1LCLA

Charcot-leyden crystal protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
141
structure length
141
Chain Sequence
SLLPVPYTEAASLSTGSTVTIKGRPLVCFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSOPHOSPHOLIPASE
publication title Crystal structure of human Charcot-Leyden crystal protein, an eosinophil lysophospholipase, identifies it as a new member of the carbohydrate-binding family of galectins.
pubmed doi rcsb
molecule tags Serine esterase
total genus 36
structure length 141
sequence length 141
ec nomenclature ec 3.1.1.5: Lysophospholipase.
pdb deposition date 1996-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lclA00
4YZ1A 3HR9A 1DHKB 2NYYA 2Q5TA 4C1WA 4K1YA 1AJOA 2VW1A 1CN1A 3USUB 3PJQA 2GNBA 3WUCA 1Z78A 1W0PA 2ZGQA 4FP2A 4YW2A 4LBQA 1GZWB 1ZA4A 5E8AA 4Q1RA 5H9QA 3ZPYA 1Z0HA 2D6MA 4FPEA 1AJKA 1AX1A 1H9WA 1XQNA 2BQPA 3ZXFA 1S0IA 4FPFA 2E53A 4LBQD 1CR7A 3USUA 1HLCA 4YGBA 2V5YA 2JJ6A 3AXEA 2WJSA 3ZYRA 1FYUA 2A6XA 3OBTA 2A3WA 4Y26A 2GNTA 3H0OA 1BQPA 2ZKNA 1QNWA 2OW4A 1HKDA 1LHOA 3B69A 3WDWA 4YZ5A 4BOWA 2RHPA 3WOGA 2JKBA 2R16A 2R49A 3N35A 2ENRA 1LHWA 4XE9A 2C5DA 3WDTA 2D6KA 1G9AA 1CIWA 1BZWA 4FPOB 4GALA 4XJ8A 5DZEA 2AENA 5CA6A 1HDKA 2P3KA 1DQ1A 2ZMLA 3AK0A 2YXSA 3B3QE 3ZXLA 3ZXKA 4FVVA 4F83A 1ULCA 5GZFA 1DYPA 2ZGLA 1BXHA 1DQ2A 3OBRA 2NMNA 1G9FA 2ZGKA 2PELA 1LENA 1FX5A 3WVJA 2PHWA 3WUDA 4H55A 4ISQA 1CESA 2VY0A 1LU1A 3RMXA 2AR6A 4DFSA 2VW2A 3O12A 5DG1A 5JOXA 3BODA 4AVVA 2WT2A 4K21A 1W6NB 2ZAAA 1JYCA 2DUPA 4XILA 4LBNA 5T5LA 3QCWA 1N1TA 3RMYA 1CJPA 2GALA 1RINA 1ENQA 1S0FA 2GMEA 5IUQA 4YZ2A 4P9XA 4FPJA 4XIKA 3SH4A 1SCRA 4Z8BA 3WHUA 2WNEA 1F5FA 2V73A 4PF5A 1W6NA 1C4RA 1UZYA 2EXKA 1GBGA 2P34A 2ZGMA 1C57A 3POSA 1R1ZA 3UJOA 1KITA 2AREA 3LSEA 1IS4A 1LULA 3AZZA 4WVVA 3AP4A 1SCSA 2DTWA 3RQ0A 4Q8KA 4CZSA 4WV8A 5JMCA 3N7MA 1A3KA 1S1AA 2JD4A 2WT1A 3AP9A 4WZFA 5T5OA 2ZBJA 3WDUA 4ITCA 3APBA 2ERFA 3WG2A 4HL0A 1S0DA 3OYWA 1V00A 1MS3A 5GLVA 4MYEA 1BYHA 2CNAA 2P2KA 4YZ4A 1MS5A 3DGTA 4M3CB 3D5OA 4XIOA 4XJZA 3ZSKA 4BMBA 2E7QA 4BLIA 4DRRA 5GALA 4R9AA 2GDFA 1ONAA 1WUVA 1D0HA 1MS8A 1AX0A 4P14A 2SBAA 2SLIA 1SLLA 1UN1A 2C9AA 4M01A 1PZ9A 2ZGUA 3DUIA 2JECA 4M3CA 1IS3A 1RIRA 2CTVA 1Y7BA 3T1LA 4NOTA 4ASMB 4YM3A 4RL7A 2WKKA 1MZ6A 4FOWA 4YW1A 1N3PA 1V6OA 3T1MA 3V64A 2ZHMA 2NN8A 3FUOA 4TYSA 1WW5A 2P3IA 3M1HA 1LEMA 2ARXA 3V65A 2DWRA 1BJQA 1CPMA 2HYKA 5DXDA 1AXZA 1AF9A 1FNYA 2A3YA 5F5QA 1Q56A 2CWMA 1YO8A 1LOGA 1O4ZA 5CB7A 1YXWA 1GZCA 2WSVA 4HANA 4Y1UA 4FPCA 3ASIA 1H9PA 3AXDA 3AYAA 3ZSJA 3MW4A 3IN9A 4Q1PA 1CQ9A 1YYNA 1ULGA 2R1BA 2UWCA 4FOYA 4GA9A 3OY8A 4XYXA 5L73A 1S0BA 3ILRA 4PBOA 4XTPA 1W6PB 3MEPA 4FP3A 1QGLA 2D3SA 4XJ9A 5AVAA 4FOQA 2CYFA 5H9RA 5JLVA 2ZZJA 1GSLA 1AVBA 2DVBA 1AXKA 1IOAA 5H9PA 5DG2A 1N3OA 1W6PA 3NWKA 3WZ1A 5EYXA 3NV3A 1JXNA 1WW7A 2AGSA 1MZ5A 1VLNA 2FMDA 1OQ1A 2ZHKA 4LBLA 4P9YA 4XHXA 5GZDA 3AZWA 5F9TA 1SLIA 4Y20B 5KXBA 1WBFA 1DQ6A 1J1TA 4YFWA 2YMZA 2R0HA 3N7JA 3M2MA 1MVEA 3Q9OA 4XXAA 3RG0A 4LBJA 2UURA 4PCRA 3W59A 1HQLA 2A75A 1QOTA 3A4UA 1JYIA 1LESA 4L8QA 5T52A 3HN1A 4Y20A 1LOEA 2DU1A 3ZSLA 1Q8SA 5CNAA 2ZHLA 4FQZA 2DVFA 2DVAA 3B9CA 2DVGA 3AYDA 2E6VA 3VKMA 3PVNA 1UMZA 5JOZA 1PZ8A 3I4IA 3INAA 3TAYA 3MW3A 1VAMA 4R9BA 1LOCA 1QOOA 4AGVA 4DS0A 3AX4A 3GNEA 1G86A 1FNZA 2W68A 2PHUA 4YW5A 1V6JA 1Q8VA 3R4SA 2EAKA 3VKLA 1SLAA 1V6LA 1N1SA 1QDOA 2E51A 4U2AA 1MS4A 5GLTA 1KDMA 5EXOA 4XJUA 2A70A 3KQRA 3JU9A 4XHBA 2D6NA 1QKQA 5GLWA 3T2TA 3I8TA 1B09A 1MACA 3PMEA 5E89A 4OZXA 2D6OX 2FHRA 1URXA 2YROA 3FFZA 5T50A 1N3QA 2DYCA 1UL9A 3D4KA 4AVSA 3AP6A 4I30A 1Q8OA 2ARBA 1TEIA 1JN2P 1AX2A 1N47A 3OYWB 1BKZA 1KDKA 5DZGA 1I1EA 1QU0A 3SNMA 3N7LA 5T55A 4LBOA 4XMAA 2ZMNA 4ISRA 4Y22B 4ATFA 1WW6A 2EXHA 1GZ9A 2DURA 4BLJA 1ULDA 1QMJA 3WG3A 1G9BA 3BIWE 3M3EA 1DYKA 2NP0A 4XBLA 1N1YA 3AP5A 3WNXA 3SITA 4YM1A 1NXD1 2DUQA 1FATA 1DIWA 3NV4A 2D6PA 5GLZA 4Y22A 2AYHA 2P37A 2PHXA 2YV8A 3FLTA 1SBEA 4TZDA 4XDQA 1QOSA 3R05A 1JW6A 2DUOA 3HMYA 4Q27A 5LK5A 1Q8PA 4Y1XA 2ZGSA 5JOWA 5IK4A 2D44A 3ENRA 4YM2A 3SLIA 5GZGA 1SLCA 2JE9A 2ES3A 2ZGPA 1MS0A 5GZCA 4GWNA 5JDBA 1D2SA 5E88A 1IS6A 3AYEA 3BOPA 1F9KA 2W08A 1UPSA 1GKBA 3WCSA 4IQPA 4XZPA 1N1VA 3A0NA 3UL2A 3SH3A 3LSDA 1SLBA 2W39A 2LTNA 3ILFA 1IKQA 3A0KA 3ZYPA 5JOYA 3V0BB 3AZVA 4M3CF 2XB6C 4CRQA 3AFKA 2JE7A 4XTMA 4AGGA 4UW5A 1G9CA 1GLHA 1PZ7A 1DQ0A 1W6OB 1W0OA 2A6VA 3OY8B 5DUVA 4KBBA 2ZHNA 1LECA 3UJQA 3U4XA 1JOJA 1LJ7A 4XJAA 3WHTA 3V0BA 1SBDA 4FPHA 5IT6A 1LGNA 2GNDA 2KM2A 1GANA 2LALA 5GLUA 1W6OA 3MW2A 4FPLA 5H9SA 2XG3A 4YM0A 4R9DA 1LTEA 3KM5A 3FLRA 3IKWA 1X50A 3IM0A 5T5JA 4GWMA 3WV6A 2DTYA 1CONA 1FAYA 1YRZA 3VKOA 4BPZA 3GALA 1UX6A 1WLCA 2D43A 1KJLA 5FRAA 1V6MA 3FLPA 4XOGA 2ZA9A 4FPGA 1LOAA 3WLUA 1DFQA 2OVUA 1DQ4A 3O0WA 4Y1VA 2EIGA 2ZGTA 3NV2A 1A78A 1GICA 2VU9A 3AYCA 1MS9A 1RITA 1W6QA 1YI7A 2EF6A 3NV1A 5T5PA 3R4UA 3IPVA 2WT0A 2YY1A 1KQRA 4JC1A 4YGCA 5DUUA 4XBNA 1DLLA 4XMIA 4XBQA 3ZVXA 1LU2A 4YG0A 4UW4A 1G8WA 1CPNA 1W6MB 1HQWA 1LHUA 4YG6A 3AJYA 1G9DA 4R9CA 3WCRA 3LCPA 1C1FA 1NLSA 1ULEA 1AXYA 3PVOA 2YZ4A 1WD3A 4Q26A 1GYKA 3IMNA 4YZ3A 4YGEA 4YW3A 1C1LA 1FV3A 1W6MA 2D6LX 1JHNA 3FUQA 4FQ4A 4AGRA 4BMEA 4C1XA 3M3CA 1A8DA 1JUIA 3AZYA 1GZWA 3PVEA 1OFSA 2WQZC 1VAVA 4Q8LA 1ENRA 3OPZA 1GNZA 1LGBA 1LOBA 2D3PA 4YLZA 4AYUA 1DBNA 1SLTA 5EYYA 4YGDA 4SLIA 2JDZA 3N3HA 3RRDA 2DVDA 4NO4A 4ZXKA 2ZGRA 2I2SA 1QDCA 3RSJA 3QLQA 2PHFA 4LBMA 4GKXA 2ZGNA 1S0EA 2ZMKA 1VIWB 2OUJA 4UW3A 4AWDA 2CY6A 2WSUA 1V6KA 2WLQA 5BYNA 1S0GA 2H0BA 3AJZA 1KJRA 2P3JA 3ZXJA 2VH9A 3WDXA 1GV9A 5HCBA 3WDVA 2A6YA 3OJBA 2GMPA 3VKNA 3SISA 1AZDA 4JRAA 2TEPA 2EXIA 5KXCA 2AUYA 3M3QA 1I3HA 4FPKA 4Y24A 2PHTA 1IS5A 3AZXA 3VV1A 5IK8A 3VUOA 1V6IA 2UU8A 5KXEA 2DV9A 1Q8QA 1U0AA 1YIFA 1MS1A 1SBFA 2ZACA 1DGLA 4XJWA 2GN7A 2D7FA 2A3XA 3N7KA 3B01A 4ZKTB 5DUWA 1KRIA 1JBCA 1LHVA 4UW6A 1LOFA 4Q2FA 5DZFA 3TB0A 1S0JA 2NMOA 3D6EA 1SACA 4DRVA 4D69A 2G4IA 2NZ9A 3L2YA 4GXLA 3VKFC 3WG4A 5T54A 3MPPG 4BM8A 1G7YA 1DQ5A 1WW4A 5HCAA 2E7TA 2GMMA 3ILNA 4JCKA 1APNA 1ENSA 2VW0A 3OGGA 3ZXEA 4ATEA 1LEDA 1LODA 3UK9A 1LGCA 4DPNA 2AH2A 2A6ZA 4AVTA 1MVQA 1IKPA 4XXPA 1OKQA 2VUAA 1DZQA 3N36A 3JUUA 4BQ1A 4CTEA 3O5SA 1LCLA 1EPWA 2A71A 2GN3A 2A6WA 1UZZA 1VALA 3SH5A 4Y1YA 5HCFA 4WVWA 2CWSA 1GNHA 3ZSMA 2UWAA 4GKYA 3WDYA 3B00A 2NM1A 2R1DA 3CNAA 2EXJA 2PHRA 4DQAA 2EALA 4PBPA 5EWSA 5FREA 3FBYA 1CVNA 5CAZA 1ULFA 2ZGOA 5GM0A 2W52A 2VXRA 5KXDA 4M3CE 2A7AA 3V0AB 2CL2A 2D3RA 1O4YA 1ZM1A 3O0XA 1SFYA 3BTAA 3O0VA 4LBKA 2A5ZA 1WD4A 1UKGA 4K20A 3RS6A 1LOFC 3ATGA 3M3OA 1LHNA 2GNMA 2R0FA 4U36A 3V0AA 4P9WA 4W65A 1W6QB 5DUXA 5IK7A 4RA0A 2B7YA 2OUHA 4FOVA 1H30A 3IPVB 5GJ6A 1WBLA 1QF3A 3WG1A 1QNYA 5IK5A 4Y1ZA 3POYA 1WLDA 2ZABA 5SV8A 3AP7A 1F31A 4M00A 1V6NA 4YW4A 1UAIA 4FPYA 5JVVA 2Z42A 4PQ9A 3POWA 1WLWA 1S0CA 4LBQB 1FV2A 4YFZA 4YG3A 5CBLA 3W58A 5GZEA 2DU0A 3C2UA 2UWBA 1WCSA 1MR5A 4K1ZA
chains in the Genus database with same CATH superfamily
1DHKB 2HWF2 4QKDA 3PIJA 4LULA 1AJOA 2VW1A 2OYZA 3USUB 1GP4A 5CU1A 2JKXA 3WW4A 3RZJA 3WP5A 1SHWB 4LBQA 4Q1RA 5JWPA 2PQSA 4KWKA 3O1RA 1H9WA 2FMYA 4HZFA 4Y3OA 4XUQA 4FT8A 5BY5A 2E53A 4RGGA 2BGOA 4PJYA 2DF7A 4RGAA 1XNTA 4YGBA 3BVCA 5JCTA 4KWJA 2JJ6A 4JRLA 1FYUA 2ZPXA 4TLGA 4I02A 3H0OA 1BQPA 1QNWA 2OW4A 1HKDA 2P17A 3DXUA 5IAVA 2BFUS 4IV1C 4X8NA 1NA1A 3B69A 4IV3C 2Q4SA 3ME2A 3FWEA 1OT5A 2R30A 3IBMA 4XEZA 3AVSA 1VE0A 2DCYA 2JKBA 2LS6A 3N35A 4WZCA 4XFGA 4CEWB 3FZ3A 4MZUA 5FYTA 4FPOB 5DZEA 1RL3A 1CGPA 2AENA 1W8NA 4HN1A 1HDKA 3A22A 3AK0A 5JDBA 3I3EA 4YVWA 4FVVA 1ULCA 5GZFA 1POV0 5FPXA 4AQSA 2NMNA 2PELA 2VXJA 3QD6A 3VBUA 2Q0AA 2BGCA 4CU6A 3WVJA 4XC9A 3WUDA 4CUCA 3H8XA 3OOXA 1WMXA 2VY0A 4XW3A 3VBHB 1WA6X 3RMXA 2X5IA 4XABA 4DFSA 5CG8A 3B7MA 1OSGA 4GJZA 3O12A 3RI9A 3OGJA 2BU9A 2WNVB 1W6NB 2ZAAA 2YFZA 3MIFA 3RMYA 2QQLA 2YBPA 2K9ZA 3DPRA 3WF3A 5IUQA 4DY5A 1UYZA 3MO4A 4XIKA 1GU3A 5GKAC 2HWD1 4UF0A 1H2KA 3KCXA 4OHWA 4WM7A 3LGRA 1PNFA 3NAPA 2V73A 4PF5A 5A70A 1GBGA 3B94A 3POSA 5AVPA 2X09A 3UJOA 3MF9A 4I09A 3LSEA 4CCLA 1ZRCA 1IS4A 3AZZA 2CGOA 3ZYJB 2UY9A 4MOAA 5T3NA 2HBUA 2VOKA 4CZSA 4WV8A 5JMCA 5FPAA 3AP9A 1NE6A 4LPLA 3APBA 3FBMA 4OCTA 3WDWA 5F6KA 4HL0A 3OYWA 3K3NA 1V00A 4MXWA 3PIGA 1X7NA 1BYHA 2WA3A 1MS5A 4MGIE 2DFCA 2DCZA 4UWDA 4XIOA 3MIBA 3ZSKA 3DV8A 2PAEA 2QQVA 3LEGA 4DXRA 1ONAA 1DYOA 4DZGA 1DG6A 1HN0A 5F7UA 4DEVA 2HEWF 1SLLA 5I0TA 2QNKA 1WCUA 2ZGUA 5FZIA 3DUIA 2ORZA 3GZUC 3MF6A 4M3CA 4JDNA 2CGPA 1OC1A 1POQA 5L9RA 4QXCA 4UFHA 2VMIA 1MQTB 2PLV3 5C6CA 3BU7A 2Y6HA 4YM3A 4BXSV 1Y9MA 1AR63 1ZYBA 3ZDSA 4YW1A 1ST8A 1YI9A 2PN5A 2WZR1 5F8PA 1V6OA 4A44A 4RFT0 4OMDA 2IXHA 2Y34A 5HXVA 4TYSA 5JR2A 1O3QA 5LY2A 3I2IA 3M1HA 2ARXA 2DWRA 1BJQA 1CPMA 4JV4A 3TBDA 1OURA 1PGL1 4JX0A 2HYKA 5DXDA 4M0HA 2FCTA 4DNYA 5FXXA 1AF9A 3QACA 4ORFA 1EV11 2CWMA 4AI1A 4CUAA 4XACA 1LOGA 3LOIA 1QJY2 5CB7A 4QPIA 5FPVA 4IV1A 2XLFA 3LA2A 1H4GA 1H9PA 3AXDA 3AMMA 4P9JA 4QPGC 5IVJA 1AYN3 1RTVA 2XJUA 5FKCA 5AFEA 2JEMA 3IN9A 4E4SA 4FXGB 2UWCA 2VM9A 2XUEA 4BQ5A 3PDQA 1ZVFA 3LIGA 2WQ8A 4XYXA 2VQAA 2WWSA 5CVRA 5ACA2 3L9JT 3MEPA 1AR73 5AVAA 5H9RA 1UXXX 2CYFA 1V0AA 2Y8KA 4YNIA 4DO0A 5C9AC 4JGYC 5JZGC 2J42A 3LZZA 1L7LA 2FDJA 4Q4V1 3O1VA 3PU8A 4NE9A 2D5FA 2DVBA 4CEYB 2IVJA 1POV3 2RM22 2XJRA 5DG2A 4LO5B 5F5IA 1X8EA 2R073 1JXNA 3HNBM 2K0GA 1QEXA 3ZFGA 2FMDA 1K5MC 1W03A 2WWUA 1OQ1A 4YVSC 4MH0E 3BIEA 3K48A 3WR0A 5C5UA 3ZR6A 3O1MA 1GZTA 1DQ6A 1J1TA 4OUEA 4HN0A 3H3UA 3Q9OA 4HLTA 4IE6A 3RPQA 5I8SA 4LBJA 2UURA 4PCRA 3W59A 1JYXA 1BCXA 4GIQA 1YJLA 4L8QA 3WNKA 4GB32 4Y20A 1CIYA 4QX1A 3CJXA 1EAH2 2VVFA 5FMOS 2N7GA 2ZHLA 1G6NA 3KZ4C 5BNPC 3GF6A 1E5IA 1W2AX 5FZFA 2CGNA 3ELNA 2VCAA 2DVGA 3GBGA 2IC1A 4HOOA 1UMZA 4Q4Y1 5HI0A 3TAYA 4EZHA 3KS7A 1HN1A 1VAMA 1LOCA 1QOOA 2CAVA 4AGVA 5J7MA 4Y4YA 3AX4A 3GNEA 1FNZA 1GMMA 2W68A 4KG8A 1ACCA 1RUH1 1PGW1 3OEBA 1IQAA 2EAKA 4CDXB 1SLAA 4U2AA 3JCIA 4GJYA 4TWTA 3WD5A 5HPOA 5DQ0A 3KQRA 4N53B 4XFHA 1QKQA 5GLWA 2GAUA 4EN7B 1AYN2 1B09A 1MACA 3PMEA 4D8MA 2YROA 5T50A 1XE7A 4Z1VA 5D1IA 2CSGA 1RVF2 4XFAA 1UY3A 2ARBA 3H8RA 1XNKA 2QTWB 2VGDA 5DZGA 2PYTA 3IZOA 2VNVA 3OPTA 4RHV3 4N7UA 5A3MA 4PLNA 1SG3A 2D98A 4TXWA 2WINB 3HPNA 4G3YC 4LBOA 4B29A 4Y22B 3ZLIA 4UT5A 1BLZA 3H50A 1GZ9A 2V5DA 2B9UA 2IXJA 2W9XA 1QMJA 4TSVA 3LPFA 4QPGA 5ABJB 4QD2A 2OQ7A 3K51A 4RN5A 2Q8EA 2MHFA 2ZX4A 1RUI2 2PHXA 3FLTA 2WLPA 3VBRB 1SBEA 4XDQA 2B46X 2HWD3 3R05A 4KI5M 4CDWB 3O1UA 1UQXA 1YNAA 3HMYA 1HV0A 3E97A 2LM3A 3NO8A 4Y1XA 5C9AA 4JGYA 4DOUA 2PAMA 3AKQA 3SLIA 3F2ZA 1MS0A 2JG9C 5FZ8A 1MZFA 4LO7A 4D3WA 4L9BA 3AYEA 5LRRA 1CAXB 3BYWA 2ADDA 4QB2A 1NAEA 1N1VA 2WS91 4QX8A 1ND2A 2WBKA 4LITA 1MEC1 3SH3A 1LRHA 4FTBA 4N9HA 1PO11 1COV3 3ZFEC 4B4PA 1CAUA 1VMHA 5BNOC 3V0BB 2UY8A 3FL7A 3USSA 4M3CF 2JE7A 2V4AA 4XTMA 5A3PA 1G9CA 1PZ7A 2A6VA 4KBBA 5A3LA 5J37A 2XVGA 4SBVA 3HBZA 2PTMA 4QHZA 1PVXA 1JYNA 1SBDA 4FPHA 3MICA 3F95A 4O65A 1J59A 4AQ6A 2V09A 4A41A 1TME2 2IVIB 2LALA 2XHKA 1W6OA 2XJSA 4WVMA 4FPLA 5A7WB 3UGFA 2XG3A 4V1PA 2XH6A 1STMA 1X50A 3DKWA 2WFPA 3WV6A 5CFDC 3LA7A 4W6WA 1CONA 1RC6A 1M06G 5JMOA 2WR9A 1EV13 2WZPP 2TNFA 3VKOA 3ZOIA 1FMD3 2OXBA 3GALA 3KGZA 4A3ZA 3MLLA 3J8F1 1KJLA 2F4LA 2GC3A 3MLKA 2QQNA 5FRAA 3FLPA 4RR3B 1O3RA 4Y1VA 2EIGA 2VNRA 1ZBE1 3OGSA 5FZLA 4YYOA 3UT0A 2VU9A 2EF6A 2OZJA 1O8SA 3NV1A 4HETA 1D2QA 3TN93 5APAA 2WT0A 1PM7A 2L9LA 2YY1A 2HWD2 1QQP1 3LWCA 5JXIA 3C7OA 1TMF1 3HT1A 4JC1A 4Z2WA 2FDIA 4XBNA 4AEDC 1VRH1 2E32A 4K8RB 4XQDA 5G05L 3U78A 3B93A 1W6MB 3VBFC 4YG6A 3AJYA 4R9CA 3UGGA 1J58A 2NQYA 2ZX3A 3MUZ1 1WD3A 3DN7A 2J1SA 4QDRA 5A32B 1YHFA 1PK6B 1GYKA 4NPRA 2QQJA 5KHGA 1FV3A 3S57A 4AGRA 1JHNA 4FQ4A 2WQ4A 2J1VA 4QB1A 1RJ7A 5CKMA 4COVA 4I0AA 3I59A 1W3XA 1VAVA 1H1MA 1GNZA 2D3PA 5FY7A 4AYUA 1RUF1 1FT9A 4EN6B 2ZZQA 5EYYA 3POEA 1C8NA 1RUD3 3W21A 2JDZA 3IIAA 1XOYA 1JYWA 1C8M1 2DVDA 1W9FA 2VMDA 2R32A 4AHYA 2I2SA 1QDCA 3BGAA 2XLAA 2PHFA 3G6JB 4IERA 1VBC2 3RSJA 4AI8A 4CPBD 5F6LB 1RUE1 5K8SA 5B2GB 2WLQA 2BEOA 2WZR2 3ZFEA 5BYNA 1S0GA 5DMYA 1H1IA 4LT5A 3M7AA 3VZMA 5FYHA 2VL4A 2P3JA 2HWF1 4OHVA 3WDXA 4BU2A 5BNOA 4XFFA 5HCBA 3WDVA 4E27A 4FSJA 1OH3A 3OJBA 4W4ZA 1ASJ1 1RUH3 1AZDA 4JRAA 1EV12 3S30A 4MG2A 3M3QA 2MEV2 1I3HA 4FPKA 5DDJ1 1QJEA 5LBFA 5C70A 1TQ5A 1W05A 2C1FA 3U75A 4UFIA 3VV1A 4DEQA 2EIBA 3VUOA 4COZA 5IK8A 1DDLA 4RS5C 2HWE1 1RUNA 5KXEA 1IG0A 4IE0A 3WSOA 3ZYHA 1OPOA 4BB3A 1DGRN 1MS1A 1SBFA 2WNVA 1W9TA 3N7KA 4W50A 1REFA 3U07A 2WO3A 5CFDA 2B4KA 3RZGA 3NKTA 4Q2FA 2VUCA 5DZFA 3EO6A 1S0JA 3VZLA 2F6BA 1EP0A 4Q4V2 1DZTA 2YU1A 5FXZA 2D93A 2G4IA 2NZ9A 2XQXA 4GXLA 3TEYA 5T54A 4IL7A 2ARAA 5FJKA 3J26N 5HCAA 5JR7B 5JXJA 4NRPA 3UKNA 1JHJA 1L7RA 2JG8B 3EQEA 3ZXEA 5FIXA 4ATEA 3UK9A 1NKGA 5FZ9A 5EQUA 5FP9A 2XKOA 3I2KA 1IKPA 4DXZA 1OKQA 3PMSA 5ERLA 3N36A 4QXBA 3WXPA 1UMIA 1VBE1 1H8TC 1SZBA 4IEOA 3TWIA 2DBNA 4AQTA 4KWUA 4C0BA 4XQWA 5IVCA 2CWSA 3J7MA 1SFPA 1UX7A 1GNHA 5IYYA 4D6SA 5FBZA 4Y5Z0 3I2HA 2BRTA 1JTZX 3B02A 3POJA 3CDZB 4PBPA 5EWSA 4P9LA 2QQPA 2ET1A 4E4DX 4CU8A 1OH4A 1E5HA 5IFPA 4MGQA 2WS93 1MEC3 1MQTA 2RMU1 4M3CE 2D3RA 2PA7A 3AM2A 1CAWA 1PO13 1ZM1A 4PLMA 5FOBB 4LBKA 4Q4Y2 4ZONA 1VPHA 4CCCA 3AL5A 3RS6A 1OOPC 4QKNA 2ZKLA 3WQ7A 5C8CC 5HV4A 2E9QA 4CYDA 4FBFA 4P9WA 4W65A 3NNLA 3LDBA 5FLHA 1ULOA 5A3NA 1GNYA 1PGW2 2GC0A 4FOVA 3WINE 1H30A 2EVXA 1WBLA 3WG1A 2R063 2H0VA 3BALA 2ILMA 3POYA 1WLDA 4HK9A 2DCTA 1OVSA 4UFJA 1PGSA 1JZ5A 3O1SA 3C8XA 3KQ4B 4M00A 3J9SA 4YW4A 1UIJA 3PL0A 4FPYA 2FDFA 3W5NA 1H4HA 4L2NA 4CCMA 4DIQA 1UOGA 4N8MA 1HB3A 1FV2A 1UXZA 3WT3A 4D6RA 4IEWA 5CEHA 5CBLA 4AZZA 3C2UA 2UWBA 1DU3D 4K1ZA 5FWJA 4CXYA 1VMJA 5EPAA 2O1QA 4FAGA 2GNBA 2QZ3A 1TZOA 5FKBA 1W0PA 3ROUA 1GZWB 5E8AA 5H9QA 1RJ8A 3J8F3 1Z0HA 4AVAA 2WFF2 1H6XA 1OLRA 1AJKA 2BQPA 2IXLA 4BCUA 4HMZA 4HKWA 5JIUA 1NQJA 4Q0VA 4RS5A 4UXAA 1OF3A 1ZBE3 4IUGA 1HLCA 1T2XA 4NIAA 3VZNA 3AXEA 3ZYRA 3NSTA 5LCWL 3ZYGA 2GNTA 1QQP3 4HSJA 2GSYA 2IXKA 1VRH3 4ASKA 1LHOA 2A73B 2YDEA 3NJYA 1B35C 3VDDC 4YW6A 1V9U1 1VBB2 3DF0A 2C5DA 3D8CA 5FYIA 2D6KA 1NT0A 4IESA 4MV2A 3T09A 1G9AA 4Q0SA 5ACA1 2JIJA 4JHZA 5FZ0A 3B3QE 5C4WB 3K75B 4F83A 4Z92B 3ZXLA 1U5YA 4QX7A 3ZFFC 2WS92 3GZEA 3OBRA 5J48A 2W87A 4COYA 3ZYIB 2C4XA 1FX5A 1I6XA 2R041 2VMHA 3P5BA 2RM21 1E5RA 2VQTA 4DY3A 1VJ2A 5FZOA 5EP9A 4OUSA 1LU1A 2VVEA 1Y43B 4E4HA 3PURA 3BODA 1HRI1 1C8M3 1N1TA 3QCWA 5TSWA 3POFA 2LROA 3QH7A 3UGHA 1U5IA 4BWOA 2KR2A 3SH4A 2B9VA 1WMDA 4CDXA 4YSFA 3PHMA 3ST7A 1RUE3 1F35A 1F5FA 5IVVA 2EXKA 4JTOA 2ZTNA 4LIVA 3THPA 1R1ZA 3S7IA 5FP7A 3IDAA 1AL0G 2AREA 1OKOA 2RS33 2RDNA 4GB31 3AP4A 4Q8KA 5FPUA 2HWF3 1NA1C 2H6BA 5C8CA 1S1AA 5BNQA 1NCRB 1Q43A 2JD4A 2E31A 4KGGA 4WZFA 4YW7A 5L7OB 5CG9A 4N90A 3PUSA 1S0DA 1C3HA 3J8F2 4M0NA 4AHXA 1PNGA 3R4DB 4MYEA 4NPLA 2P2KA 4XJZA 3DGTA 4KH9A 4AL9A 2HWE3 5GALA 1ZBE2 3MV11 3Q8AA 4OHZA 4QHBA 1JYVA 5J09A 3HNYM 5I8TA 4LTAA 3WNOA 2HLEA 3CJIC 4BDVB 1UN1A 4GAZA 2C9AA 2VG9A 1PZ9A 4ZZ8A 1QH6A 4WBBA 5I8YA 3W5MA 1QQP2 1D4VB 2X5IC 2JECA 2W92A 1TMF2 3T2PA 3U37A 1IS3A 4HG6B 1RHI1 3VBRA 2OKXA 2D40A 5A1FA 2BNOA 1W9YA 2E26A 4LKFA 4CDWA 2W94A 4ASMB 5CKNA 3ZXAC 5BUVA 4G9SB 4RL7A 1RGSA 3DPRC 1MZ6A 4FOWA 1PHMA 2G9FA 1JZ6A 3D0JA 3MIHA 3OD4A 2Q8CA 1N3PA 1RVF1 4TN7A 3T1MA 3LD8A 4OYUA 2P3IA 4PQQA 3LDRA 4FFGA 2XL7A 4X6QB 1HW5A 1LB2A 2YFUA 2YGMA 5FY5A 3GBWA 1FNYA 4A7KA 2XR4A 3HWJA 1VBE3 4OVEA 3AFGA 1GZCA 5A80A 1RUF2 2WSVA 4HANA 4Y1UA 3JD71 4OULA 5ANNA 3ZKYA 3C7FA 1PMHX 5JSOA 1B35A 1VBA1 3AYAA 3DECA 4QX0A 3VDDA 3ZSJA 3MW4A 3GGLA 4NUBA 1RUI1 3H8UA 4Q1PA 3ECQA 4FOYA 4NPMA 2R1BA 3HOBA 4OLLA 3ZXGA 4QQOA 5FY8A 2JDNA 3NNFA 3WX5A 3ILRA 4XTPA 1RUE2 4PI0A 3ZFFA 5J36A 4NWVA 1Q5OA 3JBG2 4IETA 3ZKUA 2AEZA 5JLVA 1GSLA 1SDDB 3VLBB 1W8OA 4IEXA 5D8AC 4PF1A 1RXFA 1H6YA 5H9PA 3OD0A 5DAPA 5FCCA 1RUOA 4PT6A 2FDHA 2G9GA 1W6PA 2Y6KA 5F3GA 2R7EB 3NWKA 4KU7A 3SHRA 2ET7A 1ASJ2 1BK0A 2XL9A 4N7IA 1WW7A 2XPJA 2YBSA 1VLNA 3OUHA 3IAPA 1XNDA 5DDJ2 2FD8A 2ZHKA 4PDWB 3N9MA 3AZWA 3BI3A 1WMFA 2WNOA 5K0UC 4BZ4A 4A3XA 3AMNA 2HWE2 4IGPA 4JHTA 1UIKA 2YMZA 4OQ9A 1MVEA 3DL3A 4FXKB 4Q0QA 3RG0A 5A1AA 3LFIA 3LF7A 2A75A 1EY2A 4QPYA 4YARA 4QPIC 5T52A 1A8MA 2JDMA 4N43C 2ZX0A 4E2GA 3N4MA 2WL1A 3HN1A 4IEZA 3OGRA 3HEIA 3P3PA 4CDQB 1GUIA 1TME1 3CO2A 3B9CA 5FOJB 3AYDA 2CU5A 1OFNA 2E6VA 3VKMA 3VL8A 4MGZE 5JOZA 1WA4A 2E33A 3I4IA 3PVBB 4R9BA 3ETQA 5A32A 2PHUA 3CJIA 1KFXL 1KS4A 1CZVA 1O6UA 4CA9A 1QJY3 3R4SA 3JXSA 1VBE2 1V6LA 1MS4A 1GOGA 4URTA 4QM9A 3SCFA 3PNAA 4Q4X1 5EXOA 5J1XA 3JU9A 5A7NA 4EWEA 3ZFGC 1ULPA 4YPJA 1CX1A 3LA3A 5E89A 2JXAA 2G19A 4A7ZA 3FFZA 4JDOA 4LJHA 2DYCA 3D4KA 3EHKA 5ACA3 2XBO1 2PQQA 1H8VA 3ZN6B 1OUXA 4AW7A 1TEIA 5F32A 1JODA 2RMU2 1JN2P 3AKPA 2AZ5A 5FZEA 1YEWA 1RYYA 2OX0A 3H42B 2R043 1QU0A 2BDRA 4UFKA 2RM23 2Y6LA 4Z82A 1U5XA 2W2IA 2BBVA 1J3RA 5DAQA 2EXHA 3FHQA 3NW4A 3I3DA 4BLJA 1IHMA 3LEKA 3BIWE 3M3EA 2FDKA 2NP0A 1N1YA 1HRI3 3RZKA 3NL1A 1NXD1 3NV4A 3OTFA 1DIWA 3AMHA 2D6PA 4WM8C 4QXKA 3OB8A 2P37A 2YV8A 4A4AA 4NAMA 2YU2A 3PTRB 5BXXA 5I93A 4GH4B 1JW6A 2DUOA 4FI9A 4Q27A 4XF3A 4B1LA 1Q8PA 1ZNPA 5A33A 1HX6A 1FPN2 5KC5A 3VDCA 3SCHA 2JE8A 4YM2A 3ZMNA 1SLCA 4EQVA 4OHYA 2ZGPA 2XJQA 5GZCA 4GB33 5D8AA 5JUVA 1JMUB 1EAH3 1VBC1 1IS6A 5LZ6A 3WP3A 1F9KA 3WQ0A 4BXFA 1QJU1 1HQNA 3WCSA 3OG2A 4C8DA 4EN8B 2FDGA 2ETEA 3KSCA 3LSDA 5LASA 3HIFA 5K0UA 5JPMB 1QJFA 3ILFA 4AXOA 1AYM2 3AZVA 3FHIB 5ISLA 1O59A 3NVCA 3SC7X 4C91A 3AFKA 5L19A 2XHNA 1UOBA 2MEV1 2P6HA 3E5QA 1DGWA 3VBSB 4JVAA 4JZRA 4I3GA 4JGZB 4N43A 1LECA 2JDYA 3UJQA 4D7YA 1LJ7A 3WHTA 1QJX2 5FPLA 4J1XA 2RDRA 2ZX2A 1LGNA 3B5LB 1V9U2 4XAAA 2GNDA 3D3AA 4GQ7A 3SEPA 4L99A 1RVF3 1RUG1 3KWVA 4R9DA 3S7EA 4JDMA 3SCGA 3HQRA 2YPJA 4CCNA 4XCAA 2EICA 5T5JA 3S5AA 2XGXA 2QE3A 4NVPA 3H1MA 4L97A 3FE5A 1O3SA 2DTYA 1EUUA 4LLFA 5FYBA 2R042 4NRMA 1FAYA 4C0HA 5CFCB 3H1WA 1C5HA 4H7LA 1JS9A 1EPZA 3BPZA 1V6MA 1PMJX 3UNPA 1AUYA 2ZA9A 1K5JA 1DFQA 1QHDA 1DQ4A 1ND2C 2OVUA 2JENA 1VBA3 2ZCWA 1HRI2 1GICA 1RUI3 4B4RA 1MS9A 1NLQA 2FQPA 3LDKA 5IATA 3VB9A 2ATFA 4CU9A 4O9GA 3LB9A 2Q30A 3H8OA 4YGCA 5DUUA 3S0MA 1DLLA 4XMIA 1Y4WA 3OF1A 1LU2A 4UFLA 4YG0A 4BA6A 5FO8B 1G8WA 4AAXA 4CE8A 4ARYA 1HQWA 1LHUA 3WCRA 2HWC1 4QM8A 2VVDA 4K3UA 1YQ6A 1KS5A 3KMHA 5BNNC 2YZ4A 1TNRA 5LBCA 4QX2A 5JSRA 1OD5A 4Q26A 1PX4A 2WNUC 3PJYA 5KBFA 4FTSA 3IMNA 1Y3TA 2D6LX 4WM8A 4C1XA 4NAOA 2VMGA 3IIIA 3LOBA 1A8DA 2XONA 3HQUA 3TEXA 1GZWA 2GH2A 1OFSA 4KU8A 1CAVA 2W5FA 1E5SA 4Q8LA 1W28A 4YLZA 1XNBA 1SLTA 1GFF2 4CPBA 4SLIA 3DCQA 3N3HA 2D97A 3RRDA 1VB4A 4ZXKA 2ZGRA 3J7NA 4XCBA 1RHI2 4KL1A 3BTYA 3QLQA 2XUMA 4LBMA 5IVBA 1UZWA 1SEFA 4BJ0A 1VIWB 2UYAA 1TME3 2OUJA 4UW3A 2CY6A 1V6KA 4GZ9A 1HB4A 1HIXA 4AVVA 1RUC2 3N9NA 2H0BA 5IAXA 2BYVE 2QKDA 3AJZA 3ES1A 3ZXJA 3BPSA 3LQCA 3H1YA 5C4WA 2GMPA 1OPMA 3NKGA 4HKOA 3VKNA 1L3JA 4N9IA 1AR92 2WFF1 4HBNA 5FYYA 4E8DA 2TBVA 4Y24A 3OCPA 4URAA 2DDUA 1CX4A 3CZJA 3AMQA 4Q4X3 5DPNA 4AFDA 3JD72 1VBA2 1UW8A 1Q8QA 1X33A 4L92A 4AFAA 2BPA2 5K7PA 1ENXA 3AL6A 1H0BA 2XBO3 1WLTA 2GN7A 2ZEXA 2JX9A 3KT7A 5FZ7A 5DUWA 4QMAA 1F5JA 1JBCA 1KRIA 1PMIA 2WN2A 4UW6A 1LOFA 3AMPA 5E16A 1VBB1 3ALQA 1W06A 2NMOA 3D6EA 3B9IA 3MIDA 4D69A 2VZTA 3VHRA 1ND3B 4CSWA 2Y33A 3MPPG 2WAAA 1GP5A 5FWEA 2HEVF 2VW0A 3H7YA 3EB7A 1UZVA 1NCRA 2A6ZA 4P00B 1NCQB 3D0SA 4CEWC 5KR7A 3M8LA 4D7TA 4OI2A 5LATA 1EPWA 5IFTA 2GN3A 2VQUA 3IDEA 1UZZA 3UYJA 2G1MA 5FY1A 4WVWA 3BKZA 3CF6E 4ET7A 3ZM8A 3TOJA 5F2WA 4CP9A 1GOFA 2UWAA 4LK7A 5A7PA 5LW9A 5F3IA 5BNNA 1VBC3 3B00A 1C5IA 1U5ZA 2R1DA 2EXJA 2PHRA 3CNAA 4DQAA 3HN3A 5LA9A 5FREA 3FBYA 1CVNA 1QXJA 1QJU3 2WNUA 1XYOA 3VBHC 1SMVA 5CAZA 2ZGOA 2YC4A 4OMCA 1X8MA 1F15A 2VXRA 3VBOB 2WNVC 2A7AA 2WZR3 3V0AB 2CL2A 4B7EA 3I49A 3CHXA 2EIEA 1SDWA 3KV6A 4J1WA 3E1F1 4Q4W2 2XKPA 4EROA 1SFYA 2FZ2A 2K46A 3MI8A 1ZBA1 2A5ZA 3URFA 1VAKA 1O3TA 1GR3A 4I2OA 3M3OA 4NRQA 3WP4A 5FBJA 4K40A 4E2SA 2VBPA 1W6QB 1KGYA 4QDQA 2MEV3 1NXMA 4RQPB 3C7HA 5GJ6A 5C7GA 4C90A 1QNYA 2GP3A 2C0ZA 2ID4A 2J1RA 4Y1ZA 1TG7A 2FZ1A 3IT8A 4K6BA 5C3RA 3I2FA 4Q4X2 4W6XA 1T6BX 4RYDA 3AP7A 1F31A 1QY4A 1UY2A 2BOIA 4H7MA 5FPBA 1WZXA 2IFWA 2Z42A 2PHDA 4HT1T 1PO22 4PQ9A 1AL21 1RUG3 1WLWA 3POWA 4LBQB 1HB2A 2XBO2 3KF3A 4ASLA 3W58A 5GZEA 1SPPA 4IGOA 3ZVXA 3CQOA 2WABA 3HR9A 2NYYA 2RVAA 1YQCA 4Q4V3 4A2UA 4YZ1A 3ACFA 4UAPA 1JI6A 1VRBA 1CN1A 1VBD2 3ACLA 3PJQA 3WUCA 2BTVC 4M4RA 1Z78A 1F4HA 2ZGQA 3H9AA 3VDAA 3ABZA 2Q1ZB 5FZBA 1ODMA 3FMGA 2D6MA 4FPEA 1AX1A 1XQNA 3JB4C 3ZXFA 4K8FA 1S0IA 1MQTC 5FP3A 3USUA 2OT7A 3NJVA 1UU5A 3RYKA 3PUHA 2V5YA 3K4AA 4EWDA 3N9PA 5FXVA 2WJSA 5FFOC 4MO3M 5FUPA 4RFRB 4PDWA 4B8EA 3VGIA 4BISA 4LKSA 1OLQA 1SFNA 4YVWB 3N9QA 4YZ5A 5HXMA 4EWAA 2C6SA 1OA4A 2R16A 1RMU1 2HWC3 2ENRA 2DCJA 1LHWA 2G9ZA 4FO9A 4XE9A 3KV4A 3G7DA 3ZX7A 3VBUB 4OQ8A 2J1EA 1CIWA 1BZWA 4XJ8A 4I0BA 1QJU2 1UO9A 4NHLA 3ZXKA 2YXSA 3JBG1 4FFIA 2W1QA 1W8HA 5FP8A 4BIFA 4EE2A 2ZGLA 1BXHA 1GWKA 4AAPA 1W9SA 4CDQA 2ZGKA 4CEWA 1I5ZA 1LENA 4Q4Y3 3VZJA 2PHLA 4QWNA 5FZCA 1CESA 1Q3EA 2AR6A 4P9GA 4JQRA 3I97A 4K7JA 1O4TA 3E5XA 4WM7B 4AHZA 3NAPB 2WT2A 4K21A 1QIQA 3WNMA 4XILA 5T5LA 1JYCA 2DUPA 4LE3A 5DAXA 2F4PA 4KGQA 1CJPA 2GALA 1RINA 1ENQA 1S0FA 2GMEA 2QQKA 4CEYC 3MIEA 4YZ2A 3MV01 3CZUA 3VBHA 4FPJA 2CV6A 2CDPA 2VZ3A 1SCRA 4QU2A 4Z8BA 1W8FA 4ZU7A 3ON7A 2WNEA 3KB5A 1W6NA 1C4RA 1UZYA 3DYOA 2RS51 2Y38A 2VBBA 3JQWA 1E57A 1X82A 3SMHA 1RUG2 5C3OA 3OPWA 4A6SA 5LEJA 5IVYA 4PIYA 2PFWA 5LBEA 3RQ0A 3MZHA 2DTWA 3MHZA 1OQDA 3W20A 5HV0A 2QFEA 1A3KA 1K3IA 4LOTA 5C3SA 3QH6A 5T5OA 4CDUB 1ODNA 2V72A 2ERFA 3R6SA 2WFF3 4JTNA 4GWJA 3MFAA 1MS3A 5GLVA 1R081 3Q8EA 2CNAA 4YZ4A 4INDA 4M3CB 3D5OA 4DRRA 4XETA 2ZEYA 3H7JA 5HCHA 4AFBA 4BYYA 1WUVA 5FMBA 1D0HA 1AX0A 3CLPA 1UCXA 4P14A 2SBAA 1JZ2A 5I0UA 3ITQA 1IQDC 4MGKE 5K9YA 1RXGA 2Y60A 3J7LA 3H3LA 4GWIA 3FFQA 3V56A 4Z2AA 1NYWA 5FZDA 4CCDA 2VTFA 1VBB3 2CTVA 1Y7BA 3O7OA 4GH4A 4OI4A 4NOTA 2B45X 2HWC2 4AI2A 4CVUA 5D2AA 4UBGA 1JZ4A 4CDXC 3R0RA 3V64A 2X29A 2ZHMA 3FUOA 5FZMA 1WW5A 2C26A 3V65A 4N53C 5FXWA 4IV1B 4IV3B 3RFRA 1XC6A 3OUJA 4QKBA 2XXZA 3CU7A 4XF0A 3THDA 2XDVA 1YCIA 1Q56A 2LW8A 4RGKA 1UOJA 1YO8A 5J96B 1O4ZA 2JB4A 2X10A 3ZN5A 1YXWA 5FYVA 1JZ7A 4LUMA 3PU3A 2VECA 3ASIA 3OEAA 4IDZA 2OS2A 4OI1A 2P3YA 3RI8A 3BU0A 2J1TA 2RJKA 3GHNA 1UWWA 1OMIA 2C9KA 2VE1A 2OPKA 4IE5A 5L73A 4PI2A 4PBOA 1HJFA 5CIRA 1FPN1 1JOBA 5FZ1A 2YHJA 5ABJC 4FOQA 5A3OA 2OZ6A 4FFHA 4PIXA 3TRSB 2X8KA 5I0RA 2VCMA 5J3UA 3WW3A 2RR11 1GWLA 5FZ3A 1H1AA 3VBRC 1AXKA 3WQBA 5EZWA 1N3OA 4UYBA 4CDWC 2E7AA 1R64A 2WRAA 4NIHA 3JQXA 5EYXA 1XBFA 3NV3A 5C33A 4NHKA 2AGSA 1MZ5A 4BIOA 3RZMA 2C24A 1CZSA 2HBTA 4QGNA 1R1A1 2NPIA 4LBLA 4P9YA 4XHXA 4CEYA 4M4PA 5F9TA 1OI6A 3ZIXA 2VZ1A 2PXJA 1AYM1 3ZYFA 4Y20B 3QOPA 1D4M1 1R091 5AFBA 1OVPA 4YFWA 5D21A 3N7JA 3N9OA 5FAXA 3M2MA 5FO7B 3CIHA 1TMF3 1HQLA 3A4UA 1QOTA 1LESA 1QJX1 3FX3A 3U0ZA 3BN6A 2DU1A 2RS11 3ZSLA 5M0TA 4Y5TA 3T0DA 4FQZA 2DVFA 2DVAA 4FCAA 4IE7A 5FYMA 4XPVA 1A6CA 3J7HA 2YGLA 3PVNA 1PVC2 1BEV2 4PIZA 4LORA 5EJZB 4S2FA 5FQ0B 3VHOA 4X8PA 4YRDA 2BVVA 4XURA 3WW1A 1Q8VA 5LEKA 4JKMA 5FMCA 1UNBA 2BBAA 1RUF3 1N1SA 2BWAA 2LUWA 2W47A 4JKKA 4KWLA 5F39A 3ACHA 3VHNA 1KDMA 2NLRA 2A70A 2D6NA 4MSVA 2WYFA 2IFRA 4XZUG 3ZMOA 2B5HA 1RMU3 3GCXA 5LA1A 1REDA 2D6OX 1URXA 1UL9A 2B42B 3AB0A 4LIUA 4AVSA 4BH9A 4RR3C 4L0PA 4KNCA 4I30A 1Q8OA 3JBG3 4N53A 2VZPA 5LB6A 1L7QA 4EZ4A 1AX2A 1ZZ7A 2ZAHA 4QPGB 2FCUA 1BKZA 1DGRA 1KDKA 3EXUA 5B4NA 1I1EA 2YYOA 1ZBA2 3AKRA 5JSPA 2ZEZA 2ZMNA 1OA2A 1VP6A 1BK1A 1ZRFA 1ASJ3 1NE4A 1ULDA 1US2A 4LR4A 1G9BA 3IAQA 1DYKA 1OBNA 5DDJ3 4XBLA 1NX9A 3AP5A 3D82A 3ORJA 3WNXA 5LY1A 2F17A 5C9AB 4JGYB 2WZEA 4ZU4A 5JZGB 3RVHA 1FATA 2HKXA 5GLZA 1JU4A 4Y22A 4XUNA 4QQLA 4NIDA 1BBT2 1NZCA 1O7FA 4AI9A 2VCCA 1ZRIA 3FJSA 4NHXA 1QOSA 3U4SA 1PK6C 4Q0PA 5ABJA 3IWZA 3I2GA 5JOWA 5IK4A 4HKLA 1WCQA 2D44A 3ENRA 1AL22 5GZGA 1W2TA 2JE9A 2ES3A 2P4EA 5JI9A 2VNGA 1HXS2 1K5MB 4YVSB 4GWNA 1D2SA 3POBA 5E88A 4E9KA 4LO4B 4D6QA 1CAUB 1IPJA 3BOPA 4IEVA 3VD7A 1XNCA 3HT2A 5E6HA 4EN0A 1GKBA 4DINB 2BP6A 2K2SA 3A0NA 3KHBA 3RJ2X 3VD4A 1RUC1 3I2JA 4A45A 2JIGA 4IE4A 2B39A 1SLBA 1IPSA 2GC1A 2LTNA 2RG4A 1CAXA 2W39A 4MX3A 4NMIA 5JOYA 3NJZA 3I2OA 5BNPB 2XB6C 3M4FA 4JKLA 5F37A 2W1UA 2HJIA 4UW5A 1AR91 1GLHA 1W6OB 1W0OA 3HQXA 3OY8B 4GULA 2GP5A 2WA4A 4WVMB 5DUVA 2JDAA 4LOSA 3U4XA 1JOJA 3UESA 4XJAA 4WVZA 3V0BA 1PX3A 3C7GA 4JQTA 1YC61 1RMU2 2LRPA 1GANA 5GLUA 3MW2A 1UU6A 5FZ4A 4CUGA 4YM0A 4OUMA 3KM5A 4MHUA 3GZAA 5E1RA 2Q8OA 3IM0A 2RMU3 2WYSA 1UF2C 4LO8A 1POV1 3EJKA 3PUQA 5A7SA 5A7WA 2GH8A 5KWRA 4KQ7A 5A7QA 3ACIA 4LHNA 4PHZA 3Q8FA 5F3EA 1WLCA 2D43A 1KEXA 2WAOA 3NNGA 2FBEA 4XOGA 1NQDA 3H3ZA 1OF4A 1TVGA 2VZVA 3NV2A 4I01A 3AYCA 1XB9A 1M4WA 1ZZ6A 3WF0A 1W6QA 5T5PA 1YI7A 4CCKA 2QQOA 3GJBA 4W6YA 4RR3A 1DF0A 5BV6A 1KQRA 2QQMA 1FPN3 2JG8C 2ZXQA 5FZHA 4ZXEA 3OBAA 4JAAA 4XBQA 2GC2A 2RS52 1AHSA 1CPNA 4BK4A 1G9DA 2RR13 1F2NA 3HD8B 2BFUL 5EHDA 1AXYA 3PVOA 4AHWA 4OFGA 3WW2A 5JXHA 3I59B 1UD1A 3KCYA 4QB6A 1Z7S2 1ZZCA 4YZ3A 1C1LA 4YGEA 5LA0A 2CAUA 4Q4W1 1W6MA 3HAGA 3FUQA 3WF4A 4BMEA 1ZREA 5FYSA 3VL9A 1R082 1R1A3 2J22A 2JG9B 1JUIA 2BUKA 2Y0OA 3ZSEA 1IZ3A 5FK7A 3VZKA 1AYM3 1P8JA 1QXPA 2RJLA 1D4M3 3W9AA 1PK6A 1R093 4EJRA 3ES4A 1LGBA 2DBIA 1LOBA 1XU1A 1WMEA 3IDBB 3NRUA 5ANQA 5KC6A 5A7OA 2X05A 5L9BA 4R52A 2VOTA 2JB8A 4NO4A 2W0XA 1UY4A 1W0NA 3ZFEB 1QJX3 2RS13 4DXTA 2HWB2 4LHSA 1CZTA 1V9U3 5BNOB 4QX5A 4AG4A 2RV9A 4HSLA 4AWDA 4NHYA 1PO21 3RNSA 4KG0A 5F3CA 4KMQA 4LKEA 1XSRA 1H2NA 3LAGA 4RHV1 1KJRA 4OI0A 3DXTA 1GV9A 3MFCA 4ZU5A 5LA2A 1VBD1 2VQ0A 5L9VA 2A6YA 1XYNA 3UETA 1NY71 4IW3A 3SISA 1VMFA 2EXIA 1OXCA 4H2AA 4F8AA 1KD7A 3OUIA 3T4VA 2PHTA 4MUVA 4BOWA 1IS5A 4F7ZA 1Y9GA 3C7EA 4LHKA 3FN9A 1WWYA 1Y9QA 5CFDB 2UU8A 3VD3A 2DV9A 3AKTA 2QCSB 1U0AA 4EV0A 2OPWA 1NZIA 2XVKA 2VTXJ 3NQHA 5I0SA 4IEPA 4OZOA 3THCA 1QXRA 2A3XA 1WCDJ 1ZZ9A 3I2DA 4ZKTB 1BMV1 2JD9A 2BGPA 2GZWA 4NROA 1X36A 1W2UA 3VN4A 3WNNA 2KD7A 2RR12 3E6BA 1SACA 1S2KA 5FTTC 4LHLA 3L2YA 3VKFC 1W9WA 4META 2ZX1A 3WG4A 5IW0A 2WIIB 2GMMA 3E6DA 1COV1 1ENSA 3OGGA 4LA2A 3MGUA 4Y5SA 1LEDA 1LODA 1NUKA 3LIHA 4HFSA 2AH2A 4ZS3A 4DPNA 1PIV1 4AVTA 4XDOA 1MVQA 5A3UA 3VBFB 1JU3A 1R1A2 4CDUA 3M70A 3JUUA 2ZJCA 4BQ1A 2WWJA 1D4M2 3O5SA 1LCLA 1R092 2JG8A 2RJ2A 2A71A 5C4WC 1CD3G 4BE3A 4ES8A 3SH5A 2H6CA 4XUPA 2ZOEB 5EV7A 3KD4A 1RHI3 4V2VA 1IPKA 1C28A 1CAWB 4BQYA 1UY1A 5CYYA 1DLCA 1DP0A 2RS12 2EALA 1HRV1 2J1UA 2W1WA 1ULFA 5GM0A 1GQGA 2W52A 1A34A 4HONA 5KXDA 1RUC3 3I7DA 3RYRA 1UZ0A 5FUNA 3O0XA 4QXHA 5FYUA 5F1RA 3VD5A 4FFFA 1WKYA 1UPIA 1WD4A 1XE0A 1YQ2A 2JDHA 1LOFC 2O8OA 3O14A 1FMD1 2XJPA 1LHNA 4K20A 1OLMA 2R0FA 2Q1FA 1GQPA 4U36A 1W8TA 5DUXA 4RA0A 2OUHA 1AR93 3K77A 2EIDA 4IV3A 5KHJA 2VR4A 3IPVB 4CCJA 5KHKA 1QF3A 5IK5A 3JD73 2BWCA 2ZABA 5SV8A 4BHPA 4IXLA 3TN91 1NCRC 1TNFA 3TNPB 5L7OC 1UAIA 3T08A 2QQIA 3KT4A 3FHAA 4AVCA 4G4FA 4QAWA 3GBFA 4YFZA 1I5PA 1RB8G 4XF9A 2Z79A 3S5QA 2DU0A 2VOXA 2ZMLA 1MR5A 1DYPA 1XYPA 4C1WA 2Q5TA 4RS5B 4K1YA 2IXIA 3IDCB 3T0BA 3KVAA 2XMLA 4AVBA 4FP2A 4YW2A 2XQRA 4QGMA 5FMOL 1ZA4A 3LKJA 3ZPYA 3KCCA 5CADA 1S55A 2D5HA 2IXCA 4FPFA 4LBQD 3KV9A 1CR7A 3X29B 2VZOA 4AI0A 1UYXA 2VAUA 2V4VA 5J98B 3OBZA 4BK5A 1DGWX 2A6XA 1MZEA 4NWWA 4B1MA 2VTXA 2A3WA 3OBTA 3P3NA 3P6BA 4Y26A 4PLOA 2ZKNA 1RUD1 5F5CA 3WQ1A 5HBAA 4ARXA 4XQ4A 2KA3A 1UYYA 2RHPA 3WOGA 2JICA 1AR81 2PLV2 2R49A 1LR5A 3N9LA 3WDTA 1AR62 1NLRA 4GALA 3DYPA 4E4ZA 5CA6A 5FZOB 1H8TB 2P3KA 4AK3A 1DQ1A 3U1XA 2WN3A 4Q4W3 3NNMA 1DQ2A 4O9EA 4BQ2A 1G9FA 4QQHA 3ACGA 5FK8A 5BPXA 2JDUA 2PHWA 4H55A 4XFIA 5LBBA 1JZ3A 4ISQA 2VZRA 4KBZA 4CU7A 4AOCA 2VW2A 3K2OA 1W3VA 4B7KA 2P1BA 4P08A 5DG1A 5JOXA 1O8PA 1NOVA 5FQ0A 3O1TA 2BW8A 4LBNA 4ZS2A 4HPKB 1XJAA 2JWPA 2Y64A 4P9XA 2XJTA 1OOPB 3M3IA 3WHUA 5C8CB 2JDKA 2PAKA 2XVLA 1PO23 1HB1A 2P34A 1W04A 2XOMA 2Y26A 2ZGMA 1C57A 1AR72 4OHXA 4B4QA 1KITA 2QBXA 3AC0A 5FR3A 3K4ZA 5FZGA 1LULA 4PDWC 4WVVA 2Q8DA 1SCSA 1F4AA 4MADA 3CMGA 3RDIA 3U14A 2VZSA 1VBD3 3N7MA 5FY9A 1H2LA 1V70A 2WT1A 4V2WA 4NIGA 2TUNA 2ZBJA 3WDUA 1US3A 4ITCA 2KXLA 3KHCA 1VR3A 3WG2A 2R072 1XRUA 1PVC1 1QH7A 1BEV1 2WUHA 3ZYBA 4BMBA 1K12A 5FZAA 2E7QA 4BLIA 4R9AA 2GDFA 5C3QA 3DKQA 3KLSA 1YFWA 4HVOA 1MS8A 4XFBA 3HBKA 3NJXA 4CDQC 5L7OA 5DAWA 2SLIA 3POIA 4GMP1 4M01A 3MYXA 1S2EA 2Y6JA 5JZGA 4COWA 4AQ2A 3RZHA 1YUDA 2ADEA 1RIRA 3IMMA 4QT6A 5LK7B 3T1LA 3TNQA 2QQWA 2WKKA 4COUA 5JPNB 2RE9A 4DUVA 2ZS6B 4LA3A 2ARCA 1K5MA 1X9PA 3CKHA 4YVSA 2NN8A 5CISA 1O91A 4MHRA 4L11A 1LEMA 4NR1A 1PIV3 2BNMA 1OHFA 3A21A 1B35B 1AXZA 3VDDB 5FLIA 2A3YA 5F5QA 2WC2A 4QHOA 2CDOA 4W8JA 4AEKA 4XUOA 4CCEA 1U12A 4LLOA 5AC91 2R061 1WGPA 4FPCA 3ZFFB 4D7SA 3BB6A 3EBRA 5BNPA 4CP0A 4IGQA 1BBT1 3RZZA 1T6GC 1CQ9A 1YYNA 1ULGA 4UFMA 4GA9A 3OY8A 1HRV3 2B8MA 1S0BA 1ZRDA 1O5LA 1W6PB 4R8HA 4FP3A 1QGLA 2D3SA 2W46A 4XJ9A 5A6YA 1LAJA 1HXS1 2ZZJA 4E8CA 5JXGA 4P5YA 1ZZ8A 2DCKA 4H3WA 2VPVA 4RHV2 1AVBA 3K46A 1IOAA 5K4LA 4GH4C 2VULA 2HH9A 1RUJ1 1NY72 2Y6GA 3L2HA 3UKTA 3WZ1A 3AVRA 5FO9B 5CFCC 2W95A 5G04L 1H2MA 1EUTA 5JAXA 5DABA 3HVDA 5GZDA 5A3TA 2CHHA 5IVEA 4GMP0 4MVTA 2Q1MA 1PM4A 3VHPA 1SLIA 1GWMA 1NA1B 5LWBA 5KXBA 1WBFA 4CP2A 3MPBA 2R0HA 5EFUA 4QQ2A 2VCBA 3I3QA 4XXAA 4XUTA 5FYCA 4F3JA 1JYIA 2BERA 1UY0A 2ZEWA 4QDSA 1XE8A 4IEUA 4DMIA 1CJDA 4LKDA 4HK8A 4FTEA 3KGLA 1BMV2 4AFMA 1LOEA 2IZWA 3BTZA 2QUOA 1FOD1 1Q8SA 2BOJA 5CNAA 2W3JA 5F5AA 3LE0A 4LEJA 1VB2A 4Q29A 3CJIB 3VBSC 2AC1A 4JGZC 1KXGA 3HNMA 3O1PA 2YUEA 2X5IB 1PZ8A 1F8VA 3INAA 1W2NA 2I07B 1COV2 3MW3A 3FC0A 4O7XA 2UYBA 3NNJA 4DS0A 1PIV2 1QWRA 1G86A 1I9RA 4MGTA 1W99A 2GU9A 3LEMA 3Q8CA 2W1SA 3DPRB 4MGSA 4YW5A 1V6JA 5FYZA 4AFCA 2YC2A 3VKLA 2E51A 2JG9A 4UF0B 1QDOA 5GLTA 3MDPA 4XJUA 5IHRA 4XHBA 1AR83 3I8TA 3NMBA 3T2TA 1YQ5A 4I3PA 2VNOA 1YQ8A 4OZXA 1REEA 2I74A 4XVHA 2FHRA 4Z07A 5FY4A 4FAHA 1N3QA 4BQ4A 1HRV2 2MNGA 3GYDA 3TYJA 3UKVA 2VUDA 3AP6A 2RS31 3POGA 1LNSA 1UU4A 3TEWA 4AEMA 3I3MA 1N47A 3OYWB 4EN9B 1PGL2 4MXWB 2WO2A 3SNMA 3N7LA 3UV9A 1KFUL 5T55A 3RJRA 4XMAA 1K45A 4ISRA 4ATFA 3ZN6A 1FMD2 1FXZA 1WW6A 3PTYA 4HXCA 3SKJE 3T4HB 2DURA 1Z7S1 4CP1A 5FUIA 2VJXA 5KHIA 3GM8A 3WG3A 1HJGA 5A33B 2Z69A 3LFMA 3OGVA 2O8QA 4YM1A 3SITA 2DUQA 1J3QA 2AYHA 1XPWA 5D8AB 1UMHA 3BOWA 3DYMA 1YFYA 4TZDA 3TN92 2AACA 3O1OA 5LK5A 3I3BA 2OIIA 4IEQA 3U11A 2ZGSA 3E6CC 1W90A 3KF5A 4ZPIA 4RSUA 5FPZA 4DXSA 5C71A 3TEZA 1XU2A 2O0OA 4LO6B 4NHMA 3JZVA 2X53S 2HWB1 4ONUA 4UI9L 1IGOA 5FP4A 2WDBA 3RWNA 3T30A 2W08A 5K0UB 1UPSA 2FCVA 5C8WA 2YG0A 3PUIA 3WY6A 4IQPA 5FV3A 1DCSA 4XZPA 2O14A 3UL2A 3KT1A 5FJHA 5FZ6A 1PVC3 2DFBA 2YPDA 1ZA7A 1BEV3 3ETPA 4QPIB 4RD7A 4Y4RA 4N43B 1IKQA 1JH5A 1FI2A 3A0KA 3ZYPA 4AR2A 4CRQA 4HVQA 1ALYA 1ZZBA 3HJRA 4MLOA 4AGGA 4AEDA 4GMP3 2P6CA 2VO5A 2P5BA 4QX3A 3ZPOA 4Q0UA 3THTA 1DQ0A 3WF1A 5LRSA 3VBFA 1RUD2 2ZHNA 1O5UA 3CL1A 3RGBA 5FZKA 2WO7A 5EJ1B 4AEJA 5IT6A 1D0GA 2BZDA 5JI7A 4D94A 1AR82 5C5TA 5I0DA 1GQHA 2BNNA 2KM2A 3VBSA 2BJSA 4JGZA 4LQRA 5H9SA 1OQEA 3I54A 4A42A 1LTEA 1XXNA 3FLRA 3IKWA 3KVBA 3VZOA 4AI3A 4GWMA 3WF2A 4QU1A 1YFXA 3T2OA 3ZFGB 1ZBA3 2WZ8A 5FMDA 3ZIWA 3ZDVA 1WCKA 1YRZA 3MLJA 4BPZA 1RUH2 2HEYF 1UX6A 4Q5OA 4TTGA 5EIYB 4X6RB 5AC93 4FPGA 3LEIA 1LOAA 2JDPA 3SEEA 2I45A 1YLLA 3O0WA 3WLUA 3WP6A 4NJ4A 2VMFA 2ZGTA 4S2DA 4LXLA 1A78A 2IWGB 5A6ZA 5CFCA 4D0QA 4P9IA 1SQ4A 1OUSA 1RITA 1BBT3 1ND3C 4LNVA 3T3YA 3R4UA 3T2QA 3ZO0B 1OLME 1J83A 2VBDA 4H14A 4NIIA 3IPVA 4CCOA 4BQWA 2Y6FA 3MBWA 4CXXA 4MGYE 2RDQA 4AEDB 1AL23 1CWPA 4UW4A 1HXS3 4ZZ5A 2AEYA 5CZKA 1JOPA 2VC9A 1NCQC 5EJ3A 1X9TA 1IG3A 4WM8B 5DAVA 4A6OA 3LCPA 1C1FA 1NLSA 1ULEA 1ZRRA 4DUWA 5FY0A 4CUBA 2R6QA 2VOWA 1RUJ3 5A3WA 1CAVB 2QQUA 2WO1A 2RDSA 4YW3A 4DUXA 4CXWA 4UOJA 3GZTB 2QJVA 3J4UH 4S2HA 3M3CA 3VDBA 2EA7A 2YBKA 3K4DA 5JIAA 3AZYA 3WNPA 4E2QA 3PVEA 3WEZA 5A6QA 1LKNA 2Z4FA 2WQZC 3GXUA 1W8ZA 1QJY1 1ENRA 3MIGA 3OPZA 1YIPA 1TE1B 3VBOC 1DBNA 3GHMA 3IB3A 4XDPA 5FLJA 3SXWA 4YGDA 1YFUA 1BVVA 5DN2A 3Q8BA 1BHGA 5L36A 5A6XA 1MPXA 1FOD3 4GKXA 4LE4A 2ZGNA 1S0EA 2ZMKA 3AKSA 3U10A 3LPGA 3OSDA 3A7QA 2WSUA 4Y33A 4RQPC 1GOHA 2VUJA 3GJAA 1MEC2 4ZY9A 3ZXDA 1PO12 3E5UA 4K9SA 1NG0A 2VH9A 4R4XA 2XWJB 3WNLA 5I91A 2QVSB 1H8TA 1JZ8A 2PMWB 1XNAA 2TEPA 5KXCA 3PUAA 2AUYA 4P5HA 5A1LA 1J1LA 4XFCA 1JUHA 2OA2A 3EMRA 4XF1A 5AC92 3AZXA 2R062 1V6IA 1EYBA 3SKVA 1OA3A 3T0AA 2ORXA 2VMCA 2VMEA 1YIFA 2ZACA 5IWFA 1DGLA 1QJZA 4XJWA 3JB8A 2D7FA 4HPKA 3VD9A 3B01A 4MXVA 4QQPA 2QDNA 2RS53 1ZX5A 4LUKA 2YB7A 1LHVA 4XF4A 4EYUA 1ND2B 1EAH1 1S4CA 1OOPA 2PLV1 5C3PA 3TB0A 3BTXA 3S6PA 2E63A 4DRVA 1XSQA 1AR61 4NN0A 4S2GA 4R4ZA 4BM8A 1G7YA 1DQ5A 4BQ3A 1WW4A 2XLGA 2E7TA 2YC0A 3DEMA 4YWAA 1RUJ2 1Z7S3 4LK6A 1W2OA 2VZUA 3ILNA 4JCKA 1APNA 4J6GA 3ZR5A 2J1AA 4YVWC 5IVFA 1LGCA 1R083 4J25A 1W39A 3BCWA 3RYPA 1W8WA 1ND3A 1OD3A 4XXPA 4CP9B 2XWBB 4B3NA 2VUAA 3VBUC 3P1IA 1DZQA 1GP6A 2IUWA 2J7MA 4AE2A 4CTEA 5BNNB 5CKQA 2VOVA 4AF9A 4LMFA 2A6WA 2WNUB 3GCWA 4GD4A 1K42A 1UYPA 1VALA 3ZN4A 3KV5A 4Y1YA 5HCFA 1VRH2 4O61A 2HYXA 1NCQA 3SQOA 4DB5A 2QDRA 1AYN1 3ZSMA 2Y0IA 4GKYA 4XAEA 5B4XA 1S2BA 1HV1A 3WDYA 2HWB3 2NM1A 3QBQA 3RWKX 4ZHNA 1J84A 1FOD2 4BQXA 3BUCA 1BVP1 2QZ2A 2Z2SB 2A1XA 4WM7C 3NAPC 1AR71 3K3OA 4QPWA 3MUY1 3EYPA 5FDBA 1O4YA 1DZRA 4P02B 3BTAA 3O0VA 2VD7A 2XJVA 4ES9A 1D7PM 2VZQA 1UKGA 5SV5A 3CEWA 3ATGA 2BV4A 3A23A 1W8UA 2EAAA 2GNMA 3GDBA 2OQ6A 2W91A 1J3PA 3VBOA 5IK7A 3V0AA 3PLQA 2B7YA 2R071 3CBNA 4QKFA 5KHHA 1YJKA 2MPFA 5F2SA 5IJRA 4IEYA 1C8M2 4TLFA 3RZLA 1SPPB 4QGLA 4A7YA 2Z5WA 1V6NA 1UOFA 4RQPA 4CDUC 4UBHA 4I0WB 5JVVA 1UKRA 2BVBA 1S0CA 1JYTA 3C3VA 4YG3A 1YWKA 2RS32 4HVRA 1WCSA
chains in the Genus database with same CATH topology
1DHKB 2HWF2 4LULA 1AJOA 2VW1A 2OYZA 3USUB 5CU1A 3WW4A 3WP5A 4LBQA 4Q1RA 5JWPA 4KWKA 1H9WA 2FMYA 4HZFA 5BY5A 4FT8A 2E53A 4RGGA 4PJYA 2DF7A 4RGAA 4YGBA 5JCTA 4KWJA 2JJ6A 4JRLA 1FYUA 2ZPXA 4I02A 3H0OA 1BQPA 1QNWA 2OW4A 1HKDA 2P17A 2BFUS 4IV1C 4X8NA 1NA1A 3B69A 4IV3C 2Q4SA 3ME2A 3FWEA 3IBMA 2R30A 4XEZA 3WDWA 4BOWA 2DCYA 2JKBA 3N35A 4WZCA 4XFGA 4CEWB 3FZ3A 4MZUA 4FPOB 5DZEA 1RL3A 1CGPA 2AENA 4HN1A 1HDKA 3AK0A 5JDBA 4YVWA 4FVVA 1ULCA 5GZFA 1POV0 5FPXA 4AQSA 2NMNA 2PELA 3QD6A 3VBUA 2Q0AA 2BGCA 3WVJA 3WUDA 2VY0A 4XW3A 3VBHB 3RMXA 2X5IA 4DFSA 5CG8A 3B7MA 1OSGA 3O12A 3RI9A 3OGJA 2WNVB 1W6NB 2ZAAA 3MIFA 3RMYA 2K9ZA 3DPRA 5IUQA 4DY5A 4XIKA 5GKAC 2HWD1 1H2KA 3KCXA 4OHWA 4WM7A 3LGRA 1PNFA 3NAPA 2V73A 4PF5A 1GBGA 3B94A 3POSA 5AVPA 3UJOA 3MF9A 4I09A 3LSEA 1ZRCA 1IS4A 3AZZA 2CGOA 3ZYJB 2UY9A 5T3NA 2VOKA 4CZSA 4WV8A 5JMCA 3AP9A 1NE6A 3APBA 3FBMA 5F6KA 4HL0A 3OYWA 1V00A 4MXWA 1X7NA 1BYHA 2WA3A 1MS5A 4MGIE 2DFCA 2DCZA 4XIOA 3ZSKA 3MIBA 3DV8A 2PAEA 4DZGA 1ONAA 1DG6A 2HEWF 1SLLA 5I0TA 2QNKA 2ZGUA 3DUIA 3GZUC 3MF6A 4M3CA 4JDNA 2CGPA 2VMIA 1MQTB 2PLV3 5C6CA 3BU7A 4YM3A 1AR63 1ZYBA 3ZDSA 4YW1A 2PN5A 1YI9A 2WZR1 1V6OA 4RFT0 1O3QA 2IXHA 5HXVA 4TYSA 3M1HA 2ARXA 2DWRA 1BJQA 1CPMA 4JV4A 3TBDA 1PGL1 2HYKA 5DXDA 4M0HA 4DNYA 1AF9A 3QACA 4ORFA 1EV11 2CWMA 4AI1A 1LOGA 3LOIA 1QJY2 5CB7A 4QPIA 4IV1A 2XLFA 3LA2A 1H4GA 1H9PA 3AXDA 3AMMA 4P9JA 4QPGC 1AYN3 1RTVA 2XJUA 5AFEA 2JEMA 3IN9A 4E4SA 4FXGB 2UWCA 1ZVFA 4XYXA 2VQAA 2WWSA 5CVRA 5ACA2 3L9JT 3MEPA 1AR73 5AVAA 5H9RA 2CYFA 4YNIA 5C9AC 4JGYC 5JZGC 3LZZA 4Q4V1 2D5FA 2DVBA 4CEYB 2RM22 1POV3 2XJRA 5DG2A 4LO5B 1X8EA 2R073 1JXNA 2K0GA 3ZFGA 2FMDA 1K5MC 4YVSC 1OQ1A 4MH0E 3K48A 3WR0A 1DQ6A 1J1TA 4HN0A 3H3UA 3Q9OA 4HLTA 3RPQA 5I8SA 4LBJA 2UURA 4PCRA 3W59A 1BCXA 4GIQA 1YJLA 4L8QA 4GB32 4Y20A 3CJXA 1EAH2 2VVFA 5FMOS 2N7GA 2ZHLA 1G6NA 3KZ4C 5BNPC 3GF6A 2CGNA 3ELNA 2DVGA 3GBGA 2IC1A 1UMZA 4Q4Y1 5HI0A 3TAYA 3KS7A 1VAMA 1LOCA 1QOOA 2CAVA 4AGVA 5J7MA 4Y4YA 3AX4A 3GNEA 1FNZA 2W68A 4KG8A 1RUH1 1PGW1 1IQAA 2EAKA 4CDXB 1SLAA 4U2AA 3JCIA 4TWTA 3WD5A 3KQRA 4N53B 4XFHA 1QKQA 5GLWA 2GAUA 4EN7B 1AYN2 1B09A 1MACA 3PMEA 2YROA 5T50A 1XE7A 4Z1VA 5D1IA 4XFAA 1RVF2 2ARBA 1XNKA 2VGDA 5DZGA 2PYTA 4RHV3 4N7UA 5A3MA 4PLNA 2D98A 2WINB 4LBOA 4G3YC 4B29A 4Y22B 3H50A 1GZ9A 2B9UA 2IXJA 1QMJA 4TSVA 4QPGA 5ABJB 4QD2A 3K51A 2MHFA 2ZX4A 1RUI2 2PHXA 3FLTA 2WLPA 3VBRB 1SBEA 4XDQA 2B46X 2HWD3 3R05A 4CDWB 3HMYA 1YNAA 1HV0A 3E97A 2LM3A 3NO8A 4Y1XA 5C9AA 4JGYA 4DOUA 2PAMA 3AKQA 3SLIA 1MS0A 2JG9C 1MZFA 4LO7A 4D3WA 4L9BA 3AYEA 5LRRA 1CAXB 1N1VA 2WS91 1ND2A 1MEC1 3SH3A 1LRHA 4FTBA 4N9HA 1PO11 1COV3 3ZFEC 4B4PA 1CAUA 5BNOC 3V0BB 2UY8A 3USSA 4M3CF 2JE7A 4XTMA 1G9CA 1PZ7A 2A6VA 4KBBA 5A3LA 5J37A 2XVGA 4SBVA 3HBZA 2PTMA 1PVXA 1SBDA 4FPHA 3MICA 1J59A 4AQ6A 2V09A 1TME2 2LALA 2XHKA 1W6OA 2XJSA 4WVMA 4FPLA 2XG3A 4V1PA 2XH6A 1X50A 3DKWA 2WFPA 3WV6A 5CFDC 3LA7A 4W6WA 1CONA 1RC6A 1M06G 1EV13 2WZPP 2TNFA 3VKOA 1FMD3 3KGZA 3GALA 3MLLA 3J8F1 1KJLA 5FRAA 2GC3A 3MLKA 3FLPA 4RR3B 1O3RA 4Y1VA 2EIGA 2VNRA 1ZBE1 4YYOA 2VU9A 2EF6A 2OZJA 4HETA 3NV1A 1D2QA 3TN93 2WT0A 1PM7A 3LWCA 2YY1A 2HWD2 1QQP1 3HT1A 1TMF1 4JC1A 4Z2WA 4XBNA 4AEDC 1VRH1 4XQDA 3B93A 1W6MB 3VBFC 4YG6A 3AJYA 4R9CA 1J58A 2NQYA 2ZX3A 1WD3A 3DN7A 5A32B 1YHFA 1PK6B 1GYKA 4NPRA 5KHGA 1FV3A 4AGRA 1JHNA 4FQ4A 2WQ4A 1RJ7A 4COVA 4I0AA 3I59A 1VAVA 1H1MA 1GNZA 2D3PA 4AYUA 1RUF1 1FT9A 4EN6B 2ZZQA 5EYYA 1C8NA 1RUD3 2JDZA 3IIAA 1C8M1 2DVDA 2R32A 4AHYA 2I2SA 1QDCA 3RSJA 2XLAA 2PHFA 3G6JB 4IERA 1VBC2 4AI8A 5F6LB 1RUE1 5K8SA 5B2GB 2WLQA 2BEOA 2WZR2 3ZFEA 5BYNA 1S0GA 1H1IA 4LT5A 3M7AA 3VZMA 2P3JA 2HWF1 4OHVA 3WDXA 5BNOA 4XFFA 5HCBA 3WDVA 4E27A 4FSJA 3OJBA 1ASJ1 1RUH3 1AZDA 4JRAA 1EV12 3S30A 3M3QA 2MEV2 1I3HA 4FPKA 5DDJ1 1TQ5A 2C1FA 3VV1A 5IK8A 3VUOA 4COZA 1DDLA 4RS5C 2HWE1 1RUNA 5KXEA 1OPOA 1DGRN 1MS1A 1SBFA 2WNVA 3N7KA 1REFA 3U07A 5CFDA 3NKTA 4Q2FA 5DZFA 3EO6A 1S0JA 3VZLA 2F6BA 1EP0A 4Q4V2 1DZTA 2D93A 2G4IA 2NZ9A 4GXLA 5T54A 4IL7A 3J26N 5HCAA 5JR7B 3UKNA 2JG8B 3EQEA 3ZXEA 4ATEA 3UK9A 2XKOA 1IKPA 4DXZA 1OKQA 3PMSA 3N36A 3WXPA 1VBE1 1H8TC 4IEOA 3TWIA 4AQTA 4C0BA 4XQWA 2CWSA 1GNHA 5FBZA 4Y5Z0 3B02A 1JTZX 4PBPA 2QQPA 5EWSA 4P9LA 2ET1A 4E4DX 2WS93 1MEC3 1MQTA 2RMU1 4M3CE 2D3RA 2PA7A 3AM2A 1CAWA 1PO13 1ZM1A 4PLMA 5FOBB 4LBKA 4Q4Y2 3RS6A 1OOPC 5C8CC 2ZKLA 3WQ7A 2E9QA 4CYDA 4FBFA 4P9WA 4W65A 5FLHA 1PGW2 2GC0A 4FOVA 3WINE 1H30A 2EVXA 1WBLA 3WG1A 2R063 2H0VA 3BALA 2ILMA 3POYA 1WLDA 4HK9A 2DCTA 1PGSA 4M00A 3J9SA 4YW4A 1UIJA 4FPYA 1H4HA 4L2NA 3WT3A 1FV2A 4IEWA 5CBLA 3C2UA 2UWBA 1DU3D 4K1ZA 4FAGA 2O1QA 2GNBA 2QZ3A 1W0PA 3ROUA 1GZWB 5E8AA 5H9QA 1RJ8A 3J8F3 1Z0HA 4AVAA 2WFF2 1OLRA 4BCUA 1AJKA 2BQPA 2IXLA 4HMZA 4HKWA 5JIUA 1NQJA 4Q0VA 4RS5A 4UXAA 1ZBE3 1HLCA 3VZNA 3AXEA 3ZYRA 3NSTA 3ZYGA 2GNTA 1QQP3 4HSJA 2GSYA 2IXKA 1VRH3 1LHOA 2A73B 2YDEA 1B35C 3VDDC 1V9U1 1VBB2 3DF0A 2C5DA 3D8CA 2D6KA 4IESA 4MV2A 1G9AA 4Q0SA 5ACA1 3B3QE 5C4WB 4F83A 4Z92B 3ZXLA 1U5YA 3ZFFC 2WS92 3OBRA 4COYA 3ZYIB 1FX5A 1I6XA 2R041 2VMHA 2RM21 4DY3A 1VJ2A 4OUSA 1LU1A 2VVEA 1Y43B 3BODA 1HRI1 1C8M3 1N1TA 3QCWA 5TSWA 3QH7A 4BWOA 1U5IA 3SH4A 1WMDA 4CDXA 4YSFA 3PHMA 3ST7A 1RUE3 1F5FA 2EXKA 4JTOA 2ZTNA 3THPA 1R1ZA 3S7IA 1AL0G 2AREA 2RS33 4GB31 3AP4A 4Q8KA 2HWF3 1NA1C 2H6BA 5C8CA 1S1AA 5BNQA 1NCRB 1Q43A 2JD4A 4KGGA 4WZFA 5L7OB 5CG9A 4N90A 1S0DA 1C3HA 3J8F2 4M0NA 4AHXA 1PNGA 3R4DB 4MYEA 2P2KA 4XJZA 3DGTA 4KH9A 2HWE3 5GALA 1ZBE2 4OHZA 4QHBA 5J09A 5I8TA 4LTAA 3CJIC 1UN1A 2C9AA 2VG9A 1PZ9A 5I8YA 1QH6A 4WBBA 1QQP2 1D4VB 2X5IC 2JECA 1TMF2 1IS3A 1RHI1 3VBRA 2D40A 2BNOA 4CDWA 4ASMB 3ZXAC 5BUVA 4G9SB 4RL7A 1RGSA 3DPRC 1MZ6A 4FOWA 1PHMA 2G9FA 3D0JA 3MIHA 3OD4A 1N3PA 1RVF1 3T1MA 2P3IA 2XL7A 4X6QB 1HW5A 1LB2A 2YGMA 3GBWA 1FNYA 4A7KA 3HWJA 1VBE3 4OVEA 3AFGA 1GZCA 1RUF2 2WSVA 4HANA 4Y1UA 3JD71 4OULA 5JSOA 1B35A 1VBA1 3AYAA 3VDDA 3ZSJA 3MW4A 1RUI1 3H8UA 4Q1PA 3ECQA 4FOYA 4OLLA 2R1BA 3ZXGA 4QQOA 3WX5A 3ILRA 4XTPA 1RUE2 3ZFFA 5J36A 4NWVA 1Q5OA 3JBG2 4IETA 5JLVA 1GSLA 3VLBB 4IEXA 5D8AC 5H9PA 3OD0A 5FCCA 1RUOA 2G9GA 1W6PA 3NWKA 4KU7A 3SHRA 2ET7A 1ASJ2 4N7IA 2XL9A 2XPJA 1WW7A 1VLNA 5DDJ2 1XNDA 2ZHKA 4PDWB 3AZWA 1WMFA 5K0UC 4BZ4A 4A3XA 3AMNA 2HWE2 1UIKA 2YMZA 1MVEA 3DL3A 4FXKB 4Q0QA 3RG0A 2A75A 1EY2A 4QPYA 4YARA 4QPIC 5T52A 1A8MA 4N43C 4E2GA 2ZX0A 3N4MA 2WL1A 3HN1A 4IEZA 3P3PA 4CDQB 1TME1 3CO2A 3B9CA 5FOJB 3AYDA 1OFNA 2E6VA 3VKMA 3VL8A 4MGZE 5JOZA 1WA4A 3I4IA 3PVBB 4R9BA 3ETQA 5A32A 2PHUA 3CJIA 1KFXL 1KS4A 1QJY3 3R4SA 1VBE2 1V6LA 1MS4A 4URTA 4QM9A 3SCFA 3PNAA 4Q4X1 5EXOA 3JU9A 4EWEA 3ZFGC 3LA3A 5E89A 2JXAA 4A7ZA 3FFZA 4JDOA 2DYCA 3D4KA 3EHKA 5ACA3 2XBO1 2PQQA 1H8VA 3ZN6B 4AW7A 1TEIA 2RMU2 1JN2P 3AKPA 2AZ5A 2R043 1QU0A 2RM23 4Z82A 1U5XA 2BBVA 1J3RA 2EXHA 3NW4A 4BLJA 1IHMA 3BIWE 3M3EA 2NP0A 1N1YA 1HRI3 3NL1A 1NXD1 3NV4A 3OTFA 1DIWA 3AMHA 2D6PA 4WM8C 4QXKA 2P37A 2YV8A 5BXXA 5I93A 4GH4B 1JW6A 2DUOA 4Q27A 4XF3A 1Q8PA 1ZNPA 5A33A 1HX6A 1FPN2 5KC5A 3SCHA 4YM2A 3ZMNA 1SLCA 4OHYA 2ZGPA 2XJQA 5GZCA 4GB33 5D8AA 1EAH3 1VBC1 1IS6A 3WP3A 1F9KA 3WQ0A 1QJU1 1HQNA 3WCSA 4EN8B 2ETEA 3KSCA 3LSDA 3HIFA 5K0UA 5JPMB 3ILFA 4AXOA 1AYM2 3AZVA 3FHIB 3NVCA 4C91A 3AFKA 5L19A 2MEV1 3E5QA 1DGWA 3VBSB 4JVAA 4I3GA 4JGZB 4N43A 1LECA 3UJQA 4D7YA 1LJ7A 3WHTA 1QJX2 4J1XA 2ZX2A 1LGNA 3B5LB 1V9U2 2GNDA 4GQ7A 4L99A 1RVF3 1RUG1 4R9DA 3S7EA 4JDMA 3SCGA 2YPJA 5T5JA 2XGXA 2QE3A 4NVPA 3H1MA 4L97A 3FE5A 1O3SA 2DTYA 4LLFA 2R042 1FAYA 4C0HA 5CFCB 3H1WA 1C5HA 4H7LA 1EPZA 3BPZA 1V6MA 1AUYA 2ZA9A 1DFQA 1QHDA 1DQ4A 1ND2C 2OVUA 2JENA 1VBA3 2ZCWA 1HRI2 1GICA 1RUI3 4B4RA 1MS9A 2FQPA 2ATFA 4O9GA 3LB9A 2Q30A 4YGCA 5DUUA 3S0MA 1DLLA 4XMIA 3OF1A 1LU2A 4YG0A 4BA6A 5FO8B 1G8WA 1HQWA 1LHUA 3WCRA 2HWC1 4QM8A 2VVDA 4K3UA 1KS5A 3KMHA 5BNNC