1LCVA

Streptavidin-norbiotin complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
121
Chain Sequence
b'AGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords streptavidin
publication title Ligand exchange between proteins: exchange of biotin and biotin derivatives between avidin and streptavidin
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Unknown function
total genus 27
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1lcvA00
4BCSA 1HY2A 2RTBB 1SRGA 1PTSA 1Y53X 2BC3A 3RDMA 4GDAA 4CPFA 1VWQB 1SWPA 3RDUA 2IZEB 4DNEA 3SZIA 5B5GA 1SRHA 1MOYA 1SWAA 1SWEA 1SWOA 2AVIA 3WZOA 1HXLA 1SWKA 1VWCB 1VWIB 1N9MA 2Y3EA 2UYWA 1N4JA 2QCBA 2RTHB 1SLFB 1STPA 2RTIB 4BX6B 4GGTA 1KL5A 1NQMA 1NBXA 4I60A 3T2XA 5B5FA 1LDQA 3SZHA 3VGWA 1SWLA 2C1QA 3SZJA 4EKVA 4BJ8A 2C1SA 1MK5A 3WYPA 3T6LA 1VWAB 1NC9A 3T2WA 1MEPA 1SLGB 1VYOA 1RXHA 4GGZA 2MF6A 1VWFB 1Y52X 3WZNA 2IZCB 1DF8A 4Z28A 3VHIA 4Z2VA 1SLEB 2IZKA 4Z6JA 3RE6A 2CAMA 2IZDB 1SWTA 1KL3A 2OFBA 1RXJA 3EW1A 3RDQA 1VWMB 4GJSA 1SRIA 1RSTB 1SWFA 2UZ2A 2C4IA 4CPHB 1RXKA 2OF9A 3EW2A 5CSEA 1LCVA 1HXZA 3RDXA 2RTJA 1SWSA 3MG5A 1VWEB 3RE5A 1MM9A 2A5BA 2GH7A 1SWBA 1VWDB 3WYQA 1I9HA 2OF8A 1WBIA 1AVEA 1SWHA 2RTKA 4IRWA 2FHLA 1SLDB 2Y32A 3VHMA 1IJ8A 4JHQA 4Z27A 1SWCA 1VWLB 2RTMA 3MM0A 2IZFB 2IZGB 2OFAA 3RDOA 1SRJA 2IZBA 5IRWA 2RTAA 2WPUA 1VWJB 1LELA 2A8GA 3FDCA 1N9YA 5IRAA 4GD9A 4BX5A 1VWBB 1LDOA 2F01A 1HQQA 4CPIA 4Z2OA 1SWGA 3WZPA 4JNJA 4OKAA 4BBOA 2JGSA 1VWHB 2IZHB 2FHNX 5K68A 1NQNA 4CPEA 4CPHA 2IZIA 1VWRB 1VWKB 2RTCB 2G5LA 2IZLB 1KFFA 3T6FA 2Y3FA 4BX5B 1LCWA 1RSUB 1SWDA 4BX7A 1SWQA 2RTLA 5L3YA 3PK2A 1SWRA 1SWNA 2IZJA 1LUQA 2A5CA 2RTNB 4Y5DA 2RTPB 4Z2PA 4U46A 1KL4A 4GGRA 5JD2A 1LCZA 1VWOB 2RTQB 1NDJA 1STSB 3WZQA 4YVBA 1VWGB 2RTOB 2RTGB 4JO6A 1SREA 5IRUA 2IZAA 1STRB 2RTDB 4GJVA 2RTEB 2RTRB 2ZSCA 1SWUA 1RAVA 1SRFA 1VWPB 1Y55X 2RTFB 5CHKA 1SWJA 5F2BA 3RY1A 3VHHA 1AVDA 1N7YA 4Y59A 3RY2A 4BX6A 1VWNB 1N43A 3RDSA 3X00A 5K67A 4BX7B
chains in the Genus database with same CATH superfamily
3BSZE 3K3LA 4O4SA 4I3BA 1P6PA 1NP4A 3PECA 1Y53X 3VG2A 4IB9A 2MO5A 3E3CA 2AH7X 2XKLA 1JMXA 1CJ5A 2VFBA 2G78A 3STMX 4DNEA 5K06A 4AW8A 1BEBA 2FS7A 4GRJA 1LIDA 3WJCA 1MUPA 2ASNX 3WZOA 3WJBA 1S44A 4U3QA 1FJ1E 2PI3O 2Y3EA 1N9MA 4ZHHA 2QCBA 4K19A 2M4LA 2WEWA 4BX6B 1DZKA 2WWPA 1RBPA 3FIDA 4I60A 5KIDA 1LDQA 1K24A 3VGWA 4AZQA 4BJ8A 4A60A 4YMYA 1KZWA 3WYPA 1YWCA 4CDDA 1VWAB 1NC9A 1HN2A 1NP1A 3C78X 1MEPA 2KTSA 2JN3A 4GNWA 2FKGA 1UYOX 5HZ5A 1SXWA 1EQDA 1W4TA 2A3FX 1QABE 1EUOA 3FR4A 3ZW0B 5KHPA 2HLVA 2HNXA 1BWYA 4TQ2A 4Z28A 3ZW1B 1ADLA 1HMRA 2ZAIA 5F6ZA 1FE3A 2RA6A 3EBKA 1KT7A 4EFGA 2CAMA 2OFBA 1KL3A 3FMZA 2WSJA 3B2LA 5B27A 3VE1A 1RXJA 5AEOA 4EXZA 4ORWA 1VWMB 2OY8A 3CBSA 1L6MA 1Y9TA 3FA9A 1SRIA 1RSTB 1SWFA 4BQUA 1IKJA 1RXKA 2BS6A 2AT5X 3EW2A 3FA6A 4TKJA 4YGGA 2LBVA 1SWSA 1VWEB 1PM1X 2OYBO 3RE6A 1CBIA 2AT0X 2GH7A 4N7CA 1G7NA 2X4MA 2OF8A 3VG7A 3FR5A 3HWEA 3VG5A 4U8UO 1CBRA 4KT5A 2HMBA 1JZUA 4DQ3A 5AQ6A 4JGLA 1OEEA 1HBPA 2O62A 3DSZA 4XMCA 4YGHA 5FQ8E 2MM3A 4RUUA 1SRJA 4BGFA 2AT8X 2G7BA 3HWFA 2W2FA 2VDFA 2GTLN 4I3DA 4BX5A 1GT3A 4IBAA 2E4JA 3PQSA 1YWAA 5LJBA 4LKTA 3D96A 1DZPA 4CPIA 1HQQA 1KT4A 1E06A 2OFMX 3IA8A 3NQ3A 3BY0A 3O2YA 2HZQA 2L67A 4A1HA 5LKEA 4FBRA 4PJ2A 4LZUA 3EBWA 4OKAA 2AF5A 5DPQA 5B3MO 1BM5A 3WJFA 5IO7A 1VWHB 3STNA 2JU8A 3Q34A 1LF7A 1UZ2X 2FHNX 2RD7C 1HQPA 3TGCA 4O9SA 4IB7A 2NNEA 3N91A 4YCHA 5AJCA 1T0VA 3L4RA 4NNSA 1VWKB 3NQKA 4O4UA 3UEWA 3WVMA 5H9AA 2IZLB 1ZNLA 4IMOA 4NLJA 2N93A 1KT3A 1LCWA 4XMGA 5EPQA 1H91A 4R0BA 2A2GA 2KT4B 2RTLA 4NYRA 3ZUIA 5LJHA 4YKOA 3SAOA 5EEEA 1O1UA 4OMWA 1IIUA 4U46A 3VPJE 5H9LA 1LCZA 2HYSA 2RTQB 1NDJA 1EXSA 1VWGB 2FS6A 1E2TA 2L68A 2RTOB 5D4AA 3TGBA 1IKEA 2RTEB 5CHKA 5F2BA 2POAA 1JV4A 2GTFX 2RTFB 5DG4A 4TJZA 4ZHCA 4GH7A 3BRNA 1U17A 1U0XA 1N43A 3D95A 3NP1A 4Y0QA 4BCSA 1HY2A 4CDCA 5AJBA 3UEUA 2RTBB 3ZZVA 1SRGA 1SXYA 3NR3A 4CV7A 3RDMA 3FYFA 1A3YA 1KOIA 2R56A 4MVKA 4GZVA 3P6FA 1VWQB 3S26A 3RZYA 2NNDA 2NP1A 3JQOA 3BLGA 1JBHA 5HZQA 1MX8A 1MOYA 3OD9A 5BVSA 4I9RA 1KZXA 1YP7A 3P24A 4QZTA 1MX7A 1HXLA 1ICNA 1VPRA 2QO6A 3ELXA 4WBKA 2JW1A 4WFUA 1VWIB 2FT9A 3CR6A 2UYWA 1R0UA 1N4JA 5B2AO 1DC9A 1SLFB 2OY7A 1AB0A 3SLOA 4ZFXA 5L8OA 3T2XA 1X8PA 2K23A 4L3RA 3SZHA 5HZ9A 2JU7A 3HPEA 4A8ZA 5B11O 3T2WA 3WJGA 4ORSA 1BRPA 1LIFA 5CYBA 4KC7A 1AQBA 2MF6A 2X34A 3LHNA 5FFHA 4IB8A 3FR2A 3FW4A 3LTWA 3VHIA 4Z2VA 3CQNA 3H3IA 2Q9SA 3ZI8A 4KH8A 1A18A 1KGLA 2L9CA 3AUMO 3EM0A 4GK9A 4UU2A 4U8UM 1U18A 4CSBA 1LNMA 2UZ2A 3RKGA 2OF9A 4OMXA 2LKKA 2OL7A 1HXZA 1UYNX 4ID2A 3MG5A 1CRBA 4O49A 4ORUA 2FTBA 1G5WA 3RE5A 4EEJA 1T68X 1VWDB 1GGLA 1QY0A 1HMSA 1GM6A 4NYQA 5EZ2A 4NNTA 4IRWA 4AYHA 2Y32A 3VHMA 2HKDA 5FENA 3D4RA 1T8VA 1SWCA 2QMIA 1SY0A 1QY1A 1SXXA 2GJ5A 3G7XA 3MM0A 4ARHA 2GC9A 1GKAA 3NX1A 3GE2A 2IZBA 4ORYA 2WPUA 3RSWA 3UEVA 3EMMA 2WQ9A 3NADA 3RBYA 4D6BA 4D6AA 1DF3A 2BLGA 3S60A 3NBXX 4GD9A 4CDFA 3FELA 1B0OA 5HTEA 3HTYA 5B10O 1FELA 1VWBB 5BVTA 3C76X 2X8FA 4GE1A 5HCEC 3Q6LA 2IFBA 2LB6A 1FDQA 1O1VA 2RQ0A 4XMFA 1QG5A 4CDEA 4QGXA 1I78A 2W2BA 2GTLO 1K3BA 2LA7A 1QWDA 1Y0GA 3D9WA 3F8AA 1EIIA 2JGSA 4M7MA 1PMPA 1OBPA 1LKEA 4O3WA 4O3YA 1OBUA 4CPHA 1KT5A 2MWHA 4HFOA 1D3SA 1A57A 1YWBA 1SA8A 5HCCC 2FR2A 3U0DA 5IO5A 3U03A 4BX5B 1JQPA 1JYDA 4QRLA 5L8NA 3ZUOA 3P6DA 1EPBA 3KVNA 4RUNA 4Z2PA 2RTNB 1KQWA 3KZAA 4IAWA 2RTPB 1ZNGA 3B2KA 4HPBA 1KL4A 2R73A 1SXUA 3B2IA 2X8TA 2VFCA 5D48A 1VWOB 2L5PA 5JD2A 2A0AA 1DV9A 3CKGA 1EPAA 2BSZA 3WZQA 2AMMX 1YP6A 4CK4A 4IB6A 2PY1A 4YDBA 1STRB 2MHDA 3EYCA 1ZNEA 1VWPB 1SRFA 3APUA 3RY1A 4AZRA 4KC8A 3CKFA 2X8SA 4Y59A 3RY2A 1MVGA 1VWNB 4M6SA 2CBSA 3FLLA 1YWDA 2MJIA 3PDFA 4ES7A 4ZCBA 4TKHA 1S7DA 4COTA 4EQAC 4ZGFA 1A2DA 1X8NA 4ORXA 5F1EA 1PTSA 2BC3A 2BHVA 5H8TA 3TF6A 3F6ZB 1X89A 1ICMA 5L8IA 2ACOA 4NP1A 2IZEB 4GUZA 3RDUA 4CPFA 1S2PA 4FBVA 1SWAA 2YMSA 3I17A 3UAQA 3FA7A 4YGZA 1W6FA 1CBSA 1I4UA 1QFVA 1GT5A 1ZNDA 3HWGA 5IO6A 1DFVA 2JU3A 3AKMA 1LIBA 4MVEA 5D47A 2OY5O 1KQXA 4GGTA 1KL5A 2A13A 5B5FA 1X8OA 5LJGA 2P8GA 2FRSA 3RWXA 1SWLA 2C1QA 3SZJA 2FKJA 1GX3A 2LBAA 5LJEA 1PBOA 3HK1A 1EALA 2X46A 2X32A 2WQAE 2OL8O 3WJEA 1LFOA 2ACPX 1SLGB 2Q4NA 4GGZA 3SLTA 2R74A 1IFBA 4FQBB 4OELA 3WZNA 2IZCB 3I0AA 1DF8A 2DJFA 4O4XA 3EC5A 2IZKA 3APXA 4GU8A 4OS3A 3UEXA 3BDRA 3VG4A 1X71A 1N0SA 2ZAGA 5LKFA 5HA0A 1OSPO 1PEEA 3TGAA 1HMTA 3SOTA 1TOUA 2I5ZO 2KD2A 2JOZA 4GNYA 4QQ1A 3RDQA 4NW4A 1YUPA 1PBYA 5HA1A 4N7DA 4QGWA 3CQRA 1RLBE 3RDXA 2RTJA 1G85A 1OBQA 5H9KA 1MM9A 5H9NA 1AVEA 2X45A 1JIWI 1LIEA 2FHLA 1SLDB 3BU1A 1ML7A 3PPTA 1IJ8A 3KQ0A 3MVFA 2QO5A 4JHQA 5EEDA 1LICA 4Z27A 4L1NA 1ERXA 1VWLB 2RTMA 3APVA 3T1DA 1ZRYA 2OFAA 4O3ZA 3RDOA 5HWZA 2WUTA 1LPJA 4O3XB 1VYGA 4ZHGA 2GTLM 3NX2A 1Z24A 2RTAA 3P6CA 1LELA 2A8GA 4GKCA 4WFVA 1I05A 4Y0SA 1KT6A 1QY2A 3JSQA 3OE3A 4TKBA 2X56A 2CM9A 1TVQA 2F01A 4XMEA 4Y0RA 4Z2OA 2CBRA 3VG6A 3WXQA 3KFFA 3WZPA 4U9CA 4IABA 4QGVA 2EU7X 4BBOA 3HWDA 1EIOA 1BSQA 4Y0PA 3P6EA 4YFQA 5K68A 5FQ6E 4LQZA 2CZTA 4MVIA 1BJ7A 1GKAB 3WOVA 2IZIA 4ZHFA 1VWRB 5HCDC 2RTCB 1G74A 1FENA 2G5LA 2Z4IA 3KFIA 1IFCA 1KFFA 2FWVA 3T6FA 4AZMA 4BX7A 3APWA 4OS8A 3VG3A 1VYFA 4XMHA 2OVDA 3STKA 3ZQ3A 4I3CA 3SLJA 1B8EA 1SWRA 1SWNA 1LUQA 1DZMA 2A5CA 2CM4A 3LV4A 4Y5DA 5IRWA 1OEJA 1W5RA 2RCQA 2W2AA 2Q39A 2OVAA 5HAEA 4YBPA 1GT4A 1STSB 1CBQA 4YVBA 1TOWA 3CBCA 3S5VA 1XCAA 1KXOA 4JO6A 4WHIA 3O22A 1BLRA 2RTDB 3S5XA 5IXGA 2RTRB 4CPHB 2KW1A 1Y55X 3F9DA 3VU1A 1SWJA 1TXLA 4ZH6A 1N7YA 1OPBA 1O8VA 2OL6O 4BX6A 5K67A 3KFGA 1GX9A 4BOEA 2QOMA 4GDZA 3AKNA 3BX7A 3QKGA 4GDAA 1JJXA 3V8UA 1SWPA 1JJUA 1EW3A 1I06A 2AKQA 3ZW0A 3SZIA 1BSYA 5B5GA 2G79A 1SRHA 1B4MA 1SWEA 1SWOA 2AVIA 2KTDA 3B2JA 5FQ7E 3ZW1A 4EDEA 1NGLA 1SWKA 4ZGUA 1VWCB 3OJYC 1E02A 3P6HA 2DJGA 1GT1A 4IAXA 4NV8A 5D8JA 2RTHB 1YIVA 1JMZA 1STPA 1WUBA 2RTIB 3HOLA 3PP6A 4FBOA 4ZJ0A 1NQMA 1NBXA 4YFPA 2YG2A 1BSOA 3PQUA 1EI5A 4TNNA 4EKVA 4YDAA 2C1SA 1MK5A 2I5VO 3T6LA 5FAZA 4B55A 3WJDA 2NNQA 1VYOA 1XKIA 1RXHA 3B2HA 4ALBA 4ALOA 1VWFB 3WBGA 1Y52X 4AZNA 1QQSA 5B29A 2WR6A 3GAQA 4ORRA 1SLEB 4PSQA 1JJJA 1E5PA 3OBLA 4YBUA 4Z6JA 1I04A 4O4OA 1AELA 1D2UA 2OZQA 1GX8A 2IZDB 1SWTA 3HOEA 4ON1A 1ZNKA 1TW4A 3FEKA 4MEEA 3EW1A 2AT3X 1JYJA 5LJKA 4NLIA 1X8UA 4GJSA 1SMPI 2DM5A 4U8UN 3PEDA 2C4IA 5F6BA 4XMDA 4ZH9A 5CE4A 5CSEA 1LCVA 2Q2MA 4QYNA 4C5PA 4YH0A 1GXAA 4LKPA 1OPAA 2A5BA 1SWBA 5BYPA 3WYQA 1I9HA 1FEMA 1WBIA 1B56A 2G8CO 2QM9A 1SWHA 2QO4A 2RTKA 5F7GA 4ZHDA 5JR8A 1FTPA 4ML7B 4MIRA 4QAEA 5HZ6A 5HZ8A 2K62A 2IZFB 1SY2A 2IZGB 2Q2PA 4I6SA 4AZPA 5HTDA 2AT6X 4TLJA 3NPOA 4A1YA 3CWKA 4LZVA 1VWJB 5F58A 3BU9A 3FDCA 1N9YA 5HBSA 5IRAA 3IFBA 4QNIA 4MISA 2HZRA 1BBPA 1MDCA 4OEMA 1LDOA 4FGIB 1UREA 3NQ9A 5LJCA 3FW5A 1SWGA 2ALLX 4BVMA 4KIIA 1ALBA 4JNJA 3FEPA 3P6GA 1X8QA 3ZWEA 1ACDA 1HBQA 3MX7A 2FR3A 2IZHB 3C77X 5D45A 3ZW2A 2ANSA 4OS0A 4INNA 2OFRX 4HWMA 4YFRA 1NQNA 4CPEA 1OEKA 4IMNA 1ZNHA 3BS2A 1E00A 3DTQA 4QYPA 1IW2A 2OVSA 4KCAA 4AZOA 1SY3A 2XSTA 4I95A 2BT9A 4YCEA 4DQ4A 3ELZA 3PH5A 1SY1A 2FLJA 1AVGI 2Y3FA 3D97A 1RSUB 1SWDA 3TZSA 1SWQA 1DZJA 3PH6A 3O19A 5L3YA 3PK2A 3AEHA 3BX8A 4HPDA 1QFTA 2IZJA 4GETA 3KFHA 3MBTA 3P02A 2A2UA 4HPAA 4I9SA 2F73A 4MVLA 5EDBA 2RN4A 5KICA 1ERBA 2WEXA 2X55A 4GGRA 3FA8A 1BRQA 1Y9LA 2LFOA 3CMPA 2CZUA 3QQ2A 2OY1O 2QOSC 2RTGB 5BVQA 1SREA 4ZR2A 5IRUA 2IZAA 5LJDA 2BS5A 4GJVA 2RCTA 2Z4HA 4ODDA 4UU3A 2AL0X 2JMBA 1SWUA 1RAVA 2ZSCA 2F09A 3JS1A 4QZUA 3VHHA 4NV7A 3VE2A 3U9PC 1AVDA 3FENA 3FIQA 2OVEA 5C0NA 4HPCA 4YKMA 3RDSA 3X00A 4DCBA 5EDCA 2FGSA 4BX7B
chains in the Genus database with same CATH topology
4BCSA 1HY2A 2RTBB 1SRGA 1PTSA 1Y53X 2BC3A 3RDMA 4GDAA 4CPFA 1VWQB 1SWPA 3RDUA 2IZEB 4DNEA 3SZIA 5B5GA 1SRHA 1MOYA 1SWAA 1SWEA 1SWOA 2AVIA 3WZOA 1HXLA 1SWKA 1VWCB 1VWIB 1N9MA 2Y3EA 2UYWA 1N4JA 2QCBA 2RTHB 1SLFB 1STPA 2RTIB 4BX6B 4GGTA 1KL5A 1NQMA 1NBXA 4I60A 3T2XA 5B5FA 1LDQA 3SZHA 3VGWA 1SWLA 2C1QA 3SZJA 4EKVA 4BJ8A 2C1SA 1MK5A 3WYPA 3T6LA 1VWAB 1NC9A 3T2WA 1MEPA 1SLGB 1VYOA 1RXHA 4GGZA 2MF6A 1VWFB 1Y52X 3WZNA 2IZCB 1DF8A 4Z28A 3VHIA 4Z2VA 1SLEB 2IZKA 4Z6JA 3RE6A 2CAMA 2IZDB 1SWTA 1KL3A 2OFBA 1RXJA 3EW1A 3RDQA 1VWMB 4GJSA 1SRIA 1RSTB 1SWFA 2UZ2A 2C4IA 4CPHB 1RXKA 2OF9A 3EW2A 5CSEA 1LCVA 1HXZA 3RDXA 2RTJA 1SWSA 3MG5A 1VWEB 3RE5A 1MM9A 2A5BA 2GH7A 1SWBA 1VWDB 3WYQA 1I9HA 2OF8A 1WBIA 1AVEA 1SWHA 2RTKA 4IRWA 2FHLA 1SLDB 2Y32A 3VHMA 1IJ8A 4JHQA 4Z27A 1SWCA 1VWLB 2RTMA 3MM0A 2IZFB 2IZGB 2OFAA 3RDOA 1SRJA 2IZBA 5IRWA 2RTAA 2WPUA 1VWJB 1LELA 2A8GA 3FDCA 1N9YA 5IRAA 4GD9A 4BX5A 1VWBB 1LDOA 2F01A 1HQQA 4CPIA 4Z2OA 1SWGA 3WZPA 4JNJA 4OKAA 4BBOA 2JGSA 1VWHB 2IZHB 2FHNX 5K68A 1NQNA 4CPEA 4CPHA 2IZIA 1VWRB 1VWKB 2RTCB 2G5LA 2IZLB 1KFFA 3T6FA 2Y3FA 4BX5B 1LCWA 1RSUB 1SWDA 4BX7A 1SWQA 2RTLA 5L3YA 3PK2A 1SWRA 1SWNA 2IZJA 1LUQA 2A5CA 2RTNB 4Y5DA 2RTPB 4Z2PA 4U46A 1KL4A 4GGRA 5JD2A 1LCZA 1VWOB 2RTQB 1NDJA 1STSB 3WZQA 4YVBA 1VWGB 2RTOB 2RTGB 4JO6A 1SREA 5IRUA 2IZAA 1STRB 2RTDB 4GJVA 2RTEB 2RTRB 2ZSCA 1SWUA 1RAVA 1SRFA 1VWPB 1Y55X 2RTFB 5CHKA 1SWJA 5F2BA 3RY1A 3VHHA 1AVDA 1N7YA 4Y59A 3RY2A 4BX6A 1VWNB 1N43A 3RDSA 3X00A 5K67A 4BX7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BCS A;  1HY2 A;  2RTB B;  1SRG A;  1PTS A;  1Y53 X;  2BC3 A;  3RDM A;  4GDA A;  4CPF A;  1VWQ B;  1SWP A;  3RDU A;  2IZE B;  4DNE A;  3SZI A;  5B5G A;  1SRH A;  1MOY A;  1SWA A;  1SWE A;  1SWO A;  2AVI A;  3WZO A;  1HXL A;  1SWK A;  1VWC B;  1VWI B;  1N9M A;  2Y3E A;  2UYW A;  1N4J A;  2QCB A;  2RTH B;  1SLF B;  1STP A;  2RTI B;  4BX6 B;  4GGT A;  1KL5 A;  1NQM A;  1NBX A;  4I60 A;  3T2X A;  5B5F A;  1LDQ A;  3SZH A;  3VGW A;  1SWL A;  2C1Q A;  3SZJ A;  4EKV A;  4BJ8 A;  2C1S A;  1MK5 A;  3WYP A;  3T6L A;  1VWA B;  1NC9 A;  3T2W A;  1MEP A;  1SLG B;  1VYO A;  1RXH A;  4GGZ A;  2MF6 A;  1VWF B;  1Y52 X;  3WZN A;  2IZC B;  1DF8 A;  4Z28 A;  3VHI A;  4Z2V A;  1SLE B;  2IZK A;  4Z6J A;  3RE6 A;  2CAM A;  2IZD B;  1SWT A;  1KL3 A;  2OFB A;  1RXJ A;  3EW1 A;  3RDQ A;  1VWM B;  4GJS A;  1SRI A;  1RST B;  1SWF A;  2UZ2 A;  2C4I A;  4CPH B;  1RXK A;  2OF9 A;  3EW2 A;  5CSE A;  1LCV A;  1HXZ A;  3RDX A;  2RTJ A;  1SWS A;  3MG5 A;  1VWE B;  3RE5 A;  1MM9 A;  2A5B A;  2GH7 A;  1SWB A;  1VWD B;  3WYQ A;  1I9H A;  2OF8 A;  1WBI A;  1AVE A;  1SWH A;  2RTK A;  4IRW A;  2FHL A;  1SLD B;  2Y32 A;  3VHM A;  1IJ8 A;  4JHQ A;  4Z27 A;  1SWC A;  1VWL B;  2RTM A;  3MM0 A;  2IZF B;  2IZG B;  2OFA A;  3RDO A;  1SRJ A;  2IZB A;  5IRW A;  2RTA A;  2WPU A;  1VWJ B;  1LEL A;  2A8G A;  3FDC A;  1N9Y A;  5IRA A;  4GD9 A;  4BX5 A;  1VWB B;  1LDO A;  2F01 A;  1HQQ A;  4CPI A;  4Z2O A;  1SWG A;  3WZP A;  4JNJ A;  4OKA A;  4BBO A;  2JGS A;  1VWH B;  2IZH B;  2FHN X;  5K68 A;  1NQN A;  4CPE A;  4CPH A;  2IZI A;  1VWR B;  1VWK B;  2RTC B;  2G5L A;  2IZL B;  1KFF A;  3T6F A;  2Y3F A;  4BX5 B;  1LCW A;  1RSU B;  1SWD A;  4BX7 A;  1SWQ A;  2RTL A;  5L3Y A;  3PK2 A;  1SWR A;  1SWN A;  2IZJ A;  1LUQ A;  2A5C A;  2RTN B;  4Y5D A;  2RTP B;  4Z2P A;  4U46 A;  1KL4 A;  4GGR A;  5JD2 A;  1LCZ A;  1VWO B;  2RTQ B;  1NDJ A;  1STS B;  3WZQ A;  4YVB A;  1VWG B;  2RTO B;  2RTG B;  4JO6 A;  1SRE A;  5IRU A;  2IZA A;  1STR B;  2RTD B;  4GJV A;  2RTE B;  2RTR B;  2ZSC A;  1SWU A;  1RAV A;  1SRF A;  1VWP B;  1Y55 X;  2RTF B;  5CHK A;  1SWJ A;  5F2B A;  3RY1 A;  3VHH A;  1AVD A;  1N7Y A;  4Y59 A;  3RY2 A;  4BX6 A;  1VWN B;  1N43 A;  3RDS A;  3X00 A;  5K67 A;  4BX7 B; 
#chains in the Genus database with same CATH topology
 3BSZ E;  3K3L A;  4O4S A;  4I3B A;  1P6P A;  1NP4 A;  3PEC A;  1Y53 X;  3VG2 A;  4IB9 A;  2MO5 A;  3E3C A;  2AH7 X;  2XKL A;  1JMX A;  1CJ5 A;  2VFB A;  2G78 A;  3STM X;  4DNE A;  5K06 A;  4AW8 A;  1BEB A;  2FS7 A;  4GRJ A;  1LID A;  3WJC A;  1MUP A;  2ASN X;  3WZO A;  3WJB A;  1S44 A;  4U3Q A;  1FJ1 E;  2PI3 O;  2Y3E A;  1N9M A;  4ZHH A;  2QCB A;  4K19 A;  2M4L A;  2WEW A;  4BX6 B;  1DZK A;  2WWP A;  1RBP A;  3FID A;  4I60 A;  5KID A;  1LDQ A;  1K24 A;  3VGW A;  4AZQ A;  4BJ8 A;  4A60 A;  4YMY A;  1KZW A;  3WYP A;  1YWC A;  4CDD A;  1VWA B;  1NC9 A;  1HN2 A;  1NP1 A;  3C78 X;  1MEP A;  2KTS A;  2JN3 A;  4GNW A;  2FKG A;  1UYO X;  5HZ5 A;  1SXW A;  1EQD A;  1W4T A;  2A3F X;  1QAB E;  1EUO A;  3FR4 A;  3ZW0 B;  5KHP A;  2HLV A;  2HNX A;  1BWY A;  4TQ2 A;  4Z28 A;  3ZW1 B;  1ADL A;  1HMR A;  2ZAI A;  5F6Z A;  1FE3 A;  2RA6 A;  3EBK A;  1KT7 A;  4EFG A;  2CAM A;  2OFB A;  1KL3 A;  3FMZ A;  2WSJ A;  3B2L A;  5B27 A;  3VE1 A;  1RXJ A;  5AEO A;  4EXZ A;  4ORW A;  1VWM B;  2OY8 A;  3CBS A;  1L6M A;  1Y9T A;  3FA9 A;  1SRI A;  1RST B;  1SWF A;  4BQU A;  1IKJ A;  1RXK A;  2BS6 A;  2AT5 X;  3EW2 A;  3FA6 A;  4TKJ A;  4YGG A;  2LBV A;  1SWS A;  1VWE B;  1PM1 X;  2OYB O;  3RE6 A;  1CBI A;  2AT0 X;  2GH7 A;  4N7C A;  1G7N A;  2X4M A;  2OF8 A;  3VG7 A;  3FR5 A;  3HWE A;  3VG5 A;  4U8U O;  1CBR A;  4KT5 A;  2HMB A;  1JZU A;  4DQ3 A;  5AQ6 A;  4JGL A;  1OEE A;  1HBP A;  2O62 A;  3DSZ A;  4XMC A;  4YGH A;  5FQ8 E;  2MM3 A;  4RUU A;  1SRJ A;  4BGF A;  2AT8 X;  2G7B A;  3HWF A;  2W2F A;  2VDF A;  2GTL N;  4I3D A;  4BX5 A;  1GT3 A;  4IBA A;  2E4J A;  3PQS A;  1YWA A;  5LJB A;  4LKT A;  3D96 A;  1DZP A;  4CPI A;  1HQQ A;  1KT4 A;  1E06 A;  2OFM X;  3IA8 A;  3NQ3 A;  3BY0 A;  3O2Y A;  2HZQ A;  2L67 A;  4A1H A;  5LKE A;  4FBR A;  4PJ2 A;  4LZU A;  3EBW A;  4OKA A;  2AF5 A;  5DPQ A;  5B3M O;  1BM5 A;  3WJF A;  5IO7 A;  1VWH B;  3STN A;  2JU8 A;  3Q34 A;  1LF7 A;  1UZ2 X;  2FHN X;  2RD7 C;  1HQP A;  3TGC A;  4O9S A;  4IB7 A;  2NNE A;  3N91 A;  4YCH A;  5AJC A;  1T0V A;  3L4R A;  4NNS A;  1VWK B;  3NQK A;  4O4U A;  3UEW A;  3WVM A;  5H9A A;  2IZL B;  1ZNL A;  4IMO A;  4NLJ A;  2N93 A;  1KT3 A;  1LCW A;  4XMG A;  5EPQ A;  1H91 A;  4R0B A;  2A2G A;  2KT4 B;  2RTL A;  4NYR A;  3ZUI A;  5LJH A;  4YKO A;  3SAO A;  5EEE A;  1O1U A;  4OMW A;  1IIU A;  4U46 A;  3VPJ E;  5H9L A;  1LCZ A;  2HYS A;  2RTQ B;  1NDJ A;  1EXS A;  1VWG B;  2FS6 A;  1E2T A;  2L68 A;  2RTO B;  5D4A A;  3TGB A;  1IKE A;  2RTE B;  5CHK A;  5F2B A;  2POA A;  1JV4 A;  2GTF X;  2RTF B;  5DG4 A;  4TJZ A;  4ZHC A;  4GH7 A;  3BRN A;  1U17 A;  1U0X A;  1N43 A;  3D95 A;  3NP1 A;  4Y0Q A;  4BCS A;  1HY2 A;  4CDC A;  5AJB A;  3UEU A;  2RTB B;  3ZZV A;  1SRG A;  1SXY A;  3NR3 A;  4CV7 A;  3RDM A;  3FYF A;  1A3Y A;  1KOI A;  2R56 A;  4MVK A;  4GZV A;  3P6F A;  1VWQ B;  3S26 A;  3RZY A;  2NND A;  2NP1 A;  3JQO A;  3BLG A;  1JBH A;  5HZQ A;  1MX8 A;  1MOY A;  3OD9 A;  5BVS A;  4I9R A;  1KZX A;  1YP7 A;  3P24 A;  4QZT A;  1MX7 A;  1HXL A;  1ICN A;  1VPR A;  2QO6 A;  3ELX A;  4WBK A;  2JW1 A;  4WFU A;  1VWI B;  2FT9 A;  3CR6 A;  2UYW A;  1R0U A;  1N4J A;  5B2A O;  1DC9 A;  1SLF B;  2OY7 A;  1AB0 A;  3SLO A;  4ZFX A;  5L8O A;  3T2X A;  1X8P A;  2K23 A;  4L3R A;  3SZH A;  5HZ9 A;  2JU7 A;  3HPE A;  4A8Z A;  5B11 O;  3T2W A;  3WJG A;  4ORS A;  1BRP A;  1LIF A;  5CYB A;  4KC7 A;  1AQB A;  2MF6 A;  2X34 A;  3LHN A;  5FFH A;  4IB8 A;  3FR2 A;  3FW4 A;  3LTW A;  3VHI A;  4Z2V A;  3CQN A;  3H3I A;  2Q9S A;  3ZI8 A;  4KH8 A;  1A18 A;  1KGL A;  2L9C A;  3AUM O;  3EM0 A;  4GK9 A;  4UU2 A;  4U8U M;  1U18 A;  4CSB A;  1LNM A;  2UZ2 A;  3RKG A;  2OF9 A;  4OMX A;  2LKK A;  2OL7 A;  1HXZ A;  1UYN X;  4ID2 A;  3MG5 A;  1CRB A;  4O49 A;  4ORU A;  2FTB A;  1G5W A;  3RE5 A;  4EEJ A;  1T68 X;  1VWD B;  1GGL A;  1QY0 A;  1HMS A;  1GM6 A;  4NYQ A;  5EZ2 A;  4NNT A;  4IRW A;  4AYH A;  2Y32 A;  3VHM A;  2HKD A;  5FEN A;  3D4R A;  1T8V A;  1SWC A;  2QMI A;  1SY0 A;  1QY1 A;  1SXX A;  2GJ5 A;  3G7X A;  3MM0 A;  4ARH A;  2GC9 A;  1GKA A;  3NX1 A;  3GE2 A;  2IZB A;  4ORY A;  2WPU A;  3RSW A;  3UEV A;  3EMM A;  2WQ9 A;  3NAD A;  3RBY A;  4D6B A;  4D6A A;  1DF3 A;  2BLG A;  3S60 A;  3NBX X;  4GD9 A;  4CDF A;  3FEL A;  1B0O A;  5HTE A;  3HTY A;  5B10 O;  1FEL A;  1VWB B;  5BVT A;  3C76 X;  2X8F A;  4GE1 A;  5HCE C;  3Q6L A;  2IFB A;  2LB6 A;  1FDQ A;  1O1V A;  2RQ0 A;  4XMF A;  1QG5 A;  4CDE A;  4QGX A;  1I78 A;  2W2B A;  2GTL O;  1K3B A;  2LA7 A;  1QWD A;  1Y0G A;  3D9W A;  3F8A A;  1EII A;  2JGS A;  4M7M A;  1PMP A;  1OBP A;  1LKE A;  4O3W A;  4O3Y A;  1OBU A;  4CPH A;  1KT5 A;  2MWH A;  4HFO A;  1D3S A;  1A57 A;  1YWB A;  1SA8 A;  5HCC C;  2FR2 A;  3U0D A;  5IO5 A;  3U03 A;  4BX5 B;  1JQP A;  1JYD A;  4QRL A;  5L8N A;  3ZUO A;  3P6D A;  1EPB A;  3KVN A;  4RUN A;  4Z2P A;  2RTN B;  1KQW A;  3KZA A;  4IAW A;  2RTP B;  1ZNG A;  3B2K A;  4HPB A;  1KL4 A;  2R73 A;  1SXU A;  3B2I A;  2X8T A;  2VFC A;  5D48 A;  1VWO B;  2L5P A;  5JD2 A;  2A0A A;  1DV9 A;  3CKG A;  1EPA A;  2BSZ A;  3WZQ A;  2AMM X;  1YP6 A;  4CK4 A;  4IB6 A;  2PY1 A;  4YDB A;  1STR B;  2MHD A;  3EYC A;  1ZNE A;  1VWP B;  1SRF A;  3APU A;  3RY1 A;  4AZR A;  4KC8 A;  3CKF A;  2X8S A;  4Y59 A;  3RY2 A;  1MVG A;  1VWN B;  4M6S A;  2CBS A;  3FLL A;  1YWD A;  2MJI A;  3PDF A;  4ES7 A;  4ZCB A;  4TKH A;  1S7D A;  4COT A;  4EQA C;  4ZGF A;  1A2D A;  1X8N A;  4ORX A;  5F1E A;  1PTS A;  2BC3 A;  2BHV A;  5H8T A;  3TF6 A;  3F6Z B;  1X89 A;  1ICM A;  5L8I A;  2ACO A;  4NP1 A;  2IZE B;  4GUZ A;  3RDU A;  4CPF A;  1S2P A;  4FBV A;  1SWA A;  2YMS A;  3I17 A;  3UAQ A;  3FA7 A;  4YGZ A;  1W6F A;  1CBS A;  1I4U A;  1QFV A;  1GT5 A;  1ZND A;  3HWG A;  5IO6 A;  1DFV A;  2JU3 A;  3AKM A;  1LIB A;  4MVE A;  5D47 A;  2OY5 O;  1KQX A;  4GGT A;  1KL5 A;  2A13 A;  5B5F A;  1X8O A;  5LJG A;  2P8G A;  2FRS A;  3RWX A;  1SWL A;  2C1Q A;  3SZJ A;  2FKJ A;  1GX3 A;  2LBA A;  5LJE A;  1PBO A;  3HK1 A;  1EAL A;  2X46 A;  2X32 A;  2WQA E;  2OL8 O;  3WJE A;  1LFO A;  2ACP X;  1SLG B;  2Q4N A;  4GGZ A;  3SLT A;  2R74 A;  1IFB A;  4FQB B;  4OEL A;  3WZN A;  2IZC B;  3I0A A;  1DF8 A;  2DJF A;  4O4X A;  3EC5 A;  2IZK A;  3APX A;  4GU8 A;  4OS3 A;  3UEX A;  3BDR A;  3VG4 A;  1X71 A;  1N0S A;  2ZAG A;  5LKF A;  5HA0 A;  1OSP O;  1PEE A;  3TGA A;  1HMT A;  3SOT A;  1TOU A;  2I5Z O;  2KD2 A;  2JOZ A;  4GNY A;  4QQ1 A;  3RDQ A;  4NW4 A;  1YUP A;  1PBY A;  5HA1 A;  4N7D A;  4QGW A;  3CQR A;  1RLB E;  3RDX A;  2RTJ A;  1G85 A;  1OBQ A;  5H9K A;  1MM9 A;  5H9N A;  1AVE A;  2X45 A;  1JIW I;  1LIE A;  2FHL A;  1SLD B;  3BU1 A;  1ML7 A;  3PPT A;  1IJ8 A;  3KQ0 A;  3MVF A;  2QO5 A;  4JHQ A;  5EED A;  1LIC A;  4Z27 A;  4L1N A;  1ERX A;  1VWL B;  2RTM A;  3APV A;  3T1D A;  1ZRY A;  2OFA A;  4O3Z A;  3RDO A;  5HWZ A;  2WUT A;  1LPJ A;  4O3X B;  1VYG A;  4ZHG A;  2GTL M;  3NX2 A;  1Z24 A;  2RTA A;  3P6C A;  1LEL A;  2A8G A;  4GKC A;  4WFV A;  1I05 A;  4Y0S A;  1KT6 A;  1QY2 A;  3JSQ A;  3OE3 A;  4TKB A;  2X56 A;  2CM9 A;  1TVQ A;  2F01 A;  4XME A;  4Y0R A;  4Z2O A;  2CBR A;  3VG6 A;  3WXQ A;  3KFF A;  3WZP A;  4U9C A;  4IAB A;  4QGV A;  2EU7 X;  4BBO A;  3HWD A;  1EIO A;  1BSQ A;  4Y0P A;  3P6E A;  4YFQ A;  5K68 A;  5FQ6 E;  4LQZ A;  2CZT A;  4MVI A;  1BJ7 A;  1GKA B;  3WOV A;  2IZI A;  4ZHF A;  1VWR B;  5HCD C;  2RTC B;  1G74 A;  1FEN A;  2G5L A;  2Z4I A;  3KFI A;  1IFC A;  1KFF A;  2FWV A;  3T6F A;  4AZM A;  4BX7 A;  3APW A;  4OS8 A;  3VG3 A;  1VYF A;  4XMH A;  2OVD A;  3STK A;  3ZQ3 A;  4I3C A;  3SLJ A;  1B8E A;  1SWR A;  1SWN A;  1LUQ A;  1DZM A;  2A5C A;  2CM4 A;  3LV4 A;  4Y5D A;  5IRW A;  1OEJ A;  1W5R A;  2RCQ A;  2W2A A;  2Q39 A;  2OVA A;  5HAE A;  4YBP A;  1GT4 A;  1STS B;  1CBQ A;  4YVB A;  1TOW A;  3CBC A;  3S5V A;  1XCA A;  1KXO A;  4JO6 A;  4WHI A;  3O22 A;  1BLR A;  2RTD B;  3S5X A;  5IXG A;  2RTR B;  4CPH B;  2KW1 A;  1Y55 X;  3F9D A;  3VU1 A;  1SWJ A;  1TXL A;  4ZH6 A;  1N7Y A;  1OPB A;  1O8V A;  2OL6 O;  4BX6 A;  5K67 A;  3KFG A;  1GX9 A;  4BOE A;  2QOM A;  4GDZ A;  3AKN A;  3BX7 A;  3QKG A;  4GDA A;  1JJX A;  3V8U A;  1SWP A;  1JJU A;  1EW3 A;  1I06 A;  2AKQ A;  3ZW0 A;  3SZI A;  1BSY A;  5B5G A;  2G79 A;  1SRH A;  1B4M A;  1SWE A;  1SWO A;  2AVI A;  2KTD A;  3B2J A;  5FQ7 E;  3ZW1 A;  4EDE A;  1NGL A;  1SWK A;  4ZGU A;  1VWC B;  3OJY C;  1E02 A;  3P6H A;  2DJG A;  1GT1 A;  4IAX A;  4NV8 A;  5D8J A;  2RTH B;  1YIV A;  1JMZ A;  1STP A;  1WUB A;  2RTI B;  3HOL A;  3PP6 A;  4FBO A;  4ZJ0 A;  1NQM A;  1NBX A;  4YFP A;  2YG2 A;  1BSO A;  3PQU A;  1EI5 A;  4TNN A;  4EKV A;  4YDA A;  2C1S A;  1MK5 A;  2I5V O;  3T6L A;  5FAZ A;  4B55 A;  3WJD A;  2NNQ A;  1VYO A;  1XKI A;  1RXH A;  3B2H A;  4ALB A;  4ALO A;  1VWF B;  3WBG A;  1Y52 X;  4AZN A;  1QQS A;  5B29 A;  2WR6 A;  3GAQ A;  4ORR A;  1SLE B;  4PSQ A;  1JJJ A;  1E5P A;  3OBL A;  4YBU A;  4Z6J A;  1I04 A;  4O4O A;  1AEL A;  1D2U A;  2OZQ A;  1GX8 A;  2IZD B;  1SWT A;  3HOE A;  4ON1 A;  1ZNK A;  1TW4 A;  3FEK A;  4MEE A;  3EW1 A;  2AT3 X;  1JYJ A;  5LJK A;  4NLI A;  1X8U A;  4GJS A;  1SMP I;  2DM5 A;  4U8U N;  3PED A;  2C4I A;  5F6B A;  4XMD A;  4ZH9 A;  5CE4 A;  5CSE A;  1LCV A;  2Q2M A;  4QYN A;  4C5P A;  4YH0 A;  1GXA A;  4LKP A;  1OPA A;  2A5B A;  1SWB A;  5BYP A;  3WYQ A;  1I9H A;  1FEM A;  1WBI A;  1B56 A;  2G8C O;  2QM9 A;  1SWH A;  2QO4 A;  2RTK A;  5F7G A;  4ZHD A;  5JR8 A;  1FTP A;  4ML7 B;  4MIR A;  4QAE A;  5HZ6 A;  5HZ8 A;  2K62 A;  2IZF B;  1SY2 A;  2IZG B;  2Q2P A;  4I6S A;  4AZP A;  5HTD A;  2AT6 X;  4TLJ A;  3NPO A;  4A1Y A;  3CWK A;  4LZV A;  1VWJ B;  5F58 A;  3BU9 A;  3FDC A;  1N9Y A;  5HBS A;  5IRA A;  3IFB A;  4QNI A;  4MIS A;  2HZR A;  1BBP A;  1MDC A;  4OEM A;  1LDO A;  4FGI B;  1URE A;  3NQ9 A;  5LJC A;  3FW5 A;  1SWG A;  2ALL X;  4BVM A;  4KII A;  1ALB A;  4JNJ A;  3FEP A;  3P6G A;  1X8Q A;  3ZWE A;  1ACD A;  1HBQ A;  3MX7 A;  2FR3 A;  2IZH B;  3C77 X;  5D45 A;  3ZW2 A;  2ANS A;  4OS0 A;  4INN A;  2OFR X;  4HWM A;  4YFR A;  1NQN A;  4CPE A;  1OEK A;  4IMN A;  1ZNH A;  3BS2 A;  1E00 A;  3DTQ A;  4QYP A;  1IW2 A;  2OVS A;  4KCA A;  4AZO A;  1SY3 A;  2XST A;  4I95 A;  2BT9 A;  4YCE A;  4DQ4 A;  3ELZ A;  3PH5 A;  1SY1 A;  2FLJ A;  1AVG I;  2Y3F A;  3D97 A;  1RSU B;  1SWD A;  3TZS A;  1SWQ A;  1DZJ A;  3PH6 A;  3O19 A;  5L3Y A;  3PK2 A;  3AEH A;  3BX8 A;  4HPD A;  1QFT A;  2IZJ A;  4GET A;  3KFH A;  3MBT A;  3P02 A;  2A2U A;  4HPA A;  4I9S A;  2F73 A;  4MVL A;  5EDB A;  2RN4 A;  5KIC A;  1ERB A;  2WEX A;  2X55 A;  4GGR A;  3FA8 A;  1BRQ A;  1Y9L A;  2LFO A;  3CMP A;  2CZU A;  3QQ2 A;  2OY1 O;  2QOS C;  2RTG B;  5BVQ A;  1SRE A;  4ZR2 A;  5IRU A;  2IZA A;  5LJD A;  2BS5 A;  4GJV A;  2RCT A;  2Z4H A;  4ODD A;  4UU3 A;  2AL0 X;  2JMB A;  1SWU A;  1RAV A;  2ZSC A;  2F09 A;  3JS1 A;  4QZU A;  3VHH A;  4NV7 A;  3VE2 A;  3U9P C;  1AVD A;  3FEN A;  3FIQ A;  2OVE A;  5C0N A;  4HPC A;  4YKM A;  3RDS A;  3X00 A;  4DCB A;  5EDC A;  2FGS A;  4BX7 B; 
#chains in the Genus database with same CATH homology
 4BCS A;  1HY2 A;  2RTB B;  1SRG A;  1PTS A;  1Y53 X;  2BC3 A;  3RDM A;  4GDA A;  4CPF A;  1VWQ B;  1SWP A;  3RDU A;  2IZE B;  4DNE A;  3SZI A;  5B5G A;  1SRH A;  1MOY A;  1SWA A;  1SWE A;  1SWO A;  2AVI A;  3WZO A;  1HXL A;  1SWK A;  1VWC B;  1VWI B;  1N9M A;  2Y3E A;  2UYW A;  1N4J A;  2QCB A;  2RTH B;  1SLF B;  1STP A;  2RTI B;  4BX6 B;  4GGT A;  1KL5 A;  1NQM A;  1NBX A;  4I60 A;  3T2X A;  5B5F A;  1LDQ A;  3SZH A;  3VGW A;  1SWL A;  2C1Q A;  3SZJ A;  4EKV A;  4BJ8 A;  2C1S A;  1MK5 A;  3WYP A;  3T6L A;  1VWA B;  1NC9 A;  3T2W A;  1MEP A;  1SLG B;  1VYO A;  1RXH A;  4GGZ A;  2MF6 A;  1VWF B;  1Y52 X;  3WZN A;  2IZC B;  1DF8 A;  4Z28 A;  3VHI A;  4Z2V A;  1SLE B;  2IZK A;  4Z6J A;  3RE6 A;  2CAM A;  2IZD B;  1SWT A;  1KL3 A;  2OFB A;  1RXJ A;  3EW1 A;  3RDQ A;  1VWM B;  4GJS A;  1SRI A;  1RST B;  1SWF A;  2UZ2 A;  2C4I A;  4CPH B;  1RXK A;  2OF9 A;  3EW2 A;  5CSE A;  1LCV A;  1HXZ A;  3RDX A;  2RTJ A;  1SWS A;  3MG5 A;  1VWE B;  3RE5 A;  1MM9 A;  2A5B A;  2GH7 A;  1SWB A;  1VWD B;  3WYQ A;  1I9H A;  2OF8 A;  1WBI A;  1AVE A;  1SWH A;  2RTK A;  4IRW A;  2FHL A;  1SLD B;  2Y32 A;  3VHM A;  1IJ8 A;  4JHQ A;  4Z27 A;  1SWC A;  1VWL B;  2RTM A;  3MM0 A;  2IZF B;  2IZG B;  2OFA A;  3RDO A;  1SRJ A;  2IZB A;  5IRW A;  2RTA A;  2WPU A;  1VWJ B;  1LEL A;  2A8G A;  3FDC A;  1N9Y A;  5IRA A;  4GD9 A;  4BX5 A;  1VWB B;  1LDO A;  2F01 A;  1HQQ A;  4CPI A;  4Z2O A;  1SWG A;  3WZP A;  4JNJ A;  4OKA A;  4BBO A;  2JGS A;  1VWH B;  2IZH B;  2FHN X;  5K68 A;  1NQN A;  4CPE A;  4CPH A;  2IZI A;  1VWR B;  1VWK B;  2RTC B;  2G5L A;  2IZL B;  1KFF A;  3T6F A;  2Y3F A;  4BX5 B;  1LCW A;  1RSU B;  1SWD A;  4BX7 A;  1SWQ A;  2RTL A;  5L3Y A;  3PK2 A;  1SWR A;  1SWN A;  2IZJ A;  1LUQ A;  2A5C A;  2RTN B;  4Y5D A;  2RTP B;  4Z2P A;  4U46 A;  1KL4 A;  4GGR A;  5JD2 A;  1LCZ A;  1VWO B;  2RTQ B;  1NDJ A;  1STS B;  3WZQ A;  4YVB A;  1VWG B;  2RTO B;  2RTG B;  4JO6 A;  1SRE A;  5IRU A;  2IZA A;  1STR B;  2RTD B;  4GJV A;  2RTE B;  2RTR B;  2ZSC A;  1SWU A;  1RAV A;  1SRF A;  1VWP B;  1Y55 X;  2RTF B;  5CHK A;  1SWJ A;  5F2B A;  3RY1 A;  3VHH A;  1AVD A;  1N7Y A;  4Y59 A;  3RY2 A;  4BX6 A;  1VWN B;  1N43 A;  3RDS A;  3X00 A;  5K67 A;  4BX7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...