1LD7A

Co-crystal structure of human farnesyltransferase with farnesyldiphosphate and inhibitor compound 66
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
313
structure length
313
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3-Aminopyrrolidinone farnesyltransferase inhibitors: design of macrocyclic compounds with improved pharmacokinetics and excellent cell potency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords protein farnesyltransferase alpha subunit
total genus 125
structure length 313
sequence length 313
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1ld7A00
4YDEA 3PZ2A 3EU5A 2ZISA 1TN6A 1SA5A 4L9PA 1NI1A 3KSLA 3Q7FA 1N94A 4GTRA 2R2LA 1N4PA 3DSUA 3DSVA 3DSTA 3PZ1A 1NL4A 1DCEA 1O1TA 1TN8A 3Q73A 1LD8A 1O5MA 3Q78A 3C72A 3DSXA 3PZ4A 4GTQA 4YDOA 1KZOA 3Q79A 1LD7A 4LNBA 3E32A 2ZIRA 1TNOA 2H6FA 3E34A 1D8DA 3DRAA 1JCQA 1JCRA 3EUVA 1TNZA 2H6IA 1S63A 1O1SA 4LNGA 3HXBA 4GTPA 3HXFA 4GTTA 3HXEA 1SA4A 1D8EA 3DSWA 1JCSA 3HXDA 1N95A 3DPYA 1FT1A 3E37A 1X81A 1N4SA 4MBGA 1KZPA 4GTMA 2H6GA 2F0YA 3E30A 3SFXA 1S64A 1FPPA 1O1RA 1N9AA 1LTXA 2BEDA 1FT2A 1MZCA 1N4QA 1TNBA 4GTVA 1QBQA 2IEJA 3E33A 1TNUA 4EHMA 1TNYA 3SFYA 1TN7A 3KSQA 3PZ3A 4GTOA 3HXCA 3Q7AA 3Q75A 2H6HA 4GTSA 1N4RA 3DSSA
chains in the Genus database with same CATH superfamily
2WXHA 3KEZA 4L2YA 5FJYA 1BI8B 2LSVA 4OVVA 4N39A 1SQMA 4ILHB 2XRYA 2R2LA 3UMVA 3QC1A 1N4PA 4B8CB 4E85A 4GZ5A 4JPSA 3PEUB 1BU9A 4I6GA 3C3QA 3APFA 5B1BE 3ZHEA 1RW2A 3P2BA 2DYSE 4UUCA 4G26A 4GAAA 1SZAA 4JD2G 2UY1A 3ML8A 2IO3C 1MX2A 3PH0C 1NP7A 5HI7A 3CIAA 1BI7B 2J07A 4I9CA 2P9PG 3PUKA 3CKBA 3MV2B 4O1OA 2WQHA 2XPYA 4GTPA 5FQ4A 2XPIA 3FTUA 3ASFA 4WUYA 5G05J 4RLYA 5FZQA 3FH7A 4HI9A 1TYQG 4Z68A 5T8IA 1IQRA 2CG2A 3E30A 3SFXA 2ETBA 2QFCA 4MLPA 3LYAA 3CK9A 2YHEA 3T8KA 2X3MA 2MYOA 4FLHA 5ENOD 3ZHEB 3PZDA 4UWHA 1Y8MA 3S7BA 1L5JA 2XGMA 4RQIA 3L82A 2GRNB 2FF4A 4LRZA 1WM5A 2XZDG 3KSQA 5C1DA 3FTSA 3PE3A 3FUNA 3MA5A 4G1TA 1N4RA 1OCZE 1BLXB 4AOFA 4K5BA 4N5QA 3I3NA 1PY1A 1E8XA 1SA5A 3ZEFA 4J8FA 1A5EA 4UI9C 3KD7A 1OCCE 4K03A 4JA7A 3Q9UC 3PZ1A 5DBKA 2NSZA 3D9NA 2DBAA 5KJMA 3DSXA 2AXUA 2J4BA 2V4LA 2ZIRA 4DRXE 4N5CA 4GB9A 3G2UA 1N11A 3L13A 5BNWA 2Y1LE 4UWFA 3X2QE 4ATZD 4DI4A 4G23A 4N2QA 4JHRA 4F1SA 3RRNB 4O1PA 4U0SA 2HR2A 4U04A 4KXKB 3CVVA 3LDZA 3FUDA 4NIKA 1FCHA 1JPLA 2F37A 3UM0A 4HS2A 3HXDA 4ATGA 3E37A 5G04J 1KZPA 3JUIA 3W9GA 5IY5E 2F0YA 2OEWA 1EYHA 2EIME 4N3BA 3CGHA 4Q69A 2AW6A 4HFGA 5JMND 1K3ZD 3PDNA 4HRMB 4IYPA 1ELRA 3TL5A 3MCXA 5CCLA 3MX3A 4RG9A 4B94A 1KLXA 2CFZA 3HDXA 2C0LA 1NA0A 3ZGQA 4BT8A 3ENEA 2VGYA 3PREA 5CEDB 1W3BA 1N94A 3K9IA 4ILIA 4MKTA 4KZ0A 2WXFA 1WAO1 3CHRA 4XI0A 3Q73A 3O48A 1KZOA 2AJAA 3PRZA 3D9MA 2F8YA 2A5EA 2MRIA 2YHCA 1K1AA 2CHWA 2H6IA 3J5QB 1EPUA 3ZXPA 3QAQA 4LNGA 1ZB1A 5CMYA 3HVEA 3KAEA 1IXVA 4L7TA 3D9KA 3NAWA 4HOUA 2PM6A 3P1UA 1IHGA 3VLDA 3MKQB 3L08A 3S7FA 1MX4A 5LP0A 3OXFA 3R7QA 3UTMA 2AVPA 4GPMA 1OUVA 2BUGA 1QZ2A 3AAAC 4GZDA 3ASNE 3HYMB 1HFAA 5AIJA 2ONDA 4LSZE 4GTOA 4EECA 1E90A 2X6FA 4AIFA 4LG6A 3TGOA 4N3CA 2KZTB 5B3SE 4C9BB 2MOWA 3PUJA 3PEVB 1DCEA 3UT4A 4G8LA 4RG6A 2KCKA 3PVLA 5G04C 4H7XA 1NZNA 2OVFA 2IF4A 4AJWA 3EIQC 3B7TA 1TNZA 3ONKA 1TJCA 4U96D 3FUKA 3G2WA 3UKRG 5ENPD 5LCWC 4ANVA 2P9SG 4QFVA 4DX7D 4EPZA 3TWSA 3QJZA 3FU5A 3V2XA 4PUCA 1E7VA 3RAUA 1LTXA 3CVWA 1IKND 3TXMA 4YDWA 2I9CA 4JB8P 2IOSA 1A17A 2DYRE 3FHEA 4J8SA 2J4DA 5BPPA 4CRWA 3IKOB 1TNYA 3PNTB 2WQ6A 2BKKB 5LX8A 3ZXSA 3EHMA 1N0RA 2X38A 5AJDA 3ZYKA 4BX9A 1HZ4A 2QYJA 3UI2A 4CT0A 2EIKE 2HM8A 3LCAA 4GTRA 4XE0A 2L9BA 5AENA 3HHMA 4JVSA 3DSUA 3DSVA 4DLOA 1FVHA 1TN8A 1E7UA 2DZOA 1WY6A 4UWLA 5HKPA 3IEGA 4OVUA 1TNOA 4XX5A 3O4ZA 4JW1A 3RRMB 5BT1A 2V8SE 4TUMA 4AM9A 4EQFA 3UIPC 1HX8A 1S63A 3UXGA 3NB2A 4FC8A 3U66A 1N54A 3OTNA 1N0QA 4DX2A 3FU6A 2I1JA 3JXIA 1D8EA 2WMOA 4J0UA 3B7SA 4JL0A 4B89A 2L6JA 4CGVA 4H7YA 5ANRA 3CVUA 1WG0A 3NQPA 2EIJE 3G2TA 2GRRB 5BUZA 2LNIA 4BY6A 4BWRA 3IBEA 4FU3A 1JWGA 4UWKA 4A3VA 3BG0B 5CRUA 3CVXA 3NOCD 5KNHD 4AP2A 4JEHA 3D9PA 3UM3A 2V4HC 3F6QA 3UIOC 3FTVA 2LAIA 4XKCA 3FEYA 5CBOA 3L6AA 1E8WA 5D0QD 5EX0A 2FO1E 4DUIA 3Q7AA 5AYWD 1TR4A 3AS4A 1Z6TA 2DIWA 5CMWA 2AXZA 4YDEA 2KBXA 2IO2C 4U0UA 4GU5A 2WXLA 3ZPJA 3AU4A 3ASHA 3D3MA 3FH5A 3CHPA 3RK6A 2QY7A 4FJYA 4B0ZA 2YNQA 4HOSA 2GRPB 3ABKE 3Q79A 4N3AA 3DPDA 4YDYA 1MX6A 3TWXA 1D8DA 2KCLA 3EU9A 1HXIA 3L16A 3N71A 3QWWA 1DCQA 5JA4D 4V3IA 4XKBA 2Y4TA 3FTXA 2VYIA 3RU0A 1TEZA 3VTYA 3CEQA 2P9LG 5B1AE 3LS8A 4WNFA 5HQ8A 4JEUA 1B89A 2IU1A 3SY2A 3S7DA 3SF4A 3ZW3A 3ZVVA 4GTMA 4BX8A 4HNAD 3KEAA 1D9SA 3CK8A 1IQUA 4GA2A 4LNUD 1H6KA 5J08A 1ELWA 2VJ8A 1E96B 1WDYA 3ML9A 4RVBA 4C0EA 3HG0D 5CECB 3JXJA 1U2VG 1S70B 2ZU6B 4KMOA 5AQAA 3V79K 3B7UX 2KATA 4G25A 3G2SA 3FEXA 3UM2A 3KSLA 2DZNA 1UOHA 1X5BA 1ELKA 3UINC 1LD8A 1UJJA 3Q78A 1AWCB 3C72A 4E6HA 1OT8A 3ISMC 4LCTA 2IOLA 3UT7A 3DRAA 3D9OA 3LVQE 4PS7A 2AWIA 3L9TA 4I1AA 2NYJA 3SO8A 5FZRA 3ZUVB 2LXMA 2XGSA 3QARA 5ENRD 3TWUA 3URZA 5AAOA 3PE4A 4DX6D 1EDUA 3GZSA 4M3OA 1HE8A 3Q5MA 4EZLA 2OOEA 4ACLA 3B95A 2ZGDA 4ANWA 2CG3A 1QQEA 3SBTB 2WM9A 1AP7A 4JA9A 4CDNA 2GRMA 3CQGB 3OAWA 3FTWA 1H6OA 2X6KA 3NZSA 3MKRA 3FDHA 1KT0A 4HVBA 3FTZA 4A1SA 3JQ0A 3U3WA 5AQBA 4JHKA 3JUEA 3U64A 2WB2A 3U9WA 2FULA 3FU3A 4I1MA 3PZ4A 4YDOA 2CHXA 4HOQA 2X6HA 4IRUA 4J6IA 4BSXA 1PC2A 3SQVA 4PS8A 3SNXA 5EIBE 2CFUA 2L0IA 3JCKC 3CVYA 3I5PA 5ANLA 2XCCA 4XIFA 2VSXE 4I6JA 2IQCA 2LXLA 3T5VA 3FP3A 3UM1A 1XGWA 5T3RA 2Y4UA 4PDXA 1N95A 4N2SA 4CYMD 2KZTA 2A4ZA 1SW6A 3RSEG 5KWDA 2XRZA 3ASGA 2XEEA 3LVRE 3ZYLA 2P9KG 4I17A 1PAQA 4DX5D 2R17C 3S2AA 2WXPA 3R7RA 4G2VA 4FJZA 5JHBA 3GYZA 3QNKA 3D9HA 4AEZC 2H6HA 3V2OA 1HH8A 3UKUG 3QDNA 4O60A 5LFAA 5J90A 4HLLA 2VGEA 4C48B 5FT9A 5CERB 1O1TA 5AARA 1E8YA 1GW6A 1HF8A 1UJKA 2JLBA 2VSNA 3FU0A 3LJ3A 3ZRHA 3E32A 3TWQA 3R9MA 4ANUA 5FWQA 4HB5A 4OAUC 3ZYMA 3D9JA 1UN8A 1HG5A 5DIZA 3Q15A 3Q49B 3RO2A 2AXVA 2FI7A 1OY3D 1V55E 3SFZA 4Y6WA 3IHVA 1O1SA 3CHOA 4EBAA 1OWOA 3L17A 4AV7A 1Y6IA 1P5QA 2ZXWE 5HS0A 2PQRA 1JCSA 4EBAG 4QQIA 1FT1A 1KPSB 4JXTA 5H7PA 4HRLA 1U3CA 2KC7A 1N9AA 2PZIA 2BEDA 2WVIA 5EX3A 5JJ6A 5C2YA 4YNDA 3EHQA 2XPZA 1K8KG 4GYWA 2IEJA 4ACKA 2XCBA 2VGXB 5EIDA 3CVLA 2R03A 4TV3A 3FUHA 3D9LA 3IHYA 5CHEE 2IFUA 3DXMG 2NXPA 4HOTA 2WMNA 3ASDA 3QWPA 5ENTD 3T8MA 5FINA 4J8EA 2GRQB 3RO3A 5E75A 4ILGA 5AJLA 1JUQA 2Y3AA 3OXGA 4CCAA 4BETA 3ABLE 3UQ3A 2I2OA 3TWRA 4CDRA 4UI9K 5BW8C 2V5QC 2P58C 5CCMA 3ULQA 4LERA 5AN8A 4GYYA 4CDMA 4YVQC 1JCQA 1E8ZA 1Z3YA 3B13A 2L0TB 4B93B 2LUHA 4GPKA 3L54A 3HXBA 3CV0A 4KYOB 3ZKJA 4LUNU 3G2VA 2XZTG 4GCNA 4U7EB 2GGFA 2RFMA 1SZ9A 3R9AB 3PNLB 5ENNA 4DK5A 4PS3A 5ENQD 2WXNA 1H6PA 4TRQA 5G2NA 2XEVA 3FH8A 5JJ7A 2P9IG 5JJTA 3AJIA 3MEKA 1H2VC 2HYZA 2EQXA 4CEMA 4K5AB 1TNBA 2BTDA 3E4BA 4LEUA 3MKQA 5D66A 1H0AA 2JABA 2XS1A 3MJWA 3SFYA 4JC8A 4BESA 2BF0X 5ARFA 3C5RA 3IV0A 3SGHA 3BG1B 5E76A 3FFLA 2X6JA 4APFA 3DSSA 4NQ0A 2KM4A 5KJKA 3PZ2A 2I1KA 2RKKA 3CSFA 4L9PA 2E0IA 4WWNA 1NA3A 4A1GA 2J49A 3EHRA 3ZNGA 1HU3A 2WQ7A 1DC2A 4G24A 5EYLA 2KCVA 1BD8A 3UT8A 1V54E 4FP7A 5A7DB 4HBDA 3BUAA 3LXUX 1Z3XA 2ILRA 4IULA 3EIJA 1ZU2A 3TJPA 4KBQA 3FUFA 1HG2A 4TXQA 2QZAA 3BQOA 2P9UG 1OCRE 4GCOA 3CSTA 3JYSA 3QB2A 3EHNA 4F53A 3FUMA 5CRVA 4DLQA 5FQ7A 2VQ2A 2H6GA 2GW1A 3CQCB 4GZ6A 5M72A 1MZCA 2RG8A 5BV1A 4HQDA 4U07A 4U63A 1MQSA 2VGXA 3TG5A 4L23A 3D9IA 3BU8A 3IXEA 4EHMA 2BKGA 4XZ4A 3NBNB 2MHKA 2J08A 3B7BA 2OV8A 4GMRA 2J8SD 2RFAA 2YINA 2ZISA 3SI5A 4BSZB 3ULEG 4AY5A 3AS5A 4WWOA 4U8VD 4Q96A 4FADA 3SHFA 2B0OE 2R05A 1NFIE 4DI3A 5BV0A 2WXOA 4GTQA 5BXUA 1HS6A 3GZ2A 3CVNA 1U3DA 3KS2A 3TWTA 4G8KA 2H6FA 4BEPA 4L1BA 2R5SA 5FQ8A 4KVMA 4UQXA 2EINE 4FHJA 1XNFA 4UWGA 3MYVA 3AG1E 4OAVB 1Q2ZA 3S7JA 4BTBA 5LCWJ 3LY7A 4JHJA 1YA0A 1N52A 4ME2A 3DEPA 4J7WA 3RJVA 3APCA 1YCSB 2Q7FA 5HRYA 3SD5A 3ZU7B 4YVOA 1N4QA 3OXLA 1INZA 4XEIG 4F6RD 4ABNA 4DJAA 3PZ3A 4U95D 3GZ1A 3TWVA 3EU5A 2ETCA 1MHQA 2IY0C 4J8DA 5KCMA 4TUUA 4K0RA 2J09A 1BPOA 3EJNA 3ULYA 3AG3E 4OYSA 3VLEA 1NL4A 3I4GA 4DPRA 1O5MA 4I1OB 1G3NB 3LJNA 3ZFWA 2Y0BG 2QYUA 4LNBA 5A6CA 3E34A 4BTAA 2PM7A 2ETAA 1OWNA 4A55A 1JCRA 2PNNA 4HORA 3LY9A 1LF8A 3RIBA 2WXJA 5BXOA 2WXKA 4DX1A 3DSWA 1TJFA 2XEHA 5FQ6A 1X81A 4F3VA 2R02A 4I2WA 5FTPA 3ZIMA 1N4SA 4MBGA 3AU5A 1DNPA 3ZN3A 2WPVA 2WXRA 5EN5D 4ANXA 3Q4AB 1VDYA 5KBAA 2WXQA 2VTBA 3FULA 2XQ0A 4GTVA 4MRUA 3E33A 2XGOA 3ASOE 1TN7A 3FWVA 3CHSA 4FLBA 5JHAA 2GROB 3I4RB 2P9NG 5D2MC 2JEKA 1FVFA 2CHZA 2EILE 1TN6A 2IONA 1JWFA 4GMLA 4XI9A 2M63A 1NI1A 2XENA 1IHBA 3CHMA 3RRUA 2RD0A 4FHKA 3SBSA 1ZBPA 2V0PA 3NOGD 4FULA 2L6BA 3MV3B 4PH4B 4Q94A 5FZSA 3HIZA 1OWMA 4GA1A 3V31A 5CEAA 1H2UA 2VSOE 4F7AA 2IJGX 3FY4A 4CGWA 4UQYA 4WNDA 3EUVA 2OEVA 3AS8A 5KNGA 1DVPA 5AQ9A 4EZJA 3HXFA 3NZUA 3MZLB 3WXXA 3AG2E 4GTTA 3HXEA 4HI8A 3J5PA 5A23A 3BEEA 2XS8A 4C0MA 2HO1A 4APOA 5EILA 1SVXA 4W9RA 1KT1A 1UG3A 3C3OA 4I2ZA 4KVOA 2VTBB 3FUEA 3U4TA 4U0ZA 1QYMA 4P29A 2B6CA 3CLJA 1RZ4A 5KJLA 1TNUA 3ONLA 2UWJG 5G05C 3UPVA 4G11A 3VLFA 5EKQD 4F1PA 3CR3A 4GTSA 1S0PA 4KZCA 3C98A 3DEOA 3Q9NC 3QK0A 4NRHB 3LY8A 4U8HA 2LSUA 3FUIA 4B8AA 1IYGA 3APDA 4FA6A 5EYPF 2X6IA 3LPZA 2OVBA 3ESKA 4IN3B 4HRNA 4M7CA 2C2LA 4K5CA 4BFRA 3CHQA 3DWLG 3CVPA 5LOZA 2E2EA 3L22A 3TXNA 1H2TC 4ZHBA 4GYOA 3WG7E 4WNEA 5ARGA 3TAXA 2V5FA 2LAHA 2XHEA 1Z5SC 1MJ0A 4RSYA 2WXGA 4D10C 1YYHA 4I6EA 4AY6A 2F8XK 1EF1C 3C3RA 2LO6A 3CVQA 4NACA 3HRAA 3V30A 2I6HA 1SA4A 2PL2A 2J9QA 1OWPA 3DPYA 1K1BA 4O6FA 3T5XA 2WXIA 4AXHA 1FPPA 1O1RA 3ZYQA 4GZCA 3DBSA 3PS6A 5T4YA 4L2LA 5FIOA 3RKVA 4WNGA 2UY1B 1UN9A 5KJNA 3EDTB 4BERA 5AQ7A 1HO8A 2C0MA 4HLEA 3MGBA 3CKCA 3FUJA 4Y6CA 4U8YD 3VTXA 2KXPC 2YQ8A 2DCPA 5D0OD 3ABME 3B7RL 3Q75A 4JZYA 4CT4A 3SZ7A 3QKYA 4GZ3A 3JQ1A 1OWLA 3Q7FA 2QC9A 3AG4E 3HVEB 4KT6B 4R7LA 2ZGGA 4EZKA 3CK7A 3DSTA 3DXKG 3GW4A 4AVXA 1OCOE 3FTYA 4WAFA 3UX4A 3QWVA 1LD7A 4I43A 2NC9A 4UI9J 1YMPA 4HXIA 1OXJA 4MS6A 4A3TA 3T9KA 4I9EA 4X8QA 2DVWA 2PQNA 3UUXA 5CBNA 1QNFA 3LEWA 3NF1A 2FO7A 4WWPA 5G55A 5EDSA 4GA0A 4ZFHA 4URKA 2VSYA 4A63B 1MYOA 1S64A 2GRLA 2P2CP 3LKUA 5ITZF 4TXRA 1FT2A 4UQZA 3QOUA 2A5UA 1UW4B 2FBNA 2OCCE 4TXPA 1QBQA 2HE0A 2DWZA 1H19A 4CZ2D 4GMJA 2Y69E 2R59A 3W9FA 3HXCA 4J8YA 4NURA 4BT9A 2FEZA 3Q47B 3ESLA 3TWWA 2WXMA 5ENSD 3TG4A
chains in the Genus database with same CATH topology
4YDEA 3PZ2A 3EU5A 2ZISA 1TN6A 1SA5A 4L9PA 1NI1A 3KSLA 3Q7FA 1N94A 4GTRA 2R2LA 1N4PA 3DSUA 3DSVA 3DSTA 3PZ1A 1NL4A 1DCEA 1O1TA 1TN8A 3Q73A 1LD8A 1O5MA 3Q78A 3C72A 3DSXA 3PZ4A 4GTQA 4YDOA 1KZOA 3Q79A 1LD7A 4LNBA 3E32A 2ZIRA 1TNOA 2H6FA 3E34A 1D8DA 3DRAA 1JCQA 1JCRA 3EUVA 1TNZA 2H6IA 1S63A 1O1SA 4LNGA 3HXBA 4GTPA 3HXFA 4GTTA 3HXEA 1SA4A 1D8EA 3DSWA 1JCSA 3HXDA 1N95A 3DPYA 1FT1A 3E37A 1X81A 1N4SA 4MBGA 1KZPA 4GTMA 2H6GA 2F0YA 3E30A 3SFXA 1S64A 1FPPA 1O1RA 1N9AA 1LTXA 2BEDA 1FT2A 1MZCA 1N4QA 1TNBA 4GTVA 1QBQA 2IEJA 3E33A 1TNUA 4EHMA 1TNYA 3SFYA 1TN7A 3KSQA 3PZ3A 4GTOA 3HXCA 3Q7AA 3Q75A 2H6HA 4GTSA 1N4RA 3DSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YDE A;  3PZ2 A;  3EU5 A;  2ZIS A;  1TN6 A;  1SA5 A;  4L9P A;  1NI1 A;  3KSL A;  3Q7F A;  1N94 A;  4GTR A;  2R2L A;  1N4P A;  3DSU A;  3DSV A;  3DST A;  3PZ1 A;  1NL4 A;  1DCE A;  1O1T A;  1TN8 A;  3Q73 A;  1LD8 A;  1O5M A;  3Q78 A;  3C72 A;  3DSX A;  3PZ4 A;  4GTQ A;  4YDO A;  1KZO A;  3Q79 A;  1LD7 A;  4LNB A;  3E32 A;  2ZIR A;  1TNO A;  2H6F A;  3E34 A;  1D8D A;  3DRA A;  1JCQ A;  1JCR A;  3EUV A;  1TNZ A;  2H6I A;  1S63 A;  1O1S A;  4LNG A;  3HXB A;  4GTP A;  3HXF A;  4GTT A;  3HXE A;  1SA4 A;  1D8E A;  3DSW A;  1JCS A;  3HXD A;  1N95 A;  3DPY A;  1FT1 A;  3E37 A;  1X81 A;  1N4S A;  4MBG A;  1KZP A;  4GTM A;  2H6G A;  2F0Y A;  3E30 A;  3SFX A;  1S64 A;  1FPP A;  1O1R A;  1N9A A;  1LTX A;  2BED A;  1FT2 A;  1MZC A;  1N4Q A;  1TNB A;  4GTV A;  1QBQ A;  2IEJ A;  3E33 A;  1TNU A;  4EHM A;  1TNY A;  3SFY A;  1TN7 A;  3KSQ A;  3PZ3 A;  4GTO A;  3HXC A;  3Q7A A;  3Q75 A;  2H6H A;  4GTS A;  1N4R A;  3DSS A; 
#chains in the Genus database with same CATH topology
 2WXH A;  3KEZ A;  4L2Y A;  5FJY A;  1BI8 B;  2LSV A;  4OVV A;  4N39 A;  1SQM A;  4ILH B;  2XRY A;  2R2L A;  3UMV A;  3QC1 A;  1N4P A;  4B8C B;  4E85 A;  4GZ5 A;  4JPS A;  3PEU B;  1BU9 A;  4I6G A;  3C3Q A;  3APF A;  5B1B E;  3ZHE A;  1RW2 A;  3P2B A;  2DYS E;  4UUC A;  4G26 A;  4GAA A;  1SZA A;  4JD2 G;  2UY1 A;  3ML8 A;  2IO3 C;  1MX2 A;  3PH0 C;  1NP7 A;  5HI7 A;  3CIA A;  1BI7 B;  2J07 A;  4I9C A;  2P9P G;  3PUK A;  3CKB A;  3MV2 B;  4O1O A;  2WQH A;  2XPY A;  4GTP A;  5FQ4 A;  2XPI A;  3FTU A;  3ASF A;  4WUY A;  5G05 J;  4RLY A;  5FZQ A;  3FH7 A;  4HI9 A;  1TYQ G;  4Z68 A;  5T8I A;  1IQR A;  2CG2 A;  3E30 A;  3SFX A;  2ETB A;  2QFC A;  4MLP A;  3LYA A;  3CK9 A;  2YHE A;  3T8K A;  2X3M A;  2MYO A;  4FLH A;  5ENO D;  3ZHE B;  3PZD A;  4UWH A;  1Y8M A;  3S7B A;  1L5J A;  2XGM A;  4RQI A;  3L82 A;  2GRN B;  2FF4 A;  4LRZ A;  1WM5 A;  2XZD G;  3KSQ A;  5C1D A;  3FTS A;  3PE3 A;  3FUN A;  3MA5 A;  4G1T A;  1N4R A;  1OCZ E;  1BLX B;  4AOF A;  4K5B A;  4N5Q A;  3I3N A;  1PY1 A;  1E8X A;  1SA5 A;  3ZEF A;  4J8F A;  1A5E A;  4UI9 C;  3KD7 A;  1OCC E;  4K03 A;  4JA7 A;  3Q9U C;  3PZ1 A;  5DBK A;  2NSZ A;  3D9N A;  2DBA A;  5KJM A;  3DSX A;  2AXU A;  2J4B A;  2V4L A;  2ZIR A;  4DRX E;  4N5C A;  4GB9 A;  3G2U A;  1N11 A;  3L13 A;  5BNW A;  2Y1L E;  4UWF A;  3X2Q E;  4ATZ D;  4DI4 A;  4G23 A;  4N2Q A;  4JHR A;  4F1S A;  3RRN B;  4O1P A;  4U0S A;  2HR2 A;  4U04 A;  4KXK B;  3CVV A;  3LDZ A;  3FUD A;  4NIK A;  1FCH A;  1JPL A;  2F37 A;  3UM0 A;  4HS2 A;  3HXD A;  4ATG A;  3E37 A;  5G04 J;  1KZP A;  3JUI A;  3W9G A;  5IY5 E;  2F0Y A;  2OEW A;  1EYH A;  2EIM E;  4N3B A;  3CGH A;  4Q69 A;  2AW6 A;  4HFG A;  5JMN D;  1K3Z D;  3PDN A;  4HRM B;  4IYP A;  1ELR A;  3TL5 A;  3MCX A;  5CCL A;  3MX3 A;  4RG9 A;  4B94 A;  1KLX A;  2CFZ A;  3HDX A;  2C0L A;  1NA0 A;  3ZGQ A;  4BT8 A;  3ENE A;  2VGY A;  3PRE A;  5CED B;  1W3B A;  1N94 A;  3K9I A;  4ILI A;  4MKT A;  4KZ0 A;  2WXF A;  1WAO 1;  3CHR A;  4XI0 A;  3Q73 A;  3O48 A;  1KZO A;  2AJA A;  3PRZ A;  3D9M A;  2F8Y A;  2A5E A;  2MRI A;  2YHC A;  1K1A A;  2CHW A;  2H6I A;  3J5Q B;  1EPU A;  3ZXP A;  3QAQ A;  4LNG A;  1ZB1 A;  5CMY A;  3HVE A;  3KAE A;  1IXV A;  4L7T A;  3D9K A;  3NAW A;  4HOU A;  2PM6 A;  3P1U A;  1IHG A;  3VLD A;  3MKQ B;  3L08 A;  3S7F A;  1MX4 A;  5LP0 A;  3OXF A;  3R7Q A;  3UTM A;  2AVP A;  4GPM A;  1OUV A;  2BUG A;  1QZ2 A;  3AAA C;  4GZD A;  3ASN E;  3HYM B;  1HFA A;  5AIJ A;  2OND A;  4LSZ E;  4GTO A;  4EEC A;  1E90 A;  2X6F A;  4AIF A;  4LG6 A;  3TGO A;  4N3C A;  2KZT B;  5B3S E;  4C9B B;  2MOW A;  3PUJ A;  3PEV B;  1DCE A;  3UT4 A;  4G8L A;  4RG6 A;  2KCK A;  3PVL A;  5G04 C;  4H7X A;  1NZN A;  2OVF A;  2IF4 A;  4AJW A;  3EIQ C;  3B7T A;  1TNZ A;  3ONK A;  1TJC A;  4U96 D;  3FUK A;  3G2W A;  3UKR G;  5ENP D;  5LCW C;  4ANV A;  2P9S G;  4QFV A;  4DX7 D;  4EPZ A;  3TWS A;  3QJZ A;  3FU5 A;  3V2X A;  4PUC A;  1E7V A;  3RAU A;  1LTX A;  3CVW A;  1IKN D;  3TXM A;  4YDW A;  2I9C A;  4JB8 P;  2IOS A;  1A17 A;  2DYR E;  3FHE A;  4J8S A;  2J4D A;  5BPP A;  4CRW A;  3IKO B;  1TNY A;  3PNT B;  2WQ6 A;  2BKK B;  5LX8 A;  3ZXS A;  3EHM A;  1N0R A;  2X38 A;  5AJD A;  3ZYK A;  4BX9 A;  1HZ4 A;  2QYJ A;  3UI2 A;  4CT0 A;  2EIK E;  2HM8 A;  3LCA A;  4GTR A;  4XE0 A;  2L9B A;  5AEN A;  3HHM A;  4JVS A;  3DSU A;  3DSV A;  4DLO A;  1FVH A;  1TN8 A;  1E7U A;  2DZO A;  1WY6 A;  4UWL A;  5HKP A;  3IEG A;  4OVU A;  1TNO A;  4XX5 A;  3O4Z A;  4JW1 A;  3RRM B;  5BT1 A;  2V8S E;  4TUM A;  4AM9 A;  4EQF A;  3UIP C;  1HX8 A;  1S63 A;  3UXG A;  3NB2 A;  4FC8 A;  3U66 A;  1N54 A;  3OTN A;  1N0Q A;  4DX2 A;  3FU6 A;  2I1J A;  3JXI A;  1D8E A;  2WMO A;  4J0U A;  3B7S A;  4JL0 A;  4B89 A;  2L6J A;  4CGV A;  4H7Y A;  5ANR A;  3CVU A;  1WG0 A;  3NQP A;  2EIJ E;  3G2T A;  2GRR B;  5BUZ A;  2LNI A;  4BY6 A;  4BWR A;  3IBE A;  4FU3 A;  1JWG A;  4UWK A;  4A3V A;  3BG0 B;  5CRU A;  3CVX A;  3NOC D;  5KNH D;  4AP2 A;  4JEH A;  3D9P A;  3UM3 A;  2V4H C;  3F6Q A;  3UIO C;  3FTV A;  2LAI A;  4XKC A;  3FEY A;  5CBO A;  3L6A A;  1E8W A;  5D0Q D;  5EX0 A;  2FO1 E;  4DUI A;  3Q7A A;  5AYW D;  1TR4 A;  3AS4 A;  1Z6T A;  2DIW A;  5CMW A;  2AXZ A;  4YDE A;  2KBX A;  2IO2 C;  4U0U A;  4GU5 A;  2WXL A;  3ZPJ A;  3AU4 A;  3ASH A;  3D3M A;  3FH5 A;  3CHP A;  3RK6 A;  2QY7 A;  4FJY A;  4B0Z A;  2YNQ A;  4HOS A;  2GRP B;  3ABK E;  3Q79 A;  4N3A A;  3DPD A;  4YDY A;  1MX6 A;  3TWX A;  1D8D A;  2KCL A;  3EU9 A;  1HXI A;  3L16 A;  3N71 A;  3QWW A;  1DCQ A;  5JA4 D;  4V3I A;  4XKB A;  2Y4T A;  3FTX A;  2VYI A;  3RU0 A;  1TEZ A;  3VTY A;  3CEQ A;  2P9L G;  5B1A E;  3LS8 A;  4WNF A;  5HQ8 A;  4JEU A;  1B89 A;  2IU1 A;  3SY2 A;  3S7D A;  3SF4 A;  3ZW3 A;  3ZVV A;  4GTM A;  4BX8 A;  4HNA D;  3KEA A;  1D9S A;  3CK8 A;  1IQU A;  4GA2 A;  4LNU D;  1H6K A;  5J08 A;  1ELW A;  2VJ8 A;  1E96 B;  1WDY A;  3ML9 A;  4RVB A;  4C0E A;  3HG0 D;  5CEC B;  3JXJ A;  1U2V G;  1S70 B;  2ZU6 B;  4KMO A;  5AQA A;  3V79 K;  3B7U X;  2KAT A;  4G25 A;  3G2S A;  3FEX A;  3UM2 A;  3KSL A;  2DZN A;  1UOH A;  1X5B A;  1ELK A;  3UIN C;  1LD8 A;  1UJJ A;  3Q78 A;  1AWC B;  3C72 A;  4E6H A;  1OT8 A;  3ISM C;  4LCT A;  2IOL A;  3UT7 A;  3DRA A;  3D9O A;  3LVQ E;  4PS7 A;  2AWI A;  3L9T A;  4I1A A;  2NYJ A;  3SO8 A;  5FZR A;  3ZUV B;  2LXM A;  2XGS A;  3QAR A;  5ENR D;  3TWU A;  3URZ A;  5AAO A;  3PE4 A;  4DX6 D;  1EDU A;  3GZS A;  4M3O A;  1HE8 A;  3Q5M A;  4EZL A;  2OOE A;  4ACL A;  3B95 A;  2ZGD A;  4ANW A;  2CG3 A;  1QQE A;  3SBT B;  2WM9 A;  1AP7 A;  4JA9 A;  4CDN A;  2GRM A;  3CQG B;  3OAW A;  3FTW A;  1H6O A;  2X6K A;  3NZS A;  3MKR A;  3FDH A;  1KT0 A;  4HVB A;  3FTZ A;  4A1S A;  3JQ0 A;  3U3W A;  5AQB A;  4JHK A;  3JUE A;  3U64 A;  2WB2 A;  3U9W A;  2FUL A;  3FU3 A;  4I1M A;  3PZ4 A;  4YDO A;  2CHX A;  4HOQ A;  2X6H A;  4IRU A;  4J6I A;  4BSX A;  1PC2 A;  3SQV A;  4PS8 A;  3SNX A;  5EIB E;  2CFU A;  2L0I A;  3JCK C;  3CVY A;  3I5P A;  5ANL A;  2XCC A;  4XIF A;  2VSX E;  4I6J A;  2IQC A;  2LXL A;  3T5V A;  3FP3 A;  3UM1 A;  1XGW A;  5T3R A;  2Y4U A;  4PDX A;  1N95 A;  4N2S A;  4CYM D;  2KZT A;  2A4Z A;  1SW6 A;  3RSE G;  5KWD A;  2XRZ A;  3ASG A;  2XEE A;  3LVR E;  3ZYL A;  2P9K G;  4I17 A;  1PAQ A;  4DX5 D;  2R17 C;  3S2A A;  2WXP A;  3R7R A;  4G2V A;  4FJZ A;  5JHB A;  3GYZ A;  3QNK A;  3D9H A;  4AEZ C;  2H6H A;  3V2O A;  1HH8 A;  3UKU G;  3QDN A;  4O60 A;  5LFA A;  5J90 A;  4HLL A;  2VGE A;  4C48 B;  5FT9 A;  5CER B;  1O1T A;  5AAR A;  1E8Y A;  1GW6 A;  1HF8 A;  1UJK A;  2JLB A;  2VSN A;  3FU0 A;  3LJ3 A;  3ZRH A;  3E32 A;  3TWQ A;  3R9M A;  4ANU A;  5FWQ A;  4HB5 A;  4OAU C;  3ZYM A;  3D9J A;  1UN8 A;  1HG5 A;  5DIZ A;  3Q15 A;  3Q49 B;  3RO2 A;  2AXV A;  2FI7 A;  1OY3 D;  1V55 E;  3SFZ A;  4Y6W A;  3IHV A;  1O1S A;  3CHO A;  4EBA A;  1OWO A;  3L17 A;  4AV7 A;  1Y6I A;  1P5Q A;  2ZXW E;  5HS0 A;  2PQR A;  1JCS A;  4EBA G;  4QQI A;  1FT1 A;  1KPS B;  4JXT A;  5H7P A;  4HRL A;  1U3C A;  2KC7 A;  1N9A A;  2PZI A;  2BED A;  2WVI A;  5EX3 A;  5JJ6 A;  5C2Y A;  4YND A;  3EHQ A;  2XPZ A;  1K8K G;  4GYW A;  2IEJ A;  4ACK A;  2XCB A;  2VGX B;  5EID A;  3CVL A;  2R03 A;  4TV3 A;  3FUH A;  3D9L A;  3IHY A;  5CHE E;  2IFU A;  3DXM G;  2NXP A;  4HOT A;  2WMN A;  3ASD A;  3QWP A;  5ENT D;  3T8M A;  5FIN A;  4J8E A;  2GRQ B;  3RO3 A;  5E75 A;  4ILG A;  5AJL A;  1JUQ A;  2Y3A A;  3OXG A;  4CCA A;  4BET A;  3ABL E;  3UQ3 A;  2I2O A;  3TWR A;  4CDR A;  4UI9 K;  5BW8 C;  2V5Q C;  2P58 C;  5CCM A;  3ULQ A;  4LER A;  5AN8 A;  4GYY A;  4CDM A;  4YVQ C;  1JCQ A;  1E8Z A;  1Z3Y A;  3B13 A;  2L0T B;  4B93 B;  2LUH A;  4GPK A;  3L54 A;  3HXB A;  3CV0 A;  4KYO B;  3ZKJ A;  4LUN U;  3G2V A;  2XZT G;  4GCN A;  4U7E B;  2GGF A;  2RFM A;  1SZ9 A;  3R9A B;  3PNL B;  5ENN A;  4DK5 A;  4PS3 A;  5ENQ D;  2WXN A;  1H6P A;  4TRQ A;  5G2N A;  2XEV A;  3FH8 A;  5JJ7 A;  2P9I G;  5JJT A;  3AJI A;  3MEK A;  1H2V C;  2HYZ A;  2EQX A;  4CEM A;  4K5A B;  1TNB A;  2BTD A;  3E4B A;  4LEU A;  3MKQ A;  5D66 A;  1H0A A;  2JAB A;  2XS1 A;  3MJW A;  3SFY A;  4JC8 A;  4BES A;  2BF0 X;  5ARF A;  3C5R A;  3IV0 A;  3SGH A;  3BG1 B;  5E76 A;  3FFL A;  2X6J A;  4APF A;  3DSS A;  4NQ0 A;  2KM4 A;  5KJK A;  3PZ2 A;  2I1K A;  2RKK A;  3CSF A;  4L9P A;  2E0I A;  4WWN A;  1NA3 A;  4A1G A;  2J49 A;  3EHR A;  3ZNG A;  1HU3 A;  2WQ7 A;  1DC2 A;  4G24 A;  5EYL A;  2KCV A;  1BD8 A;  3UT8 A;  1V54 E;  4FP7 A;  5A7D B;  4HBD A;  3BUA A;  3LXU X;  1Z3X A;  2ILR A;  4IUL A;  3EIJ A;  1ZU2 A;  3TJP A;  4KBQ A;  3FUF A;  1HG2 A;  4TXQ A;  2QZA A;  3BQO A;  2P9U G;  1OCR E;  4GCO A;  3CST A;  3JYS A;  3QB2 A;  3EHN A;  4F53 A;  3FUM A;  5CRV A;  4DLQ A;  5FQ7 A;  2VQ2 A;  2H6G A;  2GW1 A;  3CQC B;  4GZ6 A;  5M72 A;  1MZC A;  2RG8 A;  5BV1 A;  4HQD A;  4U07 A;  4U63 A;  1MQS A;  2VGX A;  3TG5 A;  4L23 A;  3D9I A;  3BU8 A;  3IXE A;  4EHM A;  2BKG A;  4XZ4 A;  3NBN B;  2MHK A;  2J08 A;  3B7B A;  2OV8 A;  4GMR A;  2J8S D;  2RFA A;  2YIN A;  2ZIS A;  3SI5 A;  4BSZ B;  3ULE G;  4AY5 A;  3AS5 A;  4WWO A;  4U8V D;  4Q96 A;  4FAD A;  3SHF A;  2B0O E;  2R05 A;  1NFI E;  4DI3 A;  5BV0 A;  2WXO A;  4GTQ A;  5BXU A;  1HS6 A;  3GZ2 A;  3CVN A;  1U3D A;  3KS2 A;  3TWT A;  4G8K A;  2H6F A;  4BEP A;  4L1B A;  2R5S A;  5FQ8 A;  4KVM A;  4UQX A;  2EIN E;  4FHJ A;  1XNF A;  4UWG A;  3MYV A;  3AG1 E;  4OAV B;  1Q2Z A;  3S7J A;  4BTB A;  5LCW J;  3LY7 A;  4JHJ A;  1YA0 A;  1N52 A;  4ME2 A;  3DEP A;  4J7W A;  3RJV A;  3APC A;  1YCS B;  2Q7F A;  5HRY A;  3SD5 A;  3ZU7 B;  4YVO A;  1N4Q A;  3OXL A;  1INZ A;  4XEI G;  4F6R D;  4ABN A;  4DJA A;  3PZ3 A;  4U95 D;  3GZ1 A;  3TWV A;  3EU5 A;  2ETC A;  1MHQ A;  2IY0 C;  4J8D A;  5KCM A;  4TUU A;  4K0R A;  2J09 A;  1BPO A;  3EJN A;  3ULY A;  3AG3 E;  4OYS A;  3VLE A;  1NL4 A;  3I4G A;  4DPR A;  1O5M A;  4I1O B;  1G3N B;  3LJN A;  3ZFW A;  2Y0B G;  2QYU A;  4LNB A;  5A6C A;  3E34 A;  4BTA A;  2PM7 A;  2ETA A;  1OWN A;  4A55 A;  1JCR A;  2PNN A;  4HOR A;  3LY9 A;  1LF8 A;  3RIB A;  2WXJ A;  5BXO A;  2WXK A;  4DX1 A;  3DSW A;  1TJF A;  2XEH A;  5FQ6 A;  1X81 A;  4F3V A;  2R02 A;  4I2W A;  5FTP A;  3ZIM A;  1N4S A;  4MBG A;  3AU5 A;  1DNP A;  3ZN3 A;  2WPV A;  2WXR A;  5EN5 D;  4ANX A;  3Q4A B;  1VDY A;  5KBA A;  2WXQ A;  2VTB A;  3FUL A;  2XQ0 A;  4GTV A;  4MRU A;  3E33 A;  2XGO A;  3ASO E;  1TN7 A;  3FWV A;  3CHS A;  4FLB A;  5JHA A;  2GRO B;  3I4R B;  2P9N G;  5D2M C;  2JEK A;  1FVF A;  2CHZ A;  2EIL E;  1TN6 A;  2ION A;  1JWF A;  4GML A;  4XI9 A;  2M63 A;  1NI1 A;  2XEN A;  1IHB A;  3CHM A;  3RRU A;  2RD0 A;  4FHK A;  3SBS A;  1ZBP A;  2V0P A;  3NOG D;  4FUL A;  2L6B A;  3MV3 B;  4PH4 B;  4Q94 A;  5FZS A;  3HIZ A;  1OWM A;  4GA1 A;  3V31 A;  5CEA A;  1H2U A;  2VSO E;  4F7A A;  2IJG X;  3FY4 A;  4CGW A;  4UQY A;  4WND A;  3EUV A;  2OEV A;  3AS8 A;  5KNG A;  1DVP A;  5AQ9 A;  4EZJ A;  3HXF A;  3NZU A;  3MZL B;  3WXX A;  3AG2 E;  4GTT A;  3HXE A;  4HI8 A;  3J5P A;  5A23 A;  3BEE A;  2XS8 A;  4C0M A;  2HO1 A;  4APO A;  5EIL A;  1SVX A;  4W9R A;  1KT1 A;  1UG3 A;  3C3O A;  4I2Z A;  4KVO A;  2VTB B;  3FUE A;  3U4T A;  4U0Z A;  1QYM A;  4P29 A;  2B6C A;  3CLJ A;  1RZ4 A;  5KJL A;  1TNU A;  3ONL A;  2UWJ G;  5G05 C;  3UPV A;  4G11 A;  3VLF A;  5EKQ D;  4F1P A;  3CR3 A;  4GTS A;  1S0P A;  4KZC A;  3C98 A;  3DEO A;  3Q9N C;  3QK0 A;  4NRH B;  3LY8 A;  4U8H A;  2LSU A;  3FUI A;  4B8A A;  1IYG A;  3APD A;  4FA6 A;  5EYP F;  2X6I A;  3LPZ A;  2OVB A;  3ESK A;  4IN3 B;  4HRN A;  4M7C A;  2C2L A;  4K5C A;  4BFR A;  3CHQ A;  3DWL G;  3CVP A;  5LOZ A;  2E2E A;  3L22 A;  3TXN A;  1H2T C;  4ZHB A;  4GYO A;  3WG7 E;  4WNE A;  5ARG A;  3TAX A;  2V5F A;  2LAH A;  2XHE A;  1Z5S C;  1MJ0 A;  4RSY A;  2WXG A;  4D10 C;  1YYH A;  4I6E A;  4AY6 A;  2F8X K;  1EF1 C;  3C3R A;  2LO6 A;  3CVQ A;  4NAC A;  3HRA A;  3V30 A;  2I6H A;  1SA4 A;  2PL2 A;  2J9Q A;  1OWP A;  3DPY A;  1K1B A;  4O6F A;  3T5X A;  2WXI A;  4AXH A;  1FPP A;  1O1R A;  3ZYQ A;  4GZC A;  3DBS A;  3PS6 A;  5T4Y A;  4L2L A;  5FIO A;  3RKV A;  4WNG A;  2UY1 B;  1UN9 A;  5KJN A;  3EDT B;  4BER A;  5AQ7 A;  1HO8 A;  2C0M A;  4HLE A;  3MGB A;  3CKC A;  3FUJ A;  4Y6C A;  4U8Y D;  3VTX A;  2KXP C;  2YQ8 A;  2DCP A;  5D0O D;  3ABM E;  3B7R L;  3Q75 A;  4JZY A;  4CT4 A;  3SZ7 A;  3QKY A;  4GZ3 A;  3JQ1 A;  1OWL A;  3Q7F A;  2QC9 A;  3AG4 E;  3HVE B;  4KT6 B;  4R7L A;  2ZGG A;  4EZK A;  3CK7 A;  3DST A;  3DXK G;  3GW4 A;  4AVX A;  1OCO E;  3FTY A;  4WAF A;  3UX4 A;  3QWV A;  1LD7 A;  4I43 A;  2NC9 A;  4UI9 J;  1YMP A;  4HXI A;  1OXJ A;  4MS6 A;  4A3T A;  3T9K A;  4I9E A;  4X8Q A;  2DVW A;  2PQN A;  3UUX A;  5CBN A;  1QNF A;  3LEW A;  3NF1 A;  2FO7 A;  4WWP A;  5G55 A;  5EDS A;  4GA0 A;  4ZFH A;  4URK A;  2VSY A;  4A63 B;  1MYO A;  1S64 A;  2GRL A;  2P2C P;  3LKU A;  5ITZ F;  4TXR A;  1FT2 A;  4UQZ A;  3QOU A;  2A5U A;  1UW4 B;  2FBN A;  2OCC E;  4TXP A;  1QBQ A;  2HE0 A;  2DWZ A;  1H19 A;  4CZ2 D;  4GMJ A;  2Y69 E;  2R59 A;  3W9F A;  3HXC A;  4J8Y A;  4NUR A;  4BT9 A;  2FEZ A;  3Q47 B;  3ESL A;  3TWW A;  2WXM A;  5ENS D;  3TG4 A; 
#chains in the Genus database with same CATH homology
 4YDE A;  3PZ2 A;  3EU5 A;  2ZIS A;  1TN6 A;  1SA5 A;  4L9P A;  1NI1 A;  3KSL A;  3Q7F A;  1N94 A;  4GTR A;  2R2L A;  1N4P A;  3DSU A;  3DSV A;  3DST A;  3PZ1 A;  1NL4 A;  1DCE A;  1O1T A;  1TN8 A;  3Q73 A;  1LD8 A;  1O5M A;  3Q78 A;  3C72 A;  3DSX A;  3PZ4 A;  4GTQ A;  4YDO A;  1KZO A;  3Q79 A;  1LD7 A;  4LNB A;  3E32 A;  2ZIR A;  1TNO A;  2H6F A;  3E34 A;  1D8D A;  3DRA A;  1JCQ A;  1JCR A;  3EUV A;  1TNZ A;  2H6I A;  1S63 A;  1O1S A;  4LNG A;  3HXB A;  4GTP A;  3HXF A;  4GTT A;  3HXE A;  1SA4 A;  1D8E A;  3DSW A;  1JCS A;  3HXD A;  1N95 A;  3DPY A;  1FT1 A;  3E37 A;  1X81 A;  1N4S A;  4MBG A;  1KZP A;  4GTM A;  2H6G A;  2F0Y A;  3E30 A;  3SFX A;  1S64 A;  1FPP A;  1O1R A;  1N9A A;  1LTX A;  2BED A;  1FT2 A;  1MZC A;  1N4Q A;  1TNB A;  4GTV A;  1QBQ A;  2IEJ A;  3E33 A;  1TNU A;  4EHM A;  1TNY A;  3SFY A;  1TN7 A;  3KSQ A;  3PZ3 A;  4GTO A;  3HXC A;  3Q7A A;  3Q75 A;  2H6H A;  4GTS A;  1N4R A;  3DSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...