1LD7A

Co-crystal structure of human farnesyltransferase with farnesyldiphosphate and inhibitor compound 66
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
313
structure length
313
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein farnesyltransferase alpha subunit
publication title 3-Aminopyrrolidinone farnesyltransferase inhibitors: design of macrocyclic compounds with improved pharmacokinetics and excellent cell potency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 125
structure length 313
sequence length 313
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1ld7A00
3EU5A 2F0YA 1N4QA 1LD7A 1FT1A 3Q79A 3PZ3A 1X81A 2IEJA 2R2LA 1MZCA 1FPPA 1N4SA 4MBGA 3Q73A 4GTPA 1SA4A 1N95A 4GTSA 3DSSA 1TNOA 1TNYA 3DSWA 1KZOA 1KZPA 1O1RA 3HXFA 3DSVA 4GTTA 3PZ2A 3E34A 1D8DA 1NL4A 1TNBA 1JCSA 2H6FA 4GTQA 1S64A 1LTXA 1D8EA 3SFYA 2H6HA 1TNUA 3E33A 3PZ1A 1TNZA 3KSQA 1JCRA 3HXDA 3DSUA 1N94A 3E37A 3DPYA 3EUVA 4GTVA 3Q75A 3E30A 3KSLA 3E32A 4L9PA 1TN8A 1O1TA 3Q7FA 3DSXA 3SFXA 4LNBA 3HXBA 1N4RA 1S63A 1TN6A 2ZISA 3DSTA 1DCEA 3Q78A 1N9AA 2ZIRA 1FT2A 1N4PA 1TN7A 1O5MA 2H6IA 2BEDA 4EHMA 4YDEA 3DRAA 3HXCA 1JCQA 4LNGA 3PZ4A 3HXEA 1SA5A 1LD8A 2H6GA 4GTRA 3Q7AA 1NI1A 4YDOA 1QBQA 4GTOA 3C72A 4GTMA 1O1SA
chains in the Genus database with same CATH superfamily
5AARA 4XKBA 1NFIE 4ATZD 4Q96A 4U0SA 3F6QA 1MZCA 3SBTB 5BXOA 2P9PG 4GZ3A 5D0QD 3LPZA 3DSSA 4BT9A 3R7RA 4F53A 4BT8A 3L22A 3DEPA 5KJLA 3B7UX 3UIPC 2ONDA 3KEAA 3SO8A 4N3CA 2NC9A 1E7UA 4O60A 3QK0A 4A1SA 3SFYA 2H6HA 1WDYA 1NP7A 4JL0A 2WXJA 3ML8A 4KVMA 2BKKB 3B7BA 1MHQA 3HIZA 3NAWA 5M72A 1MX2A 4IRUA 5EKQD 4BWRA 3T5VA 3W9GA 3AG2E 2PNNA 1N0RA 4GA0A 3MZLB 3KEZA 3UMVA 3SFZA 1W3BA 2PM6A 3ZGQA 2IOLA 3TWRA 1TN7A 3LY7A 4A1GA 3ABME 1RW2A 2WXOA 4WWOA 5HS0A 3CKCA 5AYWD 2KCVA 3I3NA 5CBOA 2IU1A 3DWLG 4I2ZA 2MYOA 3TWTA 3ASFA 3PRZA 2PM7A 5EN5D 5EX3A 4PS8A 5T4YA 4U8HA 1A5EA 4HRMB 1BI8B 2LUHA 4J8EA 3ULQA 3MKRA 1RZ4A 3FTWA 4FLBA 1IQUA 3AAAC 2RKKA 2WXMA 3APCA 4CGVA 1ELKA 3QAQA 4HVBA 4G1TA 1PC2A 1XNFA 3R9AB 2X6IA 3G2UA 2FULA 1JCSA 4CCAA 3DEOA 2XEEA 4FC8A 1TJCA 2I9CA 4LNUD 4RG6A 3ZPJA 2OOEA 1EF1C 2C0LA 3KSQA 3RKVA 1H6KA 2PZIA 4FULA 3T9KA 5CMWA 2HYZA 3FU6A 4C0EA 3W9FA 5FZQA 2WQHA 5D66A 1IHGA 3FU0A 1DCQA 2V4HC 3B13A 3CQGB 4GZDA 4MLPA 4BEPA 3EHNA 1O5MA 4FHJA 5JJ7A 3B7RL 1HU3A 2C0MA 2EQXA 3FH8A 2KATA 4HLEA 4I1OB 3RRNB 5G04C 4WNDA 3MJWA 4GB9A 3EIJA 3ASGA 2B6CA 3G2VA 4XIFA 4BX8A 3UTMA 1HZ4A 4B94A 4BTBA 4U63A 4L2LA 4HI9A 3QWVA 2WXHA 3FUEA 3NOGD 3UUXA 2WQ6A 4FP7A 4HRNA 4Y6WA 3KD7A 4ZHBA 2IO3C 3FP3A 1NL4A 4JA9A 4F7AA 2I2OA 1Q2ZA 3ENEA 3L08A 3ABLE 2MRIA 3ZIMA 1OCCE 2V5QC 3QNKA 3C5RA 3ZN3A 1HX8A 2X3MA 4TXPA 3G2TA 2VTBA 1S63A 4DPRA 1EYHA 4LG6A 4UWLA 3CVUA 5A6CA 3FU5A 3FFLA 2J4BA 2CHWA 3FUJA 2PQRA 3FUKA 4U04A 4G11A 5EX0A 2IFUA 1PAQA 4GZCA 4PUCA 4HS2A 4U8VD 3PH0C 3J5QB 1OWPA 2H6GA 4GTRA 4X8QA 2BF0X 4L2YA 3O48A 3NOCD 2VTBB 5DIZA 4CT4A 1QQEA 4GTOA 3C72A 2BKGA 2WXIA 4BSXA 3GZ1A 5KJMA 4I9CA 3FTYA 5J08A 3APFA 5ENPD 1Y6IA 3FTSA 2ETAA 1H0AA 4HOQA 1E8XA 1TNOA 4O1PA 3ZVVA 3FTVA 5EYPF 5ENRD 4FADA 3FDHA 2IQCA 4N5QA 4EZKA 4GAAA 2V8SE 2Y4UA 4AVXA 1SVXA 4BFRA 5KBAA 4ZFHA 4HBDA 3E33A 3PZ1A 1V54E 3U4TA 3AS5A 3CQCB 3UKRG 4ACLA 4NACA 5ENOD 4D10C 2QFCA 2GRMA 1UN8A 5FJYA 4TXRA 5CRUA 3PDNA 5AQBA 3SFXA 5CECB 4H7XA 2CFZA 3S7FA 2ZISA 2E0IA 3TWSA 4I6GA 1HF8A 3FH5A 4RG9A 5ENQD 2VSNA 3CHSA 2OVFA 3NF1A 1OWLA 1K8KG 1Y8MA 3LCAA 3PZ4A 1YYHA 4UQZA 3TG4A 1UJJA 1BU9A 1JWFA 3Q49B 3SY2A 4CDNA 4LCTA 1HS6A 3UPVA 1OCOE 5G55A 4JHRA 5ITZF 4DLOA 3EU9A 3SHFA 5T8IA 1IQRA 3JQ1A 4KVOA 1XGWA 4U07A 2CG3A 3R7QA 5CEAA 2IF4A 3DSWA 3S2AA 1KPSB 3I4RB 5BV0A 2WQ7A 5BV1A 2J08A 4DI3A 4GTTA 2B0OE 3C3RA 2HO1A 1Z3XA 5HQ8A 3EDTB 2OVBA 4N2QA 4KBQA 1BLXB 4APOA 3V2XA 2XZTG 1NA0A 3EHRA 5AJLA 3DPDA 4ATGA 4G8LA 3P1UA 4GYWA 3AG1E 4DX6D 1N94A 4GTVA 5G04J 1L5JA 3L16A 3CVQA 3ESLA 1UN9A 2DWZA 4H7YA 1ZB1A 1O1TA 2JABA 4N39A 3Q7FA 3VLDA 4FU3A 4GPKA 1EDUA 2ETBA 4UUCA 2AW6A 3FULA 2ZU6B 1FT2A 2GRRB 3L6AA 5D2MC 2BEDA 3UM1A 2LSUA 3DRAA 3SQVA 3CVPA 4PS3A 4N3BA 4DX2A 3EJNA 2BUGA 3ESKA 3IV0A 3PS6A 1BPOA 4WNFA 3IHYA 3ZYQA 3ZKJA 2EINE 2KC7A 1HH8A 1FT1A 2BTDA 3HHMA 4MBGA 4DX7D 3CSFA 3SI5A 1D9SA 4UI9C 3TJPA 3LDZA 2RFAA 3QWWA 3ONLA 1GW6A 2DCPA 3MA5A 2EIME 2WB2A 5CMYA 1B89A 5B1BE 2LO6A 4DLQA 3BQOA 3JCKC 2P9SG 1Z5SC 3UIOC 4Z68A 1H2VC 2WXPA 2V4LA 2L0TB 2R05A 1H2TC 4P29A 3ASHA 4EZLA 1QYMA 3DBSA 3E30A 2F8YA 4L1BA 1EPUA 4L9PA 2YHCA 2A5UA 1SQMA 3D9NA 2CG2A 2UY1A 5LCWJ 3HRAA 4O6FA 1TN6A 3L9TA 3LEWA 4K5AB 3SD5A 4U96D 5KJKA 1N9AA 4JZYA 5JJTA 2WXKA 2L0IA 5BXUA 3HXCA 4QQIA 5JJ6A 3FEYA 3FTXA 1SA5A 3SNXA 1PY1A 4ILHB 2DIWA 2UY1B 2LSVA 2AJAA 5BNWA 2V0PA 4GTMA 1IHBA 1N0QA 3NZSA 4AY6A 2RG8A 5AN8A 1N4QA 1MQSA 1K1AA 1WAO1 2YHEA 1IYGA 1X5BA 3PNTB 3UM0A 2VGXA 2WXFA 4JVSA 1SA4A 3CVXA 4JEUA 5EILA 1OWOA 3C3OA 3RSEG 4GMRA 2R5SA 4G23A 3CVVA 4HB5A 1TNBA 3ZRHA 2WM9A 4XX5A 3ASDA 2JEKA 2JLBA 3UX4A 1TEZA 3RU0A 3QKYA 2I1KA 4JD2G 3HYMB 4WAFA 3JYSA 1TYQG 4G24A 2VJ8A 3QDNA 3CVLA 2VGXB 2DZOA 3CK9A 4BSZB 1DNPA 2ZGDA 3RAUA 3FUNA 5ARGA 4OYSA 4B8AA 1Z3YA 4DJAA 1KLXA 3FH7A 3PNLB 4BY6A 2DBAA 1N4RA 5AQAA 5H7PA 3LXUX 5EIDA 5AQ7A 2LAHA 2XEVA 4Q94A 5ARFA 5FZSA 4UWHA 2AXUA 4RQIA 2F37A 2KM4A 5A7DB 5FTPA 3SZ7A 3L17A 5JA4D 4GYOA 4HFGA 2GGFA 1K1BA 2Y0BG 4A63B 4PDXA 3CK7A 3EHMA 3T8KA 1KT0A 1WG0A 3PE4A 2FO1E 5C1DA 2VYIA 3FWVA 2IEJA 2R2LA 4OAVB 3UXGA 2FEZA 5AIJA 3S7BA 4JB8P 3D9KA 3CR3A 5G05J 5AJDA 4GTSA 4OVVA 2XPZA 1TNYA 4XI9A 3RRMB 3ISMC 3GZ2A 1FVHA 4GA1A 4DI4A 3CLJA 3E34A 4UWKA 2X6JA 4AP2A 5AENA 3CGHA 3ZU7B 1DVPA 2XPYA 3FUMA 3UKUG 3D9HA 2QY7A 2H6FA 4I1AA 1S64A 1D8EA 2M63A 3LJ3A 2J8SD 3O4ZA 1TNZA 3ONKA 3GW4A 2A4ZA 2WXLA 3CV0A 2E2EA 3LVRE 4B89A 2MHKA 1OCZE 3BU8A 4XEIG 4WNGA 2FBNA 4K03A 3KS2A 4JW1A 2J4DA 3NZUA 1K3ZD 3ZNGA 3WXXA 4UI9J 2EILE 3Q4AB 2GROB 4PH4B 4KMOA 3TWUA 1TR4A 3AG3E 5HRYA 4LNGA 4KZ0A 2F8XK 5CRVA 3CVYA 5CCMA 1A17A 3UQ3A 4AEZC 2XENA 4AIFA 5B1AE 4I17A 2AXVA 4AM9A 1MYOA 3HDXA 2YNQA 1OUVA 4NRHB 3TG5A 3QB2A 1OY3D 4XI0A 3BG0B 3IBEA 2QC9A 5FQ4A 5LOZA 3ABKE 3FUIA 1N11A 3HVEA 4I6EA 5FZRA 2XEHA 3Q5MA 3U3WA 3Q47B 5LCWC 3Q9UC 4CGWA 4UWFA 1H19A 3CSTA 2HR2A 4KZCA 1TNUA 1JCRA 4FLHA 3VTYA 3SBSA 2XGMA 2I1JA 4URKA 3HVEB 3ZXSA 4ACKA 3ML9A 3UT8A 2P58C 2XRZA 3PUKA 4LNBA 3HXBA 4GZ6A 5G2NA 1E8ZA 2EIJE 3FHEA 4U0UA 4C48B 4QFVA 1OT8A 3L54A 1INZA 4DX5D 5FIOA 4FA6A 3ZUVB 1S70B 2OEWA 3BEEA 1ELWA 3D3MA 3V79K 4IN3B 1S0PA 4GZ5A 4DK5A 3MV3B 4JA7A 4G26A 3V2OA 3JUIA 3TWWA 3SF4A 3MEKA 4U8YD 3CK8A 1LD7A 2Y4TA 4J8SA 2MOWA 5KJNA 4ME2A 2Y1LE 3U64A 2NYJA 3FTUA 2WMOA 4APFA 4NIKA 3LJNA 1N95A 4KT6B 3AS8A 4LEUA 5LX8A 3PREA 4JC8A 4J8YA 2CHZA 3UT7A 3N71A 4ANWA 4CDMA 1DC2A 4YNDA 2OCCE 3CVWA 3CHQA 4GTQA 1MJ0A 1OXJA 3IEGA 1KT1A 1UOHA 3L13A 1V55E 2R17C 3OAWA 3LY8A 3B7TA 2R59A 3KSLA 1U3DA 1E7VA 5ENTD 4AY5A 1TN8A 4A3TA 2VSOE 2XCBA 5ANLA 3ZYMA 1N54A 1H2UA 2VGYA 4CT0A 3Q15A 4XE0A 4TUMA 1NZNA 2ZIRA 3AU4A 4TRQA 5LP0A 4UQYA 4F1SA 3LKUA 4HNAD 3UT4A 1YCSB 3HXEA 3LY9A 3LS8A 5G05C 4U7EB 3MV2B 2QYUA 1E8WA 3CHOA 1NI1A 3JXJA 5FWQA 2YINA 3K9IA 3BUAA 4JEHA 2AXZA 4E6HA 4YVQC 4AV7A 3Q79A 3PZ3A 4HLLA 3VTXA 5CEDB 1FVFA 2L6JA 1N4SA 4K5BA 3EHQA 5E76A 5J90A 2DZNA 4KXKB 1KZPA 4EQFA 4HOUA 2KXPC 1WM5A 1D8DA 4CDRA 5HKPA 4M7CA 4R7LA 2J49A 4PS7A 2DVWA 4BETA 4GCNA 3D9IA 3URZA 2FF4A 3PVLA 2R02A 4I1MA 2C2LA 3ASNE 4GU5A 4BESA 3E4BA 4FJZA 3RJVA 4HI8A 3I5PA 4TXQA 1FCHA 1E90A 4GMLA 1JUQA 5FQ6A 5BT1A 4JXTA 3LVQE 3PE3A 4GA2A 2KZTA 4JHJA 5KNHD 2P9UG 3VLEA 4I2WA 2X6HA 3MKQA 4C9BB 4LERA 3I4GA 5ENNA 2P9IG 4CZ2D 4TV3A 3T5XA 4YDYA 5CBNA 4CYMD 1H6OA 1UJKA 2XPIA 4DX1A 3OXGA 3TL5A 4GYYA 2WXNA 4MS6A 2WXRA 1QNFA 2KZTB 4LSZE 3ASOE 3Q73A 2UWJG 2Q7FA 3QOUA 2IONA 4GTPA 3PUJA 4N2SA 4W9RA 2KCKA 3V30A 3MKQB 5ANRA 3TGOA 3FY4A 3ZHEA 4XZ4A 3TAXA 4FHKA 3HXFA 4GPMA 1P5QA 2Y3AA 4EBAG 1E96B 3ZXPA 1LTXA 3NQPA 4MRUA 4ANVA 3D9LA 3J5PA 4I43A 5KNGA 5CCLA 4AOFA 3D9PA 3CHMA 5KWDA 2IO2C 3ZHEB 4YVOA 3AG4E 3TWVA 1MX4A 4JHKA 4AJWA 4B93B 4B0ZA 5HI7A 4TUUA 4I9EA 2GRPB 4EHMA 1ZBPA 4CRWA 3L82A 3T8MA 5T3RA 3PEUB 4K5CA 4L23A 4ILIA 3D9MA 4KYOB 1VDYA 3MX3A 2AVPA 1JWGA 3EU5A 1YA0A 4BERA 4HRLA 3TXNA 2IOSA 3RK6A 3FU3A 3ULYA 2XHEA 3VLFA 3P2BA 2HE0A 3OTNA 3OXLA 4A3VA 4I6JA 3UINC 1O1RA 5EYLA 4J0UA 5DBKA 4CEMA 5JHBA 4EECA 1ZU2A 5B3SE 2J09A 3G2WA 4HOTA 4B8CB 3Q9NC 3RO3A 4JPSA 4F1PA 1HXIA 5FQ8A 3FUHA 4Q69A 4EZJA 3UI2A 4UI9K 3JQ0A 4XKCA 3NBNB 4UQXA 4ANXA 1H6PA 3ZEFA 3C98A 1HFAA 2P9LG 3DSXA 4MKTA 4Y6CA 3SGHA 3ULEG 4RVBA 4ABNA 1AWCB 3PZDA 3Q78A 3X2QE 3AJIA 1SZAA 2LXLA 5BW8C 1JCQA 4HOSA 4U0ZA 3C3QA 1ELRA 2IY0C 2X38A 4J8FA 2ETCA 3CHPA 2OEVA 1OCRE 4IULA 2XGOA 3Q7AA 5CHEE 3MGBA 1QZ2A 2RD0A 1AP7A 3TWQA 1O1SA 2GW1A 3S7JA 4AXHA 2FI7A 3KAEA 4O1OA 2A5EA 3PEVB 2LNIA 4L7TA 2HM8A 2WXQA 4HQDA 5JMND 5IY5E 4OVUA 3JXIA 3V31A 3DXKG 4C0MA 5LFAA 2WPVA 1OWMA 5FINA 3B7SA 2J07A 3CKBA 4A55A 1U3CA 3OXFA 1LF8A 4N3AA 2WVIA 3U9WA 2P9NG 4V3IA 1HG2A 3G2SA 3CHRA 4BTAA 2GRNB 2X6FA 4DUIA 3E37A 3EUVA 1HE8A 4OAUC 1BI7B 3MCXA 3E32A 4RLYA 2CFUA 4J6IA 2Y69E 1U2VG 3D9JA 1IXVA 2IJGX 2KBXA 2QZAA 4K0RA 1OWNA 3U66A 3DSTA 1DCEA 5FQ7A 1YMPA 2OV8A 2XS1A 1E8YA 4ILGA 3TWXA 3IKOB 3ZFWA 2EIKE 2V5FA 4UWGA 2YQ8A 2R03A 2QYJA 4BX9A 4NURA 3CIAA 5BPPA 3QWPA 3QARA 3GZSA 2XQ0A 3R9MA 3UM2A 2VSXE 1SW6A 2ZGGA 3AS4A 1SZ9A 1TJFA 3ZW3A 4YDWA 1X81A 4J7WA 3DXMG 1HG5A 1KZOA 1WY6A 3B95A 1NA3A 3DSVA 2L6BA 2LXMA 1UG3A 3MYVA 2XRYA 5FT9A 2DYSE 3QJZA 3HG0D 4LUNU 3WG7E 2I6HA 1N52A 5D0OD 4F6RD 3UM3A 4LRZA 4WWNA 3ZYKA 3HXDA 2FO7A 3CEQA 3DPYA 3FUDA 3Q75A 3S7DA 3RO2A 1Z6TA 4WNEA 5C2YA 2PL2A 4HORA 3RIBA 3QC1A 4NQ0A 2VSYA 2DYRE 4EPZA 1N4PA 1UW4B 4IYPA 5JHAA 4WUYA 2PQNA 4F3VA 3FUFA 3IXEA 4E85A 1G3NB 4FJYA 5EIBE 3LYAA 1JPLA 3D9OA 2P9KG 2F0YA 2GRQB 2GRLA 3FTZA 1MX6A 3TXMA 4DRXE 4HXIA 1BD8A 2ZXWE 1FPPA 3NB2A 2P2CP 3BG1B 5BUZA 2NXPA 2LAIA 5EDSA 2XCCA 4EBAA 2L9BA 3PZ2A 5KCMA 3IHVA 5AQ9A 4ANUA 4U95D 5A23A 2KCLA 2VGEA 5ENSD 5CERB 4WWPA 3AU5A 4G8KA 4RSYA 4GCOA 5AAOA 2WMNA 3DSUA 4J8DA 3RRUA 4G2VA 3JUEA 1HO8A 3FEXA 3ZYLA 2J9QA 4GMJA 4G25A 3CVNA 2XS8A 3APDA 2CHXA 4M3OA 3EIQC 5E75A 2VQ2A 2AWIA 2H6IA 2XGSA 4YDEA 1IKND 2ILRA 2XZDG 2WXGA 2X6KA 4N5CA 1LD8A 2NSZA 3GYZA 4YDOA 1QBQA 2RFMA
chains in the Genus database with same CATH topology
3EU5A 2F0YA 1N4QA 1LD7A 1FT1A 3Q79A 3PZ3A 1X81A 2IEJA 2R2LA 1MZCA 1FPPA 1N4SA 4MBGA 3Q73A 4GTPA 1SA4A 1N95A 4GTSA 3DSSA 1TNOA 1TNYA 3DSWA 1KZOA 1KZPA 1O1RA 3HXFA 3DSVA 4GTTA 3PZ2A 3E34A 1D8DA 1NL4A 1TNBA 1JCSA 2H6FA 4GTQA 1S64A 1LTXA 1D8EA 3SFYA 2H6HA 1TNUA 3E33A 3PZ1A 1TNZA 3KSQA 1JCRA 3HXDA 3DSUA 1N94A 3E37A 3DPYA 3EUVA 4GTVA 3Q75A 3E30A 3KSLA 3E32A 4L9PA 1TN8A 1O1TA 3Q7FA 3DSXA 3SFXA 4LNBA 3HXBA 1N4RA 1S63A 1TN6A 2ZISA 3DSTA 1DCEA 3Q78A 1N9AA 2ZIRA 1FT2A 1N4PA 1TN7A 1O5MA 2H6IA 2BEDA 4EHMA 4YDEA 3DRAA 3HXCA 1JCQA 4LNGA 3PZ4A 3HXEA 1SA5A 1LD8A 2H6GA 4GTRA 3Q7AA 1NI1A 4YDOA 1QBQA 4GTOA 3C72A 4GTMA 1O1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EU5 A;  2F0Y A;  1N4Q A;  1LD7 A;  1FT1 A;  3Q79 A;  3PZ3 A;  1X81 A;  2IEJ A;  2R2L A;  1MZC A;  1FPP A;  1N4S A;  4MBG A;  3Q73 A;  4GTP A;  1SA4 A;  1N95 A;  4GTS A;  3DSS A;  1TNO A;  1TNY A;  3DSW A;  1KZO A;  1KZP A;  1O1R A;  3HXF A;  3DSV A;  4GTT A;  3PZ2 A;  3E34 A;  1D8D A;  1NL4 A;  1TNB A;  1JCS A;  2H6F A;  4GTQ A;  1S64 A;  1LTX A;  1D8E A;  3SFY A;  2H6H A;  1TNU A;  3E33 A;  3PZ1 A;  1TNZ A;  3KSQ A;  1JCR A;  3HXD A;  3DSU A;  1N94 A;  3E37 A;  3DPY A;  3EUV A;  4GTV A;  3Q75 A;  3E30 A;  3KSL A;  3E32 A;  4L9P A;  1TN8 A;  1O1T A;  3Q7F A;  3DSX A;  3SFX A;  4LNB A;  3HXB A;  1N4R A;  1S63 A;  1TN6 A;  2ZIS A;  3DST A;  1DCE A;  3Q78 A;  1N9A A;  2ZIR A;  1FT2 A;  1N4P A;  1TN7 A;  1O5M A;  2H6I A;  2BED A;  4EHM A;  4YDE A;  3DRA A;  3HXC A;  1JCQ A;  4LNG A;  3PZ4 A;  3HXE A;  1SA5 A;  1LD8 A;  2H6G A;  4GTR A;  3Q7A A;  1NI1 A;  4YDO A;  1QBQ A;  4GTO A;  3C72 A;  4GTM A;  1O1S A; 
#chains in the Genus database with same CATH topology
 5AAR A;  4XKB A;  1NFI E;  4ATZ D;  4Q96 A;  4U0S A;  3F6Q A;  1MZC A;  3SBT B;  5BXO A;  2P9P G;  4GZ3 A;  5D0Q D;  3LPZ A;  3DSS A;  4BT9 A;  3R7R A;  4F53 A;  4BT8 A;  3L22 A;  3DEP A;  5KJL A;  3B7U X;  3UIP C;  2OND A;  3KEA A;  3SO8 A;  4N3C A;  2NC9 A;  1E7U A;  4O60 A;  3QK0 A;  4A1S A;  3SFY A;  2H6H A;  1WDY A;  1NP7 A;  4JL0 A;  2WXJ A;  3ML8 A;  4KVM A;  2BKK B;  3B7B A;  1MHQ A;  3HIZ A;  3NAW A;  5M72 A;  1MX2 A;  4IRU A;  5EKQ D;  4BWR A;  3T5V A;  3W9G A;  3AG2 E;  2PNN A;  1N0R A;  4GA0 A;  3MZL B;  3KEZ A;  3UMV A;  3SFZ A;  1W3B A;  2PM6 A;  3ZGQ A;  2IOL A;  3TWR A;  1TN7 A;  3LY7 A;  4A1G A;  3ABM E;  1RW2 A;  2WXO A;  4WWO A;  5HS0 A;  3CKC A;  5AYW D;  2KCV A;  3I3N A;  5CBO A;  2IU1 A;  3DWL G;  4I2Z A;  2MYO A;  3TWT A;  3ASF A;  3PRZ A;  2PM7 A;  5EN5 D;  5EX3 A;  4PS8 A;  5T4Y A;  4U8H A;  1A5E A;  4HRM B;  1BI8 B;  2LUH A;  4J8E A;  3ULQ A;  3MKR A;  1RZ4 A;  3FTW A;  4FLB A;  1IQU A;  3AAA C;  2RKK A;  2WXM A;  3APC A;  4CGV A;  1ELK A;  3QAQ A;  4HVB A;  4G1T A;  1PC2 A;  1XNF A;  3R9A B;  2X6I A;  3G2U A;  2FUL A;  1JCS A;  4CCA A;  3DEO A;  2XEE A;  4FC8 A;  1TJC A;  2I9C A;  4LNU D;  4RG6 A;  3ZPJ A;  2OOE A;  1EF1 C;  2C0L A;  3KSQ A;  3RKV A;  1H6K A;  2PZI A;  4FUL A;  3T9K A;  5CMW A;  2HYZ A;  3FU6 A;  4C0E A;  3W9F A;  5FZQ A;  2WQH A;  5D66 A;  1IHG A;  3FU0 A;  1DCQ A;  2V4H C;  3B13 A;  3CQG B;  4GZD A;  4MLP A;  4BEP A;  3EHN A;  1O5M A;  4FHJ A;  5JJ7 A;  3B7R L;  1HU3 A;  2C0M A;  2EQX A;  3FH8 A;  2KAT A;  4HLE A;  4I1O B;  3RRN B;  5G04 C;  4WND A;  3MJW A;  4GB9 A;  3EIJ A;  3ASG A;  2B6C A;  3G2V A;  4XIF A;  4BX8 A;  3UTM A;  1HZ4 A;  4B94 A;  4BTB A;  4U63 A;  4L2L A;  4HI9 A;  3QWV A;  2WXH A;  3FUE A;  3NOG D;  3UUX A;  2WQ6 A;  4FP7 A;  4HRN A;  4Y6W A;  3KD7 A;  4ZHB A;  2IO3 C;  3FP3 A;  1NL4 A;  4JA9 A;  4F7A A;  2I2O A;  1Q2Z A;  3ENE A;  3L08 A;  3ABL E;  2MRI A;  3ZIM A;  1OCC E;  2V5Q C;  3QNK A;  3C5R A;  3ZN3 A;  1HX8 A;  2X3M A;  4TXP A;  3G2T A;  2VTB A;  1S63 A;  4DPR A;  1EYH A;  4LG6 A;  4UWL A;  3CVU A;  5A6C A;  3FU5 A;  3FFL A;  2J4B A;  2CHW A;  3FUJ A;  2PQR A;  3FUK A;  4U04 A;  4G11 A;  5EX0 A;  2IFU A;  1PAQ A;  4GZC A;  4PUC A;  4HS2 A;  4U8V D;  3PH0 C;  3J5Q B;  1OWP A;  2H6G A;  4GTR A;  4X8Q A;  2BF0 X;  4L2Y A;  3O48 A;  3NOC D;  2VTB B;  5DIZ A;  4CT4 A;  1QQE A;  4GTO A;  3C72 A;  2BKG A;  2WXI A;  4BSX A;  3GZ1 A;  5KJM A;  4I9C A;  3FTY A;  5J08 A;  3APF A;  5ENP D;  1Y6I A;  3FTS A;  2ETA A;  1H0A A;  4HOQ A;  1E8X A;  1TNO A;  4O1P A;  3ZVV A;  3FTV A;  5EYP F;  5ENR D;  4FAD A;  3FDH A;  2IQC A;  4N5Q A;  4EZK A;  4GAA A;  2V8S E;  2Y4U A;  4AVX A;  1SVX A;  4BFR A;  5KBA A;  4ZFH A;  4HBD A;  3E33 A;  3PZ1 A;  1V54 E;  3U4T A;  3AS5 A;  3CQC B;  3UKR G;  4ACL A;  4NAC A;  5ENO D;  4D10 C;  2QFC A;  2GRM A;  1UN8 A;  5FJY A;  4TXR A;  5CRU A;  3PDN A;  5AQB A;  3SFX A;  5CEC B;  4H7X A;  2CFZ A;  3S7F A;  2ZIS A;  2E0I A;  3TWS A;  4I6G A;  1HF8 A;  3FH5 A;  4RG9 A;  5ENQ D;  2VSN A;  3CHS A;  2OVF A;  3NF1 A;  1OWL A;  1K8K G;  1Y8M A;  3LCA A;  3PZ4 A;  1YYH A;  4UQZ A;  3TG4 A;  1UJJ A;  1BU9 A;  1JWF A;  3Q49 B;  3SY2 A;  4CDN A;  4LCT A;  1HS6 A;  3UPV A;  1OCO E;  5G55 A;  4JHR A;  5ITZ F;  4DLO A;  3EU9 A;  3SHF A;  5T8I A;  1IQR A;  3JQ1 A;  4KVO A;  1XGW A;  4U07 A;  2CG3 A;  3R7Q A;  5CEA A;  2IF4 A;  3DSW A;  3S2A A;  1KPS B;  3I4R B;  5BV0 A;  2WQ7 A;  5BV1 A;  2J08 A;  4DI3 A;  4GTT A;  2B0O E;  3C3R A;  2HO1 A;  1Z3X A;  5HQ8 A;  3EDT B;  2OVB A;  4N2Q A;  4KBQ A;  1BLX B;  4APO A;  3V2X A;  2XZT G;  1NA0 A;  3EHR A;  5AJL A;  3DPD A;  4ATG A;  4G8L A;  3P1U A;  4GYW A;  3AG1 E;  4DX6 D;  1N94 A;  4GTV A;  5G04 J;  1L5J A;  3L16 A;  3CVQ A;  3ESL A;  1UN9 A;  2DWZ A;  4H7Y A;  1ZB1 A;  1O1T A;  2JAB A;  4N39 A;  3Q7F A;  3VLD A;  4FU3 A;  4GPK A;  1EDU A;  2ETB A;  4UUC A;  2AW6 A;  3FUL A;  2ZU6 B;  1FT2 A;  2GRR B;  3L6A A;  5D2M C;  2BED A;  3UM1 A;  2LSU A;  3DRA A;  3SQV A;  3CVP A;  4PS3 A;  4N3B A;  4DX2 A;  3EJN A;  2BUG A;  3ESK A;  3IV0 A;  3PS6 A;  1BPO A;  4WNF A;  3IHY A;  3ZYQ A;  3ZKJ A;  2EIN E;  2KC7 A;  1HH8 A;  1FT1 A;  2BTD A;  3HHM A;  4MBG A;  4DX7 D;  3CSF A;  3SI5 A;  1D9S A;  4UI9 C;  3TJP A;  3LDZ A;  2RFA A;  3QWW A;  3ONL A;  1GW6 A;  2DCP A;  3MA5 A;  2EIM E;  2WB2 A;  5CMY A;  1B89 A;  5B1B E;  2LO6 A;  4DLQ A;  3BQO A;  3JCK C;  2P9S G;  1Z5S C;  3UIO C;  4Z68 A;  1H2V C;  2WXP A;  2V4L A;  2L0T B;  2R05 A;  1H2T C;  4P29 A;  3ASH A;  4EZL A;  1QYM A;  3DBS A;  3E30 A;  2F8Y A;  4L1B A;  1EPU A;  4L9P A;  2YHC A;  2A5U A;  1SQM A;  3D9N A;  2CG2 A;  2UY1 A;  5LCW J;  3HRA A;  4O6F A;  1TN6 A;  3L9T A;  3LEW A;  4K5A B;  3SD5 A;  4U96 D;  5KJK A;  1N9A A;  4JZY A;  5JJT A;  2WXK A;  2L0I A;  5BXU A;  3HXC A;  4QQI A;  5JJ6 A;  3FEY A;  3FTX A;  1SA5 A;  3SNX A;  1PY1 A;  4ILH B;  2DIW A;  2UY1 B;  2LSV A;  2AJA A;  5BNW A;  2V0P A;  4GTM A;  1IHB A;  1N0Q A;  3NZS A;  4AY6 A;  2RG8 A;  5AN8 A;  1N4Q A;  1MQS A;  1K1A A;  1WAO 1;  2YHE A;  1IYG A;  1X5B A;  3PNT B;  3UM0 A;  2VGX A;  2WXF A;  4JVS A;  1SA4 A;  3CVX A;  4JEU A;  5EIL A;  1OWO A;  3C3O A;  3RSE G;  4GMR A;  2R5S A;  4G23 A;  3CVV A;  4HB5 A;  1TNB A;  3ZRH A;  2WM9 A;  4XX5 A;  3ASD A;  2JEK A;  2JLB A;  3UX4 A;  1TEZ A;  3RU0 A;  3QKY A;  2I1K A;  4JD2 G;  3HYM B;  4WAF A;  3JYS A;  1TYQ G;  4G24 A;  2VJ8 A;  3QDN A;  3CVL A;  2VGX B;  2DZO A;  3CK9 A;  4BSZ B;  1DNP A;  2ZGD A;  3RAU A;  3FUN A;  5ARG A;  4OYS A;  4B8A A;  1Z3Y A;  4DJA A;  1KLX A;  3FH7 A;  3PNL B;  4BY6 A;  2DBA A;  1N4R A;  5AQA A;  5H7P A;  3LXU X;  5EID A;  5AQ7 A;  2LAH A;  2XEV A;  4Q94 A;  5ARF A;  5FZS A;  4UWH A;  2AXU A;  4RQI A;  2F37 A;  2KM4 A;  5A7D B;  5FTP A;  3SZ7 A;  3L17 A;  5JA4 D;  4GYO A;  4HFG A;  2GGF A;  1K1B A;  2Y0B G;  4A63 B;  4PDX A;  3CK7 A;  3EHM A;  3T8K A;  1KT0 A;  1WG0 A;  3PE4 A;  2FO1 E;  5C1D A;  2VYI A;  3FWV A;  2IEJ A;  2R2L A;  4OAV B;  3UXG A;  2FEZ A;  5AIJ A;  3S7B A;  4JB8 P;  3D9K A;  3CR3 A;  5G05 J;  5AJD A;  4GTS A;  4OVV A;  2XPZ A;  1TNY A;  4XI9 A;  3RRM B;  3ISM C;  3GZ2 A;  1FVH A;  4GA1 A;  4DI4 A;  3CLJ A;  3E34 A;  4UWK A;  2X6J A;  4AP2 A;  5AEN A;  3CGH A;  3ZU7 B;  1DVP A;  2XPY A;  3FUM A;  3UKU G;  3D9H A;  2QY7 A;  2H6F A;  4I1A A;  1S64 A;  1D8E A;  2M63 A;  3LJ3 A;  2J8S D;  3O4Z A;  1TNZ A;  3ONK A;  3GW4 A;  2A4Z A;  2WXL A;  3CV0 A;  2E2E A;  3LVR E;  4B89 A;  2MHK A;  1OCZ E;  3BU8 A;  4XEI G;  4WNG A;  2FBN A;  4K03 A;  3KS2 A;  4JW1 A;  2J4D A;  3NZU A;  1K3Z D;  3ZNG A;  3WXX A;  4UI9 J;  2EIL E;  3Q4A B;  2GRO B;  4PH4 B;  4KMO A;  3TWU A;  1TR4 A;  3AG3 E;  5HRY A;  4LNG A;  4KZ0 A;  2F8X K;  5CRV A;  3CVY A;  5CCM A;  1A17 A;  3UQ3 A;  4AEZ C;  2XEN A;  4AIF A;  5B1A E;  4I17 A;  2AXV A;  4AM9 A;  1MYO A;  3HDX A;  2YNQ A;  1OUV A;  4NRH B;  3TG5 A;  3QB2 A;  1OY3 D;  4XI0 A;  3BG0 B;  3IBE A;  2QC9 A;  5FQ4 A;  5LOZ A;  3ABK E;  3FUI A;  1N11 A;  3HVE A;  4I6E A;  5FZR A;  2XEH A;  3Q5M A;  3U3W A;  3Q47 B;  5LCW C;  3Q9U C;  4CGW A;  4UWF A;  1H19 A;  3CST A;  2HR2 A;  4KZC A;  1TNU A;  1JCR A;  4FLH A;  3VTY A;  3SBS A;  2XGM A;  2I1J A;  4URK A;  3HVE B;  3ZXS A;  4ACK A;  3ML9 A;  3UT8 A;  2P58 C;  2XRZ A;  3PUK A;  4LNB A;  3HXB A;  4GZ6 A;  5G2N A;  1E8Z A;  2EIJ E;  3FHE A;  4U0U A;  4C48 B;  4QFV A;  1OT8 A;  3L54 A;  1INZ A;  4DX5 D;  5FIO A;  4FA6 A;  3ZUV B;  1S70 B;  2OEW A;  3BEE A;  1ELW A;  3D3M A;  3V79 K;  4IN3 B;  1S0P A;  4GZ5 A;  4DK5 A;  3MV3 B;  4JA7 A;  4G26 A;  3V2O A;  3JUI A;  3TWW A;  3SF4 A;  3MEK A;  4U8Y D;  3CK8 A;  1LD7 A;  2Y4T A;  4J8S A;  2MOW A;  5KJN A;  4ME2 A;  2Y1L E;  3U64 A;  2NYJ A;  3FTU A;  2WMO A;  4APF A;  4NIK A;  3LJN A;  1N95 A;  4KT6 B;  3AS8 A;  4LEU A;  5LX8 A;  3PRE A;  4JC8 A;  4J8Y A;  2CHZ A;  3UT7 A;  3N71 A;  4ANW A;  4CDM A;  1DC2 A;  4YND A;  2OCC E;  3CVW A;  3CHQ A;  4GTQ A;  1MJ0 A;  1OXJ A;  3IEG A;  1KT1 A;  1UOH A;  3L13 A;  1V55 E;  2R17 C;  3OAW A;  3LY8 A;  3B7T A;  2R59 A;  3KSL A;  1U3D A;  1E7V A;  5ENT D;  4AY5 A;  1TN8 A;  4A3T A;  2VSO E;  2XCB A;  5ANL A;  3ZYM A;  1N54 A;  1H2U A;  2VGY A;  4CT0 A;  3Q15 A;  4XE0 A;  4TUM A;  1NZN A;  2ZIR A;  3AU4 A;  4TRQ A;  5LP0 A;  4UQY A;  4F1S A;  3LKU A;  4HNA D;  3UT4 A;  1YCS B;  3HXE A;  3LY9 A;  3LS8 A;  5G05 C;  4U7E B;  3MV2 B;  2QYU A;  1E8W A;  3CHO A;  1NI1 A;  3JXJ A;  5FWQ A;  2YIN A;  3K9I A;  3BUA A;  4JEH A;  2AXZ A;  4E6H A;  4YVQ C;  4AV7 A;  3Q79 A;  3PZ3 A;  4HLL A;  3VTX A;  5CED B;  1FVF A;  2L6J A;  1N4S A;  4K5B A;  3EHQ A;  5E76 A;  5J90 A;  2DZN A;  4KXK B;  1KZP A;  4EQF A;  4HOU A;  2KXP C;  1WM5 A;  1D8D A;  4CDR A;  5HKP A;  4M7C A;  4R7L A;  2J49 A;  4PS7 A;  2DVW A;  4BET A;  4GCN A;  3D9I A;  3URZ A;  2FF4 A;  3PVL A;  2R02 A;  4I1M A;  2C2L A;  3ASN E;  4GU5 A;  4BES A;  3E4B A;  4FJZ A;  3RJV A;  4HI8 A;  3I5P A;  4TXQ A;  1FCH A;  1E90 A;  4GML A;  1JUQ A;  5FQ6 A;  5BT1 A;  4JXT A;  3LVQ E;  3PE3 A;  4GA2 A;  2KZT A;  4JHJ A;  5KNH D;  2P9U G;  3VLE A;  4I2W A;  2X6H A;  3MKQ A;  4C9B B;  4LER A;  3I4G A;  5ENN A;  2P9I G;  4CZ2 D;  4TV3 A;  3T5X A;  4YDY A;  5CBN A;  4CYM D;  1H6O A;  1UJK A;  2XPI A;  4DX1 A;  3OXG A;  3TL5 A;  4GYY A;  2WXN A;  4MS6 A;  2WXR A;  1QNF A;  2KZT B;  4LSZ E;  3ASO E;  3Q73 A;  2UWJ G;  2Q7F A;  3QOU A;  2ION A;  4GTP A;  3PUJ A;  4N2S A;  4W9R A;  2KCK A;  3V30 A;  3MKQ B;  5ANR A;  3TGO A;  3FY4 A;  3ZHE A;  4XZ4 A;  3TAX A;  4FHK A;  3HXF A;  4GPM A;  1P5Q A;  2Y3A A;  4EBA G;  1E96 B;  3ZXP A;  1LTX A;  3NQP A;  4MRU A;  4ANV A;  3D9L A;  3J5P A;  4I43 A;  5KNG A;  5CCL A;  4AOF A;  3D9P A;  3CHM A;  5KWD A;  2IO2 C;  3ZHE B;  4YVO A;  3AG4 E;  3TWV A;  1MX4 A;  4JHK A;  4AJW A;  4B93 B;  4B0Z A;  5HI7 A;  4TUU A;  4I9E A;  2GRP B;  4EHM A;  1ZBP A;  4CRW A;  3L82 A;  3T8M A;  5T3R A;  3PEU B;  4K5C A;  4L23 A;  4ILI A;  3D9M A;  4KYO B;  1VDY A;  3MX3 A;  2AVP A;  1JWG A;  3EU5 A;  1YA0 A;  4BER A;  4HRL A;  3TXN A;  2IOS A;  3RK6 A;  3FU3 A;  3ULY A;  2XHE A;  3VLF A;  3P2B A;  2HE0 A;  3OTN A;  3OXL A;  4A3V A;  4I6J A;  3UIN C;  1O1R A;  5EYL A;  4J0U A;  5DBK A;  4CEM A;  5JHB A;  4EEC A;  1ZU2 A;  5B3S E;  2J09 A;  3G2W A;  4HOT A;  4B8C B;  3Q9N C;  3RO3 A;  4JPS A;  4F1P A;  1HXI A;  5FQ8 A;  3FUH A;  4Q69 A;  4EZJ A;  3UI2 A;  4UI9 K;  3JQ0 A;  4XKC A;  3NBN B;  4UQX A;  4ANX A;  1H6P A;  3ZEF A;  3C98 A;  1HFA A;  2P9L G;  3DSX A;  4MKT A;  4Y6C A;  3SGH A;  3ULE G;  4RVB A;  4ABN A;  1AWC B;  3PZD A;  3Q78 A;  3X2Q E;  3AJI A;  1SZA A;  2LXL A;  5BW8 C;  1JCQ A;  4HOS A;  4U0Z A;  3C3Q A;  1ELR A;  2IY0 C;  2X38 A;  4J8F A;  2ETC A;  3CHP A;  2OEV A;  1OCR E;  4IUL A;  2XGO A;  3Q7A A;  5CHE E;  3MGB A;  1QZ2 A;  2RD0 A;  1AP7 A;  3TWQ A;  1O1S A;  2GW1 A;  3S7J A;  4AXH A;  2FI7 A;  3KAE A;  4O1O A;  2A5E A;  3PEV B;  2LNI A;  4L7T A;  2HM8 A;  2WXQ A;  4HQD A;  5JMN D;  5IY5 E;  4OVU A;  3JXI A;  3V31 A;  3DXK G;  4C0M A;  5LFA A;  2WPV A;  1OWM A;  5FIN A;  3B7S A;  2J07 A;  3CKB A;  4A55 A;  1U3C A;  3OXF A;  1LF8 A;  4N3A A;  2WVI A;  3U9W A;  2P9N G;  4V3I A;  1HG2 A;  3G2S A;  3CHR A;  4BTA A;  2GRN B;  2X6F A;  4DUI A;  3E37 A;  3EUV A;  1HE8 A;  4OAU C;  1BI7 B;  3MCX A;  3E32 A;  4RLY A;  2CFU A;  4J6I A;  2Y69 E;  1U2V G;  3D9J A;  1IXV A;  2IJG X;  2KBX A;  2QZA A;  4K0R A;  1OWN A;  3U66 A;  3DST A;  1DCE A;  5FQ7 A;  1YMP A;  2OV8 A;  2XS1 A;  1E8Y A;  4ILG A;  3TWX A;  3IKO B;  3ZFW A;  2EIK E;  2V5F A;  4UWG A;  2YQ8 A;  2R03 A;  2QYJ A;  4BX9 A;  4NUR A;  3CIA A;  5BPP A;  3QWP A;  3QAR A;  3GZS A;  2XQ0 A;  3R9M A;  3UM2 A;  2VSX E;  1SW6 A;  2ZGG A;  3AS4 A;  1SZ9 A;  1TJF A;  3ZW3 A;  4YDW A;  1X81 A;  4J7W A;  3DXM G;  1HG5 A;  1KZO A;  1WY6 A;  3B95 A;  1NA3 A;  3DSV A;  2L6B A;  2LXM A;  1UG3 A;  3MYV A;  2XRY A;  5FT9 A;  2DYS E;  3QJZ A;  3HG0 D;  4LUN U;  3WG7 E;  2I6H A;  1N52 A;  5D0O D;  4F6R D;  3UM3 A;  4LRZ A;  4WWN A;  3ZYK A;  3HXD A;  2FO7 A;  3CEQ A;  3DPY A;  3FUD A;  3Q75 A;  3S7D A;  3RO2 A;  1Z6T A;  4WNE A;  5C2Y A;  2PL2 A;  4HOR A;  3RIB A;  3QC1 A;  4NQ0 A;  2VSY A;  2DYR E;  4EPZ A;  1N4P A;  1UW4 B;  4IYP A;  5JHA A;  4WUY A;  2PQN A;  4F3V A;  3FUF A;  3IXE A;  4E85 A;  1G3N B;  4FJY A;  5EIB E;  3LYA A;  1JPL A;  3D9O A;  2P9K G;  2F0Y A;  2GRQ B;  2GRL A;  3FTZ A;  1MX6 A;  3TXM A;  4DRX E;  4HXI A;  1BD8 A;  2ZXW E;  1FPP A;  3NB2 A;  2P2C P;  3BG1 B;  5BUZ A;  2NXP A;  2LAI A;  5EDS A;  2XCC A;  4EBA A;  2L9B A;  3PZ2 A;  5KCM A;  3IHV A;  5AQ9 A;  4ANU A;  4U95 D;  5A23 A;  2KCL A;  2VGE A;  5ENS D;  5CER B;  4WWP A;  3AU5 A;  4G8K A;  4RSY A;  4GCO A;  5AAO A;  2WMN A;  3DSU A;  4J8D A;  3RRU A;  4G2V A;  3JUE A;  1HO8 A;  3FEX A;  3ZYL A;  2J9Q A;  4GMJ A;  4G25 A;  3CVN A;  2XS8 A;  3APD A;  2CHX A;  4M3O A;  3EIQ C;  5E75 A;  2VQ2 A;  2AWI A;  2H6I A;  2XGS A;  4YDE A;  1IKN D;  2ILR A;  2XZD G;  2WXG A;  2X6K A;  4N5C A;  1LD8 A;  2NSZ A;  3GYZ A;  4YDO A;  1QBQ A;  2RFM A; 
#chains in the Genus database with same CATH homology
 3EU5 A;  2F0Y A;  1N4Q A;  1LD7 A;  1FT1 A;  3Q79 A;  3PZ3 A;  1X81 A;  2IEJ A;  2R2L A;  1MZC A;  1FPP A;  1N4S A;  4MBG A;  3Q73 A;  4GTP A;  1SA4 A;  1N95 A;  4GTS A;  3DSS A;  1TNO A;  1TNY A;  3DSW A;  1KZO A;  1KZP A;  1O1R A;  3HXF A;  3DSV A;  4GTT A;  3PZ2 A;  3E34 A;  1D8D A;  1NL4 A;  1TNB A;  1JCS A;  2H6F A;  4GTQ A;  1S64 A;  1LTX A;  1D8E A;  3SFY A;  2H6H A;  1TNU A;  3E33 A;  3PZ1 A;  1TNZ A;  3KSQ A;  1JCR A;  3HXD A;  3DSU A;  1N94 A;  3E37 A;  3DPY A;  3EUV A;  4GTV A;  3Q75 A;  3E30 A;  3KSL A;  3E32 A;  4L9P A;  1TN8 A;  1O1T A;  3Q7F A;  3DSX A;  3SFX A;  4LNB A;  3HXB A;  1N4R A;  1S63 A;  1TN6 A;  2ZIS A;  3DST A;  1DCE A;  3Q78 A;  1N9A A;  2ZIR A;  1FT2 A;  1N4P A;  1TN7 A;  1O5M A;  2H6I A;  2BED A;  4EHM A;  4YDE A;  3DRA A;  3HXC A;  1JCQ A;  4LNG A;  3PZ4 A;  3HXE A;  1SA5 A;  1LD8 A;  2H6G A;  4GTR A;  3Q7A A;  1NI1 A;  4YDO A;  1QBQ A;  4GTO A;  3C72 A;  4GTM A;  1O1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...