1LD8A

Co-crystal structure of human farnesyltransferase with farnesyldiphosphate and inhibitor compound 49
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
313
structure length
313
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3-Aminopyrrolidinone farnesyltransferase inhibitors: design of macrocyclic compounds with improved pharmacokinetics and excellent cell potency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords protein farnesyltransferase alpha subunit
total genus 124
structure length 313
sequence length 313
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1ld8A00
1TN8A 2BEDA 1JCSA 3DPYA 3E34A 3E30A 3HXBA 2IEJA 3C72A 3KSLA 1FT1A 3Q79A 4GTVA 1FPPA 3DSUA 3DSVA 3DSWA 1MZCA 2ZISA 4EHMA 1QBQA 1D8DA 1O1RA 1N95A 1O5MA 1LTXA 1TNUA 3SFYA 4MBGA 1S64A 1KZPA 3PZ3A 2H6GA 1TNYA 4GTTA 4YDEA 1O1TA 1TN7A 3Q7AA 1SA5A 3PZ1A 1JCQA 1TNBA 3HXCA 1LD7A 4GTQA 4GTMA 1N9AA 1S63A 2R2LA 1X81A 1N4QA 2F0YA 2H6HA 3EUVA 1N94A 1O1SA 3DSXA 1N4SA 3HXEA 3EU5A 2H6IA 1JCRA 1NL4A 3DRAA 4LNGA 3E33A 2ZIRA 4GTSA 3SFXA 1D8EA 1NI1A 1FT2A 3HXFA 3Q78A 1LD8A 1TNOA 4L9PA 1N4PA 4LNBA 2H6FA 3E37A 3E32A 3DSTA 3DSSA 1DCEA 1SA4A 4GTPA 4GTRA 3Q75A 3KSQA 1TNZA 1N4RA 3HXDA 4YDOA 3Q73A 3PZ2A 1TN6A 1KZOA 3Q7FA 4GTOA 3PZ4A
chains in the Genus database with same CATH superfamily
1OCZE 5DIZA 3W9FA 3FP3A 4X8QA 2J09A 2VGXB 1W3BA 4YDYA 3ABME 1IYGA 4JHJA 2GGFA 3PNLB 2MOWA 5ENNA 2IO2C 3DSWA 3V31A 2WPVA 2PQNA 3LEWA 4AOFA 3FH5A 5KCMA 4BX8A 4GU5A 3SGHA 2WQ6A 4G25A 4HXIA 3ZHEA 1RW2A 4N3CA 3Q7AA 2WB2A 4KZCA 3B7RL 5EKQD 3RRMB 3UX4A 3L17A 4WWOA 3UTMA 3L9TA 4QQIA 2KCVA 3R9MA 2A5EA 4L1BA 3ULEG 4NACA 3MKRA 5HKPA 3EHNA 1NL4A 1IHBA 3SBTB 3HDXA 3UM1A 3CHSA 3CLJA 3DEPA 1MJ0A 4BEPA 3TWUA 4J0UA 3BQOA 2VSNA 2KBXA 2QYJA 2YHEA 3Q9NC 4BSZB 2WXRA 3SNXA 4UUCA 3D3MA 1OXJA 1DVPA 4B8AA 1UOHA 2ONDA 4N39A 4Y6WA 4YVQC 1TN8A 4P29A 1SZAA 2YNQA 4GCNA 3KS2A 3VLDA 3ZN3A 4ACLA 3UUXA 2RKKA 5FQ6A 3CVUA 5BT1A 4FLHA 4GPMA 1SW6A 2VGYA 4HRLA 2VYIA 1N95A 1QNFA 2JABA 2C2LA 2KCKA 1HO8A 4MKTA 2XZDG 1U2VG 3KEAA 2ZXWE 2H6GA 3CVXA 5B3SE 3TXMA 4APOA 5H7PA 3PUKA 2R17C 3HG0D 3R7RA 2QC9A 5CMYA 4CDNA 1BI8B 2EIJE 3UT8A 3PE4A 2PNNA 5CERB 2MHKA 3LY8A 3R9AB 4GYWA 3MJWA 4AM9A 4RSYA 1KLXA 4DI4A 5EDSA 4H7XA 1H2VC 3URZA 2WXQA 3JXJA 3FEYA 3LDZA 4UI9K 4IN3B 4K0RA 5T4YA 3V79K 2IO3C 2X6HA 5EIBE 4ANUA 5CRVA 5EILA 3MEKA 3Q49B 4YNDA 3L82A 3UIOC 2QY7A 3FTVA 3Q7FA 5AARA 4HNAD 4BSXA 4JL0A 5JHAA 3RRNB 2P9IG 3L08A 3UM3A 1PC2A 3C98A 2RFAA 1TYQG 2C0LA 3RJVA 4DX1A 4LG6A 3D9IA 2KZTB 3LJ3A 2NC9A 2I9CA 4A55A 4N3BA 4BETA 1HXIA 3C3OA 3CVNA 1NA3A 5D2MC 5E75A 2X3MA 3MV2B 4DLOA 2R2LA 2F0YA 2ETCA 3ZFWA 1N11A 2NYJA 2GRPB 3T9KA 3QB2A 2JLBA 4Z68A 1N0RA 3D9JA 3CIAA 2DYRE 1HFAA 4A3TA 1IXVA 3MCXA 3FTXA 2HE0A 2WMOA 3DXMG 1V55E 4GYOA 3SD5A 2BTDA 3NZUA 2XPIA 5FINA 1PAQA 2LXMA 2H6FA 5D0OD 5KWDA 2M63A 2F8YA 5FJYA 4I1AA 3V30A 2R59A 3KSQA 3LCAA 4HLEA 3EIQC 4K5AB 2VGEA 3BG0B 5EIDA 2FO7A 4WWPA 1KT0A 2I2OA 3PZ4A 4U04A 3UKUG 2DIWA 5LOZA 5BPPA 1NP7A 2PM6A 1G3NB 1MQSA 3QWVA 4ILHB 1LF8A 4C0MA 4L2YA 1DC2A 3EU9A 3OAWA 3Q4AB 3FUHA 5AIJA 5A23A 1TJCA 3ISMC 4CDRA 4JEUA 4DK5A 4PS3A 4U8YD 1TNUA 1TEZA 3D9OA 3SFYA 3B95A 4MRUA 4ANVA 5ENQD 4UQXA 5CCLA 1JCQA 3EIJA 5CEDB 3FUIA 4WNEA 4NIKA 4F53A 4TRQA 4E85A 1N4SA 3FTSA 3MX3A 2EIKE 4J6IA 4U8HA 3Q5MA 2LXLA 4EPZA 2RG8A 3FTYA 4XKCA 4B8CB 2ZGDA 3FFLA 1TR4A 2KXPC 1TNOA 3KAEA 1OWMA 1EDUA 3FDHA 2V5FA 3DSSA 2QZAA 2QFCA 4CDMA 4A1SA 1WY6A 3GZ1A 5AQ9A 3AU4A 4ABNA 5A7DB 2V5QC 4XX5A 2WXHA 2YHCA 1OCRE 2R03A 3J5PA 5T3RA 4Q96A 1SZ9A 2HR2A 2XGMA 1YA0A 3D9HA 4E6HA 3C3RA 3CQCB 3MKQA 3RO3A 2AW6A 2DZOA 3I3NA 4M7CA 5ITZF 2IEJA 5M72A 3VTXA 2BF0X 2ZISA 4HVBA 5HI7A 3CVQA 3ZYLA 3D9LA 2OOEA 3VLFA 1H2TC 1WM5A 2CFZA 3AG1E 4I6GA 2FI7A 3ASOE 3DEOA 2F37A 5JJTA 1SVXA 1OWLA 3UKRG 1OCOE 2X6IA 2PQRA 1O1SA 5AQAA 3HXEA 1IQUA 1YYHA 2H6IA 4U95D 3PS6A 4OAVB 1NFIE 3SQVA 2LSVA 5CBOA 4IULA 1BPOA 5EX3A 2XCBA 2IONA 4WAFA 3ASGA 2BKKB 4TV3A 4LEUA 2DVWA 2ZGGA 3S2AA 1L5JA 1H6KA 1Z5SC 3CKBA 4GZ3A 1Q2ZA 4G8KA 1DCEA 4M3OA 3U64A 3TL5A 3S7DA 3F6QA 3ML8A 2WVIA 2XPYA 1MX6A 2FBNA 3FTZA 3BUAA 4DRXE 4I6JA 3FH8A 4TUUA 5JA4D 1UJJA 1Z3XA 3Q47B 4TXQA 3FU0A 4BESA 4C0EA 1N0QA 2VSOE 3UT7A 1GW6A 2PL2A 3CQGB 1JWGA 3LPZA 4MS6A 4J7WA 4JVSA 4FP7A 2XS1A 4GYYA 3WG7E 4UWHA 3RRUA 2IOSA 5IY5E 1SA5A 1V54E 1Y8MA 5AQBA 4WNFA 3DBSA 4U0ZA 5FT9A 1YCSB 1K1BA 2P2CP 2EILE 2XPZA 5BV1A 4I9EA 4KVMA 1AWCB 5CBNA 4ILIA 4KXKB 1H19A 4CGVA 3FEXA 4ME2A 2WM9A 3RO2A 5CMWA 4URKA 3Q78A 1NZNA 4O1PA 2WQHA 1DCQA 5ANRA 3D9PA 4BX9A 2KATA 4C48B 3SFZA 3RSEG 5D0QD 3FTUA 5KJNA 2I6HA 3EJNA 4BTBA 3U66A 3ASNE 3LS8A 3QWPA 2Q7FA 4YVOA 4LSZE 2GRRB 3CSTA 3SHFA 3BU8A 1E8ZA 1IQRA 4FADA 3PDNA 3ZVVA 2R5SA 4LNUD 1K3ZD 3KSLA 3ABKE 3PEVB 4XI0A 3LY9A 3FUNA 3UM0A 3TWTA 3PZ3A 4Q94A 2P9KG 5G05J 3TG4A 5A6CA 5ENPD 1TN7A 1HX8A 3B7BA 3Q9UC 5B1AE 2XHEA 4EBAA 3HXCA 1EYHA 2GRQB 2WXNA 5ENTD 1N4QA 4I9CA 4BWRA 3DXKG 3BEEA 3EUVA 4FHKA 2JEKA 2PM7A 3LKUA 1S70B 2CG3A 3E33A 4U0SA 3S7JA 3C3QA 3TWRA 3ML9A 2BUGA 4TUMA 4AXHA 3R7QA 3U4TA 4KZ0A 3FTWA 4F3VA 4C9BB 1N4PA 3UPVA 3PH0C 3HVEB 2XEHA 4ACKA 4EZJA 3CHQA 1FVFA 3HHMA 2WQ7A 4KMOA 4PH4B 1H0AA 3Q73A 4OVUA 1KZOA 5ENOD 3QNKA 1S0PA 3ULYA 3UIPC 2CHWA 3T8MA 4QFVA 2V0PA 4ILGA 2VGXA 4XIFA 1TJFA 2CG2A 4LCTA 2VTBB 4GA1A 3EHMA 5G55A 3J5QB 3DSVA 5G04C 1QYMA 4IRUA 4HOTA 1D8DA 4F6RD 2OCCE 2IJGX 1OCCE 5FZRA 4GTTA 3Q15A 3AU5A 2XQ0A 3ZGQA 3B7TA 2IOLA 1K8KG 2H6HA 1HS6A 3ABLE 3FH7A 3SY2A 3L54A 3NZSA 4B0ZA 1OWNA 3LYAA 1IKND 3FY4A 1SQMA 3G2SA 2VSXE 3ZNGA 5KJLA 1HE8A 3IKOB 5LP0A 4U96D 2OVFA 4EECA 1HG2A 3HXFA 1NA0A 4HRNA 2L9BA 1LD8A 3X2QE 4L9PA 5JJ7A 4HI9A 2P9SG 2I1KA 1BLXB 4B89A 1UN9A 2J4DA 3IXEA 3NBNB 2OVBA 3LVQE 4H7YA 4L23A 2FULA 1K1AA 1BU9A 2LAHA 5LCWC 2Y0BG 3CK8A 3UXGA 1OUVA 4ANWA 4WNGA 3AG3E 4KT6B 3CVYA 3PZ2A 4GTOA 2J9QA 2XS8A 3NQPA 3P1UA 3LJNA 4DI3A 2BEDA 1ELKA 5HRYA 5HS0A 3QAQA 3LXUX 4AP2A 4F1SA 3JXIA 3FU5A 3IHVA 2P58C 2V4LA 1FT1A 4YDWA 4G24A 3SO8A 1UJKA 1AP7A 1U3DA 1S64A 2P9UG 4J8DA 1E96B 2GW1A 4CT0A 3RKVA 2GRLA 2E0IA 1TNBA 3MGBA 1HU3A 4G23A 2WXMA 4G8LA 5CCMA 3RK6A 1E90A 1BI7B 2WXFA 2OEVA 1JCRA 4I2WA 4O6FA 4HOUA 4Y6CA 1X5BA 1D8EA 2EINE 3L13A 4W9RA 2IFUA 3EDTB 1FT2A 4XI9A 2KM4A 3TJPA 5BNWA 5LCWJ 4J8SA 3EHQA 2LSUA 3AS4A 4GMLA 4KYOB 3QDNA 4LNBA 2L0IA 2QYUA 2XRZA 3E32A 3O48A 3TWWA 4G26A 2V8SE 1TN6A 3VTYA 4DJAA 2L6JA 3AG2E 2IY0C 5D66A 4TXRA 2F8XK 5ARGA 4ATZD 2J08A 2UWJG 4PS7A 1OT8A 4JPSA 3GW4A 5FQ8A 3NAWA 4JHRA 4BY6A 3VLEA 4DLQA 2RFMA 5FWQA 2GROB 5B1BE 4EHMA 5BUZA 3ZRHA 4R7LA 1E8WA 3NB2A 3EHRA 1UN8A 3DWLG 3G2TA 3S7BA 3QK0A 3ZYMA 1S63A 5KNHD 5ARFA 5KJKA 2WXLA 3APFA 4OYSA 1ZU2A 2NSZA 4HOSA 4JC8A 3FU3A 3DSXA 2Y3AA 2WXPA 4DUIA 3UQ3A 1HH8A 2ILRA 3AS8A 1DNPA 2DCPA 4UWLA 5FTPA 3EU5A 4K5BA 2XRYA 2ZIRA 2P9PG 3ZU7B 3NOCD 1E8YA 3NOGD 5JMND 4HS2A 4OAUC 4OVVA 4JA9A 1XGWA 4EBAG 3ZW3A 3WXXA 4A3VA 3DSTA 3SF4A 4RG9A 1D9SA 3PUJA 2X6FA 5AAOA 2LUHA 1TNZA 2AVPA 3RU0A 3CHPA 1OWOA 4EQFA 2OEWA 1P5QA 2YINA 3L16A 5C2YA 3MKQB 3CK7A 4J8YA 4HORA 2RD0A 3CR3A 4HB5A 4B93B 4UI9J 4DX6D 3JYSA 4U07A 1XNFA 3E30A 3CKCA 4U7EB 2FO1E 4BT8A 4Q69A 3DPDA 3PVLA 3UINC 3T8KA 3ZYKA 4I43A 3P2BA 1JWFA 3G2WA 1O1TA 2UY1A 3U3WA 4GTQA 1OY3D 4PS8A 5DBKA 3T5XA 3ESLA 3OXLA 4LERA 5CECB 3G2UA 3RIBA 4JA7A 1UW4B 2AXZA 3PNTB 3GYZA 4G11A 2NXPA 1HG5A 4HFGA 4O60A 2X6KA 4LNGA 4K03A 4IYPA 1INZA 1ELWA 5CEAA 2AXUA 4UWGA 5EX0A 2ETBA 2E2EA 3JUEA 3CHRA 3ONLA 2B0OE 3ZYQA 3TWSA 4XEIG 2XZTG 5C1DA 3ZKJA 3N71A 4AEZC 1KT1A 2J4BA 3LVRE 4GZDA 3UI2A 2LO6A 3TWVA 3MYVA 4FA6A 2WMNA 4GA2A 4AY5A 3JQ0A 4I2ZA 4KBQA 2FEZA 4GCOA 1HZ4A 4U0UA 3HXBA 4AJWA 3TGOA 2L6BA 4U63A 1PY1A 3ENEA 4HI8A 4HRMB 2R05A 4MBGA 5AN8A 2J49A 5E76A 1ZB1A 3RAUA 1MHQA 4HBDA 4I6EA 3ASFA 3APCA 1UG3A 3OTNA 4PDXA 3OXGA 4UQZA 4JZYA 2CHZA 4V3IA 4GPKA 3TG5A 3HRAA 4RG6A 3APDA 3AAAC 1Z6TA 2V4HC 1EF1C 1NI1A 1WDYA 2KCLA 5AJDA 5AJLA 1H6OA 4DX7D 2AWIA 1MYOA 4JB8P 3QJZA 4O1OA 1H2UA 4FLBA 2VSYA 1ELRA 1RZ4A 3FUEA 1B89A 3CVPA 1MX4A 3CK9A 2HO1A 2XEEA 5EYLA 3I5PA 4GZ6A 3IEGA 4DX5D 4UWKA 2VQ2A 4GTVA 3DSUA 4G1TA 2WXKA 4CCAA 5KBAA 3FU6A 1O1RA 1O5MA 2AJAA 2IU1A 3V2OA 3I4GA 1KZPA 3CVLA 1TNYA 2C0MA 5G04J 4YDEA 3ZXSA 2I1JA 3QWWA 3HYMB 3FWVA 5LX8A 3QARA 3AS5A 3TXNA 2GRNB 3L22A 1OWPA 3KEZA 2XEVA 5J90A 5BXOA 2ZU6B 3S7FA 1FCHA 4GTSA 3U9WA 3SFXA 4N5QA 5HQ8A 5ENSD 2GRMA 3MA5A 4L7TA 5FIOA 5BXUA 3E37A 4G2VA 2P9LG 4APFA 5LFAA 4CEMA 3FUFA 2WXOA 3NF1A 2UY1B 2R02A 5AENA 1ZBPA 5CHEE 5KJMA 4ATGA 2WXIA 4WNDA 3IBEA 2XGOA 2KZTA 4J8FA 4BFRA 1N4RA 4AVXA 4YDOA 3ESKA 5CRUA 4J8EA 4B94A 4FHJA 2B6CA 4GMRA 2IF4A 4F7AA 2VJ8A 1JCSA 4DPRA 1JUQA 1QQEA 3ZPJA 3Q79A 1E7UA 3FUJA 4WWNA 1QBQA 4CT4A 1WAO1 2J07A 4I1OB 3SBSA 4LUNU 2EIME 2KC7A 5ANLA 1Z3YA 3I4RB 3ZUVB 3PZ1A 2A4ZA 1LD7A 4BT9A 3UMVA 1YMPA 4XKBA 3CVVA 2EQXA 1N94A 4ZFHA 2Y69E 1FVHA 5FQ4A 2CHXA 4N2QA 3DRAA 4GZ5A 3TAXA 3GZ2A 2FF4A 4RLYA 4PUCA 4D10C 3OXFA 1N52A 5BW8C 3ULQA 3W9GA 3CEQA 3MV3B 1JPLA 4UI9C 4UWFA 2DWZA 2WXJA 4DX2A 3O4ZA 3CVWA 3CHOA 1KPSB 1SA4A 4F1PA 4GAAA 4GA0A 3V2XA 4AIFA 2PZIA 4XE0A 2CFUA 5JJ6A 5EYPF 2BKGA 4BERA 1U3CA 4A63B 3PZDA 3QOUA 3DPYA 4CYMD 4N5CA 4NURA 4ZHBA 3D9KA 2LAIA 1VDYA 4WUYA 4BTAA 5BV0A 4ANXA 2VTBA 1LTXA 5AYWD 3AJIA 3QC1A 3UT4A 5T8IA 3BG1B 3ZEFA 2HYZA 5AQ7A 1E7VA 2HM8A 4GMJA 2OV8A 3IV0A 4GTMA 1N9AA 2LNIA 1X81A 1IHGA 3PREA 4FC8A 2XGSA 4GZCA 2X38A 4RQIA 3TWXA 3ONKA 2ETAA 3T5VA 4KVOA 4HOQA 2WXGA 3HVEA 4EZLA 1A17A 3FUMA 1BD8A 4A1GA 3FUDA 5KNGA 3PRZA 5G2NA 2XCCA 1N54A 3UM2A 3SZ7A 3B7SA 3GZSA 4XZ4A 3D9NA 3ZXPA 4CZ2D 4RVBA 5FZQA 3MZLB 4NQ0A 4JW1A 2YQ8A 3HXDA 2DBAA 4FULA 3ASDA 2J8SD 2Y4TA 3LY7A 5EN5D 3G2VA 2IQCA 1WG0A 2AXVA 3L6AA 3KD7A 2P9NG 3B7UX 3E34A 1A5EA 1H6PA 2DYSE 3JUIA 2X6JA 4CGWA 3C72A 4JXTA 1FPPA 4UQYA 4AV7A 1MZCA 4LRZA 3FUKA 3JQ1A 4N3AA 4JEHA 4NRHB 4I17A 4GB9A 4TXPA 3CGHA 3B13A 4N2SA 1EPUA 1HF8A 3K9IA 3AG4E 4U8VD 4JHKA 3ASHA 5JHBA 3SI5A 3CSFA 3IHYA 5G05C 4AY6A 3ZIMA 3FULA 2XENA 2Y1LE 3TWQA 1Y6IA 2L0TB 4HQDA 3QKYA 4L2LA 4EZKA 4I1MA 3ZHEB 1MX2A 3PEUB 4FJYA 4JD2G 5J08A 2MYOA 5FQ7A 3HIZA 4HLLA 4FJZA 3PE3A 2DZNA 3CHMA 4FU3A 5FZSA 4CRWA 2MRIA 4MLPA 3FHEA 5ENRD 4GTPA 4GTRA 4K5CA 3Q75A 1E8XA 3CV0A 3JCKC 2Y4UA 2A5UA 3D9MA 3E4BA 3C5RA 1QZ2A
chains in the Genus database with same CATH topology
1TN8A 2BEDA 1JCSA 3DPYA 3E34A 3E30A 3HXBA 2IEJA 3C72A 3KSLA 1FT1A 3Q79A 4GTVA 1FPPA 3DSUA 3DSVA 3DSWA 1MZCA 2ZISA 4EHMA 1QBQA 1D8DA 1O1RA 1N95A 1O5MA 1LTXA 1TNUA 3SFYA 4MBGA 1S64A 1KZPA 3PZ3A 2H6GA 1TNYA 4GTTA 4YDEA 1O1TA 1TN7A 3Q7AA 1SA5A 3PZ1A 1JCQA 1TNBA 3HXCA 1LD7A 4GTQA 4GTMA 1N9AA 1S63A 2R2LA 1X81A 1N4QA 2F0YA 2H6HA 3EUVA 1N94A 1O1SA 3DSXA 1N4SA 3HXEA 3EU5A 2H6IA 1JCRA 1NL4A 3DRAA 4LNGA 3E33A 2ZIRA 4GTSA 3SFXA 1D8EA 1NI1A 1FT2A 3HXFA 3Q78A 1LD8A 1TNOA 4L9PA 1N4PA 4LNBA 2H6FA 3E37A 3E32A 3DSTA 3DSSA 1DCEA 1SA4A 4GTPA 4GTRA 3Q75A 3KSQA 1TNZA 1N4RA 3HXDA 4YDOA 3Q73A 3PZ2A 1TN6A 1KZOA 3Q7FA 4GTOA 3PZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TN8 A;  2BED A;  1JCS A;  3DPY A;  3E34 A;  3E30 A;  3HXB A;  2IEJ A;  3C72 A;  3KSL A;  1FT1 A;  3Q79 A;  4GTV A;  1FPP A;  3DSU A;  3DSV A;  3DSW A;  1MZC A;  2ZIS A;  4EHM A;  1QBQ A;  1D8D A;  1O1R A;  1N95 A;  1O5M A;  1LTX A;  1TNU A;  3SFY A;  4MBG A;  1S64 A;  1KZP A;  3PZ3 A;  2H6G A;  1TNY A;  4GTT A;  4YDE A;  1O1T A;  1TN7 A;  3Q7A A;  1SA5 A;  3PZ1 A;  1JCQ A;  1TNB A;  3HXC A;  1LD7 A;  4GTQ A;  4GTM A;  1N9A A;  1S63 A;  2R2L A;  1X81 A;  1N4Q A;  2F0Y A;  2H6H A;  3EUV A;  1N94 A;  1O1S A;  3DSX A;  1N4S A;  3HXE A;  3EU5 A;  2H6I A;  1JCR A;  1NL4 A;  3DRA A;  4LNG A;  3E33 A;  2ZIR A;  4GTS A;  3SFX A;  1D8E A;  1NI1 A;  1FT2 A;  3HXF A;  3Q78 A;  1LD8 A;  1TNO A;  4L9P A;  1N4P A;  4LNB A;  2H6F A;  3E37 A;  3E32 A;  3DST A;  3DSS A;  1DCE A;  1SA4 A;  4GTP A;  4GTR A;  3Q75 A;  3KSQ A;  1TNZ A;  1N4R A;  3HXD A;  4YDO A;  3Q73 A;  3PZ2 A;  1TN6 A;  1KZO A;  3Q7F A;  4GTO A;  3PZ4 A; 
#chains in the Genus database with same CATH topology
 1OCZ E;  5DIZ A;  3W9F A;  3FP3 A;  4X8Q A;  2J09 A;  2VGX B;  1W3B A;  4YDY A;  3ABM E;  1IYG A;  4JHJ A;  2GGF A;  3PNL B;  2MOW A;  5ENN A;  2IO2 C;  3DSW A;  3V31 A;  2WPV A;  2PQN A;  3LEW A;  4AOF A;  3FH5 A;  5KCM A;  4BX8 A;  4GU5 A;  3SGH A;  2WQ6 A;  4G25 A;  4HXI A;  3ZHE A;  1RW2 A;  4N3C A;  3Q7A A;  2WB2 A;  4KZC A;  3B7R L;  5EKQ D;  3RRM B;  3UX4 A;  3L17 A;  4WWO A;  3UTM A;  3L9T A;  4QQI A;  2KCV A;  3R9M A;  2A5E A;  4L1B A;  3ULE G;  4NAC A;  3MKR A;  5HKP A;  3EHN A;  1NL4 A;  1IHB A;  3SBT B;  3HDX A;  3UM1 A;  3CHS A;  3CLJ A;  3DEP A;  1MJ0 A;  4BEP A;  3TWU A;  4J0U A;  3BQO A;  2VSN A;  2KBX A;  2QYJ A;  2YHE A;  3Q9N C;  4BSZ B;  2WXR A;  3SNX A;  4UUC A;  3D3M A;  1OXJ A;  1DVP A;  4B8A A;  1UOH A;  2OND A;  4N39 A;  4Y6W A;  4YVQ C;  1TN8 A;  4P29 A;  1SZA A;  2YNQ A;  4GCN A;  3KS2 A;  3VLD A;  3ZN3 A;  4ACL A;  3UUX A;  2RKK A;  5FQ6 A;  3CVU A;  5BT1 A;  4FLH A;  4GPM A;  1SW6 A;  2VGY A;  4HRL A;  2VYI A;  1N95 A;  1QNF A;  2JAB A;  2C2L A;  2KCK A;  1HO8 A;  4MKT A;  2XZD G;  1U2V G;  3KEA A;  2ZXW E;  2H6G A;  3CVX A;  5B3S E;  3TXM A;  4APO A;  5H7P A;  3PUK A;  2R17 C;  3HG0 D;  3R7R A;  2QC9 A;  5CMY A;  4CDN A;  1BI8 B;  2EIJ E;  3UT8 A;  3PE4 A;  2PNN A;  5CER B;  2MHK A;  3LY8 A;  3R9A B;  4GYW A;  3MJW A;  4AM9 A;  4RSY A;  1KLX A;  4DI4 A;  5EDS A;  4H7X A;  1H2V C;  3URZ A;  2WXQ A;  3JXJ A;  3FEY A;  3LDZ A;  4UI9 K;  4IN3 B;  4K0R A;  5T4Y A;  3V79 K;  2IO3 C;  2X6H A;  5EIB E;  4ANU A;  5CRV A;  5EIL A;  3MEK A;  3Q49 B;  4YND A;  3L82 A;  3UIO C;  2QY7 A;  3FTV A;  3Q7F A;  5AAR A;  4HNA D;  4BSX A;  4JL0 A;  5JHA A;  3RRN B;  2P9I G;  3L08 A;  3UM3 A;  1PC2 A;  3C98 A;  2RFA A;  1TYQ G;  2C0L A;  3RJV A;  4DX1 A;  4LG6 A;  3D9I A;  2KZT B;  3LJ3 A;  2NC9 A;  2I9C A;  4A55 A;  4N3B A;  4BET A;  1HXI A;  3C3O A;  3CVN A;  1NA3 A;  5D2M C;  5E75 A;  2X3M A;  3MV2 B;  4DLO A;  2R2L A;  2F0Y A;  2ETC A;  3ZFW A;  1N11 A;  2NYJ A;  2GRP B;  3T9K A;  3QB2 A;  2JLB A;  4Z68 A;  1N0R A;  3D9J A;  3CIA A;  2DYR E;  1HFA A;  4A3T A;  1IXV A;  3MCX A;  3FTX A;  2HE0 A;  2WMO A;  3DXM G;  1V55 E;  4GYO A;  3SD5 A;  2BTD A;  3NZU A;  2XPI A;  5FIN A;  1PAQ A;  2LXM A;  2H6F A;  5D0O D;  5KWD A;  2M63 A;  2F8Y A;  5FJY A;  4I1A A;  3V30 A;  2R59 A;  3KSQ A;  3LCA A;  4HLE A;  3EIQ C;  4K5A B;  2VGE A;  3BG0 B;  5EID A;  2FO7 A;  4WWP A;  1KT0 A;  2I2O A;  3PZ4 A;  4U04 A;  3UKU G;  2DIW A;  5LOZ A;  5BPP A;  1NP7 A;  2PM6 A;  1G3N B;  1MQS A;  3QWV A;  4ILH B;  1LF8 A;  4C0M A;  4L2Y A;  1DC2 A;  3EU9 A;  3OAW A;  3Q4A B;  3FUH A;  5AIJ A;  5A23 A;  1TJC A;  3ISM C;  4CDR A;  4JEU A;  4DK5 A;  4PS3 A;  4U8Y D;  1TNU A;  1TEZ A;  3D9O A;  3SFY A;  3B95 A;  4MRU A;  4ANV A;  5ENQ D;  4UQX A;  5CCL A;  1JCQ A;  3EIJ A;  5CED B;  3FUI A;  4WNE A;  4NIK A;  4F53 A;  4TRQ A;  4E85 A;  1N4S A;  3FTS A;  3MX3 A;  2EIK E;  4J6I A;  4U8H A;  3Q5M A;  2LXL A;  4EPZ A;  2RG8 A;  3FTY A;  4XKC A;  4B8C B;  2ZGD A;  3FFL A;  1TR4 A;  2KXP C;  1TNO A;  3KAE A;  1OWM A;  1EDU A;  3FDH A;  2V5F A;  3DSS A;  2QZA A;  2QFC A;  4CDM A;  4A1S A;  1WY6 A;  3GZ1 A;  5AQ9 A;  3AU4 A;  4ABN A;  5A7D B;  2V5Q C;  4XX5 A;  2WXH A;  2YHC A;  1OCR E;  2R03 A;  3J5P A;  5T3R A;  4Q96 A;  1SZ9 A;  2HR2 A;  2XGM A;  1YA0 A;  3D9H A;  4E6H A;  3C3R A;  3CQC B;  3MKQ A;  3RO3 A;  2AW6 A;  2DZO A;  3I3N A;  4M7C A;  5ITZ F;  2IEJ A;  5M72 A;  3VTX A;  2BF0 X;  2ZIS A;  4HVB A;  5HI7 A;  3CVQ A;  3ZYL A;  3D9L A;  2OOE A;  3VLF A;  1H2T C;  1WM5 A;  2CFZ A;  3AG1 E;  4I6G A;  2FI7 A;  3ASO E;  3DEO A;  2F37 A;  5JJT A;  1SVX A;  1OWL A;  3UKR G;  1OCO E;  2X6I A;  2PQR A;  1O1S A;  5AQA A;  3HXE A;  1IQU A;  1YYH A;  2H6I A;  4U95 D;  3PS6 A;  4OAV B;  1NFI E;  3SQV A;  2LSV A;  5CBO A;  4IUL A;  1BPO A;  5EX3 A;  2XCB A;  2ION A;  4WAF A;  3ASG A;  2BKK B;  4TV3 A;  4LEU A;  2DVW A;  2ZGG A;  3S2A A;  1L5J A;  1H6K A;  1Z5S C;  3CKB A;  4GZ3 A;  1Q2Z A;  4G8K A;  1DCE A;  4M3O A;  3U64 A;  3TL5 A;  3S7D A;  3F6Q A;  3ML8 A;  2WVI A;  2XPY A;  1MX6 A;  2FBN A;  3FTZ A;  3BUA A;  4DRX E;  4I6J A;  3FH8 A;  4TUU A;  5JA4 D;  1UJJ A;  1Z3X A;  3Q47 B;  4TXQ A;  3FU0 A;  4BES A;  4C0E A;  1N0Q A;  2VSO E;  3UT7 A;  1GW6 A;  2PL2 A;  3CQG B;  1JWG A;  3LPZ A;  4MS6 A;  4J7W A;  4JVS A;  4FP7 A;  2XS1 A;  4GYY A;  3WG7 E;  4UWH A;  3RRU A;  2IOS A;  5IY5 E;  1SA5 A;  1V54 E;  1Y8M A;  5AQB A;  4WNF A;  3DBS A;  4U0Z A;  5FT9 A;  1YCS B;  1K1B A;  2P2C P;  2EIL E;  2XPZ A;  5BV1 A;  4I9E A;  4KVM A;  1AWC B;  5CBN A;  4ILI A;  4KXK B;  1H19 A;  4CGV A;  3FEX A;  4ME2 A;  2WM9 A;  3RO2 A;  5CMW A;  4URK A;  3Q78 A;  1NZN A;  4O1P A;  2WQH A;  1DCQ A;  5ANR A;  3D9P A;  4BX9 A;  2KAT A;  4C48 B;  3SFZ A;  3RSE G;  5D0Q D;  3FTU A;  5KJN A;  2I6H A;  3EJN A;  4BTB A;  3U66 A;  3ASN E;  3LS8 A;  3QWP A;  2Q7F A;  4YVO A;  4LSZ E;  2GRR B;  3CST A;  3SHF A;  3BU8 A;  1E8Z A;  1IQR A;  4FAD A;  3PDN A;  3ZVV A;  2R5S A;  4LNU D;  1K3Z D;  3KSL A;  3ABK E;  3PEV B;  4XI0 A;  3LY9 A;  3FUN A;  3UM0 A;  3TWT A;  3PZ3 A;  4Q94 A;  2P9K G;  5G05 J;  3TG4 A;  5A6C A;  5ENP D;  1TN7 A;  1HX8 A;  3B7B A;  3Q9U C;  5B1A E;  2XHE A;  4EBA A;  3HXC A;  1EYH A;  2GRQ B;  2WXN A;  5ENT D;  1N4Q A;  4I9C A;  4BWR A;  3DXK G;  3BEE A;  3EUV A;  4FHK A;  2JEK A;  2PM7 A;  3LKU A;  1S70 B;  2CG3 A;  3E33 A;  4U0S A;  3S7J A;  3C3Q A;  3TWR A;  3ML9 A;  2BUG A;  4TUM A;  4AXH A;  3R7Q A;  3U4T A;  4KZ0 A;  3FTW A;  4F3V A;  4C9B B;  1N4P A;  3UPV A;  3PH0 C;  3HVE B;  2XEH A;  4ACK A;  4EZJ A;  3CHQ A;  1FVF A;  3HHM A;  2WQ7 A;  4KMO A;  4PH4 B;  1H0A A;  3Q73 A;  4OVU A;  1KZO A;  5ENO D;  3QNK A;  1S0P A;  3ULY A;  3UIP C;  2CHW A;  3T8M A;  4QFV A;  2V0P A;  4ILG A;  2VGX A;  4XIF A;  1TJF A;  2CG2 A;  4LCT A;  2VTB B;  4GA1 A;  3EHM A;  5G55 A;  3J5Q B;  3DSV A;  5G04 C;  1QYM A;  4IRU A;  4HOT A;  1D8D A;  4F6R D;  2OCC E;  2IJG X;  1OCC E;  5FZR A;  4GTT A;  3Q15 A;  3AU5 A;  2XQ0 A;  3ZGQ A;  3B7T A;  2IOL A;  1K8K G;  2H6H A;  1HS6 A;  3ABL E;  3FH7 A;  3SY2 A;  3L54 A;  3NZS A;  4B0Z A;  1OWN A;  3LYA A;  1IKN D;  3FY4 A;  1SQM A;  3G2S A;  2VSX E;  3ZNG A;  5KJL A;  1HE8 A;  3IKO B;  5LP0 A;  4U96 D;  2OVF A;  4EEC A;  1HG2 A;  3HXF A;  1NA0 A;  4HRN A;  2L9B A;  1LD8 A;  3X2Q E;  4L9P A;  5JJ7 A;  4HI9 A;  2P9S G;  2I1K A;  1BLX B;  4B89 A;  1UN9 A;  2J4D A;  3IXE A;  3NBN B;  2OVB A;  3LVQ E;  4H7Y A;  4L23 A;  2FUL A;  1K1A A;  1BU9 A;  2LAH A;  5LCW C;  2Y0B G;  3CK8 A;  3UXG A;  1OUV A;  4ANW A;  4WNG A;  3AG3 E;  4KT6 B;  3CVY A;  3PZ2 A;  4GTO A;  2J9Q A;  2XS8 A;  3NQP A;  3P1U A;  3LJN A;  4DI3 A;  2BED A;  1ELK A;  5HRY A;  5HS0 A;  3QAQ A;  3LXU X;  4AP2 A;  4F1S A;  3JXI A;  3FU5 A;  3IHV A;  2P58 C;  2V4L A;  1FT1 A;  4YDW A;  4G24 A;  3SO8 A;  1UJK A;  1AP7 A;  1U3D A;  1S64 A;  2P9U G;  4J8D A;  1E96 B;  2GW1 A;  4CT0 A;  3RKV A;  2GRL A;  2E0I A;  1TNB A;  3MGB A;  1HU3 A;  4G23 A;  2WXM A;  4G8L A;  5CCM A;  3RK6 A;  1E90 A;  1BI7 B;  2WXF A;  2OEV A;  1JCR A;  4I2W A;  4O6F A;  4HOU A;  4Y6C A;  1X5B A;  1D8E A;  2EIN E;  3L13 A;  4W9R A;  2IFU A;  3EDT B;  1FT2 A;  4XI9 A;  2KM4 A;  3TJP A;  5BNW A;  5LCW J;  4J8S A;  3EHQ A;  2LSU A;  3AS4 A;  4GML A;  4KYO B;  3QDN A;  4LNB A;  2L0I A;  2QYU A;  2XRZ A;  3E32 A;  3O48 A;  3TWW A;  4G26 A;  2V8S E;  1TN6 A;  3VTY A;  4DJA A;  2L6J A;  3AG2 E;  2IY0 C;  5D66 A;  4TXR A;  2F8X K;  5ARG A;  4ATZ D;  2J08 A;  2UWJ G;  4PS7 A;  1OT8 A;  4JPS A;  3GW4 A;  5FQ8 A;  3NAW A;  4JHR A;  4BY6 A;  3VLE A;  4DLQ A;  2RFM A;  5FWQ A;  2GRO B;  5B1B E;  4EHM A;  5BUZ A;  3ZRH A;  4R7L A;  1E8W A;  3NB2 A;  3EHR A;  1UN8 A;  3DWL G;  3G2T A;  3S7B A;  3QK0 A;  3ZYM A;  1S63 A;  5KNH D;  5ARF A;  5KJK A;  2WXL A;  3APF A;  4OYS A;  1ZU2 A;  2NSZ A;  4HOS A;  4JC8 A;  3FU3 A;  3DSX A;  2Y3A A;  2WXP A;  4DUI A;  3UQ3 A;  1HH8 A;  2ILR A;  3AS8 A;  1DNP A;  2DCP A;  4UWL A;  5FTP A;  3EU5 A;  4K5B A;  2XRY A;  2ZIR A;  2P9P G;  3ZU7 B;  3NOC D;  1E8Y A;  3NOG D;  5JMN D;  4HS2 A;  4OAU C;  4OVV A;  4JA9 A;  1XGW A;  4EBA G;  3ZW3 A;  3WXX A;  4A3V A;  3DST A;  3SF4 A;  4RG9 A;  1D9S A;  3PUJ A;  2X6F A;  5AAO A;  2LUH A;  1TNZ A;  2AVP A;  3RU0 A;  3CHP A;  1OWO A;  4EQF A;  2OEW A;  1P5Q A;  2YIN A;  3L16 A;  5C2Y A;  3MKQ B;  3CK7 A;  4J8Y A;  4HOR A;  2RD0 A;  3CR3 A;  4HB5 A;  4B93 B;  4UI9 J;  4DX6 D;  3JYS A;  4U07 A;  1XNF A;  3E30 A;  3CKC A;  4U7E B;  2FO1 E;  4BT8 A;  4Q69 A;  3DPD A;  3PVL A;  3UIN C;  3T8K A;  3ZYK A;  4I43 A;  3P2B A;  1JWF A;  3G2W A;  1O1T A;  2UY1 A;  3U3W A;  4GTQ A;  1OY3 D;  4PS8 A;  5DBK A;  3T5X A;  3ESL A;  3OXL A;  4LER A;  5CEC B;  3G2U A;  3RIB A;  4JA7 A;  1UW4 B;  2AXZ A;  3PNT B;  3GYZ A;  4G11 A;  2NXP A;  1HG5 A;  4HFG A;  4O60 A;  2X6K A;  4LNG A;  4K03 A;  4IYP A;  1INZ A;  1ELW A;  5CEA A;  2AXU A;  4UWG A;  5EX0 A;  2ETB A;  2E2E A;  3JUE A;  3CHR A;  3ONL A;  2B0O E;  3ZYQ A;  3TWS A;  4XEI G;  2XZT G;  5C1D A;  3ZKJ A;  3N71 A;  4AEZ C;  1KT1 A;  2J4B A;  3LVR E;  4GZD A;  3UI2 A;  2LO6 A;  3TWV A;  3MYV A;  4FA6 A;  2WMN A;  4GA2 A;  4AY5 A;  3JQ0 A;  4I2Z A;  4KBQ A;  2FEZ A;  4GCO A;  1HZ4 A;  4U0U A;  3HXB A;  4AJW A;  3TGO A;  2L6B A;  4U63 A;  1PY1 A;  3ENE A;  4HI8 A;  4HRM B;  2R05 A;  4MBG A;  5AN8 A;  2J49 A;  5E76 A;  1ZB1 A;  3RAU A;  1MHQ A;  4HBD A;  4I6E A;  3ASF A;  3APC A;  1UG3 A;  3OTN A;  4PDX A;  3OXG A;  4UQZ A;  4JZY A;  2CHZ A;  4V3I A;  4GPK A;  3TG5 A;  3HRA A;  4RG6 A;  3APD A;  3AAA C;  1Z6T A;  2V4H C;  1EF1 C;  1NI1 A;  1WDY A;  2KCL A;  5AJD A;  5AJL A;  1H6O A;  4DX7 D;  2AWI A;  1MYO A;  4JB8 P;  3QJZ A;  4O1O A;  1H2U A;  4FLB A;  2VSY A;  1ELR A;  1RZ4 A;  3FUE A;  1B89 A;  3CVP A;  1MX4 A;  3CK9 A;  2HO1 A;  2XEE A;  5EYL A;  3I5P A;  4GZ6 A;  3IEG A;  4DX5 D;  4UWK A;  2VQ2 A;  4GTV A;  3DSU A;  4G1T A;  2WXK A;  4CCA A;  5KBA A;  3FU6 A;  1O1R A;  1O5M A;  2AJA A;  2IU1 A;  3V2O A;  3I4G A;  1KZP A;  3CVL A;  1TNY A;  2C0M A;  5G04 J;  4YDE A;  3ZXS A;  2I1J A;  3QWW A;  3HYM B;  3FWV A;  5LX8 A;  3QAR A;  3AS5 A;  3TXN A;  2GRN B;  3L22 A;  1OWP A;  3KEZ A;  2XEV A;  5J90 A;  5BXO A;  2ZU6 B;  3S7F A;  1FCH A;  4GTS A;  3U9W A;  3SFX A;  4N5Q A;  5HQ8 A;  5ENS D;  2GRM A;  3MA5 A;  4L7T A;  5FIO A;  5BXU A;  3E37 A;  4G2V A;  2P9L G;  4APF A;  5LFA A;  4CEM A;  3FUF A;  2WXO A;  3NF1 A;  2UY1 B;  2R02 A;  5AEN A;  1ZBP A;  5CHE E;  5KJM A;  4ATG A;  2WXI A;  4WND A;  3IBE A;  2XGO A;  2KZT A;  4J8F A;  4BFR A;  1N4R A;  4AVX A;  4YDO A;  3ESK A;  5CRU A;  4J8E A;  4B94 A;  4FHJ A;  2B6C A;  4GMR A;  2IF4 A;  4F7A A;  2VJ8 A;  1JCS A;  4DPR A;  1JUQ A;  1QQE A;  3ZPJ A;  3Q79 A;  1E7U A;  3FUJ A;  4WWN A;  1QBQ A;  4CT4 A;  1WAO 1;  2J07 A;  4I1O B;  3SBS A;  4LUN U;  2EIM E;  2KC7 A;  5ANL A;  1Z3Y A;  3I4R B;  3ZUV B;  3PZ1 A;  2A4Z A;  1LD7 A;  4BT9 A;  3UMV A;  1YMP A;  4XKB A;  3CVV A;  2EQX A;  1N94 A;  4ZFH A;  2Y69 E;  1FVH A;  5FQ4 A;  2CHX A;  4N2Q A;  3DRA A;  4GZ5 A;  3TAX A;  3GZ2 A;  2FF4 A;  4RLY A;  4PUC A;  4D10 C;  3OXF A;  1N52 A;  5BW8 C;  3ULQ A;  3W9G A;  3CEQ A;  3MV3 B;  1JPL A;  4UI9 C;  4UWF A;  2DWZ A;  2WXJ A;  4DX2 A;  3O4Z A;  3CVW A;  3CHO A;  1KPS B;  1SA4 A;  4F1P A;  4GAA A;  4GA0 A;  3V2X A;  4AIF A;  2PZI A;  4XE0 A;  2CFU A;  5JJ6 A;  5EYP F;  2BKG A;  4BER A;  1U3C A;  4A63 B;  3PZD A;  3QOU A;  3DPY A;  4CYM D;  4N5C A;  4NUR A;  4ZHB A;  3D9K A;  2LAI A;  1VDY A;  4WUY A;  4BTA A;  5BV0 A;  4ANX A;  2VTB A;  1LTX A;  5AYW D;  3AJI A;  3QC1 A;  3UT4 A;  5T8I A;  3BG1 B;  3ZEF A;  2HYZ A;  5AQ7 A;  1E7V A;  2HM8 A;  4GMJ A;  2OV8 A;  3IV0 A;  4GTM A;  1N9A A;  2LNI A;  1X81 A;  1IHG A;  3PRE A;  4FC8 A;  2XGS A;  4GZC A;  2X38 A;  4RQI A;  3TWX A;  3ONK A;  2ETA A;  3T5V A;  4KVO A;  4HOQ A;  2WXG A;  3HVE A;  4EZL A;  1A17 A;  3FUM A;  1BD8 A;  4A1G A;  3FUD A;  5KNG A;  3PRZ A;  5G2N A;  2XCC A;  1N54 A;  3UM2 A;  3SZ7 A;  3B7S A;  3GZS A;  4XZ4 A;  3D9N A;  3ZXP A;  4CZ2 D;  4RVB A;  5FZQ A;  3MZL B;  4NQ0 A;  4JW1 A;  2YQ8 A;  3HXD A;  2DBA A;  4FUL A;  3ASD A;  2J8S D;  2Y4T A;  3LY7 A;  5EN5 D;  3G2V A;  2IQC A;  1WG0 A;  2AXV A;  3L6A A;  3KD7 A;  2P9N G;  3B7U X;  3E34 A;  1A5E A;  1H6P A;  2DYS E;  3JUI A;  2X6J A;  4CGW A;  3C72 A;  4JXT A;  1FPP A;  4UQY A;  4AV7 A;  1MZC A;  4LRZ A;  3FUK A;  3JQ1 A;  4N3A A;  4JEH A;  4NRH B;  4I17 A;  4GB9 A;  4TXP A;  3CGH A;  3B13 A;  4N2S A;  1EPU A;  1HF8 A;  3K9I A;  3AG4 E;  4U8V D;  4JHK A;  3ASH A;  5JHB A;  3SI5 A;  3CSF A;  3IHY A;  5G05 C;  4AY6 A;  3ZIM A;  3FUL A;  2XEN A;  2Y1L E;  3TWQ A;  1Y6I A;  2L0T B;  4HQD A;  3QKY A;  4L2L A;  4EZK A;  4I1M A;  3ZHE B;  1MX2 A;  3PEU B;  4FJY A;  4JD2 G;  5J08 A;  2MYO A;  5FQ7 A;  3HIZ A;  4HLL A;  4FJZ A;  3PE3 A;  2DZN A;  3CHM A;  4FU3 A;  5FZS A;  4CRW A;  2MRI A;  4MLP A;  3FHE A;  5ENR D;  4GTP A;  4GTR A;  4K5C A;  3Q75 A;  1E8X A;  3CV0 A;  3JCK C;  2Y4U A;  2A5U A;  3D9M A;  3E4B A;  3C5R A;  1QZ2 A; 
#chains in the Genus database with same CATH homology
 1TN8 A;  2BED A;  1JCS A;  3DPY A;  3E34 A;  3E30 A;  3HXB A;  2IEJ A;  3C72 A;  3KSL A;  1FT1 A;  3Q79 A;  4GTV A;  1FPP A;  3DSU A;  3DSV A;  3DSW A;  1MZC A;  2ZIS A;  4EHM A;  1QBQ A;  1D8D A;  1O1R A;  1N95 A;  1O5M A;  1LTX A;  1TNU A;  3SFY A;  4MBG A;  1S64 A;  1KZP A;  3PZ3 A;  2H6G A;  1TNY A;  4GTT A;  4YDE A;  1O1T A;  1TN7 A;  3Q7A A;  1SA5 A;  3PZ1 A;  1JCQ A;  1TNB A;  3HXC A;  1LD7 A;  4GTQ A;  4GTM A;  1N9A A;  1S63 A;  2R2L A;  1X81 A;  1N4Q A;  2F0Y A;  2H6H A;  3EUV A;  1N94 A;  1O1S A;  3DSX A;  1N4S A;  3HXE A;  3EU5 A;  2H6I A;  1JCR A;  1NL4 A;  3DRA A;  4LNG A;  3E33 A;  2ZIR A;  4GTS A;  3SFX A;  1D8E A;  1NI1 A;  1FT2 A;  3HXF A;  3Q78 A;  1LD8 A;  1TNO A;  4L9P A;  1N4P A;  4LNB A;  2H6F A;  3E37 A;  3E32 A;  3DST A;  3DSS A;  1DCE A;  1SA4 A;  4GTP A;  4GTR A;  3Q75 A;  3KSQ A;  1TNZ A;  1N4R A;  3HXD A;  4YDO A;  3Q73 A;  3PZ2 A;  1TN6 A;  1KZO A;  3Q7F A;  4GTO A;  3PZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...