1LD7A

Co-crystal structure of human farnesyltransferase with farnesyldiphosphate and inhibitor compound 66
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
313
structure length
313
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3-Aminopyrrolidinone farnesyltransferase inhibitors: design of macrocyclic compounds with improved pharmacokinetics and excellent cell potency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords protein farnesyltransferase alpha subunit
total genus 125
structure length 313
sequence length 313
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1ld7A00
4EHMA 2ZIRA 1KZPA 3DSVA 1D8DA 3HXBA 1TNZA 3DSXA 3E34A 3PZ3A 3Q73A 3Q7FA 1NI1A 1FT1A 3KSLA 4GTOA 1JCQA 1S63A 3C72A 2BEDA 1TNUA 3HXEA 3DSSA 3E30A 4GTTA 4GTQA 3E37A 1JCSA 1O5MA 1LTXA 1QBQA 3KSQA 3Q78A 4YDEA 4LNBA 1MZCA 2H6FA 2IEJA 1LD7A 4YDOA 1NL4A 3DRAA 1O1SA 3Q79A 1O1TA 3E33A 1N4PA 3DPYA 4MBGA 4LNGA 1N9AA 1N94A 2R2LA 2H6IA 1N4RA 1TNBA 1DCEA 1JCRA 1N95A 1D8EA 2H6HA 4GTRA 1TNOA 1FT2A 1TN6A 1TN7A 2ZISA 1FPPA 1KZOA 2F0YA 3Q7AA 4GTSA 1S64A 3SFYA 3HXFA 3DSUA 1N4SA 1TN8A 4GTVA 1TNYA 1O1RA 4GTPA 3DSWA 1LD8A 3HXDA 4GTMA 1SA4A 1N4QA 3HXCA 3E32A 3EU5A 3EUVA 3Q75A 1X81A 3DSTA 3PZ4A 3PZ1A 1SA5A 3PZ2A 4L9PA 3SFXA 2H6GA
chains in the Genus database with same CATH superfamily
3VTYA 4Q96A 4RQIA 1NZNA 3ASHA 4J8SA 4HS2A 3EJNA 3APCA 4OYSA 2C0MA 2P9SG 3ASFA 4JZYA 2X6KA 3CVQA 2VSOE 4DX1A 1HG2A 4G26A 4HOSA 3O48A 4G2VA 4C0MA 2NSZA 1AP7A 3HXEA 3U9WA 3FUNA 1Z6TA 1K8KG 5CEDB 3ULQA 1MYOA 2HR2A 1LTXA 3C3OA 1KPSB 4I1OB 4K5BA 1KLXA 2A5EA 3HHMA 3MX3A 3JUEA 2IEJA 1O1SA 4DX6D 4WNEA 3PEVB 1A17A 2GRQB 4ATGA 1WDYA 1N95A 2KCLA 4RG6A 2EQXA 1MHQA 4N2QA 1KZOA 2F0YA 5AYWD 5EILA 2L0TB 2L6JA 1NFIE 3HDXA 3QAQA 5AIJA 4TXPA 4OAUC 4Y6CA 3C3RA 3RIBA 3RRUA 1KT0A 4ANVA 3ZHEA 3TXMA 4UI9K 4XE0A 1EF1C 3NZUA 3VLEA 4FLBA 4J8YA 1IHGA 2WMNA 4CDRA 3HRAA 3QWVA 2FO1E 2DVWA 4IN3B 4KBQA 5FINA 1DNPA 2Y4UA 3SO8A 2V5FA 4K5AB 4I9EA 3HYMB 4UQXA 3QDNA 4LCTA 3T8MA 3MGBA 5FTPA 5J90A 3Q78A 3UM1A 4G8LA 4LNBA 1DCQA 3S2AA 4C0EA 3UM3A 2XCBA 1HFAA 2KXPC 3OXLA 3RSEG 3Q49B 4GTRA 3S7JA 4PDXA 4HBDA 4DI3A 2GRRB 2LAHA 3CHSA 3HXFA 1ZBPA 5G04C 3FTUA 2X3MA 5CMWA 4JC8A 4U0ZA 3ASOE 1N4QA 2L6BA 3CV0A 4UUCA 3EU5A 2VSNA 3BQOA 5KCMA 4JHKA 1NA3A 2XHEA 2MOWA 3CSTA 4Q69A 3ASDA 2OEWA 2ILRA 3QWWA 3L17A 2WQ7A 2XPZA 3Q7FA 4L23A 1PAQA 4C9BB 3MKRA 3AG1E 3FU3A 4O6FA 3LDZA 3CVYA 5ENQD 3D9KA 4L1BA 4KVOA 1JWFA 1JPLA 3TWSA 2DYSE 1YYHA 4I17A 3URZA 5H7PA 2IFUA 3ZFWA 3DWLG 3FTWA 3AU4A 2NC9A 4H7XA 4GCNA 5JHBA 3SBSA 2YHCA 3IBEA 5D2MC 4KT6B 3Q79A 2WXJA 5CCLA 2KCKA 1JCRA 2H6HA 3NAWA 4E6HA 5D0QD 2RFAA 4ILHB 1RW2A 2J4BA 1U2VG 2WXKA 5G05C 3BG0B 3SFYA 2WPVA 4ZHBA 1N4SA 1IYGA 1TN8A 4ILGA 4NRHB 3DSWA 4J6IA 4CT0A 5AENA 3LCAA 1OCCE 5J08A 3AS8A 3CQCB 2GROB 1OY3D 5ENTD 5JJ7A 1OXJA 3SF4A 3FU6A 3UKRG 3TJPA 3ZU7B 4GA0A 4CGWA 4G11A 3AU5A 3V2OA 4JHJA 3EHMA 3KAEA 4TRQA 1OWPA 3D9LA 3T9KA 3NQPA 3ONKA 5CHEE 1NI1A 1FT1A 1A5EA 4GTOA 3QNKA 1H2UA 1K1BA 3AS4A 5ENNA 1FVHA 1H19A 3CVPA 3K9IA 2ZXWE 4B0ZA 1K1AA 2DCPA 3D9JA 2QYJA 2X38A 5T3RA 2WXLA 4UWLA 4AM9A 1UN8A 1S70B 3UXGA 2Q7FA 2OV8A 5A7DB 1OWLA 2IOLA 2HM8A 3VLDA 4I1MA 4TXRA 3OAWA 1N94A 4WNGA 5KJKA 3TWUA 4BSZB 5FZRA 4LRZA 4FHJA 1OWOA 3L08A 3ZIMA 2L0IA 1UJJA 3C5RA 4FP7A 2V4HC 2AXUA 5KJMA 3EHNA 1P5QA 2DBAA 4JB8P 4OVUA 5B1BE 3MEKA 4CEMA 4EQFA 1NA0A 5BXOA 3AG3E 3TAXA 3DXMG 4B93B 5BNWA 3MKQA 3FFLA 5EYPF 2EIKE 1IXVA 4MLPA 3FUKA 2FI7A 2B0OE 3AAAC 2PQRA 1WAO1 2BUGA 4LNUD 1H6OA 3SGHA 4BTBA 4A3TA 4N3AA 3CLJA 3DBSA 3QJZA 3MZLB 3ABLE 2F37A 4U8YD 3CK9A 2EIME 4JHRA 2IO3C 3FULA 3E30A 2J49A 4ANWA 3JUIA 4HVBA 5HQ8A 5ENRD 2PM6A 2LSVA 2M63A 2VGXB 5HS0A 3PEUB 3GYZA 3QC1A 3DRAA 1H6KA 3G2TA 1N4PA 2F8YA 1HX8A 2RFMA 3BUAA 3LXUX 1DCEA 4I2WA 3APFA 4CYMD 3FUDA 2WXOA 4U04A 4GPKA 4B8AA 5EKQD 4GZ6A 2VJ8A 4C48B 3FHEA 3KEAA 3CVVA 3UPVA 3UI2A 4EBAA 3PRZA 3RRMB 1LD8A 2AXVA 2P9LG 5EX3A 4MS6A 3SQVA 2V5QC 3B7TA 2L9BA 4P29A 3ONLA 4NQ0A 5LCWC 1H2TC 5HI7A 3S7DA 4WWNA 2GW1A 2R03A 5KNGA 1KZPA 4HQDA 2IONA 2DIWA 2QYUA 5CECB 1N11A 3T8KA 3ASNE 4F1SA 3EDTB 2I1KA 2FF4A 3FH5A 5AJDA 4B94A 4Y6WA 3CVNA 4BERA 3PUKA 3UT8A 4F7AA 4GTQA 2OVFA 4U63A 3ULEG 3Q15A 3R7QA 3J5PA 1UW4B 2R5SA 4WWOA 3IHYA 3MYVA 4YDOA 3U66A 3LY7A 2JABA 3ZRHA 1IQUA 4HOQA 3GW4A 3CR3A 4OVVA 2J09A 4JPSA 3D9PA 5JHAA 1B89A 4CZ2D 4XKCA 4J8DA 4TV3A 2AJAA 2YINA 3V30A 1HS6A 4FU3A 4JW1A 2VGYA 4BSXA 2VYIA 3LVRE 1TR4A 1V54E 3UTMA 4F6RD 4GMRA 3L82A 2WXHA 4ANUA 1SA5A 1HF8A 3PZ2A 4XI0A 3B7RL 4M7CA 3JXIA 1E8XA 2DZNA 1TNZA 3ISMC 2XGMA 2ZU6B 3CK7A 2OCCE 1YMPA 1BLXB 1Z3YA 4HOUA 4HORA 2DYRE 5CMYA 4HXIA 1E8YA 3KS2A 4AEZC 4EZJA 1H6PA 2IQCA 1S63A 1TJFA 1JUQA 3RAUA 3LPZA 4BY6A 3BEEA 1JCSA 3D9OA 2Y4TA 4XI9A 4GCOA 3FUJA 2J07A 4I2ZA 1HH8A 3L16A 1LD7A 1NL4A 4I1AA 3OXFA 3D9HA 4ILIA 1MQSA 4LNGA 4DUIA 2QFCA 5LFAA 1ELKA 2R2LA 2IF4A 3ZYQA 1E8ZA 1D8EA 5EX0A 4KXKB 1AWCB 4N39A 4BT8A 3ZHEB 2P9NG 4AV7A 3CHMA 2ZISA 3FU0A 1FPPA 3FWVA 2P9UG 3MKQB 2NXPA 3PE3A 4LUNU 2IO2C 3FU5A 4XKBA 4ABNA 5ANLA 1HE8A 5G2NA 3ABKE 3TWVA 4ACLA 3BG1B 5CBNA 3R7RA 3ZYLA 2I2OA 2XGSA 1DVPA 3MJWA 2XEVA 4KYOB 5E75A 2PQNA 5IY5E 2BF0X 1MX2A 4WAFA 2CHXA 4IRUA 4LERA 4B89A 1D9SA 4PS8A 5AJLA 2UY1A 2X6JA 4JA7A 5FZQA 4LEUA 1IHBA 2ETAA 4OAVB 2WXFA 3Q73A 5BV1A 4O60A 4YDWA 2VQ2A 3VTXA 4BESA 3PNLB 4HNAD 3CSFA 1TNUA 4F1PA 3V2XA 1ELWA 3V31A 3UIOC 4QQIA 3U4TA 3PNTB 5HKPA 1UG3A 2XPIA 2V0PA 4JEUA 2FBNA 3CKBA 2J4DA 1E7VA 2KCVA 2CHZA 3L13A 4GPMA 5FWQA 2H6FA 3ULYA 2X6FA 3E33A 4GA1A 4TXQA 4EBAG 1FVFA 1KT1A 4N3CA 1N4RA 2QY7A 3RKVA 2QZAA 4FADA 4PUCA 3FUFA 4U95D 1TN7A 5FQ7A 2E2EA 4FC8A 3Q7AA 2P9IG 3MV3B 4HRMB 1MX4A 2BKKB 4EECA 3P2BA 4EZLA 1UJKA 4N3BA 3UQ3A 5D66A 3I4RB 1V55E 5G55A 2GRPB 3ZW3A 2WXQA 3CIAA 5HRYA 4U07A 1S0PA 1BD8A 4I6GA 4LSZE 5LCWJ 3DXKG 2B6CA 3TWTA 4GTSA 2LUHA 1RZ4A 2R17C 2V8SE 2XS1A 3RJVA 5AQBA 3CVXA 4K5CA 5AARA 2QC9A 3UMVA 3B7SA 3G2SA 5JJTA 3FUEA 2XCCA 1JCQA 3C72A 1XNFA 2A4ZA 5CERB 1WY6A 4A3VA 2WXMA 2ONDA 2WXPA 3VLFA 2JLBA 3AJIA 2I9CA 2XS8A 5EN5D 3KSQA 3EHRA 4KVMA 1W3BA 4I6JA 2WQHA 2XRZA 2RD0A 4APFA 2LXLA 3T5XA 3CVLA 3EIQC 3L9TA 5DBKA 2P9PG 1O1TA 3CHPA 5KJLA 4MBGA 3ZVVA 3FUMA 3SD5A 4CDNA 1SZ9A 1E90A 4HB5A 1TNOA 2I1JA 4DLQA 3FY4A 3NF1A 3PUJA 5EIBE 5EYLA 3J5QB 4ZFHA 4I6EA 4PH4B 2WXRA 5EIDA 5BW8C 3TWWA 1TNYA 1UN9A 3S7FA 4J8FA 3SBTB 1BI7B 3C3QA 3HXCA 5CRVA 4JL0A 3LVQE 3BU8A 3Q75A 3TXNA 5KWDA 4YVQC 3SFXA 1BI8B 3PDNA 2CHWA 4WNDA 3PREA 2XQ0A 2WXIA 3UM0A 4GYOA 3EHQA 1OWMA 3ZGQA 1QNFA 4DK5A 4U8HA 5M72A 1PY1A 5FT9A 4F53A 4YVOA 4RG9A 2DZOA 1K3ZD 2VGXA 3GZ1A 3B7BA 3UKUG 1N0QA 3ZYKA 5FJYA 1XGWA 2WQ6A 2MRIA 2GRNB 4X8QA 3PE4A 1QZ2A 3B13A 3D3MA 2XZTG 2VGEA 4W9RA 3DPYA 3I3NA 3U64A 1IKND 4MKTA 2RKKA 4HRNA 2WB2A 2P9KG 1TN6A 3ASGA 3Q4AB 2PZIA 3PZDA 2UY1B 3JYSA 4ACKA 2UWJG 2ZGGA 2PNNA 2Y1LE 2Y69E 4APOA 3ABME 3AS5A 4FLHA 1VDYA 3V79K 4TUMA 1WM5A 5CEAA 1Q2ZA 5C1DA 1TJCA 4WWPA 1QYMA 2ZIRA 1LF8A 3Q5MA 4RVBA 3ZXPA 5LX8A 4UQYA 3KEZA 1G3NB 1FCHA 1DC2A 2IY0C 3SI5A 4Q94A 1OCZE 1N0RA 3KSLA 2J9QA 3FTYA 2LSUA 3FTZA 5CBOA 3DSSA 4AY5A 3R9MA 3SFZA 3LYAA 1MX6A 2IU1A 3ZKJA 5BT1A 4IULA 3CEQA 3LS8A 4TUUA 3F6QA 3CGHA 3W9GA 4XIFA 3OTNA 3L6AA 3LY9A 1TNBA 1Z3XA 5BXUA 3DEPA 4E85A 5AQAA 2GRMA 3NOCD 2EINE 3HIZA 4R7LA 4GYWA 1TEZA 4K0RA 2A5UA 2YQ8A 3IEGA 3UUXA 3GZSA 1O1RA 2P58C 1SQMA 5T4YA 3G2WA 2KATA 3SHFA 4D10C 1HU3A 3FH8A 1EDUA 3NOGD 3G2VA 3Q47B 3TG5A 3D9IA 3OXGA 1MJ0A 3TWRA 3I4GA 4EPZA 3MA5A 3TG4A 3UX4A 2AVPA 3E34A 4UWHA 4U8VD 2VSYA 1OUVA 4GYYA 1TYQG 2YHEA 2WVIA 4L2LA 4XX5A 2Y3AA 4N5QA 4YNDA 4KZ0A 1WG0A 2BEDA 2R05A 4N5CA 3JCKC 4BETA 4AJWA 4GZ5A 5FZSA 5A23A 3SY2A 4HI9A 4BFRA 3Q9UC 1OCOE 4H7YA 3X2QE 3PH0C 2CFUA 4UI9J 3IHVA 1EYHA 2OOEA 3CHRA 4PS3A 1ELRA 3MV2B 4A1GA 4XZ4A 3FH7A 4O1OA 4DX5D 2GGFA 2XGOA 3LJ3A 5FIOA 3DEOA 1S64A 4HFGA 4BWRA 1JWGA 1SVXA 3MCXA 2WM9A 3FP3A 2MYOA 5DIZA 4AIFA 4M3OA 4DX7D 3JXJA 4J8EA 1X81A 1Y8MA 2XENA 3ML8A 4HRLA 3AG2E 3IV0A 3GZ2A 4L9PA 4GU5A 2H6GA 4FJZA 2LAIA 2F8XK 2HO1A 3ZUVB 4RLYA 3N71A 3HG0D 3DSXA 2OEVA 4NIKA 2XEHA 4FULA 3PZ3A 4G8KA 3TWQA 1E96B 3LKUA 3QKYA 3FUIA 2FO7A 2XPYA 4ME2A 4XEIG 4U0UA 4DLOA 2WXGA 1BPOA 1X5BA 3WG7E 3NBNB 4DX2A 5LP0A 5JA4D 4DI4A 5A6CA 4AXHA 2IJGX 1N54A 2AWIA 4WNFA 4AVXA 3FTVA 1N9AA 3AG4E 4HOTA 3UT7A 4K03A 3ZEFA 1YCSB 2HYZA 3JQ0A 5B3SE 3RRNB 2V4LA 1FT2A 4GA2A 5C2YA 3FTSA 3UM2A 4JA9A 4L7TA 5KBAA 4J7WA 1Y6IA 4JEHA 3EIJA 3PS6A 4BX8A 4DJAA 4CCAA 4GTVA 2AW6A 3HVEB 1H2VC 4GTPA 4HLLA 3ZNGA 3SNXA 2VTBB 3PVLA 5KJNA 4GMLA 5D0OD 3O4ZA 1INZA 3B95A 4FHKA 4CRWA 4U0SA 5FQ6A 1U3DA 4YDYA 4CT4A 2PM7A 3WXXA 4I43A 3CHOA 2R02A 3KD7A 5CRUA 4ANXA 4GAAA 3NZSA 2MHKA 3ZPJA 2FULA 3ESKA 3LJNA 5ANRA 1OWNA 5ITZF 3E37A 3FTXA 4KZCA 4NURA 4U96D 4NACA 4A1SA 3LY8A 2HE0A 4AOFA 1QQEA 4DRXE 4B8CB 4FJYA 4URKA 4U7EB 5T8IA 1MZCA 3RO3A 1GW6A 5G04J 3CVUA 1HG5A 5B1AE 3ML9A 5LOZA 2H6IA 3ENEA 1YA0A 1HXIA 5BPPA 4GB9A 3TWXA 3L22A 3B7UX 2X6HA 2OVBA 4UWFA 2BKGA 1H0AA 3EU9A 2YNQA 5BV0A 2LXMA 2WXNA 2EIJE 2IOSA 2VTBA 3I5PA 3HVEA 2CFZA 2JEKA 5JMND 1L5JA 2PL2A 2E0IA 2XRYA 3TGOA 1OT8A 3P1UA 4AY6A 3E32A 4G23A 3ZN3A 2ETCA 3EUVA 5KNHD 4UI9C 2P2CP 3QK0A 3R9AB 2NYJA 2LNIA 3G2UA 4PS7A 3U3WA 4EHMA 2KZTB 4A55A 2XEEA 3E4BA 3QB2A 4J0UA 3UINC 4G24A 3HXBA 3CHQA 1N52A 5AQ7A 1E8WA 2CG3A 3TL5A 2R59A 5CCMA 4JXTA 2RG8A 4GTTA 1PC2A 3UT4A 1O5MA 3IKOB 4UWGA 2LO6A 4MRUA 5FQ8A 3QOUA 4YDEA 5JJ6A 2ZGDA 3Q9NC 2J8SD 4JD2G 1EPUA 4IYPA 4A63B 4RSYA 2C2LA 4HLEA 2Y0BG 5BUZA 2X6IA 1Z5SC 3FDHA 1ZU2A 3CKCA 2XZDG 4HI8A 3RU0A 1E7UA 4EZKA 4ATZD 5G05J 1U3CA 1UOHA 5EDSA 4I9CA 2C0LA 4F3VA 2AXZA 4L2YA 5FQ4A 3HXDA 3QARA 2CG2A 4GTMA 2KBXA 5ENOD 4FA6A 5ARFA 3SZ7A 2FEZA 1SW6A 5ENPD 3T5VA 2VSXE 3DSTA 4DPRA 3RO2A 4AP2A 1OCRE 4N2SA 3DSVA 1D8DA 3IXEA 3FEYA 4UWKA 3ZYMA 4JVSA 3CK8A 3FEXA 3QWPA 3JQ1A 3UIPC 2KM4A 1NP7A 4G25A 4QFVA 3L54A 2KC7A 4CDMA 3ZXSA 5ARGA 4GZCA 4BTAA 5AQ9A 2BTDA 2GRLA 2DWZA 1IQRA 1QBQA 4Z68A 3CVWA 4BX9A 3FUHA 1HZ4A 3DPDA 4UQZA 5E76A 1ZB1A 4O1PA 5ENSD 4V3IA 4GMJA 4G1TA 3ESLA 2EILE 3LEWA 3D9MA 3NB2A 2WMOA 3C98A 3D9NA 4GZDA 1SZAA 5AAOA 3DSUA 4BT9A 2KZTA 4LG6A 3APDA 3RK6A 4KMOA 3CQGB 1SA4A 1BU9A 4WUYA 4BEPA 4CGVA 2I6HA 2ETBA 3W9FA 3S7BA 3PZ4A 3PZ1A 2J08A 4GZ3A 1HO8A 5AN8A
chains in the Genus database with same CATH topology
4EHMA 2ZIRA 1KZPA 3DSVA 1D8DA 3HXBA 1TNZA 3DSXA 3E34A 3PZ3A 3Q73A 3Q7FA 1NI1A 1FT1A 3KSLA 4GTOA 1JCQA 1S63A 3C72A 2BEDA 1TNUA 3HXEA 3DSSA 3E30A 4GTTA 4GTQA 3E37A 1JCSA 1O5MA 1LTXA 1QBQA 3KSQA 3Q78A 4YDEA 4LNBA 1MZCA 2H6FA 2IEJA 1LD7A 4YDOA 1NL4A 3DRAA 1O1SA 3Q79A 1O1TA 3E33A 1N4PA 3DPYA 4MBGA 4LNGA 1N9AA 1N94A 2R2LA 2H6IA 1N4RA 1TNBA 1DCEA 1JCRA 1N95A 1D8EA 2H6HA 4GTRA 1TNOA 1FT2A 1TN6A 1TN7A 2ZISA 1FPPA 1KZOA 2F0YA 3Q7AA 4GTSA 1S64A 3SFYA 3HXFA 3DSUA 1N4SA 1TN8A 4GTVA 1TNYA 1O1RA 4GTPA 3DSWA 1LD8A 3HXDA 4GTMA 1SA4A 1N4QA 3HXCA 3E32A 3EU5A 3EUVA 3Q75A 1X81A 3DSTA 3PZ4A 3PZ1A 1SA5A 3PZ2A 4L9PA 3SFXA 2H6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EHM A;  2ZIR A;  1KZP A;  3DSV A;  1D8D A;  3HXB A;  1TNZ A;  3DSX A;  3E34 A;  3PZ3 A;  3Q73 A;  3Q7F A;  1NI1 A;  1FT1 A;  3KSL A;  4GTO A;  1JCQ A;  1S63 A;  3C72 A;  2BED A;  1TNU A;  3HXE A;  3DSS A;  3E30 A;  4GTT A;  4GTQ A;  3E37 A;  1JCS A;  1O5M A;  1LTX A;  1QBQ A;  3KSQ A;  3Q78 A;  4YDE A;  4LNB A;  1MZC A;  2H6F A;  2IEJ A;  1LD7 A;  4YDO A;  1NL4 A;  3DRA A;  1O1S A;  3Q79 A;  1O1T A;  3E33 A;  1N4P A;  3DPY A;  4MBG A;  4LNG A;  1N9A A;  1N94 A;  2R2L A;  2H6I A;  1N4R A;  1TNB A;  1DCE A;  1JCR A;  1N95 A;  1D8E A;  2H6H A;  4GTR A;  1TNO A;  1FT2 A;  1TN6 A;  1TN7 A;  2ZIS A;  1FPP A;  1KZO A;  2F0Y A;  3Q7A A;  4GTS A;  1S64 A;  3SFY A;  3HXF A;  3DSU A;  1N4S A;  1TN8 A;  4GTV A;  1TNY A;  1O1R A;  4GTP A;  3DSW A;  1LD8 A;  3HXD A;  4GTM A;  1SA4 A;  1N4Q A;  3HXC A;  3E32 A;  3EU5 A;  3EUV A;  3Q75 A;  1X81 A;  3DST A;  3PZ4 A;  3PZ1 A;  1SA5 A;  3PZ2 A;  4L9P A;  3SFX A;  2H6G A; 
#chains in the Genus database with same CATH topology
 3VTY A;  4Q96 A;  4RQI A;  1NZN A;  3ASH A;  4J8S A;  4HS2 A;  3EJN A;  3APC A;  4OYS A;  2C0M A;  2P9S G;  3ASF A;  4JZY A;  2X6K A;  3CVQ A;  2VSO E;  4DX1 A;  1HG2 A;  4G26 A;  4HOS A;  3O48 A;  4G2V A;  4C0M A;  2NSZ A;  1AP7 A;  3HXE A;  3U9W A;  3FUN A;  1Z6T A;  1K8K G;  5CED B;  3ULQ A;  1MYO A;  2HR2 A;  1LTX A;  3C3O A;  1KPS B;  4I1O B;  4K5B A;  1KLX A;  2A5E A;  3HHM A;  3MX3 A;  3JUE A;  2IEJ A;  1O1S A;  4DX6 D;  4WNE A;  3PEV B;  1A17 A;  2GRQ B;  4ATG A;  1WDY A;  1N95 A;  2KCL A;  4RG6 A;  2EQX A;  1MHQ A;  4N2Q A;  1KZO A;  2F0Y A;  5AYW D;  5EIL A;  2L0T B;  2L6J A;  1NFI E;  3HDX A;  3QAQ A;  5AIJ A;  4TXP A;  4OAU C;  4Y6C A;  3C3R A;  3RIB A;  3RRU A;  1KT0 A;  4ANV A;  3ZHE A;  3TXM A;  4UI9 K;  4XE0 A;  1EF1 C;  3NZU A;  3VLE A;  4FLB A;  4J8Y A;  1IHG A;  2WMN A;  4CDR A;  3HRA A;  3QWV A;  2FO1 E;  2DVW A;  4IN3 B;  4KBQ A;  5FIN A;  1DNP A;  2Y4U A;  3SO8 A;  2V5F A;  4K5A B;  4I9E A;  3HYM B;  4UQX A;  3QDN A;  4LCT A;  3T8M A;  3MGB A;  5FTP A;  5J90 A;  3Q78 A;  3UM1 A;  4G8L A;  4LNB A;  1DCQ A;  3S2A A;  4C0E A;  3UM3 A;  2XCB A;  1HFA A;  2KXP C;  3OXL A;  3RSE G;  3Q49 B;  4GTR A;  3S7J A;  4PDX A;  4HBD A;  4DI3 A;  2GRR B;  2LAH A;  3CHS A;  3HXF A;  1ZBP A;  5G04 C;  3FTU A;  2X3M A;  5CMW A;  4JC8 A;  4U0Z A;  3ASO E;  1N4Q A;  2L6B A;  3CV0 A;  4UUC A;  3EU5 A;  2VSN A;  3BQO A;  5KCM A;  4JHK A;  1NA3 A;  2XHE A;  2MOW A;  3CST A;  4Q69 A;  3ASD A;  2OEW A;  2ILR A;  3QWW A;  3L17 A;  2WQ7 A;  2XPZ A;  3Q7F A;  4L23 A;  1PAQ A;  4C9B B;  3MKR A;  3AG1 E;  3FU3 A;  4O6F A;  3LDZ A;  3CVY A;  5ENQ D;  3D9K A;  4L1B A;  4KVO A;  1JWF A;  1JPL A;  3TWS A;  2DYS E;  1YYH A;  4I17 A;  3URZ A;  5H7P A;  2IFU A;  3ZFW A;  3DWL G;  3FTW A;  3AU4 A;  2NC9 A;  4H7X A;  4GCN A;  5JHB A;  3SBS A;  2YHC A;  3IBE A;  5D2M C;  4KT6 B;  3Q79 A;  2WXJ A;  5CCL A;  2KCK A;  1JCR A;  2H6H A;  3NAW A;  4E6H A;  5D0Q D;  2RFA A;  4ILH B;  1RW2 A;  2J4B A;  1U2V G;  2WXK A;  5G05 C;  3BG0 B;  3SFY A;  2WPV A;  4ZHB A;  1N4S A;  1IYG A;  1TN8 A;  4ILG A;  4NRH B;  3DSW A;  4J6I A;  4CT0 A;  5AEN A;  3LCA A;  1OCC E;  5J08 A;  3AS8 A;  3CQC B;  2GRO B;  1OY3 D;  5ENT D;  5JJ7 A;  1OXJ A;  3SF4 A;  3FU6 A;  3UKR G;  3TJP A;  3ZU7 B;  4GA0 A;  4CGW A;  4G11 A;  3AU5 A;  3V2O A;  4JHJ A;  3EHM A;  3KAE A;  4TRQ A;  1OWP A;  3D9L A;  3T9K A;  3NQP A;  3ONK A;  5CHE E;  1NI1 A;  1FT1 A;  1A5E A;  4GTO A;  3QNK A;  1H2U A;  1K1B A;  3AS4 A;  5ENN A;  1FVH A;  1H19 A;  3CVP A;  3K9I A;  2ZXW E;  4B0Z A;  1K1A A;  2DCP A;  3D9J A;  2QYJ A;  2X38 A;  5T3R A;  2WXL A;  4UWL A;  4AM9 A;  1UN8 A;  1S70 B;  3UXG A;  2Q7F A;  2OV8 A;  5A7D B;  1OWL A;  2IOL A;  2HM8 A;  3VLD A;  4I1M A;  4TXR A;  3OAW A;  1N94 A;  4WNG A;  5KJK A;  3TWU A;  4BSZ B;  5FZR A;  4LRZ A;  4FHJ A;  1OWO A;  3L08 A;  3ZIM A;  2L0I A;  1UJJ A;  3C5R A;  4FP7 A;  2V4H C;  2AXU A;  5KJM A;  3EHN A;  1P5Q A;  2DBA A;  4JB8 P;  4OVU A;  5B1B E;  3MEK A;  4CEM A;  4EQF A;  1NA0 A;  5BXO A;  3AG3 E;  3TAX A;  3DXM G;  4B93 B;  5BNW A;  3MKQ A;  3FFL A;  5EYP F;  2EIK E;  1IXV A;  4MLP A;  3FUK A;  2FI7 A;  2B0O E;  3AAA C;  2PQR A;  1WAO 1;  2BUG A;  4LNU D;  1H6O A;  3SGH A;  4BTB A;  4A3T A;  4N3A A;  3CLJ A;  3DBS A;  3QJZ A;  3MZL B;  3ABL E;  2F37 A;  4U8Y D;  3CK9 A;  2EIM E;  4JHR A;  2IO3 C;  3FUL A;  3E30 A;  2J49 A;  4ANW A;  3JUI A;  4HVB A;  5HQ8 A;  5ENR D;  2PM6 A;  2LSV A;  2M63 A;  2VGX B;  5HS0 A;  3PEU B;  3GYZ A;  3QC1 A;  3DRA A;  1H6K A;  3G2T A;  1N4P A;  2F8Y A;  1HX8 A;  2RFM A;  3BUA A;  3LXU X;  1DCE A;  4I2W A;  3APF A;  4CYM D;  3FUD A;  2WXO A;  4U04 A;  4GPK A;  4B8A A;  5EKQ D;  4GZ6 A;  2VJ8 A;  4C48 B;  3FHE A;  3KEA A;  3CVV A;  3UPV A;  3UI2 A;  4EBA A;  3PRZ A;  3RRM B;  1LD8 A;  2AXV A;  2P9L G;  5EX3 A;  4MS6 A;  3SQV A;  2V5Q C;  3B7T A;  2L9B A;  4P29 A;  3ONL A;  4NQ0 A;  5LCW C;  1H2T C;  5HI7 A;  3S7D A;  4WWN A;  2GW1 A;  2R03 A;  5KNG A;  1KZP A;  4HQD A;  2ION A;  2DIW A;  2QYU A;  5CEC B;  1N11 A;  3T8K A;  3ASN E;  4F1S A;  3EDT B;  2I1K A;  2FF4 A;  3FH5 A;  5AJD A;  4B94 A;  4Y6W A;  3CVN A;  4BER A;  3PUK A;  3UT8 A;  4F7A A;  4GTQ A;  2OVF A;  4U63 A;  3ULE G;  3Q15 A;  3R7Q A;  3J5P A;  1UW4 B;  2R5S A;  4WWO A;  3IHY A;  3MYV A;  4YDO A;  3U66 A;  3LY7 A;  2JAB A;  3ZRH A;  1IQU A;  4HOQ A;  3GW4 A;  3CR3 A;  4OVV A;  2J09 A;  4JPS A;  3D9P A;  5JHA A;  1B89 A;  4CZ2 D;  4XKC A;  4J8D A;  4TV3 A;  2AJA A;  2YIN A;  3V30 A;  1HS6 A;  4FU3 A;  4JW1 A;  2VGY A;  4BSX A;  2VYI A;  3LVR E;  1TR4 A;  1V54 E;  3UTM A;  4F6R D;  4GMR A;  3L82 A;  2WXH A;  4ANU A;  1SA5 A;  1HF8 A;  3PZ2 A;  4XI0 A;  3B7R L;  4M7C A;  3JXI A;  1E8X A;  2DZN A;  1TNZ A;  3ISM C;  2XGM A;  2ZU6 B;  3CK7 A;  2OCC E;  1YMP A;  1BLX B;  1Z3Y A;  4HOU A;  4HOR A;  2DYR E;  5CMY A;  4HXI A;  1E8Y A;  3KS2 A;  4AEZ C;  4EZJ A;  1H6P A;  2IQC A;  1S63 A;  1TJF A;  1JUQ A;  3RAU A;  3LPZ A;  4BY6 A;  3BEE A;  1JCS A;  3D9O A;  2Y4T A;  4XI9 A;  4GCO A;  3FUJ A;  2J07 A;  4I2Z A;  1HH8 A;  3L16 A;  1LD7 A;  1NL4 A;  4I1A A;  3OXF A;  3D9H A;  4ILI A;  1MQS A;  4LNG A;  4DUI A;  2QFC A;  5LFA A;  1ELK A;  2R2L A;  2IF4 A;  3ZYQ A;  1E8Z A;  1D8E A;  5EX0 A;  4KXK B;  1AWC B;  4N39 A;  4BT8 A;  3ZHE B;  2P9N G;  4AV7 A;  3CHM A;  2ZIS A;  3FU0 A;  1FPP A;  3FWV A;  2P9U G;  3MKQ B;  2NXP A;  3PE3 A;  4LUN U;  2IO2 C;  3FU5 A;  4XKB A;  4ABN A;  5ANL A;  1HE8 A;  5G2N A;  3ABK E;  3TWV A;  4ACL A;  3BG1 B;  5CBN A;  3R7R A;  3ZYL A;  2I2O A;  2XGS A;  1DVP A;  3MJW A;  2XEV A;  4KYO B;  5E75 A;  2PQN A;  5IY5 E;  2BF0 X;  1MX2 A;  4WAF A;  2CHX A;  4IRU A;  4LER A;  4B89 A;  1D9S A;  4PS8 A;  5AJL A;  2UY1 A;  2X6J A;  4JA7 A;  5FZQ A;  4LEU A;  1IHB A;  2ETA A;  4OAV B;  2WXF A;  3Q73 A;  5BV1 A;  4O60 A;  4YDW A;  2VQ2 A;  3VTX A;  4BES A;  3PNL B;  4HNA D;  3CSF A;  1TNU A;  4F1P A;  3V2X A;  1ELW A;  3V31 A;  3UIO C;  4QQI A;  3U4T A;  3PNT B;  5HKP A;  1UG3 A;  2XPI A;  2V0P A;  4JEU A;  2FBN A;  3CKB A;  2J4D A;  1E7V A;  2KCV A;  2CHZ A;  3L13 A;  4GPM A;  5FWQ A;  2H6F A;  3ULY A;  2X6F A;  3E33 A;  4GA1 A;  4TXQ A;  4EBA G;  1FVF A;  1KT1 A;  4N3C A;  1N4R A;  2QY7 A;  3RKV A;  2QZA A;  4FAD A;  4PUC A;  3FUF A;  4U95 D;  1TN7 A;  5FQ7 A;  2E2E A;  4FC8 A;  3Q7A A;  2P9I G;  3MV3 B;  4HRM B;  1MX4 A;  2BKK B;  4EEC A;  3P2B A;  4EZL A;  1UJK A;  4N3B A;  3UQ3 A;  5D66 A;  3I4R B;  1V55 E;  5G55 A;  2GRP B;  3ZW3 A;  2WXQ A;  3CIA A;  5HRY A;  4U07 A;  1S0P A;  1BD8 A;  4I6G A;  4LSZ E;  5LCW J;  3DXK G;  2B6C A;  3TWT A;  4GTS A;  2LUH A;  1RZ4 A;  2R17 C;  2V8S E;  2XS1 A;  3RJV A;  5AQB A;  3CVX A;  4K5C A;  5AAR A;  2QC9 A;  3UMV A;  3B7S A;  3G2S A;  5JJT A;  3FUE A;  2XCC A;  1JCQ A;  3C72 A;  1XNF A;  2A4Z A;  5CER B;  1WY6 A;  4A3V A;  2WXM A;  2OND A;  2WXP A;  3VLF A;  2JLB A;  3AJI A;  2I9C A;  2XS8 A;  5EN5 D;  3KSQ A;  3EHR A;  4KVM A;  1W3B A;  4I6J A;  2WQH A;  2XRZ A;  2RD0 A;  4APF A;  2LXL A;  3T5X A;  3CVL A;  3EIQ C;  3L9T A;  5DBK A;  2P9P G;  1O1T A;  3CHP A;  5KJL A;  4MBG A;  3ZVV A;  3FUM A;  3SD5 A;  4CDN A;  1SZ9 A;  1E90 A;  4HB5 A;  1TNO A;  2I1J A;  4DLQ A;  3FY4 A;  3NF1 A;  3PUJ A;  5EIB E;  5EYL A;  3J5Q B;  4ZFH A;  4I6E A;  4PH4 B;  2WXR A;  5EID A;  5BW8 C;  3TWW A;  1TNY A;  1UN9 A;  3S7F A;  4J8F A;  3SBT B;  1BI7 B;  3C3Q A;  3HXC A;  5CRV A;  4JL0 A;  3LVQ E;  3BU8 A;  3Q75 A;  3TXN A;  5KWD A;  4YVQ C;  3SFX A;  1BI8 B;  3PDN A;  2CHW A;  4WND A;  3PRE A;  2XQ0 A;  2WXI A;  3UM0 A;  4GYO A;  3EHQ A;  1OWM A;  3ZGQ A;  1QNF A;  4DK5 A;  4U8H A;  5M72 A;  1PY1 A;  5FT9 A;  4F53 A;  4YVO A;  4RG9 A;  2DZO A;  1K3Z D;  2VGX A;  3GZ1 A;  3B7B A;  3UKU G;  1N0Q A;  3ZYK A;  5FJY A;  1XGW A;  2WQ6 A;  2MRI A;  2GRN B;  4X8Q A;  3PE4 A;  1QZ2 A;  3B13 A;  3D3M A;  2XZT G;  2VGE A;  4W9R A;  3DPY A;  3I3N A;  3U64 A;  1IKN D;  4MKT A;  2RKK A;  4HRN A;  2WB2 A;  2P9K G;  1TN6 A;  3ASG A;  3Q4A B;  2PZI A;  3PZD A;  2UY1 B;  3JYS A;  4ACK A;  2UWJ G;  2ZGG A;  2PNN A;  2Y1L E;  2Y69 E;  4APO A;  3ABM E;  3AS5 A;  4FLH A;  1VDY A;  3V79 K;  4TUM A;  1WM5 A;  5CEA A;  1Q2Z A;  5C1D A;  1TJC A;  4WWP A;  1QYM A;  2ZIR A;  1LF8 A;  3Q5M A;  4RVB A;  3ZXP A;  5LX8 A;  4UQY A;  3KEZ A;  1G3N B;  1FCH A;  1DC2 A;  2IY0 C;  3SI5 A;  4Q94 A;  1OCZ E;  1N0R A;  3KSL A;  2J9Q A;  3FTY A;  2LSU A;  3FTZ A;  5CBO A;  3DSS A;  4AY5 A;  3R9M A;  3SFZ A;  3LYA A;  1MX6 A;  2IU1 A;  3ZKJ A;  5BT1 A;  4IUL A;  3CEQ A;  3LS8 A;  4TUU A;  3F6Q A;  3CGH A;  3W9G A;  4XIF A;  3OTN A;  3L6A A;  3LY9 A;  1TNB A;  1Z3X A;  5BXU A;  3DEP A;  4E85 A;  5AQA A;  2GRM A;  3NOC D;  2EIN E;  3HIZ A;  4R7L A;  4GYW A;  1TEZ A;  4K0R A;  2A5U A;  2YQ8 A;  3IEG A;  3UUX A;  3GZS A;  1O1R A;  2P58 C;  1SQM A;  5T4Y A;  3G2W A;  2KAT A;  3SHF A;  4D10 C;  1HU3 A;  3FH8 A;  1EDU A;  3NOG D;  3G2V A;  3Q47 B;  3TG5 A;  3D9I A;  3OXG A;  1MJ0 A;  3TWR A;  3I4G A;  4EPZ A;  3MA5 A;  3TG4 A;  3UX4 A;  2AVP A;  3E34 A;  4UWH A;  4U8V D;  2VSY A;  1OUV A;  4GYY A;  1TYQ G;  2YHE A;  2WVI A;  4L2L A;  4XX5 A;  2Y3A A;  4N5Q A;  4YND A;  4KZ0 A;  1WG0 A;  2BED A;  2R05 A;  4N5C A;  3JCK C;  4BET A;  4AJW A;  4GZ5 A;  5FZS A;  5A23 A;  3SY2 A;  4HI9 A;  4BFR A;  3Q9U C;  1OCO E;  4H7Y A;  3X2Q E;  3PH0 C;  2CFU A;  4UI9 J;  3IHV A;  1EYH A;  2OOE A;  3CHR A;  4PS3 A;  1ELR A;  3MV2 B;  4A1G A;  4XZ4 A;  3FH7 A;  4O1O A;  4DX5 D;  2GGF A;  2XGO A;  3LJ3 A;  5FIO A;  3DEO A;  1S64 A;  4HFG A;  4BWR A;  1JWG A;  1SVX A;  3MCX A;  2WM9 A;  3FP3 A;  2MYO A;  5DIZ A;  4AIF A;  4M3O A;  4DX7 D;  3JXJ A;  4J8E A;  1X81 A;  1Y8M A;  2XEN A;  3ML8 A;  4HRL A;  3AG2 E;  3IV0 A;  3GZ2 A;  4L9P A;  4GU5 A;  2H6G A;  4FJZ A;  2LAI A;  2F8X K;  2HO1 A;  3ZUV B;  4RLY A;  3N71 A;  3HG0 D;  3DSX A;  2OEV A;  4NIK A;  2XEH A;  4FUL A;  3PZ3 A;  4G8K A;  3TWQ A;  1E96 B;  3LKU A;  3QKY A;  3FUI A;  2FO7 A;  2XPY A;  4ME2 A;  4XEI G;  4U0U A;  4DLO A;  2WXG A;  1BPO A;  1X5B A;  3WG7 E;  3NBN B;  4DX2 A;  5LP0 A;  5JA4 D;  4DI4 A;  5A6C A;  4AXH A;  2IJG X;  1N54 A;  2AWI A;  4WNF A;  4AVX A;  3FTV A;  1N9A A;  3AG4 E;  4HOT A;  3UT7 A;  4K03 A;  3ZEF A;  1YCS B;  2HYZ A;  3JQ0 A;  5B3S E;  3RRN B;  2V4L A;  1FT2 A;  4GA2 A;  5C2Y A;  3FTS A;  3UM2 A;  4JA9 A;  4L7T A;  5KBA A;  4J7W A;  1Y6I A;  4JEH A;  3EIJ A;  3PS6 A;  4BX8 A;  4DJA A;  4CCA A;  4GTV A;  2AW6 A;  3HVE B;  1H2V C;  4GTP A;  4HLL A;  3ZNG A;  3SNX A;  2VTB B;  3PVL A;  5KJN A;  4GML A;  5D0O D;  3O4Z A;  1INZ A;  3B95 A;  4FHK A;  4CRW A;  4U0S A;  5FQ6 A;  1U3D A;  4YDY A;  4CT4 A;  2PM7 A;  3WXX A;  4I43 A;  3CHO A;  2R02 A;  3KD7 A;  5CRU A;  4ANX A;  4GAA A;  3NZS A;  2MHK A;  3ZPJ A;  2FUL A;  3ESK A;  3LJN A;  5ANR A;  1OWN A;  5ITZ F;  3E37 A;  3FTX A;  4KZC A;  4NUR A;  4U96 D;  4NAC A;  4A1S A;  3LY8 A;  2HE0 A;  4AOF A;  1QQE A;  4DRX E;  4B8C B;  4FJY A;  4URK A;  4U7E B;  5T8I A;  1MZC A;  3RO3 A;  1GW6 A;  5G04 J;  3CVU A;  1HG5 A;  5B1A E;  3ML9 A;  5LOZ A;  2H6I A;  3ENE A;  1YA0 A;  1HXI A;  5BPP A;  4GB9 A;  3TWX A;  3L22 A;  3B7U X;  2X6H A;  2OVB A;  4UWF A;  2BKG A;  1H0A A;  3EU9 A;  2YNQ A;  5BV0 A;  2LXM A;  2WXN A;  2EIJ E;  2IOS A;  2VTB A;  3I5P A;  3HVE A;  2CFZ A;  2JEK A;  5JMN D;  1L5J A;  2PL2 A;  2E0I A;  2XRY A;  3TGO A;  1OT8 A;  3P1U A;  4AY6 A;  3E32 A;  4G23 A;  3ZN3 A;  2ETC A;  3EUV A;  5KNH D;  4UI9 C;  2P2C P;  3QK0 A;  3R9A B;  2NYJ A;  2LNI A;  3G2U A;  4PS7 A;  3U3W A;  4EHM A;  2KZT B;  4A55 A;  2XEE A;  3E4B A;  3QB2 A;  4J0U A;  3UIN C;  4G24 A;  3HXB A;  3CHQ A;  1N52 A;  5AQ7 A;  1E8W A;  2CG3 A;  3TL5 A;  2R59 A;  5CCM A;  4JXT A;  2RG8 A;  4GTT A;  1PC2 A;  3UT4 A;  1O5M A;  3IKO B;  4UWG A;  2LO6 A;  4MRU A;  5FQ8 A;  3QOU A;  4YDE A;  5JJ6 A;  2ZGD A;  3Q9N C;  2J8S D;  4JD2 G;  1EPU A;  4IYP A;  4A63 B;  4RSY A;  2C2L A;  4HLE A;  2Y0B G;  5BUZ A;  2X6I A;  1Z5S C;  3FDH A;  1ZU2 A;  3CKC A;  2XZD G;  4HI8 A;  3RU0 A;  1E7U A;  4EZK A;  4ATZ D;  5G05 J;  1U3C A;  1UOH A;  5EDS A;  4I9C A;  2C0L A;  4F3V A;  2AXZ A;  4L2Y A;  5FQ4 A;  3HXD A;  3QAR A;  2CG2 A;  4GTM A;  2KBX A;  5ENO D;  4FA6 A;  5ARF A;  3SZ7 A;  2FEZ A;  1SW6 A;  5ENP D;  3T5V A;  2VSX E;  3DST A;  4DPR A;  3RO2 A;  4AP2 A;  1OCR E;  4N2S A;  3DSV A;  1D8D A;  3IXE A;  3FEY A;  4UWK A;  3ZYM A;  4JVS A;  3CK8 A;  3FEX A;  3QWP A;  3JQ1 A;  3UIP C;  2KM4 A;  1NP7 A;  4G25 A;  4QFV A;  3L54 A;  2KC7 A;  4CDM A;  3ZXS A;  5ARG A;  4GZC A;  4BTA A;  5AQ9 A;  2BTD A;  2GRL A;  2DWZ A;  1IQR A;  1QBQ A;  4Z68 A;  3CVW A;  4BX9 A;  3FUH A;  1HZ4 A;  3DPD A;  4UQZ A;  5E76 A;  1ZB1 A;  4O1P A;  5ENS D;  4V3I A;  4GMJ A;  4G1T A;  3ESL A;  2EIL E;  3LEW A;  3D9M A;  3NB2 A;  2WMO A;  3C98 A;  3D9N A;  4GZD A;  1SZA A;  5AAO A;  3DSU A;  4BT9 A;  2KZT A;  4LG6 A;  3APD A;  3RK6 A;  4KMO A;  3CQG B;  1SA4 A;  1BU9 A;  4WUY A;  4BEP A;  4CGV A;  2I6H A;  2ETB A;  3W9F A;  3S7B A;  3PZ4 A;  3PZ1 A;  2J08 A;  4GZ3 A;  1HO8 A;  5AN8 A; 
#chains in the Genus database with same CATH homology
 4EHM A;  2ZIR A;  1KZP A;  3DSV A;  1D8D A;  3HXB A;  1TNZ A;  3DSX A;  3E34 A;  3PZ3 A;  3Q73 A;  3Q7F A;  1NI1 A;  1FT1 A;  3KSL A;  4GTO A;  1JCQ A;  1S63 A;  3C72 A;  2BED A;  1TNU A;  3HXE A;  3DSS A;  3E30 A;  4GTT A;  4GTQ A;  3E37 A;  1JCS A;  1O5M A;  1LTX A;  1QBQ A;  3KSQ A;  3Q78 A;  4YDE A;  4LNB A;  1MZC A;  2H6F A;  2IEJ A;  1LD7 A;  4YDO A;  1NL4 A;  3DRA A;  1O1S A;  3Q79 A;  1O1T A;  3E33 A;  1N4P A;  3DPY A;  4MBG A;  4LNG A;  1N9A A;  1N94 A;  2R2L A;  2H6I A;  1N4R A;  1TNB A;  1DCE A;  1JCR A;  1N95 A;  1D8E A;  2H6H A;  4GTR A;  1TNO A;  1FT2 A;  1TN6 A;  1TN7 A;  2ZIS A;  1FPP A;  1KZO A;  2F0Y A;  3Q7A A;  4GTS A;  1S64 A;  3SFY A;  3HXF A;  3DSU A;  1N4S A;  1TN8 A;  4GTV A;  1TNY A;  1O1R A;  4GTP A;  3DSW A;  1LD8 A;  3HXD A;  4GTM A;  1SA4 A;  1N4Q A;  3HXC A;  3E32 A;  3EU5 A;  3EUV A;  3Q75 A;  1X81 A;  3DST A;  3PZ4 A;  3PZ1 A;  1SA5 A;  3PZ2 A;  4L9P A;  3SFX A;  2H6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...