1SCRA 2VW0A 2ZMLA 3A0KA 1LEDA 1LU1A 2YXSA 5AVAA 1LOEA 1SLTA 3ATGA 4LBNA 4YZ4A 4AVSA 3BIWE 1S0FA 1DQ1A 1VALA 2CNAA 3USUB 4OZXA 1LHNA 4YW2A 2JDZA 1AF9A 2DVGA 3ILNA 4FOQA 4AGGA 3RQ0A 5IT6A 4SLIA 4LBOA 5IK4A 2EXKA 3ZSMA 2A75A 2ENRA 2ZBJA 1SBEA 4ASMB 5BYNA 1JHNA 2DVFA 2UU8A 1GLHA 4XHXA 5T5PA 4GXLA 5GZGA 2D44A 3TB0A 2GNMA 1UMZA 1W6MA 4MYEA 1ULGA 1AX1A 3ILFA 1SBDA 3WDVA 4YM2A 5JDBA 5GALA 4YGBA 4UW3A 4YFWA 3GALA 4ISQA 1ENSA 3I8TA 2R0HA 2GMPA 2UWBA 2B7YA 3N7LA 1APNA 2P3IA 1N1TA 2JKBA 2C9AA 2GMMA 4JRAA 3RSJA 1Q8PA 1IKQA 1WBFA 1MS4A 3V0AB 4D69A 4FQ4A 1LESA 1LEMA 2PHWA 3OBTA 4FPJA 4M00A 1QKQA 2DURA 1AXKA 3WOGA 1WBLA 2W68A 3OYWB 1WLDA 2D3PA 1FV3A 1J1TA 1DYKA 2NN8A 3FLPA 3V0BB 4U2AA 4YFZA 1TEIA 1WW4A 3T2TA 1S0EA 4XZPA 1UPSA 3D6EA 2D6MA 1F9KA 1N1VA 4ITCA 4XJAA 3QCWA 2A7AA 2PELA 4BMEA 4Y1YA 1CESA 1AJKA 1ENQA 1N1SA 1JW6A 1S0CA 2ZMKA 4PBOA 3RG0A 4ZKTB 2DVDA 1G9CA 4FOYA 1LHWA 2WKKA 3WG1A 3AFKA 1LJ7A 2ZACA 1JYCA 3D4KA 3N7MA 4Q2FA 4WV8A 4FPFA 4LBJA 5DZEA 1A78A 4ZXKA 3WZ1A 3ZSKA 5JOZA 3IPVB 1DHKB 3T1MA 1DGLA 1JOJA 2UURA 1G9FA 1N3PA 2WT0A 1LOFA 4CTEA 4YZ3A 5IK8A 3WVJA 1LODA 2XG3A 5DZGA 5T5OA 3WDUA 2GN3A 1QDCA 1GZ9A 1MVQA 1SFYA 3WUDA 4YG3A 5KXDA 4XTPA 4XILA 2PHRA 5IK7A 5DG1A 2E51A 3N35A 4Y1ZA 2XB6C 1YRZA 1GBGA 4FOWA 4FPYA 4XBQA 3RMXA 4GWNA 5GZFA 2DWRA 2CL2A 3FUOA 4XMIA 3KQRA 1WCSA 1JBCA 1BKZA 3Q9OA 2R49A 2ZKNA 1W6PB 3JUUA 1RIRA 1MS1A 2ZGNA 4FP2A 2YMZA 4XDQA 3A4UA 3R4SA 4AVVA 2A6VA 1DQ2A 4BOWA 3SITA 1FNZA 2D3SA 4XIOA 5HCBA 3L2YA 1MS0A 5IK5A 2ZZJA 4Y20A 1JN2P 5FRAA 1W6QA 5FREA 4YZ5A 5GLUA 3AZXA 1MZ5A 4FPGA 3ILRA 2DUOA 3R4UA 1UKGA 1BQPA 3WUCA 1GNZA 3KM5A 2R0FA 3MEPA 1QDOA 5DUVA 1Z0HA 2D6KA 5HCFA 3FUQA 2A3YA 1CIWA 2OUJA 4PCRA 1IS4A 3ZSJA 2ZGOA 4L8QA 3ASIA 1OQ1A 2ZHNA 1DYPA 3HN1A 3OGGA 4BQ1A 4XXPA 1UAIA 1Q56A 1BJQA 1HDKA 2D6LX 3IM0A 5KXEA 1S0IA 3RMYA 1G9BA 1SLCA 4K20A 4C1XA 2JJ6A 1F5FA 4TYSA 1DIWA 4XE9A 4P9YA 1B09A 5HCAA 4AVTA 1LHUA 2EIGA 4M01A 1ULDA 1DQ6A 4K21A 4Y24A 5CB7A 5GZEA 1FAYA 1Q8SA 1QF3A 1LOFC 1RITA 1VAVA 1W6OA 4KBBA 3SISA 2Z42A 3WG2A 1OFSA 3V64A 4R9AA 2ERFA 4FPKA 4K1YA 4Q1RA 2D7FA 3A0NA 1MR5A 3M3QA 4HANA 4LBQA 2WQZC 2DUPA 4Q8KA
chains in the Genus database with same CATH superfamily
3PUIA 2H6CA 2OXBA 2MNGA 4QX0A 4W8JA 1XYNA 4CXYA 2VZVA 1NZCA 3WXPA 3U4XA 1BXHA 2W87A 5CAZA 4FAGA 2NZ9A 3KV9A 4KU8A 3MZHA 5LEJA 3VDDB 5CFDA 4D6RA 1TME3 2FMDA 3WV6A 3GCXA 2CY6A 4LR4A 5CU1A 1NQJA 3AZVA 3W20A 3CZJA 1RVF3 4QPIC 5EQUA 4QDSA 3HWJA 4W6XA 4XUOA 1GICA 2RDQA 3M1HA 4GJZA 3J26N 2XL9A 5FZ3A 4P9LA 4BK4A 4JGYB 1CAWA 1YCIA 4J6GA 3ES1A 3FFZA 1QU0A 4PJYA 4BQ4A 1D2SA 3VBFC 2PHFA 4QD2A 4NOTA 4QM8A 1GZWB 1HRV1 2ARXA 2NMNA 1ASJ1 1OI6A 3PVOA 4IGPA 5FXXA 1NXD1 1RUF1 2CHHA 1Y9GA 4IV1B 5DMYA 1LHVA 1XSQA 3J8F2 1G9DA 1KD7A 1JZ7A 1PK6C 1W6NB 3DPRC 4HK9A 1ST8A 2VMFA 5GLZA 1J3QA 3AB0A 2QZ2A 4CDXA 4I02A 1Y7BA 3I2OA 3H1YA 1MQTA 1HB2A 3SH4A 3LIGA 4HK8A 2Q1ZB 5IJRA 3IT8A 3PMSA 4B1LA 1RUE3 4N43C 3GZUC 4QHBA 2JG8A 1S1AA 3VBRB 4AI0A 1DZRA 1O59A 3DUIA 4DO0A 2J1RA 2YBPA 5DUXA 2EALA 4E8DA 5L7OB 5HXVA 1H6XA 3ZXLA 1HLCA 3T2OA 1QJU3 2J7MA 4D6SA 2DCTA 4XJ8A 4DNYA 3VN4A 2PA7A 5EV7A 3UK9A 1QH6A 1CPMA 3AP7A 1VRH3 1W2OA 3AJZA 3O1PA 4JZRA 2V4VA 1ND2B 4K1ZA 3OGJA 3O12A 5A6ZA 1OBNA 3ZMOA 1WA6X 3WEZA 2W52A 4HSJA 4UFMA 2W91A 1C8NA 1SBFA 5FKCA 3LKJA 2Q1MA 1QOOA 2XWBB 1UY0A 4DY5A 1REEA 3VL9A 3V65A 5CFDC 2D5HA 2C0ZA 1O5LA 2BVVA 3LOIA 4UYBA 1AL23 3A21A 4A42A 5C3SA 2IZWA 1FPN1 3ITQA 3ZN6A 5LBCA 3KWVA 5E89A 5EYXA 5KHIA 3HBZA 3HT2A 1TVGA 4KMQA 3IMNA 2KA3A 2Z5WA 4LE4A 3ON7A 1OVSA 5BNPB 2D43A 1K3IA 4I30A 3RJ2X 4QU2A 2ARBA 2CWSA 4R9CA 4AQ2A 4BXFA 4CEYA 5JXIA 4AI9A 5C4WA 2Z4FA 2RHPA 5T55A 5AFBA 4YGDA 3KV4A 1CN1A 2ZHLA 2J1VA 3AKSA 4P9GA 1LR5A 1XBFA 4CDXC 4FPLA 3RFRA 1D4VB 1MQTC 1YUDA 4GB33 1VAMA 5A70A 4OHWA 4X8NA 3MLKA 3LSEA 3AMNA 1W28A 1V6JA 2KR2A 3KHCA 4WVMA 4IQPA 4YM0A 2JG8C 1Q8VA 5C9AA 2P3JA 5A32B 1LU2A 5EXOA 3WDYA 3OG2A 4DRVA 1ENXA 2DBIA 3NSTA 3SH5A 4PQQA 4Q4W1 1MEC3 3V0AA 1BVP1 2VMGA 1IS3A 2Q5TA 1RUE1 2NMOA 4UBGA 4OI4A 1JYIA 1A8DA 3AMQA 2BNOA 2HLEA 4N53B 3NNGA 2W5FA 2VC9A 5IW0A 2VBPA 2GDFA 4FCAA 1UX7A 2RR13 4Q0SA 4LTAA 4P02B 1DBNA 1JYWA 3DKQA 4XF0A 1OLQA 3K46A 3KT4A 4QPWA 2PHUA 2QQIA 5J7MA 4GWIA 2B9UA 3AP5A 1VRH1 3U11A 1RC6A 3HD8B 3ZXEA 4G9SB 4ZU7A 2NQYA 3BTYA 1BBT2 4P08A 3WQBA 1RUC2 4JGZA 1NYWA 1JHJA 1QJFA 3NKGA 3NMBA 5A1LA 3CDZB 1ZZ9A 4QDRA 2FQPA 2XVKA 4YM1A 1EAH1 2GSYA 1YJKA 3AYDA 3ZYIB 5I93A 2GNDA 4M3CF 4H2AA 1YQ5A 3ZX7A 3HIFA 2E53A 2WO3A 4CEYC 4Y3OA 3JBG2 3IZOA 4P9XA 3VBHA 5C4WC 5J1XA 1XNDA 1Y9QA 2YYOA 4RR3A 1SLIA 4Y26A 5HCHA 3GF6A 4L99A 1SLBA 2R063 2JDNA 2ZEZA 3H3LA 2GU9A 3KV6A 4IEWA 4XBNA 3SLIA 3N9OA 4FO9A 4P5YA 2QQMA 3M3CA 3TYJA 4PT6A 1NE4A 4QKBA 5CIRA 3RZZA 3HQUA 2MHFA 4QPIB 2DU0A 3PVEA 1AYN2 3NV3A 5C9AC 2QQLA 4R4ZA 4DRRA 2DFBA 1RUG3 2GP3A 1AJOA 2ARCA 1W9YA 3FJSA 3VBFB 4H7LA 3TN92 2OS2A 3O1UA 2DFCA 2DCKA 4GB31 5F8PA 3M2MA 1D4M1 1ZBE1 2VZUA 2V73A 3I3EA 1XRUA 2EXHA 3MW4A 1PK6B 4XCBA 3DPRB 3OB8A 3GZAA 1W2UA 4NIIA 4EN6B 4XJZA 2RM21 1CGPA 4UW4A 3NV4A 4QKNA 5BUVA 1ULEA 3PIGA 2J42A 1W03A 4QQOA 1AR81 2R073 1ONAA 4N43B 2ZGRA 4YW7A 1KQRA 1UY1A 2B9VA 2NYYA 4IUGA 4NAMA 4QXHA 4JGZC 5FYZA 5F1RA 1J3PA 1X9PA 4M4RA 5A1AA 4Q4V3 2RR11 1H0BA 5FWJA 2ZGTA 1GANA 2K2SA 3CF6E 3HQXA 4A7KA 4DUWA 1AX2A 3ZYRA 1QJY2 3BN6A 2QQUA 4XYXA 2BNNA 3MIEA 5I0UA 3WNXA 1JYTA 2PHTA 3POYA 2FDJA 2JKXA 3J8F3 4LBQB 3VBHC 3TEXA 2Q8OA 4RR3C 3MUZ1 1PVC3 3RNSA 3WQ1A 4QT6A 1EV12 1VBE2 4AVCA 4GULA 5FK8A 4DS0A 3WF0A 4B7EA 4EN9B 4AGRA 5ACA3 1H9WA 5GZDA 5LA1A 1H9PA 2D6PA 2V72A 5CFDB 2VUCA 4AXOA 2R16A 4AGVA 1Y3TA 1Y43B 4XMAA 3ZYHA 1Q8OA 3MPBA 1CAWB 1J1LA 2LUWA 1LULA 2JD4A 2GNBA 2WJSA 1TG7A 3LQCA 3VV1A 4XHBA 4M3CA 4IXLA 2GZWA 1RXFA 2Q0AA 1GU3A 3AP6A 5DXDA 4ONUA 3K4DA 3OBZA 3GBGA 4FQZA 3RI8A 4BU2A 2MEV2 4DIQA 1AR93 2PHXA 3RYRA 2DYCA 2AEZA 2XKPA 4NROA 4EROA 3O7OA 1RUG1 4W50A 4CDXB 1H8TA 1RUD1 3R6SA 3FN9A 1MQTB 4L11A 1OXCA 5DN2A 1SG3A 4ZPIA 4KNCA 3THCA 3N7JA 4OLLA 1W05A 3KV5A 1CAXA 2CDPA 5FYTA 1ULPA 4NJ4A 4XQDA 2WO7A 5LBFA 3OGSA 4ISRA 3TBDA 1PM7A 2FCTA 2JG8B 2E7AA 2WS93 3NWKA 1ALYA 1MS5A 4BLJA 4D7YA 5LBBA 3UGHA 3FLRA 4LA3A 2CWMA 2B4KA 4TWTA 4S2HA 1REDA 4NAOA 1LGCA 2CYFA 1RMU2 2HBUA 3OF1A 1QNWA 1COV3 4MGIE 2R071 2XR4A 2P2KA 3ZDSA 5BNQA 5FPVA 1UD1A 3J7NA 3JZVA 4G3YC 2YV8A 3K48A 4O65A 4MGTA 1LOBA 1X8EA 2QDNA 3N7KA 4E27A 3WW1A 5L9RA 1DYOA 4HL0A 2A73B 3IB3A 2VQAA 3MV01 4NRQA 2HWC1 1OC1A 1IPKA 4V1PA 1FATA 1JZ8A 1QIQA 1I3HA 3WF4A 1VBD1 3ZN6B 2BRTA 5JMOA 1OMIA 2VZSA 2WNEA 5H9SA 4CU8A 3DYMA 3BKZA 4YZ4A 4B3NA 2ZEXA 3NL1A 4TXWA 1O4TA 4CEYB 2X5IA 5J96B 2XL7A 5C4WB 1LHNA 2H6BA 4YW2A 2C26A 2RJLA 1XNKA 4FOQA 5FY7A 5IT6A 5IK4A 2DBNA 2A75A 1JOPA 2Y0IA 2UU8A 2VD7A 5C3PA 2IXKA 2RS52 5JI7A 4QX1A 2IXJA 1K42A 3ACIA 3WDVA 3KQ4B 4K6BA 3ACLA 2JDYA 4FXKB 4LXLA 5J37A 2PFWA 1BBT3 5EHDA 1VPHA 3RYKA 1RUC3 4WVMB 5DAVA 4E2QA 3OD4A 2GMPA 3UESA 3ORJA 2XDVA 5AVPA 2L9LA 5C9AB 2P3IA 2W1SA 1N1TA 1PO13 1XSRA 3C7OA 1CZVA 4JRAA 1Q8PA 2ZJCA 2J1TA 3R0RA 5LA9A 3GHNA 4XVHA 1MS4A 2XJQA 4QHZA 3V0AB 3B7MA 2PHWA 4HKLA 3JBG3 2DURA 5LASA 2W68A 5FUNA 3OYWB 1UY2A 1FV3A 2FZ1A 2JXAA 3GM8A 3N9NA 3EJKA 4NHYA 2BOIA 1LKNA 2IC1A 2IXHA 4YFZA 5ERLA 1YI9A 2XONA 3X29B 4AW7A 1NX9A 4QXKA 1HRV2 4UWDA 3O1SA 2FDFA 3JD71 2JIGA 5FYSA 1WCDJ 1N1VA 1JYXA 1UKRA 2W0XA 4CDQA 1UF2C 1XNCA 4G4FA 4JGZB 3H50A 2ADDA 2ZTNA 1CESA 1AJKA 4TTGA 1S0CA 2ZMKA 3RG0A 5JCTA 2E63A 2WKKA 4Z8BA 1OT5A 3N7MA 4Q2FA 3PLQA 2O8QA 2VQUA 3S6PA 4N9IA 5DABA 5FZ9A 3WZ1A 3RYPA 2X5IC 2QE3A 1VRBA 2W9XA 4H7MA 3VBHB 4SBVA 5IK8A 3WP4A 4RR3B 4Y4YA 3J4UH 1SFYA 1K5MC 2V4AA 3WUDA 3MHZA 5KXDA 3KCYA 4XTPA 3BOWA 5FTTC 1JYVA 1CX1A 2WINB 5IK7A 2E51A 4BQXA 2OA2A 3G6JB 2XB6C 1TE1B 2VMDA 2JEMA 3E1F1 1OD5A 1X8MA 1YRZA 1VBA2 1ZZ6A 4GWNA 2W1UA 2WNVA 2YGMA 1BEV1 3KQRA 1CX4A 4JGYA 3T0DA 1S2KA 3MO4A 4PLMA 1BKZA 3IMMA 3Q9OA 1PNGA 1FOD1 1QQP3 2R49A 2VNVA 2ZKNA 3P5BA 1HV0A 4JKLA 4AQSA 4DXZA 1QJY3 4UAPA 3A4UA 5FPAA 4AVVA 2WO2A 2A6VA 4Q0PA 4OVEA 1FPN2 3IBMA 2D3SA 5EIYB 5HCBA 1MS0A 4JVAA 2YHJA 1HW5A 5LRRA 1ZRDA 2YUEA 2EIEA 2I07B 3C7FA 1Q43A 4FPGA 1HRI3 2DUOA 3OUHA 5FP9A 4CP0A 1BQPA 3WUCA 1GNZA 4K8RB 2Y38A 4LIUA 1TME2 5FO9B 2D6KA 5HCFA 2FD8A 2Y26A 5HPOA 1PGW1 5JPMB 3SEEA 4CDQC 3VBRA 1J59A 2WZPP 3ASIA 3VZLA 1ZBA1 1DYPA 1X33A 2CAUA 2HWB3 4FFHA 2WQ4A 2ILMA 2P5BA 3LZZA 1S0IA 3NNFA 4BA6A 1S2BA 4C1XA 3CEWA 4TYSA 3CL1A 1DIWA 4J1WA 4XE9A 4AEKA 4F3JA 1W90A 2O8OA 5F3GA 3BUCA 4Y33A 4D3WA 1DQ6A 5CB7A 1ND2A 1Q8SA 1VAVA 3CU7A 3H1MA 4QAWA 4KBBA 2V5DA 3AKPA 4LOSA 4DUXA 2Z42A 4RN5A 1XB9A 5HXMA 4OULA 3JQXA 2WYFA 4AI2A 3C7HA 4OI2A 4LO6B 2VBDA 3WP3A 4H3WA 4A41A 5AC91 3A0NA 4EN8B 2FDKA 3M3QA 3I54A 4LT5A 1C5HA 5EFUA 3WY6A 1RUE2 1QY4A 4MZUA 1DLLA 4LLOA 4JRLA 4TN7A 2ORZA 2WNVC 2VOTA 3C8XA 2ETEA 3S5QA 4B1MA 5CZKA 5FMBA 2HYXA 4AEDA 4AWDA 2VPVA 1AR63 4AL9A 4M3CB 4CXXA 3H0OA 1VRH2 4YG0A 3ACGA 1YIFA 1N1YA 3AM2A 3KVAA 3NJZA 4YPJA 3TNQA 1MZ6A 4I0WB 3CHXA 2VOKA 4FPHA 1JZ4A 4L0PA 4XFGA 3AVRA 1POV3 4DEQA 2ZGLA 5FP4A 4KQ7A 2D97A 1HQLA 2CSGA 3KCXA 2VOVA 2BFUS 1QH7A 2PXJA 1QQP1 2RMU3 3NJYA 4NPMA 4C1WA 5JUVA 1PGL1 3LDKA 2DV9A 4OCTA 1OH4A 1PIV3 3U10A 4KWLA 3E5QA 3KT7A 5FYHA 1CAXB 5KHGA 3JU9A 5FAXA 1AL22 2W94A 2QKDA 2BUKA 1K45A 2AGSA 3PUSA 4KWKA 3ZDVA 4DPNA 3U1XA 4BQ3A 1YQ8A 2BEOA 2E9QA 1IHMA 2GP5A 4GWJA 4YZ2A 1V6LA 1CAUA 1W9WA 4UT5A 2PLV3 1T2XA 5M0TA 2VZRA 4MG2A 1F8VA 5F9TA 2PHDA 4JC1A 2Q1FA 2X29A 3HT1A 3WHUA 1SEFA 5FMDA 3BTZA 2A70A 2P4EA 4R9BA 5IVVA 1O3QA 1ZA7A 2HWB1 1MZEA 4B29A 4JV4A 5FXZA 2VOXA 2N7GA 5F5IA 4GB32 5F2WA 1M4WA 1D4M2 1NUKA 1ZBE2 2MPFA 2NM1A 2ZX4A 4XF1A 5C8CA 2GN7A 1NKGA 4NR1A 2XPJA 1W6OB 2X10A 5A3MA 2P6CA 4AE2A 3H8XA 1AR73 1WLTA 1VBB1 1C57A 1S0JA 4BQYA 2YU2A 2AENA 1YIPA 4H14A 2QQVA 5F2SA 2RM22 2Y6KA 1OURA 1UY3A 1DCSA 2D6NA 3ABZA 4AZZA 4LBMA 4AEDC 2KM2A 5E88A 5E8AA 3ZKUA 3KLSA 3FL7A 3FWEA 3ZXFA 2WWSA 5CFCA 1AR82 3W21A 1I9RA 2VJXA 4V2WA 2JD9A 1QJZA 2BOJA 2X5IB 2YDEA 1U5YA 5I91A 2DVAA 2K9ZA 3T30A 3JB4C 5FPLA 3RJRA 1OD3A 4PLNA 1FX5A 4BIFA 1V6NA 4M3CE 3LAGA 1K5MB 1UYPA 2RR12 3OJBA 5EPAA 2VUAA 3ZFGA 4MUVA 4GAZA 2PQQA 4A45A 1ASJ3 4Y5Z0 5A7SA 1PHMA 1RUF3 1SFPA 3B3QE 3UKVA 3POBA 4FPCA 3F2ZA 3KHBA 4RA0A 1V00A 3ZOIA 1DZQA 4MXVA 5JXGA 4TZDA 5F5CA 3AXDA 5FY9A 1CWPA 1H2MA 4D0QA 2LTNA 1X36A 3PDQA 1RUH3 3POEA 2DUQA 1NY71 1O5UA 5FY4A 5T52A 5JZGA 1XE0A 1JH5A 5A6YA 3LD8A 2C4XA 5FZHA 1H2LA 1W0PA 5JSRA 4BIOA 1A3KA 3DN7A 3C7EA 5HI0A 5J09A 4HKOA 2Y0OA 4FBFA 2YY1A 4LO7A 3WHTA 5I0DA 1US2A 3VB9A 3LEKA 3FBYA 4BWOA 4CVUA 2JIJA 2JDHA 4C0BA 1XU2A 3J9SA 5A7PA 5C8CC 2PLV1 5IVYA 1J83A 2YB7A 2CTVA 2X8KA 3SNMA 3ZPYA 1YO8A 1SCSA 4AFCA 4CDQB 1W04A 3SHRA 1G8WA 2HEVF 1RUG2 4E2GA 1DGWX 5FYYA 3ENRA 5FCCA 1CD3G 1HJFA 5CFCC 2P34A 1UNBA 1O4YA 5FJKA 3CJXA 4EN0A 4E4SA 1MZFA 1FPN3 4BMBA 1WW5A 1AHSA 2OYZA 1KITA 2BQPA 1AR71 4R9DA 1CPNA 3NAPA 4AHYA 1GP5A 3ZFGC 2FBEA 3RGBA 2JDPA 1HXS1 3IPVA 3NJVA 5FMOL 1W8ZA 4XXAA 3UYJA 1UYYA 3VZKA 5FO8B 3A7QA 1F4HA 2R072 4U36A 5A7QA 2IFRA 2Y34A 3VD5A 4CU6A 3NNJA 1UX6A 3KF3A 3PMEA 3UETA 2EAKA 4LO4B 3WF3A 2WNVB 5K0UA 2QFEA 4Q4V2 1KXGA 1I6XA 2BPA2 1OH3A 2JDKA 3C7GA 3LPGA 1QNYA 3OPZA 4O9GA 5JZGC 1Z7S1 3ZXGA 4FFIA 3MF9A 4LBKA 4LQRA 2RS33 2IXIA 5I0SA 3MBWA 4YW1A 4QMAA 5FP7A 2WZR3 1A6CA 3FFQA 5C3QA 2A6WA 1PVC2 1IPJA 2EXJA 3K4AA 2BNMA 3IDEA 5CG9A 3B93A 3MYXA 4AF9A 4Q4W3 4D7TA 1DFQA 1RUH1 1UCXA 3M3EA 1U12A 1UN1A 4GA9A 5ACA2 5IAXA 4Y4RA 3TRSB 2PAEA 3CMGA 1PMJX 3N3HA 1BK1A 4MHRA 2IWGB 1L7RA 4CP9A 1UZZA 2ADEA 3NO8A 3VBUA 4ATFA 4E8CA 4ZZ8A 1IG3A 4K9SA 1ZVFA 1ENRA 4LNVA 5FJHA 4GH4A 4OHYA 4GD4A 5FY0A 3VBOC 4L92A 4AK3A 1LGBA 4YNIA 2G4IA 1IG0A 2E26A 4URTA 3B02A 1QGLA 2AREA 2OVUA 3N36A 4HPKB 3HN3A 5D8AA 5KXCA 5CA6A 1LECA 2WFF3 1G7YA 4YVSA 5CEHA 3KD4A 3H8OA 2ZGPA 3ZXKA 2QVSB 5IWFA 1AR92 2WDBA 5FLHA 1EAH3 3NAPC 3C2UA 4HETA 1N47A 2VMHA 2CU5A 4K40A 2IVJA 3LWCA 1DGRN 1QJX1 4V2VA 4UF0A 1CZSA 1YC61 2PMWB 1NG0A 1R091 3EYPA 3HMYA 4XJWA 5JMCA 1I1EA 1R1A3 4Q8LA 1EPZA 2VE1A 4GMP0 2WS92 1YFUA 2DTYA 2JE9A 2QTWB 2BBAA 2I45A 5K0UC 4C0HA 3J7MA 2AACA 1KJRA 1GYKA 2W1WA 2AZ5A 1ZZBA 1ZYBA 4IE0A 3ROUA 4AEDB 1QHDA 2ET7A 5FPUA 4JDOA 2VXRA 3OUJA 1COV2 3T4HB 1VE0A 5IUQA 5KHJA 2X53S 4CU9A 5C5TA 3UT0A 3PVBB 5FBJA 1V6OA 2HWE1 2OUHA 1HQNA 4GWMA 1H1IA 2BERA 4QPYA 3W59A 2Y64A 4WVVA 3OGRA 3OBRA 3BOPA 1FYUA 2UY8A 3PURA 4TSVA 3D5OA 5H9RA 4Z07A 1D4M3 1ZBE3 5JOWA 3NNLA 2VBBA 5ANQA 3Q8AA 2RS31 3VBUC 1YLLA 3C3VA 1DP0A 2WZR1 4GH4C 3VHPA 4CCCA 5C71A 2RM23 3IKWA 3AYAA 4CA9A 5DAPA 4LK6A 4Q29A 5BV6A 3SH3A 1CAUB 3VKNA 4A4AA 1AR83 5D8AC 3AKQA 1IS6A 3SQOA 3P3NA 2ZGUA 3OYWA 4YVSC 2OT7A 1C8M1 4OI1A 4CCJA 1BZWA 1FOD2 1TNRA 3ZYPA 2R32A 3URFA 1EY2A 4I3GA 2AH2A 2ZGKA 4FPEA 3T08A 4RS5C 1OA3A 5C8CB 3K4ZA 4QQPA 3THTA 3WCRA 2XLAA 4A7ZA 3HNYM 2WFF1 2WT1A 3N9MA 2ZX1A 5F39A 3SKJE 3ZXJA 2LRPA 3J7HA 3D3AA 3AMHA 5T50A 2OKXA 4MV2A 5T5JA 1PO12 2QQJA 2QQOA 4UW6A 3QLQA 3SMHA 5CFCB 3ZN4A 2JB8A 2K46A 3VHNA 5A3PA 1PGW2 2VNGA 3E97A 1R1A1 5ABJC 2A3WA 3OEBA 1XJAA 4EWDA 3S5AA 5SV8A 3NVCA 5I8TA 4M4PA 4S2DA 5JWPA 3A0KA 4IW3A 3ZSEA 1LU1A 3ZFGB 2G9GA 1LOEA 3ATGA 3FC0A 3WNKA 3WNMA 4ASKA 4RFRB 1PX4A 3I2GA 3RVHA 1VMJA 5F7UA 1W8WA 4QQ2A 4AOCA 1AF9A 2ZCWA 4AGGA 2HWF1 2RE9A 5F32A 4SLIA 4LBOA 5J98B 2EXKA 4HN0A 4XEZA 3RQ0A 2ZBJA 3TEZA 1SBEA 2BGCA 2WC2A 4J25A 4XHXA 5T5PA 1RUD3 4GXLA 2D44A 1GQPA 2GNMA 1SPPB 2ORXA 1W6MA 3I2KA 5AC92 3ILFA 5JZGB 4YM2A 4EV0A 4HXCA 3GALA 1XOYA 1OQEA 2WRAA 4QX8A 1C28A 3N7LA 1UYZA 2KD7A 4A6OA 4KWJA 3OCPA 4CDUC 1GP4A 2XXZA 1LEMA 3I2DA 3U0ZA 1WBLA 1SFNA 2ZKLA 4X8PA 1IPSA 1WLDA 4L9BA 2YC2A 2YC4A 4YYOA 2OZ6A 3ZM8A 3FLPA 2D98A 4U2AA 4KG0A 3Q8EA 4OFGA 3T2TA 2Q4SA 4M0HA 3M8LA 4I2OA 1S0EA 2W3JA 3QOPA 1VB4A 4XF3A 3VBOB 1HB4A 3W5MA 2WWUA 2RDNA 1QQP2 1PGL2 5DQ0A 2HWC3 1F9KA 3J7LA 4ET7A 2VZ1A 2P1BA 3I2HA 3WQ7A 1W06A 2ATFA 3BB6A 1GOGA 1VBD3 4AI8A 2A7AA 1IZ3A 1E5HA 2PELA 2FDGA 1XNBA 5AFEA 2WZEA 1OOPA 4OUSA 4PBOA 3NAPB 2CDOA 2DVDA 1G9CA 1LHWA 1ZNPA 2R6QA 1W9SA 4UFHA 2ZACA 4WV8A 5DAXA 4ZXKA 1HRI2 2R30A 3ZSKA 4EJRA 3DCQA 1A78A 4DXRA 5J3UA 3IPVB 1DHKB 2PQSA 3T1MA 3N9QA 2UURA 1IQAA 5DAQA 5FK7A 1JZ5A 3TNPB 3WVJA 3SC7X 2XG3A 1U5IA 1NZIA 2GC3A 5DZGA 5C33A 1GZ9A 1UQXA 4YG3A 4QB2A 5K0UB 3RWNA 2HWB2 3HQRA 4CSWA 5DG1A 1JMUB 3GYDA 2A1XA 3MFAA 3N35A 4Y1ZA 5FDBA 3H9AA 2RJKA 4GZ9A 4FPYA 3GJBA 5FZGA 3RMXA 1UZWA 3FUOA 1ZZ7A 3VL8A 3E6CC 1WCSA 1JBCA 3FX3A 4QGLA 3OGVA 1GOHA 5F3CA 3JUUA 1RIRA 1YQ2A 3IDCB 1MS1A 1E5RA 3R4SA 4CXWA 1OVPA 5HV4A 5C70A 1JZ6A 4PI2A 3SITA 4XIOA 2YBKA 4CP9B 3VBUB 3FHQA 3WINE 2WO1A 4CE8A 2GC1A 4YZ5A 4GH4B 5FY8A 1MZ5A 3ILRA 2Y6LA 1VBC1 3R4UA 4QX5A 1UKGA 5CVRA 3RDIA 4ZHNA 2VUJA 5JXHA 1AR62 3JD73 4JQTA 3HEIA 4BQ5A 1Z0HA 4OMCA 1CIWA 5D8AB 3LA2A 4PCRA 2XUMA 4LKFA 5FYBA 3ZSJA 4L8QA 4CUAA 4YVSB 4UFIA 4BQ1A 1KFXL 2YPJA 4INDA 2VZTA 4MGQA 5LA2A 3IM0A 2D6LX 2JICA 1OOPC 4W4ZA 3RMYA 4Q5OA 1UMIA 4K20A 2YBSA 3LE0A 2RMU2 3M4FA 5C3RA 4P9YA 4UF0B 4AVTA 3WNLA 4RS5B 4M01A 1PIV2 1FAYA 1W6OA 4X6RB 3SISA 1VMFA 2UYBA 3QH7A 3KVBA 2E33A 1WMDA 2JENA 3ZR6A 2Q8EA 4GMP1 3W9AA 1WMFA 2ARAA 5C7GA 4K1YA 4Q1RA 4RQPA 1UXZA 2BJSA 2WQZC 3ZYBA 2C6SA 2PLV2 2DUPA 3DV8A 4MGSA 1C4RA 3GZEA 5B4XA 3AZZA 1KDMA 1GV9A 3WG3A 4KGQA 1KFUL 2BV4A 4MXWA 5FZ4A 4AEJA 5ABJB 1AL0G 4O9EA 3O1OA 1BEV3 5FP3A 3AJYA 4DXTA 4B4QA 1ULFA 1K5MA 1PO21 1UOJA 4B4RA 2YPDA 1FOD3 3RS6A 3VD4A 4LO5B 2W39A 1ZZCA 1W2TA 2F6BA 3MLJA 3RZLA 5FZKA 3ZYGA 1WW6A 4RHV1 1C5IA 1U0AA 2W1QA 5LA0A 4A6SA 3U14A 2VG9A 3KMHA 4LHLA 2XBO3 2ZOEB 2V5YA 1AR72 1WGPA 2CAVA 3MW3A 3MDPA 5EWSA 4MVTA 3T0BA 5H9PA 3DXUA 2GH2A 1WWYA 2VOWA 1PMIA 1HXS2 3HR9A 5FZOA 1S4CA 4Z1VA 5LEKA 5FQ0A 2QZ3A 1HX6A 3BU0A 1HB1A 1KS4A 3IN9A 4Y5SA 1BK0A 1ZBA3 5A1FA 1ODMA 2Y33A 1UIKA 3BPSA 4WVWA 1UZYA 2HYKA 4XJ9A 1DDLA 2JECA 1BVVA 4YW5A 3ZYFA 4CDUB 3U78A 5A3NA 1ASJ2 1Z7S2 5F6LB 4IGOA 5L9BA 3VBSA 5JOYA 2BTVC 1GNHA 1RUF2 5L73A 2Z79A 1VIWB 3RPQA 1BCXA 5FYIA 2XJVA 2YGLA 5JOXA 1SACA 2G9FA 4DY3A 5GJ6A 5FY1A 1RUH2 4RQPC 4AFAA 1G6NA 4AI3A 5AC93 1LRHA 1YHFA 5I8YA 4XDOA 2ZHMA 4R8HA 1AUYA 4IEZA 3UJOA 3ZMNA 1UO9A 3G7DA 2VULA 2NPIA 3EB7A 5LW9A 3BPZA 4WZFA 4ZS3A 4A3XA 3SEPA 5LY2A 3TOJA 2DCJA 4CZSA 3UGGA 1LCLA 1V6KA 2Z69A 1FMD1 1IKPA 2XQRA 3UL2A 4EE2A 1SDDB 4ZY9A 5T5LA 2RV9A 3PU3A 4YW4A 3M70A 4LIVA 2OPKA 5LB6A 2B46X 2BYVE 1D7PM 4XQWA 1UOBA 4AYUA 1RINA 4KBZA 5ISLA 2XJTA 1W2NA 4IGQA 1MS8A 3FBMA 2J1EA 5GKAC 2W92A 3NRUA 1QOTA 3RZHA 2RJ2A 1WCKA 2P6HA 2OW4A 4MX3A 3VKOA 3JCIA 3D0JA 3HOBA 1CONA 2RG4A 1W6MB 4QGNA 5FZFA 2LROA 3UJQA 4QDQA 3USUA 3KGLA 2W95A 2VQTA 1JU3A 1PNFA 1CIYA 3POSA 1QMJA 1UOFA 4JTOA 5FOBB 2SLIA 4QWNA 4YZ1A 3S30A 2XBO1 3DGTA 4ATEA 1W2AX 1LGNA 3CZUA 4E9KA 3BODA 1X9TA 3M3OA 2FDHA 2HEYF 4CCNA 2ZGMA 3OPWA 3JXSA 4PDWA 1SZBA 3THDA 1O3RA 4YG6A 5LATA 4JCKA 1EPWA 1STMA 4N7IA 1V6MA 2R7EB 1GQHA 4P00B 3VBSC 2XHNA 3Q8BA 5A7NA 3BIEA 4FT8A 2ZEWA 4WZCA 1C1LA 4NIHA 2J22A 3IDBB 1U5XA 1D0HA 4YW3A 4KL1A 5A3WA 4E2SA 4DMIA 2V09A 2VW2A 4RL7A 4XUNA 4EQVA 4W6YA 5FYVA 3VHRA 3S0MA 3VUOA 5H9QA 4HPKA 4XOGA 3KZ4C 3HVDA 4S2FA 1PZ7A 2RS32 4OHXA 4P9JA 3V0BA 1R64A 1TQ5A 1VBB3 2WZR2 2RDSA 5B4NA 2JE8A 1OOPB 3R05A 4YSFA 3GNEA 3LDRA 3I3BA 1RB8G 4MLOA 4Q4W2 5HBAA 2JE7A 1ODNA 1SQ4A 3KCCA 5GM0A 3QH6A 4IE5A 5KHKA 5FZ0A 1OLRA 2AR6A 2C24A 4DZGA 2Q30A 4P9WA 1LOAA 4Q0UA 3K75B 3EXUA 2FDIA 4KU7A 1H4HA 1L3JA 1C8M2 1X82A 3KB5A 1UOGA 3WX5A 3HNBM 3O14A 4K3UA 4A3ZA 1VB2A 1K5JA 1S0DA 2E6VA 2B39A 4PF1A 5EYYA 1VLNA 5KHHA 4BM8A 4COYA 3AVSA 1I5PA 1UZ0A 3K77A 3LSDA 1V6IA 1AYN1 4NHXA 4FTSA 3ZFFA 1NCQA 3H7YA 3B01A 4MO3M 5SV5A 2WFF2 2W47A 4LJHA 2J1AA 1TMF1 3TN91 2WSVA 3WSOA 2ZABA 1CQ9A 5C6CA 1B35A 3VDCA 3ZO0B 2A6YA 4GKYA 1EAH2 3RI9A 2R1DA 3THPA 4XUQA 3VZMA 4CP2A 5L36A 2WNUA 4PBPA 5ANNA 1YI7A 4Q4Y1 2XKOA 4PDWC 3H8RA 1AYM3 4BK5A 1R1A2 4F83A 2I74A 5IFTA 1ULOA 1AXYA 3WP5A 4BHPA 5F3EA 2YFUA 2D6OX 2GALA 5CG8A 3POJA 1US3A 4AFMA 2H0BA 3MICA 2K0GA 5IVJA 1KGYA 5GLWA 5KXBA 1M06G 2Y6JA 4IE7A 3PJQA 1VJ2A 3AP4A 1H30A 1O8SA 1NXMA 1RTVA 1ND3C 1GR3A 1GWLA 5L19A 1PVXA 1SLLA 4WM7A 3VLBB 3WF2A 2QQPA 3JB8A 1YEWA 2JG9A 4AVAA 3AX4A 4JAAA 2GH8A 3FMGA 3PHMA 1KRIA 3WF1A 3O1VA 2PYTA 3ES4A 1VBE1 1YYNA 5LZ6A 2FHRA 1RUJ3 4QHOA 4UFKA 1N3QA 1A34A 3NV2A 2QUOA 2WA3A 3CLPA 5A7OA 1H8VA 3ZSLA 3H7JA 1LENA 3T2QA 3WDTA 5JSPA 4Q26A 2VVEA 1O6UA 4ASLA 1O3SA 1HXS3 1J58A 3AXEA 4RQPB 5T3NA 2D93A 4Z82A 4J1XA 3LEGA 1R1ZA 2FCUA 3MLLA 2EXIA 1DQ5A 5FO7B 3ZFFC 1NCQC 1XE7A 2A3XA 3AKTA 4MXWB 4XPVA 5CKQA 4Q4X3 4XETA 2WT2A 1O8PA 3T2PA 1B35C 1ZM1A 1ZRIA 1W39A 1OPOA 4BISA 4CRQA 2GAUA 4MGKE 3B94A 2ZS6B 4PI0A 4XJUA 2WNUC 4I3PA 2AUYA 2BWAA 2HJIA 1Z7S3 2VNOA 3PUHA 5K8SA 2JDAA 3MIDA 2WQ8A 2R1BA 4CUBA 1YXWA 2W46A 3LB9A 3BTAA 3WLUA 1PZ8A 2WZ8A 2YFZA 3PIJA 2LW8A 5FXWA 3SXWA 1CZTA 2C5DA 5J48A 1MVEA 3DL3A 5FUIA 4ZZ5A 3PTRB 4I09A 1SPPA 4HT1T 2XHKA 1DQ4A 5FZOB 5A7WA 5FXVA 4BLIA 3SCGA 1HV1A 1RJ7A 1VAKA 5FQ0B 4ZS2A 3EBRA 1YQCA 1AYM1 3HNMA 2SBAA 1H2KA 1XXNA 1XC6A 2VU9A 3EO6A 1LOCA 3MIHA 3PVNA 5DZFA 4ZU5A 5BPXA 3T4VA 1IGOA 5D1IA 1UU4A 3UKTA 2VCAA 2ZGSA 1GQGA 4WM7C 4IEOA 4BB3A 5FPXA 2VECA 3PNAA 4FXGB 1Z78A 4P9IA 2JG9C 5FYCA 3K3OA 4I01A 3VBSB 4Q0VA 2RVAA 3WP6A 3BTXA 1C1FA 1CJDA 1RXGA 1JUIA 1L7LA 5EZWA 1O4ZA 3OEAA 5FZ1A 4NIAA 4RYDA 3ELNA 2ZZQA 3BYWA 4DXSA 1CAVA 3GDBA 3R4DB 3VBOA 5FZ7A 1RUD2 1QJX3 4JQRA 1WW7A 2HWD3 2LALA 1R093 1C3HA 4ZONA 2ZGQA 1YNAA 2EA7A 2ZPXA 1EUTA 3P1IA 1FI2A 4IEVA 4NN0A 5GLTA 4AHZA 2P3YA 1RUJ1 2DF7A 1UU6A 4LBLA 3V56A 5FZCA 3OY8A 1VBC2 4AR2A 5K7PA 2Y60A 2DCYA 2XJUA 4BYYA 3DECA 5FZ8A 4A7YA 4KGGA 4S2GA 5CYYA 5FLJA 3LOBA 1HIXA 3GZTB 3HJRA 4IV3A 2F4PA 2XGXA 5JSOA 2HWE3 4Q4X1 2ZMLA 1LEDA 2BGPA 1SLTA 2RS13 3MIBA 1E5IA 3OPTA 2BZDA 1DU3D 1VR3A 5LWBA 2FZ2A 3WW3A 4R52A 1DQ1A 2EICA 2HWC2 3USUB 4HONA 3LFIA 3I59A 2JDZA 2FMYA 5D21A 1WZXA 3KSCA 3ZSMA 1VBD2 4ASMB 5BYNA 1JHNA 2DVFA 4M0NA 3CBNA 4JKKA 3ACHA 1R083 3TB0A 1ULGA 1AX1A 3OD0A 4MSVA 3DKWA 4AQTA 1S55A 4YGBA 4PDWB 4UW3A 3LA7A 4YFWA 3BI3A 1V0AA 1V9U3 4GQ7A 3MFCA 2VMIA 1ENSA 5E1RA 2VGDA 2UWBA 1NLQA 1JODA 3ZXDA 3IAQA 1APNA 1C8M3 2C9AA 1PO22 2VCBA 2GMMA 3K2OA 3P6BA 3RSJA 1TNFA 1W8UA 1WCQA 2VTFA 1IKQA 2Y8KA 3LGRA 4NRMA 4WM8A 4D69A 3RZMA 2Y6GA 1LESA 3BVCA 4FQ4A 4FPJA 4M00A 4NUBA 3WOGA 5FZDA 4LHKA 3MIFA 4CCEA 5FKBA 2QNKA 4RHV2 2D3PA 2VAUA 1GWKA 1GMMA 1DYKA 4BJ0A 3V0BB 4GIQA 1TEIA 1ND3B 4B8EA 1BMV1 2BU9A 3IDAA 1UPSA 4QX3A 1OKOA 4CUCA 4ITCA 2HWD1 1O7FA 3I2JA 4RS5A 3F95A 4ZU4A 2XLFA 4C8DA 4Y1YA 4IV3C 3PL0A 2E32A 1N1SA 5KC6A 4XFIA 4ZKTB 2CV6A 4OUMA 3RZJA 4COZA 2BWCA 2QQNA 4F8AA 3D4KA 1LJ7A 1JYCA 1UXXX 4FPFA 4LBJA 5DZEA 5JOZA 1VBA1 4PIZA 4META 5D2AA 1PX3A 3UGFA 3ZYJB 1DGLA 1JOJA 1XU1A 1G9FA 1N3PA 3JD72 3Q8FA 4JHTA 4YZ3A 2R041 3ZFFB 3W5NA 1NCQB 2HWF3 2OX0A 4L2NA 2GN3A 3ME2A 1QDCA 4QXBA 1MVQA 4HBNA 4XDPA 5ABJA 2IUWA 2PHRA 1B35B 4BXSV 4AFBA 2JWPA 2XVLA 4HVQA 2RS11 4BCUA 2WNOA 3FE5A 2WNUB 4QKDA 1GBGA 1UPIA 4UXAA 3D0SA 3I2FA 5GZFA 1JS9A 3L9JT 4XFBA 5FZIA 5G04L 4NIGA 4MADA 1FMD2 1TME1 2ZGNA 2TBVA 4WM8C 1R081 1H1AA 2YMZA 1W3VA 3CJIA 1RVF1 1DLCA 1YFWA 1DQ2A 4BOWA 3A22A 5C3OA 1FNZA 1RHI3 5IATA 1V9U1 5DPNA 5JXJA 1JN2P 5FRAA 1W6QA 5FREA 5GLUA 3AZXA 3EHKA 3NQHA 3QBQA 1BEV2 4UFJA 4FAHA 4WM7B 1H2NA 2R0FA 1Y9MA 4QQLA 4QKFA 2JG9B 4CDUA 3MEPA 1QDOA 5FR3A 4NPRA 3FUQA 2A3YA 5IFPA 4A2UA 1JZ3A 2ZGOA 1QXPA 3CIHA 1OQ1A 5I0TA 3OGGA 1J84A 4XXPA 4B4PA 1UAIA 1Q56A 4XF4A 1HDKA 2XBO2 4XUTA 5F37A 1G9BA 1W8HA 2B45X 4FSJA 4LKSA 2JJ6A 3MI8A 3ETPA 1UZVA 4XFAA 1Q5OA 4WBBA 5HCAA 1JZ2A 1LHUA 2EIGA 4L97A 1ULDA 3O1TA 1W99A 3U4SA 2G9ZA 3D8CA 3OBAA 5BNOA 4BDVB 3WG2A 3S57A 1OFSA 1JI6A 5E6HA 3M3IA 1QJU1 2DCZA 2PHLA 4R9AA 1ZBA2 3ZFEA 5EP9A 3OSDA 1RUI3 1KS5A 5C5UA 2X09A 1H4GA 3MF6A 1ZRRA 3AMPA 2D7FA 1X7NA 2ID4A 4NHKA 1LNSA 1HN0A 4XFFA 4Q8KA 3O0VA 5KBFA 1NCRA 4GJYA 1WLCA 4P5HA 3LCPA 2EF6A 2WLPA 1U5ZA 1J3RA 1E57A 4EN7B 4K8FA 4LPLA 2JDMA 4XAAA 2A71A 4EWAA 2VTXJ 4H55A 5F3IA 3WT3A 2BFUL 5LY1A 3VDBA 2OQ7A 1E5SA 2EIDA 4XUPA 3WW4A 5KC5A 1AL21 4NE9A 2UWAA 5A3LA 3CJIC 1XYOA 5A7WB 2VY0A 5DDJ3 5IAVA 3WNPA 4NHMA 2BDRA 2D40A 2VTXA 4CDWA 3QD6A 1VMHA 4Z2WA 4IETA 4FP3A 3K3NA 1W3XA 1OUXA 1VBC3 4LOTA 2P37A 4IDZA 4XBLA 3VGIA 4AAXA 3T09A 2E7QA 3POWA 5CBLA 2VZ3A 3O1MA 4FFGA 4RFT0 3SKVA 5IVEA 4LE3A 4NWVA 2G1MA 2W2IA 4Y1UA 4BQWA 4Y20B 4CCMA 4CPBD 1RHI1 5EJZB 1TMF2 3B69A 1QXRA 3I3DA 2WFPA 4BPZA 1W8TA 4ORFA 4Y22A 2WAAA 4ES9A 4DQAA 4O7XA 5DAWA 5FFOC 1CAVB 2BVBA 1PGSA 4OZOA 3UKNA 5IVBA 4D6QA 4AVBA 4Q4Y2 4Q27A 3FHIB 5FYUA 1CR7A 4IE6A 2A5ZA 3POGA 1OA4A 1O91A 1UY4A 2DU1A 2DTWA 3WG4A 3I2IA 4UW5A 3VZJA 5GLVA 5BNOC 5J36A 5DG2A 4GKXA 3ZFEC 3SCHA 2O0OA 4LEJA 3IIAA 4LUKA 4GMP3 1MEC1 1UWWA 5JAXA 4AI1A 3OY8B 3I49A 4CEWA 2UY9A 1QOSA 4YWAA 4DUVA 4Z2AA 1W0NA 4CUGA 4IEUA 3USSA 2VO5A 5HV0A 1OSGA 3ETQA 1WD4A 1SLAA 1NQDA 1NCRC 3H42B 1FXZA 2VH9A 1MACA 1XQNA 5FZEA 2P3KA 5A6XA 1UYXA 5A80A 4OI0A 4IV3B 3MUY1 3DF0A 2W08A 1F31A 4QB1A 4ES8A 1PO23 3H3UA 4N9HA 4A44A 1RUI1 3IIIA 4QPGA 5F5AA 2UWCA 2HBTA 1FNYA 1UL9A 4QX2A 1NA1A 4NVPA 4OYUA 2XJPA 3WDXA 2WBKA 4HLTA 3PUAA 1NE6A 2A6ZA 5T54A 4RHV3 5I0RA 1F2NA 4QXCA 2VL4A 3I59B 3BGAA 1F35A 2VR4A 2ZEYA 3I4IA 4LHSA 1QJEA 3RWKX 5IHRA 1LHOA 1QWRA 1VBB2 4CDWC 3MGUA 4XABA 4MHUA 3I3MA 5L9VA 2WN2A 5E16A 3B9CA 3ECQA 3FLTA 1NOVA 5LK7B 4HVOA 3OUIA 4LORA 3WW2A 5BY5A 3ALQA 4LKDA 3H3ZA 4KH9A 3U37A 2R061 5DDJ1 4QX7A 2OPWA 4N8MA 1BYHA 3WCSA 3UNPA 3NW4A 4ARYA 5TSWA 4IEXA 4XF9A 4RGGA 4XIKA 4CCKA 2P17A 4LUMA 1S0GA 4WM8B 4XACA 4URAA 1JYNA 4FPOB 1KEXA 1BHGA 4WVZA 1EP0A 3VD7A 2WUHA 5LK5A 4B7KA 2QCSB 5FMCA 4FFFA 4KG8A 5JI9A 3LDBA 1OKQA 1F5JA 1XNAA 1FV2A 5C8WA 4KI5M 1JTZX 1WLWA 4JHZA 3PUQA 4YVWA 2ES3A 1I5ZA 1POQA 2VZPA 1ULCA 1NY72 4W65A 4CEWC 1AXZA 3I97A 1OQDA 1OLMA 1OF3A 1KJLA 4XC9A 1F15A 1Q8QA 1RJ8A 2WL1A 1AYM2 3LPFA 4CU7A 3AZYA 4LBQD 3NJXA 1X50A 1GOFA 1AZDA 1OUSA 3AKRA 5CNAA 2VCMA 1MS3A 4N7UA 1L7QA 5FWEA 2PAKA 1FMD3 2WABA 3KGZA 4HMZA 4QPGC 2EVXA 1WMXA 2ET1A 4LLFA 5EJ1B 2ZX2A 1NA1C 3N9LA 2ZA9A 2ZXQA 1G86A 3INAA 4I0AA 3W58A 1ZREA 3CNAA 1MS9A 3AZWA 2YZ4A 2XOMA 2PTMA 2TEPA 3NV1A 4MH0E 2WLQA 4YM3A 3HBKA 3APBA 4Q4V1 5DUUA 2VW1A 2VCCA 3VKFC 3VD9A 2BBVA 2Q8CA 1S0BA 2FCVA 3GJAA 4AEMA 4FI9A 2I2SA 5FZAA 3AYCA 1YJLA 1WA4A 1GZCA 2D3RA 3LEMA 4UBHA 4DINB 4COUA 4EZHA 4GALA 4EZ4A 3ZIWA 3BU7A 5IVCA 5JLVA 2HH9A 3J8F1 3TEWA 3GGLA 1GUIA 2J1UA 4AG4A 4CCOA 2VNRA 4CCLA 3EMRA 1PVC1 2VZOA 3H1WA 2XWJB 2OZJA 1H1MA 2BGOA 4HFSA 1RUJ2 3A23A 4BE3A 1URXA 3LIHA 4MOAA 5ACA1 1OA2A 2ZX3A 4LKEA 1WUVA 4D94A 2VM9A 5FMOS 4COVA 4JTNA 1JU4A 3H8UA 3KT1A 5DUWA 1ZRFA 2WYSA 1DZTA 3CJIB 1ZZ8A 3IAPA 1JXNA 1YQ6A 3MIGA 4PLOA 2ZHKA 2ZMNA 2H0VA 5G05L 2GNTA 1H8TC 4CCDA 1W6QB 2AEYA 3L2HA 3SCFA 4Q4X2 3AFGA 1W6PA 1MPXA 4P14A 1QXJA 2RDRA 2YROA 3MV11 1DQ0A 4YVWC 3VHOA 3ZLIA 3AYEA 3VKLA 3QACA 5A33A 4LA2A 4IEPA 3T1LA 1K12A 1POV0 3ZR5A 1AX0A 3TEYA 1AR91 4QQHA 4LMFA 4XCAA 2DDUA 1WMEA 1XNTA 1EYBA 2IXCA 3WD5A 4AAPA 5A6QA 3UV9A 4PF5A 5BNNA 4OMDA 2PN5A 1HKDA 2E7TA 4PHZA 3O0XA 5FYMA 1LAJA 2WS91 4O61A 1V70A 3LF7A 2X05A 3S7IA 5BNOB 3PJYA 4IEQA 4YGCA 4BH9A 1GKBA 2AYHA 3AL6A 2B5HA 3ZFEB 2GMEA 4Q0QA 5I8SA 4HKWA 4OHVA 5CISA 5FUPA 1COV1 1IS5A 1S2EA 1T6GC 3B00A 1AYN3 3T0AA 4I0BA 1OHFA 2A6XA 2KXLA 1NCRB 4K7JA 3E6BA 3TAYA 1TMF3 3BCWA 3POIA 3TN93 1KDKA 1BMV2 1DGWA 5FOJB 1LTEA 1XYPA 2XUEA 2AC1A 3HAGA 4HOOA 1DGRA 2BP6A 1LOGA 3VKMA 3AK0A 4FVVA 4Q4Y3 1NLSA 4YRDA 1QJX2 5GZCA 1WD3A 3O0WA 1CVNA 1WCUA 2HWD2 5FV3A 1R092 4LK7A 4AHWA 1SMVA 3AMMA 2NP0A 1NT0A 3NNMA 5EJ3A 3MPPG 4RGAA 4XZUG 2XH6A 2WSUA 4FOVA 4CDWB 1GSLA 4D8MA 3VDDA 4D7SA 4NO4A 4QM9A 4Z92B 2Y6FA 3MW2A 2JDUA 3U07A 4CYDA 4Y5TA 3RZKA 3GXUA 1ZA4A 3I3QA 5FZLA 4YLZA 2IXLA 2R042 4F7ZA 4XTMA 2QJVA 5IYYA 1RGSA 3VZNA 2IVIB 5LRSA 1GZWA 1DG6A 1G9AA 2HWE2 4E4DX 5BNNC 4XFHA 4Y22B 3O1RA 4YGEA 2RS12 4IV1A 3POFA 1PZ9A 1BBT1 1W6NA 3ST7A 4EYUA 5K9YA 1D0GA 2F4LA 1RUC1 3O5SA 3FZ3A 4Y1VA 1EV13 4BQ2A 1VBE3 4E4HA 3ZVXA 1PM4A 1XE8A 4FTBA 1AVBA 2TUNA 1N3OA 1PO11 4Q1PA 3AL5A 4Y1XA 1ND3A 3RRDA 2YU1A 5CKNA 1R082 3JBG1 1YWKA 3WDWA 1EUUA 2XQXA 4IE4A 4CEWB 1IQDC 1RVF2 2UYAA 5A3TA 2DVBA 4W6WA 1V9U2 5CADA 5L7OA 1IOAA 2ZX0A 4HN1A 1ZRCA 1HQWA 3WR0A 4EWEA 4MGZE 4C90A 5FIXA 4YARA 2G19A 5F6KA 5JIAA 2GC0A 4QPGB 2VVFA 1NA1B 1W0OA 2MEV3 1DF0A 2B8MA 2ZAAA 1JOBA 4ARXA 3AP9A 4OQ8A 1W9FA 4PQ9A 5JVVA 1GFF2 1CJPA 4DFSA 5F5QA 4HG6B 1SCRA 1REFA 2B42B 2VW0A 2LS6A 2YXSA 4XFCA 5AVAA 3VDDC 4LBNA 3KF5A 4XURA 3U75A 3OTFA 4AVSA 3BIWE 1S0FA 2CGOA 2YG0A 4AQ6A 5JR2A 1VALA 2CNAA 4NWWA 5A3OA 4OZXA 4TLFA 1FT9A 2DVGA 3ILNA 1TZOA 4JGYC 1JUHA 3GCWA 2E31A 3NKTA 2ENRA 1H6YA 1QJU2 3OOXA 5BNPA 1GLHA 5GZGA 3HPNA 5JIUA 4JDNA 3T3YA 3ZPOA 4CP1A 4C91A 1RMU3 4IERA 1UMZA 4MYEA 5JDBA 1SBDA 4IV1C 5APAA 3M7AA 1OF4A 5GALA 4JDMA 3K51A 5CKMA 1O3TA 3DYPA 3WQ0A 1SHWB 4ISQA 2WA4A 3WNOA 3I8TA 2R0HA 4HZFA 2JX9A 3WNNA 1UW8A 2B7YA 4YW6A 5FBZA 1RUNA 2HWF2 1H8TB 4OQ9A 2JKBA 2EAAA 1QJY1 2VZQA 3VD3A 3VDAA 2VUDA 1WBFA 3Q8CA 4YVWB 3DXTA 2OIIA 2XLGA 3OBTA 2BW8A 1QKQA 3BALA 1AXKA 3VBRC 3E5UA 5A32A 1P8JA 5FPBA 2TNFA 5JR7B 4AFDA 1J1TA 1YFXA 4LHNA 2NN8A 4DEVA 5L7OC 1EV11 2QQWA 3PTYA 3ZN5A 1WW4A 2JB4A 1HRI1 4OHZA 3TWIA 4UOJA 4CPBA 4XZPA 3B5LB 3D6EA 4IESA 4X6QB 2D6MA 2WR9A 2D5FA 1NLRA 2XJRA 1ND2C 1PMHX 1GNYA 4NMIA 4N53A 4COWA 4RD7A 4XJAA 3LA3A 2VMEA 3QCWA 2WWJA 4DOUA 1RHI2 1RL3A 1T6BX 4BMEA 5FLIA 1ENQA 1JW6A 3CQOA 2RS53 3ZXAC 4FOYA 5FZ6A 5FPZA 3WG1A 1XPWA 3AFKA 1D2QA 5KXEA 3LEIA 5B2GB 2QBXA 4ZXEA 2WT0A 4OUEA 1GWMA 2MEV1 1LOFA 4CTEA 1NAEA 1Y4WA 1F4AA 1LODA 5T5OA 3S7EA 3WDUA 3EQEA 4JX0A 2VMCA 1Q3EA 2F17A 1W9TA 4JKMA 2LM3A 4UFLA 4XILA 5BNPC 1BLZA 2WIIB 2VVDA 1MEC2 4RGKA 4DB5A 4UI9L 4LULA 4PIXA 2IFWA 1UMHA 3N9PA 4XW3A 2WN3A 4FOWA 4XBQA 1UU5A 3LFMA 2DWRA 4QB6A 2CL2A 1W8FA 4XMIA 4XQ4A 2Q8DA 1WKYA 1RYYA 4HVRA 2NLRA 4R4XA 1RUOA 4QU1A 1QEXA 3DEMA 2HKXA 1HRV3 3ZIXA 1AR61 5LBEA 1RUI2 1W6PB 3E6DA 2CGNA 1RMU1 4FP2A 2CGPA 2VXJA 3B9IA 4XDQA 3ZKYA 1ZX5A 4QPIA 5LCWL 3P3PA 5A33B 1SDWA 5FZBA 3GBFA 1UIJA 3L2YA 5A3UA 5IK5A 3RZGA 1HB3A 2ZZJA 4NRPA 2Z2SB 4Y20A 4FTEA 1POV1 2O14A 2C1FA 2XJSA 3DYOA 1HN1A 2YC0A 1ACCA 4NPLA 2EIBA 4PIYA 1HJGA 5FY5A 3VBFA 4E4ZA 2RMU1 2WAOA 5BNNB 1OLME 2PAMA 3KM5A 1PIV1 5KWRA 2OQ6A 3I7DA 3AC0A 3D82A 3IWZA 3GHMA 5DUVA 3CO2A 5JPNB 1PK6A 3PU8A 1VP6A 2OUJA 3DPRA 4N53C 1IS4A 3N4MA 3KS7A 3HN1A 2ZHNA 1W8NA 5BXXA 2R062 1OPMA 2C9KA 2O1QA 5DDJ2 4BZ4A 1BJQA 3FHAA 4AHXA 4TLGA 4NIDA 1SLCA 2HEWF 3GBWA 1F5FA 4QGMA 3VZOA 4N43A 4XAEA 1VBA3 4IEYA 1B09A 2GC2A 2XMLA 4RSUA 3CKHA 5IVFA 4LO8A 4Y24A 4K21A 5FP8A 1YFYA 5GZEA 1QF3A 1W8OA 1RITA 1LOFC 3ACFA 4N90A 1OFNA 1GP6A 2R043 2J1SA 2QQKA 2ZAHA 4MGYE 5K4LA 3V64A 5KR7A 2QDRA 2XVGA 4IL7A 3JQWA 2VQ0A 2ERFA 4FPKA 2RS51 2Y6HA 4KWUA 1A8MA 3E5XA 4NHLA 5FZMA 1LB2A 1GZTA 1MR5A 4HANA 4HSLA 4LBQA 4LITA
chains in the Genus database with same CATH topology
2H6CA 2MNGA 1XYNA 3WXPA 1NZCA 3U4XA 1BXHA 5CAZA 4FAGA 2NZ9A 4KU8A 3MZHA 5LEJA 3VDDB 5CFDA 1TME3 2FMDA 3WV6A 2CY6A 4LR4A 5CU1A 1NQJA 3AZVA 1RVF3 4QPIC 4W6XA 3HWJA 1GICA 3M1HA 3J26N 2XL9A 4P9LA 4JGYB 1CAWA 1YCIA 4J6GA 3ES1A 3FFZA 1QU0A 4PJYA 1D2SA 3VBFC 2PHFA 4QD2A 4NOTA 4QM8A 1GZWB 1HRV1 2ARXA 2NMNA 1ASJ1 1OI6A 3PVOA 1NXD1 1RUF1 4IV1B 1LHVA 3J8F2 1G9DA 1KD7A 1PK6C 1W6NB 3DPRC 4HK9A 5GLZA 1J3QA 3AB0A 2QZ2A 4CDXA 4I02A 1Y7BA 3H1YA 1MQTA 3SH4A 4HK8A 2Q1ZB 3IT8A 3PMSA 1RUE3 4N43C 3GZUC 4QHBA 2JG8A 1S1AA 3VBRB 4AI0A 1DZRA 3DUIA 5DUXA 2EALA 5L7OB 5HXVA 3ZXLA 1HLCA 1QJU3 4DNYA 2DCTA 4XJ8A 3VN4A 2PA7A 5EV7A 3UK9A 1QH6A 1CPMA 3AP7A 1VRH3 3AJZA 1ND2B 4K1ZA 3OGJA 3O12A 3ZMOA 2W52A 4HSJA 1C8NA 1SBFA 3LKJA 2Q1MA 1QOOA 2XWBB 4DY5A 1REEA 3VL9A 3V65A 5CFDC 2D5HA 2C0ZA 1O5LA 2BVVA 3LOIA 1AL23 2IZWA 1FPN1 3ZN6A 5E89A 5EYXA 5KHIA 3HBZA 3HT2A 3IMNA 2KA3A 2Z5WA 4LE4A 5BNPB 2D43A 4I30A 4AQ2A 3RJ2X 4QU2A 2ARBA 2CWSA 4R9CA 4CEYA 5C4WA 2RHPA 5T55A 5AFBA 4YGDA 1CN1A 2ZHLA 3AKSA 4P9GA 1LR5A 4CDXC 4FPLA 1D4VB 1MQTC 1YUDA 4GB33 1VAMA 4OHWA 4X8NA 3MLKA 3LSEA 3AMNA 1V6JA 4WVMA 4IQPA 4YM0A 2JG8C 1Q8VA 5C9AA 2P3JA 5A32B 1LU2A 5EXOA 3WDYA 4DRVA 1ENXA 3NSTA 3SH5A 4Q4W1 1MEC3 3V0AA 1BVP1 2VMGA 1IS3A 2Q5TA 1RUE1 2NMOA 4UBGA 4OI4A 1JYIA 1A8DA 3AMQA 2BNOA 4N53B 2GDFA 4FCAA 2RR13 4Q0SA 4LTAA 1DBNA 4XF0A 1OLQA 3KT4A 2PHUA 5J7MA 2B9UA 3AP5A 1VRH1 3U11A 1RC6A 3HD8B 3ZXEA 4G9SB 4ZU7A 2NQYA 1BBT2 1RUC2 4JGZA 1NYWA 3NKGA 1ZZ9A 4YM1A 2FQPA 2XVKA 1EAH1 2GSYA 1YJKA 3AYDA 3ZYIB 5I93A 2GNDA 4M3CF 3ZX7A 3HIFA 2E53A 4CEYC 3JBG2 4P9XA 3VBHA 5C4WC 1XNDA 1Y9QA 2YYOA 4RR3A 1SLIA 4Y26A 3GF6A 4L99A 1SLBA 2R063 3SLIA 2GU9A 4IEWA 4XBNA 4FO9A 3M3CA 3TYJA 3RZZA 1NE4A 5CIRA 4QPIB 2MHFA 2DU0A 3PVEA 1AYN2 3NV3A 5C9AC 4R4ZA 4DRRA 2DFBA 1RUG3 1AJOA 3FJSA 3VBFB 4H7LA 3TN92 2DFCA 2DCKA 4GB31 3M2MA 1D4M1 1ZBE1 2V73A 1XRUA 2EXHA 3MW4A 1PK6B 3DPRB 3GZAA 1W2UA 4EN6B 4XJZA 2RM21 1CGPA 4UW4A 3NV4A 5BUVA 1ULEA 4QQOA 1AR81 2R073 1ONAA 4N43B 2ZGRA 1KQRA 2NYYA 4JGZC 5F1RA 1J3PA 4Q4V3 2RR11 1H0BA 2ZGTA 1GANA 2K2SA 3CF6E 3HQXA 4A7KA 1AX2A 3ZYRA 1QJY2 4XYXA 5I0UA 3WNXA 2BNNA 3MIEA 2PHTA 3POYA 3J8F3 4LBQB 3VBHC 2Q8OA 4RR3C 1PVC3 3RNSA 3WQ1A 4QT6A 1EV12 1VBE2 4AVCA 4GULA 4B7EA 4EN9B 4AGRA 5ACA3 1H9WA 5GZDA 1H9PA 2D6PA 5CFDB 4AXOA 2R16A 4AGVA 1Y3TA 1Y43B 4XMAA 1Q8OA 3MPBA 1CAWB 1J1LA 2LUWA 1LULA 2JD4A 2GNBA 2WJSA 3VV1A 4XHBA 4M3CA 4IXLA 2GZWA 2Q0AA 3AP6A 5DXDA 4ONUA 3GBGA 4FQZA 3RI8A 2MEV2 1AR93 2PHXA 3RYRA 2DYCA 2XKPA 4EROA 3O7OA 1RUG1 4CDXB 1H8TA 1RUD1 3R6SA 1MQTB 4L11A 4KNCA 3N7JA 4OLLA 1CAXA 4XQDA 4ISRA 3TBDA 1PM7A 2JG8B 2E7AA 2WS93 3NWKA 1ALYA 1MS5A 4BLJA 4D7YA 3FLRA 4LA3A 2CWMA 4TWTA 4S2HA 1REDA 1LGCA 2CYFA 1RMU2 3OF1A 1QNWA 1COV3 4MGIE 2R071 2P2KA 3ZDSA 5BNQA 1UD1A 4G3YC 3JZVA 2YV8A 3K48A 1LOBA 1X8EA 2QDNA 3N7KA 4E27A 3WW1A 4HL0A 2A73B 2VQAA 2HWC1 1IPKA 4V1PA 1FATA 1I3HA 1VBD1 3ZN6B 1OMIA 2WNEA 5H9SA 4YZ4A 4B3NA 3NL1A 1O4TA 4CEYB 2X5IA 5J96B 2XL7A 5C4WB 1LHNA 2H6BA 4YW2A 2RJLA 1XNKA 4FOQA 5IT6A 5IK4A 2A75A 2Y0IA 2UU8A 2IXKA 2RS52 5JI7A 2IXJA 3WDVA 4K6BA 3ACLA 4FXKB 5J37A 2PFWA 1BBT3 3RYKA 1RUC3 4WVMB 4E2QA 3OD4A 2GMPA 5C9AB 5AVPA 2P3IA 1N1TA 1PO13 4JRAA 1Q8PA 2ZJCA 3R0RA 3GHNA 1MS4A 2XJQA 3V0AB 3B7MA 2PHWA 4HKLA 3JBG3 2DURA 2W68A 3OYWB 1FV3A 2FZ1A 2JXAA 3EJKA 1LKNA 2IC1A 2IXHA 4YFZA 1YI9A 4AW7A 3X29B 4QXKA 1HRV2 3JD71 1WCDJ 1N1VA 1UKRA 2W0XA 4CDQA 1UF2C 1XNCA 4G4FA 4JGZB 3H50A 2ZTNA 1CESA 1AJKA 1S0CA 2ZMKA 3RG0A 5JCTA 2E63A 2WKKA 4Z8BA 3N7MA 4Q2FA 3PLQA 2O8QA 3S6PA 4N9IA 3WZ1A 3RYPA 2X5IC 2QE3A 4H7MA 3VBHB 4SBVA 5IK8A 3WP4A 4RR3B 4Y4YA 3J4UH 1SFYA 1K5MC 3WUDA 5KXDA 3KCYA 4XTPA 3BOWA 5FTTC 2WINB 5IK7A 2E51A 2OA2A 3G6JB 2XB6C 1TE1B 2JEMA 1OD5A 1X8MA 1YRZA 1VBA2 1ZZ6A 4GWNA 2WNVA 2YGMA 1BEV1 3KQRA 1CX4A 4JGYA 1S2KA 4PLMA 1BKZA 3Q9OA 1PNGA 1FOD1 1QQP3 2R49A 2ZKNA 1HV0A 4AQSA 4DXZA 1QJY3 3A4UA 4AVVA 2A6VA 4Q0PA 4OVEA 1FPN2 3IBMA 2D3SA 5HCBA 1MS0A 4JVAA 2YHJA 1HW5A 5LRRA 1ZRDA 2YUEA 2I07B 1Q43A 4FPGA 1HRI3 2DUOA 4CP0A 1BQPA 3WUCA 1GNZA 2Y38A 1TME2 5FO9B 2D6KA 5HCFA 2Y26A 1PGW1 5JPMB 4CDQC 1J59A 3VBRA 2WZPP 3ASIA 3VZLA 1ZBA1 1DYPA 1X33A 2CAUA 2HWB3 2WQ4A 2ILMA 3LZZA 1S0IA 4BA6A 1S2BA 4C1XA 3CEWA 4TYSA 3CL1A 1DIWA 4J1WA 4XE9A 4AEKA 4F3JA 2O8OA 4D3WA 1DQ6A 5CB7A 1ND2A 1Q8SA 1VAVA 3CU7A 3H1MA 4KBBA 3AKPA 2Z42A 4OULA 3JQXA 4AI2A 4OI2A 4LO6B 3WP3A 4H3WA 5AC91 3A0NA 4EN8B 3M3QA 3I54A 4LT5A 1C5HA 5EFUA 3WY6A 1RUE2 1QY4A 4MZUA 1DLLA 4LLOA 4JRLA 2WNVC 2ETEA 4AWDA 4AEDA 2VPVA 1AR63 4M3CB 3H0OA 1VRH2 4YG0A 1YIFA 1N1YA 3AM2A 3NJZA 3TNQA 1MZ6A 4I0WB 2VOKA 4FPHA 4XFGA 1POV3 2ZGLA 4KQ7A 2D97A 1HQLA 3KCXA 2VOVA 2BFUS 1QH7A 2RMU3 1QQP1 4C1WA 1PGL1 2DV9A 1PIV3 3U10A 4KWLA 3E5QA 3KT7A 1CAXB 5KHGA 3JU9A 5FAXA 1AL22 2QKDA 2BUKA 2AGSA 4KWKA 4DPNA 2BEOA 2E9QA 1IHMA 4YZ2A 1V6LA 1CAUA 2PLV3 1F8VA 5F9TA 2PHDA 4JC1A 2X29A 3HT1A 3WHUA 1SEFA 2A70A 4R9BA 1O3QA 2HWB1 1MZEA 4B29A 4JV4A 2VOXA 2N7GA 4GB32 5C8CA 1M4WA 1D4M2 1ZBE2 2NM1A 2MPFA 4XF1A 2ZX4A 2GN7A 2XPJA 4NR1A 1W6OB 5A3MA 4AE2A 1AR73 1WLTA 1VBB1 1C57A 1S0JA 2AENA 1YIPA 4H14A 2RM22 2D6NA 4LBMA 4AEDC 2KM2A 5E88A 5E8AA 3KLSA 3FWEA 5CFCA 3ZXFA 2WWSA 1AR82 1I9RA 1QJZA 2X5IB 2YDEA 1U5YA 5I91A 2DVAA 2K9ZA 3JB4C 3RJRA 4PLNA 1FX5A 4BIFA 1V6NA 4M3CE 3LAGA 1K5MB 2RR12 3OJBA 3ZFGA 2VUAA 4MUVA 2PQQA 1ASJ3 4Y5Z0 1PHMA 1RUF3 3B3QE 3UKVA 4FPCA 4RA0A 1V00A 1DZQA 4MXVA 4TZDA 3AXDA 1H2MA 2LTNA 1X36A 1RUH3 2DUQA 1NY71 1O5UA 5T52A 5JZGA 1JH5A 1H2LA 1W0PA 5JSRA 4BIOA 1A3KA 3DN7A 5HI0A 5J09A 4HKOA 2Y0OA 4FBFA 2YY1A 4LO7A 3WHTA 3FBYA 4BWOA 4C0BA 1XU2A 3J9SA 5C8CC 2PLV1 3SNMA 3ZPYA 2CTVA 2X8KA 1YO8A 1SCSA 4AFCA 4CDQB 3SHRA 1G8WA 2HEVF 1RUG2 4E2GA 1DGWX 3ENRA 5FCCA 1CD3G 5CFCC 2P34A 1O4YA 3CJXA 4EN0A 4E4SA 1MZFA 1FPN3 4BMBA 1WW5A 1AHSA 2OYZA 1KITA 2BQPA 1AR71 4R9DA 1CPNA 3NAPA 4AHYA 3ZFGC 2FBEA 1HXS1 3IPVA 5FMOL 4XXAA 3VZKA 5FO8B 2R072 4U36A 2IFRA 3PMEA 1UX6A 2EAKA 4LO4B 2WNVB 5K0UA 2QFEA 4Q4V2 1KXGA 1I6XA 2BPA2 4O9GA 1QNYA 3OPZA 5JZGC 1Z7S1 3ZXGA 3MF9A 4LBKA 2RS33 2IXIA 5I0SA 4YW1A 4QMAA 2WZR3 1A6CA 3FFQA 2A6WA 1PVC2 1IPJA 2EXJA 5CG9A 2BNMA 3IDEA 3B93A 3MYXA 4AF9A 4Q4W3 4D7TA 1DFQA 1RUH1 1UCXA 3M3EA 1U12A 1UN1A 4GA9A 5ACA2 3TRSB 2PAEA 3N3HA 1BK1A 2IWGB 1UZZA 3VBUA 3NO8A 4ATFA 4K9SA 1ZVFA 1ENRA 4LNVA 4GH4A 4OHYA 3VBOC 4L92A 4AK3A 1LGBA 4YNIA 2G4IA 4URTA 3B02A 1QGLA 2AREA 2OVUA 3N36A 4HPKB 5D8AA 5KXCA 5CA6A 1LECA 2WFF3 1G7YA 4YVSA 3KD4A 2ZGPA 3ZXKA 2QVSB 1AR92 5FLHA 1EAH3 3NAPC 3C2UA 4HETA 1N47A 2VMHA 4K40A 3LWCA 1DGRN 1QJX1 1NG0A 1R091 3HMYA 4XJWA 5JMCA 1I1EA 1R1A3 4Q8LA 1EPZA 4GMP0 2WS92 1YFUA 2DTYA 2JE9A 5K0UC 2I45A 4C0HA 1ZREA 1KJRA 1GYKA 2AZ5A 1ZZBA 1ZYBA 4AEDB 3ROUA 1QHDA 2ET7A 4JDOA 2VXRA 1COV2 5IUQA 5KHJA 2X53S 3PVBB 1V6OA 2HWE1 2OUHA 1HQNA 4GWMA 1H1IA 4QPYA 3W59A 4WVVA 3OBRA 3BOPA 1FYUA 2UY8A 4TSVA 3D5OA 5H9RA 4Z07A 1D4M3 1ZBE3 5JOWA 2RS31 3VBUC 1YLLA 3C3VA 2WZR1 4GH4C 3VHPA 2RM23 3IKWA 3AYAA 4Q29A 5BV6A 3SH3A 1CAUB 3VKNA 1AR83 5D8AC 3AKQA 1IS6A 3P3NA 2ZGUA 3OYWA 4YVSC 1C8M1 4OI1A 1BZWA 1FOD2 1TNRA 3ZYPA 2R32A 3URFA 1EY2A 4I3GA 2AH2A 2ZGKA 4FPEA 4RS5C 1OA3A 5C8CB 4QQPA 3THTA 3WCRA 2XLAA 4A7ZA 2WFF1 2WT1A 2ZX1A 3ZXJA 3AMHA 5T50A 4MV2A 5T5JA 1PO12 5CFCB 4UW6A 3QLQA 3SMHA 3ZN4A 3VHNA 1PGW2 2VNGA 3E97A 1R1A1 5ABJC 2A3WA 4EWDA 5SV8A 3NVCA 5I8TA 4S2DA 5JWPA 3A0KA 3ZSEA 1LU1A 3ZFGB 2G9GA 1LOEA 3ATGA 3FC0A 4QQ2A 1AF9A 2ZCWA 4AGGA 2HWF1 2RE9A 3RQ0A 4SLIA 4LBOA 5J98B 2EXKA 4HN0A 4XEZA 2ZBJA 1SBEA 2BGCA 2WC2A 4XHXA 5T5PA 1RUD3 4GXLA 2D44A 2GNMA 1W6MA 5AC92 3ILFA 5JZGB 4YM2A 4EV0A 3GALA 1OQEA 1C28A 3N7LA 4KWJA 3OCPA 4CDUC 1LEMA 3I2DA 3U0ZA 1WBLA 1SFNA 2ZKLA 4X8PA 1WLDA 4L9BA 4YYOA 2OZ6A 3FLPA 2D98A 4U2AA 4KG0A 4OFGA 3T2TA 2Q4SA 4M0HA 3M8LA 4I2OA 1S0EA 3QOPA 3VBOB 1VB4A 4XF3A