1LCZA

Streptavidin-bcap complex
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
119
structure length
119
Chain Sequence
b'GITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptavidin
publication title Ligand exchange between proteins: exchange of biotin and biotin derivatives between avidin and streptavidin
pubmed doi rcsb
source organism Streptomyces avidinii
molecule tags Unknown function
total genus 25
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1lczA00
1SWCA 1NC9A 1SWAA 1SWQA 2A5CA 2BC3A 1VWEB 2IZEB 4OKAA 3VHMA 4BX7A 4Z27A 1SWTA 3WYPA 1VWJB 2C1SA 1SWFA 2RTAA 3MG5A 1STSB 1WBIA 4GGRA 1N7YA 1SRGA 1VYOA 2C1QA 1LUQA 1PTSA 1NDJA 1SLDB 2CAMA 2FHNX 4GD9A 4GGTA 4JNJA 4Y5DA 3T6FA 2RTNB 5F2BA 1RSTB 3WZNA 1MOYA 4BX6B 1VWPB 4GGZA 1SWLA 1SWPA 2F01A 2RTEB 2OF9A 4GDAA 1MK5A 4GJSA 5JD2A 2IZGB 4YVBA 4BX5B 2G5LA 3MM0A 3RDMA 1SRFA 2OFAA 2RTJA 1HQQA 5B5GA 3RE6A 4DNEA 1VWQB 1SWJA 2A5BA 3PK2A 3T2XA 1KFFA 2IZAA 1SWDA 2RTBB 5CSEA 1SREA 1VWKB 2RTCB 3VGWA 4JHQA 3EW1A 2IZCB 2IZHB 1MEPA 2OFBA 4Z6JA 3T2WA 2IZBA 1SWEA 4Y59A 3SZIA 1RXKA 2IZFB 3T6LA 3WZPA 1SLGB 1KL3A 1VWRB 1DF8A 1VWGB 1RSUB 5CHKA 1N4JA 1SWSA 1N9MA 2GH7A 2WPUA 2ZSCA 4IRWA 1AVDA 4CPFA 4BBOA 1VWCB 2RTRB 3WZQA 2RTFB 2UZ2A 2IZIA 2Y3EA 3VHIA 2IZKA 1SWBA 2RTQB 4BJ8A 2RTMA 4BCSA 3WYQA 5IRWA 3EW2A 3VHHA 1KL4A 1SRHA 2OF8A 2FHLA 2RTLA 4BX6A 3RY1A 2JGSA 4CPEA 1NBXA 1SWNA 4U46A 1Y52X 5K67A 1LDQA 1STRB 1SWRA 2RTIB 4BX5A 4CPIA 3FDCA 3RDXA 1STPA 2RTPB 4BX7B 5L3YA 2UYWA 2AVIA 2MF6A 3RY2A 1SRJA 3SZJA 4GJVA 3SZHA 4CPHB 3RDOA 3RDQA 1Y53X 2A8GA 1HXZA 4Z28A 3RDUA 4JO6A 1LDOA 2C4IA 1HXLA 1SLEB 2QCBA 1SWKA 5B5FA 1RAVA 2IZDB 1LCVA 1I9HA 3WZOA 1NQMA 1N9YA 4Z2VA 2IZJA 1LCZA 4EKVA 3RDSA 1NQNA 1RXJA 4CPHA 1SWHA 5IRAA 1HY2A 1SLFB 1SWOA 2RTDB 4Z2OA 1AVEA 1VWOB 2RTKA 1MM9A 2Y3FA 1LCWA 1IJ8A 3RE5A 5IRUA 4I60A 1RXHA 1Y55X 1LELA 4Z2PA 1VWFB 1VWLB 2RTGB 1SWGA 5K68A 3X00A 1N43A 1SWUA 1VWBB 1VWIB 2IZLB 2RTOB 1KL5A 1VWAB 1VWHB 2Y32A 1VWNB 1VWMB 1SRIA 2RTHB 1VWDB
chains in the Genus database with same CATH superfamily
4YGZA 2A5CA 4OKAA 2MM3A 3CQRA 3O19A 2RA6A 3GAQA 1IW2A 1I4UA 3PEDA 4YH0A 2F09A 1JMXA 1EIIA 3RZYA 1WBIA 2G7BA 2LA7A 2P8GA 3APXA 3B2KA 4I3CA 3DSZA 3JSQA 1KT5A 1NDJA 1PTSA 3STMX 3B2LA 3LTWA 4PSQA 5AJBA 4ALBA 1PBOA 5CYBA 2POAA 4GK9A 5EDCA 3WBGA 1QY0A 1DZPA 4BX6B 1MX7A 3CBSA 4GGZA 3TGAA 1SWLA 4N7CA 3WJEA 4NLIA 3D9WA 3P6DA 5H9NA 3U0DA 1CBIA 4KH8A 1U17A 1LPJA 4MIRA 5JD2A 2FRSA 2RCQA 5H9AA 1YWBA 2HLVA 2G5LA 3FIQA 4QGWA 3BS2A 4HPBA 2OFAA 4WBKA 3RE6A 1UYOX 2HKDA 1BM5A 4IB8A 4YGHA 1EI5A 1KFFA 4DQ4A 2O62A 5B29A 1SREA 1VWKB 1SA8A 3V8UA 3VGWA 3B2HA 4L3RA 5D4AA 1ICMA 2BT9A 1BSQA 1MEPA 1ZNHA 3FW4A 5EEEA 2Q39A 3MX7A 4UU3A 2ALLX 3KQ0A 3FW5A 3NBXX 5HZQA 4DCBA 3T6LA 4TJZA 1DF8A 1QY1A 1Y9TA 1E5PA 4D6BA 5CHKA 4YDAA 1ACDA 2OL6O 2LBAA 3FYFA 3F9DA 3NX1A 4GNYA 2OY7A 5L8NA 1AQBA 3FELA 4BBOA 3CWKA 2OFRX 4WHIA 1T68X 5FQ8E 3WZQA 2RTFB 5CE4A 5LJEA 4U3QA 3SOTA 4EEJA 1ZNEA 4NW4A 4O49A 2IZKA 1E02A 3HOLA 1GX9A 4I9RA 4BCSA 3WYQA 2F73A 2NP1A 4CDEA 5IRWA 4U8UO 1QY2A 2RTLA 1JQPA 3AKNA 3FR4A 3KFFA 4CPEA 1SWNA 1GGLA 1Y52X 2QOSC 3VG4A 2KTDA 1G74A 1TOWA 1X8PA 1STPA 5D45A 1EALA 4XMEA 5B2AO 2K23A 3CKGA 3AKMA 2MF6A 3KFHA 4YFQA 4O4UA 5AJCA 3SZJA 2JU7A 3SZHA 1I78A 2LBVA 4CPHB 1S44A 1Y53X 3APUA 1KXOA 4WFUA 1B8EA 2CBSA 4EXZA 2KW1A 1LDOA 2C4IA 1ZNGA 3G7XA 4I9SA 1BSYA 1KOIA 4CDCA 1NP1A 4MVLA 1YWCA 5B5FA 4ZHFA 2IZDB 2MJIA 3WZOA 1W5RA 1I05A 1NQMA 5DPQA 2QM9A 4TKBA 4Z2VA 3HWFA 2QO5A 4GKCA 2X34A 4KC7A 1SMPI 4LKTA 1RXJA 4Y0SA 1GX8A 3VE1A 1SWOA 3WJCA 1JJJA 3BY0A 4A60A 4YMYA 4EQAC 1Z24A 3U03A 3U9PC 1HBQA 2QO4A 2Y3FA 3EBKA 4XMHA 2QO6A 3P02A 1DV9A 1U18A 2W2BA 3C76X 4NYRA 5HCEC 5HA0A 3LHNA 1VPRA 4OMXA 3X00A 1K3BA 4ORUA 2VDFA 1VWBB 4U8UM 1W6FA 2IZLB 5FFHA 3ZUOA 3APVA 3E3CA 2RTOB 3WVMA 1VWHB 3OE3A 1MDCA 2HZQA 1VWMB 4GU8A 4O4XA 2OL8O 5D47A 3OJYC 3BU1A 1FE3A 4CK4A 4EDEA 1SWCA 1NC9A 2BC3A 4BX7A 3VG6A 3WJDA 4Z27A 3IFBA 1SWTA 3BLGA 4ZHHA 1X8QA 4UU2A 1SY3A 4A8ZA 2RTAA 3MG5A 5HWZA 1STSB 4GGRA 1QFVA 3C78X 4GUZA 2Q2PA 4CDFA 4FGIB 3C77X 3FA9A 2CAMA 4GD9A 3S26A 1I04A 2JMBA 5H9KA 5F1EA 3WZNA 1EPBA 2XSTA 1X89A 1IIUA 2BSZA 2VFBA 1SWPA 4O4OA 4C5PA 2OF9A 4PJ2A 2MO5A 1FENA 5D8JA 2JU8A 4FBVA 4BX5B 3MVFA 4I6SA 1VYGA 1SRFA 3VPJE 4AYHA 4CSBA 3FEKA 1OPBA 4ORYA 5LJGA 2A5BA 2AH7X 3ELZA 1I06A 3UEVA 3T2XA 3ZI8A 1LICA 2IZAA 1SWDA 3NQ3A 4HWMA 5CSEA 3RBYA 3IA8A 3STNA 3ZW0B 3ZZVA 1B0OA 1VYFA 2LB6A 3CQNA 3EW1A 4JHQA 4ZH9A 3T1DA 3P6FA 3KVNA 2IZBA 1SWEA 4Y59A 4A1YA 2X55A 4AZPA 2A0AA 3NR3A 5LJCA 5EDBA 2X8TA 1ERBA 1KL3A 2M4LA 4GE1A 1EQDA 2FGSA 5LKEA 4TQ2A 2ASNX 1SWSA 5D48A 3UEUA 2WPUA 3ZW1A 1DF3A 3O2YA 1NGLA 1AVDA 1MX8A 2AT3X 4MVIA 1ZNKA 1OSPO 4O3WA 4FQBB 2GC9A 1SXUA 5EEDA 4CPFA 5HZ6A 1ZNLA 2A3FX 4MISA 3WJGA 1QG5A 2HYSA 4QYPA 1UZ2X 3UEWA 1JYJA 4YBPA 1A3YA 2QMIA 3NQ9A 4ZHCA 5F58A 4TKJA 2Q2MA 3OBLA 2OFMX 4OELA 2RTQB 4BJ8A 1R0UA 1UREA 2RTMA 2RN4A 1KL4A 5B10O 2OVAA 3K3LA 1ERXA 2JW1A 5FENA 4FBRA 3RY1A 1TVQA 4O3XB 2JGSA 3I17A 4YFPA 4TKHA 4GZVA 5LJHA 2WSJA 1KT7A 3VE2A 1STRB 3CBCA 1LKEA 4ES7A 4IAWA 2X45A 1RLBE 4QGXA 2AT8X 5L3YA 2HZRA 3STKA 5B27A 2UYWA 4ON1A 2WUTA 2AVIA 1D3SA 1CRBA 5KIDA 4IBAA 3PQSA 3RDQA 4AZMA 4A1HA 3NQKA 1XKIA 2A8GA 3PQUA 3RDUA 4D6AA 2PY1A 1GT5A 3D97A 3N91A 1JBHA 2CM4A 3PH5A 4BOEA 4I95A 3BX8A 3CMPA 4HPAA 4ML7B 3DTQA 2CBRA 4ID2A 1OPAA 4MVKA 3S5XA 2Q4NA 4IB9A 3S60A 3D95A 1GKAA 3VG5A 1JJUA 3RDSA 1NQNA 4CPHA 4ZFXA 5IRAA 1HY2A 1SLFB 2RTDB 2WEXA 1BLRA 1AVEA 1X8UA 2RTKA 3BU9A 1SXXA 3PECA 1MM9A 4IAXA 4KCAA 1TXLA 2BS6A 3P6HA 2WR6A 2GTLO 3ZQ3A 4O3ZA 3QQ2A 5FQ6E 1VWFB 3LV4A 1VWLB 1GX3A 2BS5A 1N43A 1EUOA 4U8UN 3P24A 1G7NA 1FELA 3FR2A 1DFVA 1KL5A 5LKFA 4GNWA 1SRIA 5F7GA 3SLTA 1Y0GA 1DC9A 4XMCA 1PM1X 1SWAA 2NNEA 1VWEB 3VHMA 2WQ9A 2WWPA 3PP6A 3EM0A 1ALBA 1VWJB 2C1SA 2W2AA 2A13A 2L5PA 2LFOA 2X32A 4GH7A 1JZUA 1N7YA 4AZNA 4KIIA 1X8OA 2FKGA 2C1QA 5H9LA 3PDFA 3T6FA 4QYNA 1CBQA 2N93A 2RTNB 4R0BA 5F2BA 3WOVA 1IKJA 2G79A 4TLJA 1VWPB 1S7DA 2AKQA 2F01A 2NNQA 2RTEB 4GDZA 2FS6A 4M6SA 2JN3A 1DZKA 1MVGA 4Y0RA 3Q6LA 5HTEA 3UEXA 1SXWA 3FR5A 4JGLA 2YMSA 4DNEA 1HMTA 1VWQB 1SWJA 3EMMA 5F6BA 2A2UA 3PK2A 4ZHGA 5KICA 2L9CA 1ZNDA 2RTBB 4LQZA 1LNMA 2W2FA 2GTLM 3SAOA 2DJFA 2FTBA 5C0NA 2IZCB 1PBYA 2QOMA 2OFBA 2FKJA 4ZJ0A 3Q34A 3WZPA 1FEMA 4YBUA 4KT5A 1VWRB 3FA7A 1PMPA 1JMZA 2PI3O 5HCDC 2JOZA 1VWGB 4I3BA 1RSUB 4NNTA 1UYNX 5EZ2A 4BVMA 1N9MA 3HK1A 4GETA 2ZSCA 3KFIA 1BBPA 2CZUA 3JS1A 1JJXA 4O4SA 1LIFA 4IMOA 3D96A 3TGBA 1BRQA 2UZ2A 2RCTA 3B2JA 3FA6A 1HQPA 1OEJA 2Y3EA 2Z4IA 1QFTA 4BQUA 3RKGA 4ALOA 4ZR2A 1EPAA 3RSWA 1CBRA 1T8VA 1QQSA 1TOUA 1ICNA 3EW2A 4HFOA 4LZUA 1X71A 3TF6A 1SY2A 4ARHA 4BX6A 1AB0A 2ACPX 2X8SA 4NP1A 1NBXA 4NV8A 3BSZE 4U46A 2AT5X 5FQ7E 5BVTA 1KGLA 1JIWI 4YDBA 2HNXA 3VU1A 1FDQA 1GM6A 1LDQA 1SWRA 1ZRYA 1OEKA 3FDCA 3RDXA 4QGVA 2RTPB 4BX7B 4NYQA 1KQWA 1KZWA 4ZGUA 3NPOA 3CR6A 2RD7C 3ELXA 3RY2A 2E4JA 2YG2A 3O22A 4GJVA 2L68A 3NX2A 1ML7A 3RDOA 1DZMA 1O8VA 2MWHA 4Y0PA 5BVQA 4ODDA 2AMMX 4Z28A 3EC5A 1KQXA 1NP4A 5HA1A 2OVDA 4JO6A 1Y9LA 4AZOA 4HPCA 3APWA 2QCBA 5K06A 4QNIA 5HCCC 5IO6A 5KHPA 1RAVA 2OVSA 4BGFA 5BVSA 3BDRA 2R73A 5AQ6A 1BSOA 3KZAA 3SLJA 1XCAA 1AELA 1SY1A 1E00A 2I5ZO 4OMWA 3ZWEA 1N0SA 3ZW2A 4Z2OA 2FR3A 3OD9A 4OS3A 1VWOB 5B3MO 4RUNA 3F8AA 3PPTA 4YKOA 5L8IA 5LJBA 2OYBO 1EW3A 1LCWA 1OBUA 4EFGA 1IJ8A 2X46A 4QQ1A 4U9CA 1JYDA 1RXHA 4ORRA 3VG2A 4XMFA 2OY5O 4K19A 4RUUA 3PH6A 1SY0A 1SWGA 1SXYA 2FT9A 4FBOA 1SWUA 4QAEA 5K68A 1BWYA 3HWEA 1GT4A 2GJ5A 2BHVA 3F6ZB 2R56A 1VWAB 1X8NA 2WEWA 2Y32A 3FIDA 1VWNB 4IB6A 3BRNA 4L1NA 4COTA 5IO7A 2RTHB 2ZAGA 1KT6A 2IZGB 3P6EA 3ZW1B 3RWXA 1YUPA 2X8FA 1SWQA 1S2PA 4IB7A 2IZEB 4AZQA 5LJKA 3TGCA 3I0AA 3WYPA 2KTSA 5HAEA 5IXGA 1B4MA 1SWFA 1D2UA 3QKGA 4LZVA 1O1UA 5HBSA 1SRGA 4MEEA 1VYOA 4GGTA 1LUQA 1SLDB 2A2GA 1YIVA 4JNJA 2FHNX 4Y5DA 3VG7A 1MUPA 4XMGA 3P6CA 5BYPA 2BLGA 3MBTA 1E06A 1RSTB 1MOYA 2RQ0A 5JR8A 1K24A 4QZTA 3HPEA 1WUBA 5HZ9A 1EIOA 1AVGI 5B11O 1ADLA 3H3IA 4GDAA 1FJ1E 1TW4A 2MHDA 1MK5A 4GJSA 4AZRA 1E2TA 4YGGA 2NNDA 1LIEA 2XKLA 4INNA 1PEEA 1BEBA 3MM0A 3RDMA 1IFBA 1A57A 2RTJA 1HQQA 4OEMA 4KC8A 4OS8A 5B5GA 4ZGFA 4DQ3A 2ACOA 1GT3A 2ANSA 1KZXA 2GTLN 2RTCB 1HMSA 1U0XA 4M7MA 4CDDA 5L8OA 4I3DA 1QWDA 3AUMO 4OS0A 2IZHB 4ORXA 3FMZA 4TNNA 3WJFA 4Z6JA 3T2WA 1OBQA 2DJGA 2OVEA 3SZIA 1G85A 3BX7A 1OBPA 1RXKA 1QABE 2IZFB 2OZQA 1SLGB 1CJ5A 4ZHDA 1GXAA 2CM9A 3VG3A 3FA8A 1N4JA 1GKAB 2GH7A 4IRWA 4YCHA 3WXQA 2EU7X 1GT1A 2WQAE 4O3YA 4YCEA 2VFCA 1VWCB 3HWDA 2RTRB 3FEPA 4GRJA 1YP6A 3KFGA 1G5WA 2IZIA 2LKKA 1L6MA 1P6PA 3VHIA 1FTPA 1SWBA 2FR2A 2JU3A 3HTYA 4B55A 4IABA 1KT3A 1YWDA 2FLJA 1W4TA 4NLJA 1H91A 1YWAA 3TZSA 2I5VO 3VHHA 1SRHA 1T0VA 1O1VA 1B56A 2FHLA 2OF8A 2OY8A 2Z4HA 3FLLA 2X4MA 2DM5A 2OY1O 3FENA 3GE2A 4XMDA 3P6GA 3S5VA 2Q9SA 1JV4A 4NNSA 2IFBA 1LIBA 5K67A 4CPIA 4BX5A 2RTIB 1KT4A 4ORSA 5H8TA 2AL0X 3NP1A 2ZAIA 2G8CO 1SRJA 3SLOA 4YFRA 2KT4B 3WJBA 3L4RA 4QRLA 4ORWA 2KD2A 3ZW0A 1HXZA 3HOEA 2CZTA 4Y0QA 1DZJA 2R74A 5FAZA 2OL7A 5HZ5A 1HXLA 1LF7A 1SLEB 4AW8A 3B2IA 4N7DA 1SWKA 5AEOA 1LCVA 1I9HA 5F6ZA 1A2DA 3NADA 4LKPA 5EPQA 1N9YA 1YP7A 2AT0X 4NV7A 1EXSA 2IZJA 1IKEA 1LCZA 5DG4A 5LJDA 3JQOA 1BJ7A 4EKVA 5IO5A 3EBWA 1LFOA 1HN2A 2L67A 4O9SA 4QZUA 1SWHA 4HPDA 2HMBA 3EYCA 4YKMA 4YVBA 1BRPA 3CKFA 4CV7A 2G78A 4IMNA 1RBPA 3RE5A 1A18A 3HWGA 3AEHA 4I60A 5IRUA 5HZ8A 3UAQA 1Y55X 2FWVA 4ZH6A 1HMRA 1LELA 2K62A 4Z2PA 4WFVA 2RTGB 1IFCA 1OEEA 3ZUIA 2X56A 3D4RA 1VWIB 2FS7A 4MVEA 1LIDA 2GTFX 5HTDA 2AF5A 1CBSA 1HBPA 4ZCBA 1VWDB 2AT6X
chains in the Genus database with same CATH topology
1SWCA 1NC9A 1SWAA 1SWQA 2A5CA 2BC3A 1VWEB 2IZEB 4OKAA 3VHMA 4BX7A 4Z27A 1SWTA 3WYPA 1VWJB 2C1SA 1SWFA 2RTAA 3MG5A 1STSB 1WBIA 4GGRA 1N7YA 1SRGA 1VYOA 2C1QA 1LUQA 1PTSA 1NDJA 1SLDB 2CAMA 2FHNX 4GD9A 4GGTA 4JNJA 4Y5DA 3T6FA 2RTNB 5F2BA 1RSTB 3WZNA 1MOYA 4BX6B 1VWPB 4GGZA 1SWLA 1SWPA 2F01A 2RTEB 2OF9A 4GDAA 1MK5A 4GJSA 5JD2A 2IZGB 4YVBA 4BX5B 2G5LA 3MM0A 3RDMA 1SRFA 2OFAA 2RTJA 1HQQA 5B5GA 3RE6A 4DNEA 1VWQB 1SWJA 2A5BA 3PK2A 3T2XA 1KFFA 2IZAA 1SWDA 2RTBB 5CSEA 1SREA 1VWKB 2RTCB 3VGWA 4JHQA 3EW1A 2IZCB 2IZHB 1MEPA 2OFBA 4Z6JA 3T2WA 2IZBA 1SWEA 4Y59A 3SZIA 1RXKA 2IZFB 3T6LA 3WZPA 1SLGB 1KL3A 1VWRB 1DF8A 1VWGB 1RSUB 5CHKA 1N4JA 1SWSA 1N9MA 2GH7A 2WPUA 2ZSCA 4IRWA 1AVDA 4CPFA 4BBOA 1VWCB 2RTRB 3WZQA 2RTFB 2UZ2A 2IZIA 2Y3EA 3VHIA 2IZKA 1SWBA 2RTQB 4BJ8A 2RTMA 4BCSA 3WYQA 5IRWA 3EW2A 3VHHA 1KL4A 1SRHA 2OF8A 2FHLA 2RTLA 4BX6A 3RY1A 2JGSA 4CPEA 1NBXA 1SWNA 4U46A 1Y52X 5K67A 1LDQA 1STRB 1SWRA 2RTIB 4BX5A 4CPIA 3FDCA 3RDXA 1STPA 2RTPB 4BX7B 5L3YA 2UYWA 2AVIA 2MF6A 3RY2A 1SRJA 3SZJA 4GJVA 3SZHA 4CPHB 3RDOA 3RDQA 1Y53X 2A8GA 1HXZA 4Z28A 3RDUA 4JO6A 1LDOA 2C4IA 1HXLA 1SLEB 2QCBA 1SWKA 5B5FA 1RAVA 2IZDB 1LCVA 1I9HA 3WZOA 1NQMA 1N9YA 4Z2VA 2IZJA 1LCZA 4EKVA 3RDSA 1NQNA 1RXJA 4CPHA 1SWHA 5IRAA 1HY2A 1SLFB 1SWOA 2RTDB 4Z2OA 1AVEA 1VWOB 2RTKA 1MM9A 2Y3FA 1LCWA 1IJ8A 3RE5A 5IRUA 4I60A 1RXHA 1Y55X 1LELA 4Z2PA 1VWFB 1VWLB 2RTGB 1SWGA 5K68A 3X00A 1N43A 1SWUA 1VWBB 1VWIB 2IZLB 2RTOB 1KL5A 1VWAB 1VWHB 2Y32A 1VWNB 1VWMB 1SRIA 2RTHB 1VWDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SWC A;  1NC9 A;  1SWA A;  1SWQ A;  2A5C A;  2BC3 A;  1VWE B;  2IZE B;  4OKA A;  3VHM A;  4BX7 A;  4Z27 A;  1SWT A;  3WYP A;  1VWJ B;  2C1S A;  1SWF A;  2RTA A;  3MG5 A;  1STS B;  1WBI A;  4GGR A;  1N7Y A;  1SRG A;  1VYO A;  2C1Q A;  1LUQ A;  1PTS A;  1NDJ A;  1SLD B;  2CAM A;  2FHN X;  4GD9 A;  4GGT A;  4JNJ A;  4Y5D A;  3T6F A;  2RTN B;  5F2B A;  1RST B;  3WZN A;  1MOY A;  4BX6 B;  1VWP B;  4GGZ A;  1SWL A;  1SWP A;  2F01 A;  2RTE B;  2OF9 A;  4GDA A;  1MK5 A;  4GJS A;  5JD2 A;  2IZG B;  4YVB A;  4BX5 B;  2G5L A;  3MM0 A;  3RDM A;  1SRF A;  2OFA A;  2RTJ A;  1HQQ A;  5B5G A;  3RE6 A;  4DNE A;  1VWQ B;  1SWJ A;  2A5B A;  3PK2 A;  3T2X A;  1KFF A;  2IZA A;  1SWD A;  2RTB B;  5CSE A;  1SRE A;  1VWK B;  2RTC B;  3VGW A;  4JHQ A;  3EW1 A;  2IZC B;  2IZH B;  1MEP A;  2OFB A;  4Z6J A;  3T2W A;  2IZB A;  1SWE A;  4Y59 A;  3SZI A;  1RXK A;  2IZF B;  3T6L A;  3WZP A;  1SLG B;  1KL3 A;  1VWR B;  1DF8 A;  1VWG B;  1RSU B;  5CHK A;  1N4J A;  1SWS A;  1N9M A;  2GH7 A;  2WPU A;  2ZSC A;  4IRW A;  1AVD A;  4CPF A;  4BBO A;  1VWC B;  2RTR B;  3WZQ A;  2RTF B;  2UZ2 A;  2IZI A;  2Y3E A;  3VHI A;  2IZK A;  1SWB A;  2RTQ B;  4BJ8 A;  2RTM A;  4BCS A;  3WYQ A;  5IRW A;  3EW2 A;  3VHH A;  1KL4 A;  1SRH A;  2OF8 A;  2FHL A;  2RTL A;  4BX6 A;  3RY1 A;  2JGS A;  4CPE A;  1NBX A;  1SWN A;  4U46 A;  1Y52 X;  5K67 A;  1LDQ A;  1STR B;  1SWR A;  2RTI B;  4BX5 A;  4CPI A;  3FDC A;  3RDX A;  1STP A;  2RTP B;  4BX7 B;  5L3Y A;  2UYW A;  2AVI A;  2MF6 A;  3RY2 A;  1SRJ A;  3SZJ A;  4GJV A;  3SZH A;  4CPH B;  3RDO A;  3RDQ A;  1Y53 X;  2A8G A;  1HXZ A;  4Z28 A;  3RDU A;  4JO6 A;  1LDO A;  2C4I A;  1HXL A;  1SLE B;  2QCB A;  1SWK A;  5B5F A;  1RAV A;  2IZD B;  1LCV A;  1I9H A;  3WZO A;  1NQM A;  1N9Y A;  4Z2V A;  2IZJ A;  1LCZ A;  4EKV A;  3RDS A;  1NQN A;  1RXJ A;  4CPH A;  1SWH A;  5IRA A;  1HY2 A;  1SLF B;  1SWO A;  2RTD B;  4Z2O A;  1AVE A;  1VWO B;  2RTK A;  1MM9 A;  2Y3F A;  1LCW A;  1IJ8 A;  3RE5 A;  5IRU A;  4I60 A;  1RXH A;  1Y55 X;  1LEL A;  4Z2P A;  1VWF B;  1VWL B;  2RTG B;  1SWG A;  5K68 A;  3X00 A;  1N43 A;  1SWU A;  1VWB B;  1VWI B;  2IZL B;  2RTO B;  1KL5 A;  1VWA B;  1VWH B;  2Y32 A;  1VWN B;  1VWM B;  1SRI A;  2RTH B;  1VWD B; 
#chains in the Genus database with same CATH topology
 4YGZ A;  2A5C A;  4OKA A;  2MM3 A;  3CQR A;  3O19 A;  2RA6 A;  3GAQ A;  1IW2 A;  1I4U A;  3PED A;  4YH0 A;  2F09 A;  1JMX A;  1EII A;  3RZY A;  1WBI A;  2G7B A;  2LA7 A;  2P8G A;  3APX A;  3B2K A;  4I3C A;  3DSZ A;  3JSQ A;  1KT5 A;  1NDJ A;  1PTS A;  3STM X;  3B2L A;  3LTW A;  4PSQ A;  5AJB A;  4ALB A;  1PBO A;  5CYB A;  2POA A;  4GK9 A;  5EDC A;  3WBG A;  1QY0 A;  1DZP A;  4BX6 B;  1MX7 A;  3CBS A;  4GGZ A;  3TGA A;  1SWL A;  4N7C A;  3WJE A;  4NLI A;  3D9W A;  3P6D A;  5H9N A;  3U0D A;  1CBI A;  4KH8 A;  1U17 A;  1LPJ A;  4MIR A;  5JD2 A;  2FRS A;  2RCQ A;  5H9A A;  1YWB A;  2HLV A;  2G5L A;  3FIQ A;  4QGW A;  3BS2 A;  4HPB A;  2OFA A;  4WBK A;  3RE6 A;  1UYO X;  2HKD A;  1BM5 A;  4IB8 A;  4YGH A;  1EI5 A;  1KFF A;  4DQ4 A;  2O62 A;  5B29 A;  1SRE A;  1VWK B;  1SA8 A;  3V8U A;  3VGW A;  3B2H A;  4L3R A;  5D4A A;  1ICM A;  2BT9 A;  1BSQ A;  1MEP A;  1ZNH A;  3FW4 A;  5EEE A;  2Q39 A;  3MX7 A;  4UU3 A;  2ALL X;  3KQ0 A;  3FW5 A;  3NBX X;  5HZQ A;  4DCB A;  3T6L A;  4TJZ A;  1DF8 A;  1QY1 A;  1Y9T A;  1E5P A;  4D6B A;  5CHK A;  4YDA A;  1ACD A;  2OL6 O;  2LBA A;  3FYF A;  3F9D A;  3NX1 A;  4GNY A;  2OY7 A;  5L8N A;  1AQB A;  3FEL A;  4BBO A;  3CWK A;  2OFR X;  4WHI A;  1T68 X;  5FQ8 E;  3WZQ A;  2RTF B;  5CE4 A;  5LJE A;  4U3Q A;  3SOT A;  4EEJ A;  1ZNE A;  4NW4 A;  4O49 A;  2IZK A;  1E02 A;  3HOL A;  1GX9 A;  4I9R A;  4BCS A;  3WYQ A;  2F73 A;  2NP1 A;  4CDE A;  5IRW A;  4U8U O;  1QY2 A;  2RTL A;  1JQP A;  3AKN A;  3FR4 A;  3KFF A;  4CPE A;  1SWN A;  1GGL A;  1Y52 X;  2QOS C;  3VG4 A;  2KTD A;  1G74 A;  1TOW A;  1X8P A;  1STP A;  5D45 A;  1EAL A;  4XME A;  5B2A O;  2K23 A;  3CKG A;  3AKM A;  2MF6 A;  3KFH A;  4YFQ A;  4O4U A;  5AJC A;  3SZJ A;  2JU7 A;  3SZH A;  1I78 A;  2LBV A;  4CPH B;  1S44 A;  1Y53 X;  3APU A;  1KXO A;  4WFU A;  1B8E A;  2CBS A;  4EXZ A;  2KW1 A;  1LDO A;  2C4I A;  1ZNG A;  3G7X A;  4I9S A;  1BSY A;  1KOI A;  4CDC A;  1NP1 A;  4MVL A;  1YWC A;  5B5F A;  4ZHF A;  2IZD B;  2MJI A;  3WZO A;  1W5R A;  1I05 A;  1NQM A;  5DPQ A;  2QM9 A;  4TKB A;  4Z2V A;  3HWF A;  2QO5 A;  4GKC A;  2X34 A;  4KC7 A;  1SMP I;  4LKT A;  1RXJ A;  4Y0S A;  1GX8 A;  3VE1 A;  1SWO A;  3WJC A;  1JJJ A;  3BY0 A;  4A60 A;  4YMY A;  4EQA C;  1Z24 A;  3U03 A;  3U9P C;  1HBQ A;  2QO4 A;  2Y3F A;  3EBK A;  4XMH A;  2QO6 A;  3P02 A;  1DV9 A;  1U18 A;  2W2B A;  3C76 X;  4NYR A;  5HCE C;  5HA0 A;  3LHN A;  1VPR A;  4OMX A;  3X00 A;  1K3B A;  4ORU A;  2VDF A;  1VWB B;  4U8U M;  1W6F A;  2IZL B;  5FFH A;  3ZUO A;  3APV A;  3E3C A;  2RTO B;  3WVM A;  1VWH B;  3OE3 A;  1MDC A;  2HZQ A;  1VWM B;  4GU8 A;  4O4X A;  2OL8 O;  5D47 A;  3OJY C;  3BU1 A;  1FE3 A;  4CK4 A;  4EDE A;  1SWC A;  1NC9 A;  2BC3 A;  4BX7 A;  3VG6 A;  3WJD A;  4Z27 A;  3IFB A;  1SWT A;  3BLG A;  4ZHH A;  1X8Q A;  4UU2 A;  1SY3 A;  4A8Z A;  2RTA A;  3MG5 A;  5HWZ A;  1STS B;  4GGR A;  1QFV A;  3C78 X;  4GUZ A;  2Q2P A;  4CDF A;  4FGI B;  3C77 X;  3FA9 A;  2CAM A;  4GD9 A;  3S26 A;  1I04 A;  2JMB A;  5H9K A;  5F1E A;  3WZN A;  1EPB A;  2XST A;  1X89 A;  1IIU A;  2BSZ A;  2VFB A;  1SWP A;  4O4O A;  4C5P A;  2OF9 A;  4PJ2 A;  2MO5 A;  1FEN A;  5D8J A;  2JU8 A;  4FBV A;  4BX5 B;  3MVF A;  4I6S A;  1VYG A;  1SRF A;  3VPJ E;  4AYH A;  4CSB A;  3FEK A;  1OPB A;  4ORY A;  5LJG A;  2A5B A;  2AH7 X;  3ELZ A;  1I06 A;  3UEV A;  3T2X A;  3ZI8 A;  1LIC A;  2IZA A;  1SWD A;  3NQ3 A;  4HWM A;  5CSE A;  3RBY A;  3IA8 A;  3STN A;  3ZW0 B;  3ZZV A;  1B0O A;  1VYF A;  2LB6 A;  3CQN A;  3EW1 A;  4JHQ A;  4ZH9 A;  3T1D A;  3P6F A;  3KVN A;  2IZB A;  1SWE A;  4Y59 A;  4A1Y A;  2X55 A;  4AZP A;  2A0A A;  3NR3 A;  5LJC A;  5EDB A;  2X8T A;  1ERB A;  1KL3 A;  2M4L A;  4GE1 A;  1EQD A;  2FGS A;  5LKE A;  4TQ2 A;  2ASN X;  1SWS A;  5D48 A;  3UEU A;  2WPU A;  3ZW1 A;  1DF3 A;  3O2Y A;  1NGL A;  1AVD A;  1MX8 A;  2AT3 X;  4MVI A;  1ZNK A;  1OSP O;  4O3W A;  4FQB B;  2GC9 A;  1SXU A;  5EED A;  4CPF A;  5HZ6 A;  1ZNL A;  2A3F X;  4MIS A;  3WJG A;  1QG5 A;  2HYS A;  4QYP A;  1UZ2 X;  3UEW A;  1JYJ A;  4YBP A;  1A3Y A;  2QMI A;  3NQ9 A;  4ZHC A;  5F58 A;  4TKJ A;  2Q2M A;  3OBL A;  2OFM X;  4OEL A;  2RTQ B;  4BJ8 A;  1R0U A;  1URE A;  2RTM A;  2RN4 A;  1KL4 A;  5B10 O;  2OVA A;  3K3L A;  1ERX A;  2JW1 A;  5FEN A;  4FBR A;  3RY1 A;  1TVQ A;  4O3X B;  2JGS A;  3I17 A;  4YFP A;  4TKH A;  4GZV A;  5LJH A;  2WSJ A;  1KT7 A;  3VE2 A;  1STR B;  3CBC A;  1LKE A;  4ES7 A;  4IAW A;  2X45 A;  1RLB E;  4QGX A;  2AT8 X;  5L3Y A;  2HZR A;  3STK A;  5B27 A;  2UYW A;  4ON1 A;  2WUT A;  2AVI A;  1D3S A;  1CRB A;  5KID A;  4IBA A;  3PQS A;  3RDQ A;  4AZM A;  4A1H A;  3NQK A;  1XKI A;  2A8G A;  3PQU A;  3RDU A;  4D6A A;  2PY1 A;  1GT5 A;  3D97 A;  3N91 A;  1JBH A;  2CM4 A;  3PH5 A;  4BOE A;  4I95 A;  3BX8 A;  3CMP A;  4HPA A;  4ML7 B;  3DTQ A;  2CBR A;  4ID2 A;  1OPA A;  4MVK A;  3S5X A;  2Q4N A;  4IB9 A;  3S60 A;  3D95 A;  1GKA A;  3VG5 A;  1JJU A;  3RDS A;  1NQN A;  4CPH A;  4ZFX A;  5IRA A;  1HY2 A;  1SLF B;  2RTD B;  2WEX A;  1BLR A;  1AVE A;  1X8U A;  2RTK A;  3BU9 A;  1SXX A;  3PEC A;  1MM9 A;  4IAX A;  4KCA A;  1TXL A;  2BS6 A;  3P6H A;  2WR6 A;  2GTL O;  3ZQ3 A;  4O3Z A;  3QQ2 A;  5FQ6 E;  1VWF B;  3LV4 A;  1VWL B;  1GX3 A;  2BS5 A;  1N43 A;  1EUO A;  4U8U N;  3P24 A;  1G7N A;  1FEL A;  3FR2 A;  1DFV A;  1KL5 A;  5LKF A;  4GNW A;  1SRI A;  5F7G A;  3SLT A;  1Y0G A;  1DC9 A;  4XMC A;  1PM1 X;  1SWA A;  2NNE A;  1VWE B;  3VHM A;  2WQ9 A;  2WWP A;  3PP6 A;  3EM0 A;  1ALB A;  1VWJ B;  2C1S A;  2W2A A;  2A13 A;  2L5P A;  2LFO A;  2X32 A;  4GH7 A;  1JZU A;  1N7Y A;  4AZN A;  4KII A;  1X8O A;  2FKG A;  2C1Q A;  5H9L A;  3PDF A;  3T6F A;  4QYN A;  1CBQ A;  2N93 A;  2RTN B;  4R0B A;  5F2B A;  3WOV A;  1IKJ A;  2G79 A;  4TLJ A;  1VWP B;  1S7D A;  2AKQ A;  2F01 A;  2NNQ A;  2RTE B;  4GDZ A;  2FS6 A;  4M6S A;  2JN3 A;  1DZK A;  1MVG A;  4Y0R A;  3Q6L A;  5HTE A;  3UEX A;  1SXW A;  3FR5 A;  4JGL A;  2YMS A;  4DNE A;  1HMT A;  1VWQ B;  1SWJ A;  3EMM A;  5F6B A;  2A2U A;  3PK2 A;  4ZHG A;  5KIC A;  2L9C A;  1ZND A;  2RTB B;  4LQZ A;  1LNM A;  2W2F A;  2GTL M;  3SAO A;  2DJF A;  2FTB A;  5C0N A;  2IZC B;  1PBY A;  2QOM A;  2OFB A;  2FKJ A;  4ZJ0 A;  3Q34 A;  3WZP A;  1FEM A;  4YBU A;  4KT5 A;  1VWR B;  3FA7 A;  1PMP A;  1JMZ A;  2PI3 O;  5HCD C;  2JOZ A;  1VWG B;  4I3B A;  1RSU B;  4NNT A;  1UYN X;  5EZ2 A;  4BVM A;  1N9M A;  3HK1 A;  4GET A;  2ZSC A;  3KFI A;  1BBP A;  2CZU A;  3JS1 A;  1JJX A;  4O4S A;  1LIF A;  4IMO A;  3D96 A;  3TGB A;  1BRQ A;  2UZ2 A;  2RCT A;  3B2J A;  3FA6 A;  1HQP A;  1OEJ A;  2Y3E A;  2Z4I A;  1QFT A;  4BQU A;  3RKG A;  4ALO A;  4ZR2 A;  1EPA A;  3RSW A;  1CBR A;  1T8V A;  1QQS A;  1TOU A;  1ICN A;  3EW2 A;  4HFO A;  4LZU A;  1X71 A;  3TF6 A;  1SY2 A;  4ARH A;  4BX6 A;  1AB0 A;  2ACP X;  2X8S A;  4NP1 A;  1NBX A;  4NV8 A;  3BSZ E;  4U46 A;  2AT5 X;  5FQ7 E;  5BVT A;  1KGL A;  1JIW I;  4YDB A;  2HNX A;  3VU1 A;  1FDQ A;  1GM6 A;  1LDQ A;  1SWR A;  1ZRY A;  1OEK A;  3FDC A;  3RDX A;  4QGV A;  2RTP B;  4BX7 B;  4NYQ A;  1KQW A;  1KZW A;  4ZGU A;  3NPO A;  3CR6 A;  2RD7 C;  3ELX A;  3RY2 A;  2E4J A;  2YG2 A;  3O22 A;  4GJV A;  2L68 A;  3NX2 A;  1ML7 A;  3RDO A;  1DZM A;  1O8V A;  2MWH A;  4Y0P A;  5BVQ A;  4ODD A;  2AMM X;  4Z28 A;  3EC5 A;  1KQX A;  1NP4 A;  5HA1 A;  2OVD A;  4JO6 A;  1Y9L A;  4AZO A;  4HPC A;  3APW A;  2QCB A;  5K06 A;  4QNI A;  5HCC C;  5IO6 A;  5KHP A;  1RAV A;  2OVS A;  4BGF A;  5BVS A;  3BDR A;  2R73 A;  5AQ6 A;  1BSO A;  3KZA A;  3SLJ A;  1XCA A;  1AEL A;  1SY1 A;  1E00 A;  2I5Z O;  4OMW A;  3ZWE A;  1N0S A;  3ZW2 A;  4Z2O A;  2FR3 A;  3OD9 A;  4OS3 A;  1VWO B;  5B3M O;  4RUN A;  3F8A A;  3PPT A;  4YKO A;  5L8I A;  5LJB A;  2OYB O;  1EW3 A;  1LCW A;  1OBU A;  4EFG A;  1IJ8 A;  2X46 A;  4QQ1 A;  4U9C A;  1JYD A;  1RXH A;  4ORR A;  3VG2 A;  4XMF A;  2OY5 O;  4K19 A;  4RUU A;  3PH6 A;  1SY0 A;  1SWG A;  1SXY A;  2FT9 A;  4FBO A;  1SWU A;  4QAE A;  5K68 A;  1BWY A;  3HWE A;  1GT4 A;  2GJ5 A;  2BHV A;  3F6Z B;  2R56 A;  1VWA B;  1X8N A;  2WEW A;  2Y32 A;  3FID A;  1VWN B;  4IB6 A;  3BRN A;  4L1N A;  4COT A;  5IO7 A;  2RTH B;  2ZAG A;  1KT6 A;  2IZG B;  3P6E A;  3ZW1 B;  3RWX A;  1YUP A;  2X8F A;  1SWQ A;  1S2P A;  4IB7 A;  2IZE B;  4AZQ A;  5LJK A;  3TGC A;  3I0A A;  3WYP A;  2KTS A;  5HAE A;  5IXG A;  1B4M A;  1SWF A;  1D2U A;  3QKG A;  4LZV A;  1O1U A;  5HBS A;  1SRG A;  4MEE A;  1VYO A;  4GGT A;  1LUQ A;  1SLD B;  2A2G A;  1YIV A;  4JNJ A;  2FHN X;  4Y5D A;  3VG7 A;  1MUP A;  4XMG A;  3P6C A;  5BYP A;  2BLG A;  3MBT A;  1E06 A;  1RST B;  1MOY A;  2RQ0 A;  5JR8 A;  1K24 A;  4QZT A;  3HPE A;  1WUB A;  5HZ9 A;  1EIO A;  1AVG I;  5B11 O;  1ADL A;  3H3I A;  4GDA A;  1FJ1 E;  1TW4 A;  2MHD A;  1MK5 A;  4GJS A;  4AZR A;  1E2T A;  4YGG A;  2NND A;  1LIE A;  2XKL A;  4INN A;  1PEE A;  1BEB A;  3MM0 A;  3RDM A;  1IFB A;  1A57 A;  2RTJ A;  1HQQ A;  4OEM A;  4KC8 A;  4OS8 A;  5B5G A;  4ZGF A;  4DQ3 A;  2ACO A;  1GT3 A;  2ANS A;  1KZX A;  2GTL N;  2RTC B;  1HMS A;  1U0X A;  4M7M A;  4CDD A;  5L8O A;  4I3D A;  1QWD A;  3AUM O;  4OS0 A;  2IZH B;  4ORX A;  3FMZ A;  4TNN A;  3WJF A;  4Z6J A;  3T2W A;  1OBQ A;  2DJG A;  2OVE A;  3SZI A;  1G85 A;  3BX7 A;  1OBP A;  1RXK A;  1QAB E;  2IZF B;  2OZQ A;  1SLG B;  1CJ5 A;  4ZHD A;  1GXA A;  2CM9 A;  3VG3 A;  3FA8 A;  1N4J A;  1GKA B;  2GH7 A;  4IRW A;  4YCH A;  3WXQ A;  2EU7 X;  1GT1 A;  2WQA E;  4O3Y A;  4YCE A;  2VFC A;  1VWC B;  3HWD A;  2RTR B;  3FEP A;  4GRJ A;  1YP6 A;  3KFG A;  1G5W A;  2IZI A;  2LKK A;  1L6M A;  1P6P A;  3VHI A;  1FTP A;  1SWB A;  2FR2 A;  2JU3 A;  3HTY A;  4B55 A;  4IAB A;  1KT3 A;  1YWD A;  2FLJ A;  1W4T A;  4NLJ A;  1H91 A;  1YWA A;  3TZS A;  2I5V O;  3VHH A;  1SRH A;  1T0V A;  1O1V A;  1B56 A;  2FHL A;  2OF8 A;  2OY8 A;  2Z4H A;  3FLL A;  2X4M A;  2DM5 A;  2OY1 O;  3FEN A;  3GE2 A;  4XMD A;  3P6G A;  3S5V A;  2Q9S A;  1JV4 A;  4NNS A;  2IFB A;  1LIB A;  5K67 A;  4CPI A;  4BX5 A;  2RTI B;  1KT4 A;  4ORS A;  5H8T A;  2AL0 X;  3NP1 A;  2ZAI A;  2G8C O;  1SRJ A;  3SLO A;  4YFR A;  2KT4 B;  3WJB A;  3L4R A;  4QRL A;  4ORW A;  2KD2 A;  3ZW0 A;  1HXZ A;  3HOE A;  2CZT A;  4Y0Q A;  1DZJ A;  2R74 A;  5FAZ A;  2OL7 A;  5HZ5 A;  1HXL A;  1LF7 A;  1SLE B;  4AW8 A;  3B2I A;  4N7D A;  1SWK A;  5AEO A;  1LCV A;  1I9H A;  5F6Z A;  1A2D A;  3NAD A;  4LKP A;  5EPQ A;  1N9Y A;  1YP7 A;  2AT0 X;  4NV7 A;  1EXS A;  2IZJ A;  1IKE A;  1LCZ A;  5DG4 A;  5LJD A;  3JQO A;  1BJ7 A;  4EKV A;  5IO5 A;  3EBW A;  1LFO A;  1HN2 A;  2L67 A;  4O9S A;  4QZU A;  1SWH A;  4HPD A;  2HMB A;  3EYC A;  4YKM A;  4YVB A;  1BRP A;  3CKF A;  4CV7 A;  2G78 A;  4IMN A;  1RBP A;  3RE5 A;  1A18 A;  3HWG A;  3AEH A;  4I60 A;  5IRU A;  5HZ8 A;  3UAQ A;  1Y55 X;  2FWV A;  4ZH6 A;  1HMR A;  1LEL A;  2K62 A;  4Z2P A;  4WFV A;  2RTG B;  1IFC A;  1OEE A;  3ZUI A;  2X56 A;  3D4R A;  1VWI B;  2FS7 A;  4MVE A;  1LID A;  2GTF X;  5HTD A;  2AF5 A;  1CBS A;  1HBP A;  4ZCB A;  1VWD B;  2AT6 X; 
#chains in the Genus database with same CATH homology
 1SWC A;  1NC9 A;  1SWA A;  1SWQ A;  2A5C A;  2BC3 A;  1VWE B;  2IZE B;  4OKA A;  3VHM A;  4BX7 A;  4Z27 A;  1SWT A;  3WYP A;  1VWJ B;  2C1S A;  1SWF A;  2RTA A;  3MG5 A;  1STS B;  1WBI A;  4GGR A;  1N7Y A;  1SRG A;  1VYO A;  2C1Q A;  1LUQ A;  1PTS A;  1NDJ A;  1SLD B;  2CAM A;  2FHN X;  4GD9 A;  4GGT A;  4JNJ A;  4Y5D A;  3T6F A;  2RTN B;  5F2B A;  1RST B;  3WZN A;  1MOY A;  4BX6 B;  1VWP B;  4GGZ A;  1SWL A;  1SWP A;  2F01 A;  2RTE B;  2OF9 A;  4GDA A;  1MK5 A;  4GJS A;  5JD2 A;  2IZG B;  4YVB A;  4BX5 B;  2G5L A;  3MM0 A;  3RDM A;  1SRF A;  2OFA A;  2RTJ A;  1HQQ A;  5B5G A;  3RE6 A;  4DNE A;  1VWQ B;  1SWJ A;  2A5B A;  3PK2 A;  3T2X A;  1KFF A;  2IZA A;  1SWD A;  2RTB B;  5CSE A;  1SRE A;  1VWK B;  2RTC B;  3VGW A;  4JHQ A;  3EW1 A;  2IZC B;  2IZH B;  1MEP A;  2OFB A;  4Z6J A;  3T2W A;  2IZB A;  1SWE A;  4Y59 A;  3SZI A;  1RXK A;  2IZF B;  3T6L A;  3WZP A;  1SLG B;  1KL3 A;  1VWR B;  1DF8 A;  1VWG B;  1RSU B;  5CHK A;  1N4J A;  1SWS A;  1N9M A;  2GH7 A;  2WPU A;  2ZSC A;  4IRW A;  1AVD A;  4CPF A;  4BBO A;  1VWC B;  2RTR B;  3WZQ A;  2RTF B;  2UZ2 A;  2IZI A;  2Y3E A;  3VHI A;  2IZK A;  1SWB A;  2RTQ B;  4BJ8 A;  2RTM A;  4BCS A;  3WYQ A;  5IRW A;  3EW2 A;  3VHH A;  1KL4 A;  1SRH A;  2OF8 A;  2FHL A;  2RTL A;  4BX6 A;  3RY1 A;  2JGS A;  4CPE A;  1NBX A;  1SWN A;  4U46 A;  1Y52 X;  5K67 A;  1LDQ A;  1STR B;  1SWR A;  2RTI B;  4BX5 A;  4CPI A;  3FDC A;  3RDX A;  1STP A;  2RTP B;  4BX7 B;  5L3Y A;  2UYW A;  2AVI A;  2MF6 A;  3RY2 A;  1SRJ A;  3SZJ A;  4GJV A;  3SZH A;  4CPH B;  3RDO A;  3RDQ A;  1Y53 X;  2A8G A;  1HXZ A;  4Z28 A;  3RDU A;  4JO6 A;  1LDO A;  2C4I A;  1HXL A;  1SLE B;  2QCB A;  1SWK A;  5B5F A;  1RAV A;  2IZD B;  1LCV A;  1I9H A;  3WZO A;  1NQM A;  1N9Y A;  4Z2V A;  2IZJ A;  1LCZ A;  4EKV A;  3RDS A;  1NQN A;  1RXJ A;  4CPH A;  1SWH A;  5IRA A;  1HY2 A;  1SLF B;  1SWO A;  2RTD B;  4Z2O A;  1AVE A;  1VWO B;  2RTK A;  1MM9 A;  2Y3F A;  1LCW A;  1IJ8 A;  3RE5 A;  5IRU A;  4I60 A;  1RXH A;  1Y55 X;  1LEL A;  4Z2P A;  1VWF B;  1VWL B;  2RTG B;  1SWG A;  5K68 A;  3X00 A;  1N43 A;  1SWU A;  1VWB B;  1VWI B;  2IZL B;  2RTO B;  1KL5 A;  1VWA B;  1VWH B;  2Y32 A;  1VWN B;  1VWM B;  1SRI A;  2RTH B;  1VWD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...