1LD8A

Co-crystal structure of human farnesyltransferase with farnesyldiphosphate and inhibitor compound 49
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
313
structure length
313
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein farnesyltransferase alpha subunit
publication title 3-Aminopyrrolidinone farnesyltransferase inhibitors: design of macrocyclic compounds with improved pharmacokinetics and excellent cell potency.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 124
structure length 313
sequence length 313
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1ld8A00
1TNZA 1N4QA 4L9PA 3EU5A 1TNOA 1D8DA 1TNUA 1N94A 3EUVA 3Q7AA 4GTTA 2H6GA 1QBQA 2H6FA 1NI1A 1TNYA 3DSVA 3HXBA 1MZCA 3Q75A 4GTRA 1JCSA 1O5MA 3PZ2A 4GTMA 3HXEA 4GTOA 1N95A 3E30A 3DSUA 3DSXA 1N4SA 1NL4A 3PZ4A 4LNGA 3SFXA 1S64A 4YDEA 1O1RA 3E33A 3HXDA 3Q79A 4GTVA 1FT2A 1FPPA 1TN6A 3DSWA 4GTPA 3DRAA 4LNBA 3DSTA 3Q7FA 3E37A 1O1SA 1N9AA 2F0YA 4YDOA 4MBGA 3KSLA 2H6HA 1DCEA 2ZIRA 2R2LA 3KSQA 1N4PA 1FT1A 1SA5A 1TN7A 3Q78A 3Q73A 3HXCA 4GTQA 3SFYA 1KZPA 3PZ3A 1O1TA 2ZISA 1LD8A 1TN8A 3E32A 1KZOA 2BEDA 3DPYA 2H6IA 4GTSA 1D8EA 3C72A 1N4RA 1S63A 3PZ1A 1LTXA 1JCRA 4EHMA 3DSSA 1JCQA 3E34A 1LD7A 2IEJA 1X81A 3HXFA 1SA4A 1TNBA
chains in the Genus database with same CATH superfamily
4JD2G 3EU5A 2QY7A 4BTAA 3B7UX 4E85A 4HI8A 5FTPA 1U2VG 2X6IA 4W9RA 5EDSA 1UN9A 1YCSB 4U0ZA 4APOA 3DSUA 3DSXA 1N4SA 3RAUA 2GRLA 3ASGA 1BU9A 2I1KA 1BD8A 4L2YA 4LCTA 3ZU7B 3LVRE 3C5RA 2L6BA 3CHPA 2BUGA 1IQUA 2CFZA 4LNBA 2PZIA 3TWVA 3FH8A 1OCOE 3IHYA 2L9BA 4I17A 2MHKA 4PS8A 4O1PA 4F3VA 1DC2A 1W3BA 3LEWA 3AU4A 3Q73A 4JXTA 5CRVA 4GA0A 4TRQA 3ZGQA 2FULA 1WDYA 2GRNB 3HDXA 3NAWA 1RZ4A 4FHJA 1OWNA 2DYSE 1Z3XA 5DIZA 3CK9A 2VSNA 3AG1E 2OOEA 3LVQE 3C3OA 3OXLA 4TXQA 4WUYA 1H19A 3FY4A 3IBEA 4BESA 4AXHA 4Y6WA 2XRZA 1IXVA 3B7SA 1E90A 2V4LA 1IHGA 1OWLA 5FZSA 3UUXA 2GROB 5ENRD 3CQGB 3FUNA 3CK7A 3RRUA 4CDMA 2XGMA 1NA3A 3BEEA 5AENA 4JB8P 4DUIA 2C0LA 5JJTA 4U8YD 4HI9A 1OWMA 2PQNA 3SBTB 3E37A 1DCEA 1ELWA 3L54A 1RW2A 5D0OD 3ZNGA 4K5AB 3RK6A 1Q2ZA 1K1AA 3PNLB 4B94A 4HFGA 4A55A 3QWWA 1TN7A 1QQEA 2J08A 2XZDG 3FU3A 1KZPA 5EX3A 4GZCA 5G2NA 3ULYA 3PRZA 4KYOB 1HF8A 3C3QA 3CHOA 3CVLA 3CHRA 4CZ2D 3PNTB 1SW6A 5EYLA 4AOFA 1N4RA 2ZU6B 2WMNA 3T5XA 3G2WA 3D9LA 2IJGX 1SA4A 3ASDA 3JUEA 3D9PA 3G2UA 5IY5E 2X6JA 2FF4A 3CVQA 2P2CP 3QK0A 2XPZA 3TAXA 3APFA 2ZGDA 1V55E 2KXPC 2P9KG 5BV0A 1S0PA 4I9EA 4KVMA 3LPZA 4HB5A 1H6PA 1N95A 3D3MA 3U4TA 2V4HC 3EJNA 4GYOA 3J5PA 2B0OE 5JHAA 3NZSA 2OVBA 1FCHA 3LY7A 4O1OA 1O1SA 3FEXA 4HS2A 3KSLA 4CDNA 4JA9A 4B0ZA 4JC8A 3MV2B 1X5BA 4GTQA 4OAUC 5ENPD 4EECA 4DPRA 2XEVA 3AS4A 5DBKA 5B1AE 5LOZA 5BXOA 2LSUA 4RQIA 2F8XK 1MX4A 3TWRA 5AIJA 2PM7A 1SVXA 2IEJA 4BSZB 4UI9C 1X81A 1NA0A 4QQIA 4JEHA 4AP2A 3I4RB 3TWXA 2P9LG 4TXPA 1TEZA 4J8DA 5G04J 4NACA 1NI1A 3ZN3A 2WQHA 3FULA 3PZ2A 3ONLA 2J07A 4M7CA 4DX2A 1HZ4A 4NIKA 3ZHEB 2WXRA 2KATA 4XZ4A 3WG7E 3TG5A 4GU5A 5KJNA 2DBAA 1KT1A 3R9MA 1ZBPA 3TXNA 2J9QA 5ENNA 3Q7FA 3V30A 4ACKA 5LP0A 3TXMA 4CEMA 3ESKA 3LJNA 4JEUA 3TWTA 4GA1A 2QZAA 4HXIA 5ANLA 3KSQA 3D9KA 3L82A 4B89A 2NYJA 4LERA 4DLOA 4M3OA 1UOHA 2DWZA 4FHKA 1HX8A 3RKVA 3Q9NC 4FC8A 4N5QA 1SQMA 4EBAG 1MHQA 2R03A 3L08A 3L9TA 4FA6A 1IQRA 1ELKA 5FJYA 2RKKA 1WG0A 4L7TA 4ANXA 4APFA 3NOGD 2P9IG 2A5UA 3UINC 2P9UG 1TNBA 1QNFA 4EZKA 4Q96A 3L6AA 1EYHA 1QBQA 2VYIA 1BI7B 2LNIA 2FEZA 4OVVA 2F37A 2VSXE 1ELRA 3LS8A 3VLEA 3UIPC 4BSXA 1KT0A 3CVVA 3P1UA 1OUVA 1HXIA 2WXOA 2UWJG 3KD7A 4YVQC 2DVWA 4ZHBA 2XZTG 2WXKA 4Z68A 2XCBA 2RD0A 3UMVA 5D2MC 4EQFA 4I6GA 5AJLA 2AXZA 4MKTA 4YDOA 3OXGA 2IY0C 4UQXA 4ATZD 4V3IA 4J8EA 3T9KA 4YNDA 5FZQA 4ACLA 5HKPA 3Q47B 4U7EB 3UT7A 1OT8A 3SFYA 1OWPA 3SFZA 3QKYA 3ABKE 3CQCB 1MQSA 2Y3AA 3SY2A 3FTVA 3NF1A 4WWOA 2IO3C 2H6IA 3D9JA 5BUZA 3R7QA 5FINA 4EHMA 4XEIG 2X3MA 1TJFA 4FADA 2YQ8A 1HFAA 3ZYMA 2MRIA 3UTMA 1XNFA 3QB2A 1N94A 4BWRA 3R9AB 3FFLA 4UWHA 5LCWC 3AS5A 1TNYA 4RSYA 4FLHA 4F1PA 5HS0A 5T3RA 3FTXA 2WB2A 2GW1A 4RLYA 3ABLE 2LAHA 3FUEA 4U0SA 4DJAA 2ZGGA 3TWQA 3PUJA 2XGSA 1TN6A 4H7XA 5AQBA 2XEHA 4GYWA 4GZDA 4MBGA 3CVXA 4GPKA 4G25A 2AWIA 1EPUA 3ESLA 4WWNA 3ZKJA 1U3DA 1Z5SC 3FH5A 4N2QA 1E8XA 1Z3YA 5JJ6A 4EPZA 3AS8A 3HXCA 3UX4A 4H7YA 1K8KG 4MRUA 1DNPA 4ILGA 4ILHB 1S70B 2EIJE 2AXUA 5CMWA 4IRUA 3JCKC 1FVHA 3U9WA 1WY6A 3TWUA 5B1BE 4UWFA 4GYYA 1JCRA 4AV7A 3DSSA 1JCQA 3ZUVB 3IV0A 3SHFA 2NC9A 1UG3A 3KAEA 3Q9UC 5CEDB 3VLFA 3S7FA 4GMRA 2FO7A 3RRMB 3T8KA 3CGHA 3CSFA 4JHRA 4Q94A 4Y6CA 5EIBE 4OAVB 1HH8A 4PS3A 1YMPA 5C1DA 1O5MA 4CYMD 4LSZE 1KLXA 4I1OB 3CKCA 5KJKA 1E8YA 4QFVA 2XGOA 1ZB1A 3CV0A 2I2OA 2I1JA 2ETCA 3LDZA 2UY1B 4G8KA 5AQAA 3UI2A 3MKQB 3DSWA 3DRAA 3MJWA 3ZYKA 3CHQA 5H7PA 1HS6A 2UY1A 2HYZA 3MKQA 3R7RA 1XGWA 2ZIRA 4N3BA 3ZIMA 1FT1A 5FQ6A 3PEVB 4URKA 3EHMA 3Q78A 4MS6A 3UIOC 2JLBA 4EBAA 2CHWA 3EHNA 4RG9A 3LYAA 2CHZA 5EX0A 5EKQD 3TG4A 2R05A 3QWVA 4BERA 2BF0X 3W9FA 3CVYA 1SZAA 4TV3A 4WNFA 4HLLA 4A1GA 2WXIA 2XQ0A 4G2VA 3CVNA 2XS1A 1G3NB 3UM2A 5ARFA 4BEPA 1PAQA 3MCXA 4BX9A 3PUKA 4ILIA 2LUHA 4B93B 3HVEA 2KZTA 1N4QA 3BG1B 2J8SD 4U63A 5CBNA 3SI5A 3S2AA 4KZCA 5AQ9A 2QC9A 5HI7A 2IONA 3HXBA 4HOSA 4GTRA 2A5EA 2EINE 4GTMA 1K1BA 2LO6A 3OTNA 4WWPA 3UPVA 3O48A 2B6CA 3AG4E 2FBNA 5BPPA 4AM9A 3E33A 1UW4B 3BQOA 4PS7A 4GTPA 2J4DA 5FQ4A 2DCPA 3RJVA 2R2LA 5E76A 2VGYA 5FWQA 2WXPA 2Y4TA 3AAAC 4FJYA 3ZVVA 1H0AA 4G1TA 3RSEG 2R17C 2RG8A 2V8SE 4UI9J 1IHBA 3B7TA 1N52A 4R7LA 3LXUX 2L0IA 2DZNA 3CKBA 3FTYA 4KMOA 5G55A 4F6RD 3E32A 3AG3E 4N5CA 5E75A 4XIFA 2Y4UA 3TWWA 3TL5A 4XE0A 4U0UA 2MYOA 3MV3B 2BTDA 1KPSB 2XHEA 1TNZA 3B7RL 1TNOA 1D8DA 3ONKA 1N0QA 3LY8A 4ME2A 3GW4A 1OY3D 2MOWA 3TGOA 2NSZA 3JQ0A 4IULA 3JXJA 4U8HA 3Q75A 5CCLA 2IO2C 3EHRA 4GTOA 4J0UA 3JXIA 4O6FA 4DRXE 4HRMB 2EILE 2WXGA 5KJLA 2CG3A 1BI8B 3ZRHA 1S64A 3L16A 2L0TB 5AN8A 2ONDA 1YA0A 2WVIA 4GTVA 4ANVA 3CVUA 3QOUA 3SZ7A 5KJMA 3SNXA 3MKRA 4WNGA 1DCQA 3ASHA 3ZFWA 4DX6D 3UKRG 3JYSA 5KNHD 2WPVA 3RRNB 4J8SA 4FJZA 3NZUA 5J90A 4XI0A 4TUUA 3FUFA 4AJWA 3FHEA 3BUAA 5A23A 5D66A 3FEYA 4KXKB 1HE8A 1OCRE 2J49A 3QNKA 3ZW3A 2GRPB 4FULA 2QYJA 2PL2A 4J8YA 2WM9A 3AG2E 1L5JA 4I1AA 1YYHA 2GRMA 4BT9A 4KVOA 4JPSA 4HOTA 1UN8A 2DZOA 1N54A 4GCNA 4HNAD 3S7JA 5JMND 3CEQA 2CFUA 2KM4A 2FO1E 3EUVA 2AVPA 3PS6A 2WQ6A 4UI9K 1NP7A 3MX3A 4NQ0A 2M63A 2WXFA 2AW6A 2XPYA 4OVUA 1E8WA 1HO8A 1OXJA 1TR4A 4G11A 2KBXA 2ZXWE 3L13A 2PNNA 2IU1A 4ATGA 4XX5A 3P2BA 3MYVA 3C3RA 3HRAA 2OCCE 2X38A 4CGWA 1H2TC 3UM3A 3IEGA 1AWCB 2HO1A 1VDYA 4DLQA 2F0YA 3Q49B 4PDXA 4I9CA 4ZFHA 3MEKA 3EU9A 4Q69A 4OYSA 2ILRA 5AJDA 1Y8MA 3DPDA 3ZYQA 3T8MA 3RO2A 3PVLA 1TJCA 2EQXA 3AJIA 4NRHB 1TN8A 5G05C 3FDHA 5LCWJ 1SZ9A 3NOCD 4YVOA 3SBSA 2XRYA 3B13A 3C72A 2EIME 2VSOE 3K9IA 4GPMA 5ENSD 5KBAA 3UT8A 1JUQA 3IHVA 5FZRA 5BV1A 3HXFA 2E0IA 2Y69E 3KEZA 2P9NG 5KCMA 2V5QC 2ETBA 2R02A 3V2XA 1A5EA 1QZ2A 1OCZE 1WM5A 3FH7A 5JJ7A 3DEOA 4FP7A 3WXXA 1JCSA 3ASFA 2PM6A 4HRNA 4P29A 2F8YA 3E30A 3ZXPA 3V79K 2OEWA 3CSTA 4LEUA 2GRQB 3MA5A 5CERB 3PEUB 4JZYA 2A4ZA 2H6HA 3BU8A 3FWVA 2DIWA 3E4BA 4DI4A 4U04A 1ZU2A 5LX8A 4LUNU 1QYMA 4GMJA 5EN5D 3VTYA 4IN3B 1D9SA 4UQZA 1HG5A 2C2LA 3V2OA 4F1SA 1IYGA 3PZ3A 1O1TA 1DVPA 3NB2A 4N3AA 3ISMC 2CHXA 5BXUA 2OEVA 5AAOA 2VSYA 3FUMA 2J4BA 4YDYA 5EIDA 1N11A 4BFRA 4DX5D 3UT4A 4C0MA 3SGHA 1TNUA 2ETAA 1P5QA 3S7DA 1LF8A 4C9BB 4DX7D 3DSVA 3EIQC 3UXGA 5HRYA 4BETA 3CHSA 2WXMA 4AY5A 4K5BA 3ML9A 3LCAA 3PREA 3I3NA 3DBSA 4LNGA 5T8IA 4ABNA 3FTZA 4J6IA 1MX6A 4CCAA 3URZA 3D9NA 5FT9A 3Q79A 1E7VA 4XKCA 4EZLA 2LSVA 3CLJA 3MGBA 1INZA 5CHEE 3DSTA 1N9AA 4A63B 2LXMA 4G8LA 4JA7A 3FUDA 4RG6A 2HM8A 2AXVA 4F7AA 2IQCA 3SQVA 3V31A 2P58C 2I9CA 4HLEA 3CR3A 3ABME 2WXLA 2DYRE 2WQ7A 4N39A 2WXHA 3U64A 4TXRA 3T5VA 2GRRB 3RU0A 2NXPA 2C0MA 4I1MA 3DEPA 5C2YA 2V5FA 4GZ6A 4WNEA 3ULQA 4CT0A 1H2UA 4JHKA 1S63A 3D9OA 5EYPF 2QYUA 3FU6A 3I4GA 3C98A 3E34A 5CMYA 1LD7A 3EHQA 4JL0A 2BKGA 4JVSA 4HVBA 1U3CA 2XPIA 2VGXB 2Y0BG 3ML8A 3GZ1A 3QC1A 5CEAA 2H6FA 5BW8C 4HBDA 1PC2A 2VGXA 2KZTB 3HVEB 4DI3A 3NBNB 1Y6IA 5BNWA 3G2TA 4BTBA 5AYWD 2EIKE 2XS8A 3CVWA 2BKKB 1NL4A 3CK8A 4KBQA 2WXJA 1OCCE 3O4ZA 1O1RA 2XEEA 4DK5A 3HXDA 3G2SA 1FT2A 3DXMG 3ZPJA 3KS2A 1HU3A 2AJAA 3GZ2A 2I6HA 4BY6A 2XCCA 3FUJA 1H6KA 3CIAA 3APCA 3QDNA 3U3WA 4L1BA 2Q7FA 3PE3A 4BX8A 1MJ0A 2YNQA 3OAWA 1PY1A 5KNGA 3SO8A 4LNUD 2CG2A 5ARGA 3HHMA 4D10C 2HE0A 5JHBA 3J5QB 5EILA 1IKND 4XKBA 2VGEA 5FQ8A 3DXKG 2OVFA 3W9GA 4G26A 3ENEA 4CRWA 4JHJA 1NFIE 3QJZA 4L9PA 5ITZF 2H6GA 3NQPA 3ZXSA 4G24A 2IOLA 4WNDA 3BG0B 3F6QA 4LG6A 3APDA 3TWSA 4UQYA 3QAQA 3HXEA 3D9MA 2KCLA 5FIOA 3OXFA 4K5CA 5AQ7A 5A7DB 3QWPA 1UJJA 2X6HA 4L2LA 3PZ4A 5D0QD 3HYMB 2E2EA 1K3ZD 3CVPA 4GZ5A 4XI9A 3Q4AB 4KT6B 1HG2A 4FLBA 4U96D 2P9SG 5CRUA 3AU5A 3Q5MA 3L17A 4N3CA 4LRZA 4NURA 2JEKA 3I5PA 3X2QE 2GGFA 3ASOE 1A17A 4C0EA 4N2SA 3GYZA 5A6CA 3DWLG 4HORA 3U66A 1FVFA 1SA5A 4FU3A 4HRLA 2Y1LE 1WAO1 3PZDA 2KCKA 4CT4A 2X6FA 3FUKA 2FI7A 1UJKA 2ZISA 4GAAA 4U07A 4UUCA 1JPLA 1KZOA 4YDWA 1H2VC 2BEDA 4E6HA 1MYOA 4TUMA 4O60A 1D8EA 3B7BA 4B8CB 4AEZC 1H6OA 3IXEA 4X8QA 3EDTB 5LFAA 4B8AA 1NZNA 2KC7A 2IOSA 3ULEG 3S7BA 3ASNE 3IKOB 2RFMA 3Q7AA 3PH0C 3SD5A 1E8ZA 4I2ZA 3D9HA 4G23A 4IYPA 2HR2A 3FU5A 4I43A 3ZHEA 3JUIA 2WXNA 1N0RA 5FQ7A 5JA4D 4HOQA 4F53A 1JWGA 4CDRA 2LXLA 4A1SA 4I6EA 3FTSA 3SFXA 4YDEA 1BPOA 4GCOA 1FPPA 4HOUA 1GW6A 2OV8A 4I2WA 5G04C 4DX1A 5G05J 1Z6TA 4UWLA 1V54E 3G2VA 4HQDA 4J8FA 3FP3A 1N4PA 4ANUA 5CECB 1E96B 2VTBB 3LJ3A 3QARA 4WAFA 3UM0A 4MLPA 4PH4B 3LKUA 1AP7A 2VTBA 1LD8A 4I6JA 3HG0D 2PQRA 5CBOA 4GMLA 3DPYA 3RO3A 2VJ8A 4EZJA 5M72A 5HQ8A 3RIBA 2YHEA 5B3SE 5BT1A 5CCMA 3SF4A 4A3VA 4CGVA 2WXQA 3N71A 4GTTA 4GA2A 5ANRA 2WMOA 1BLXB 1MZCA 4K0RA 2V0PA 4GZ3A 4JW1A 2QFCA 4AVXA 5KWDA 3FUIA 3FUHA 4AY6A 1TYQG 1MX2A 3Q15A 3UKUG 1EDUA 4UWKA 2YINA 2YHCA 3KEAA 4L23A 3UQ3A 3GZSA 3HIZA 4U95D 2J09A 3FU0A 2JABA 5ENTD 3VTXA 3MZLB 2XENA 3FTWA 3ZYLA 4PUCA 3UM1A 3L22A 3VLDA 3PE4A 5T4YA 4BT8A 2IF4A 1JWFA 3EIJA 4UWGA 4GB9A 3ZEFA 4K03A 2X6KA 3PDNA 4RVBA 2P9PG 4ANWA 5ENOD 3D9IA 1OWOA 5ENQD 1E7UA 3B95A 2RFAA 3LY9A 4U8VD 2L6JA 1EF1C 2LAIA 2R5SA 1B89A 4J7WA 4GTSA 3JQ1A 2VQ2A 4A3TA 3PZ1A 1LTXA 3FTUA 4C48B 2IFUA 5J08A 4AIFA 5AARA 2R59A 3TJPA 3CHMA 2KCVA 4KZ0A
chains in the Genus database with same CATH topology
1TNZA 1N4QA 4L9PA 3EU5A 1TNOA 1D8DA 1TNUA 1N94A 3EUVA 3Q7AA 4GTTA 2H6GA 1QBQA 2H6FA 1NI1A 1TNYA 3DSVA 3HXBA 1MZCA 3Q75A 4GTRA 1JCSA 1O5MA 3PZ2A 4GTMA 3HXEA 4GTOA 1N95A 3E30A 3DSUA 3DSXA 1N4SA 1NL4A 3PZ4A 4LNGA 3SFXA 1S64A 4YDEA 1O1RA 3E33A 3HXDA 3Q79A 4GTVA 1FT2A 1FPPA 1TN6A 3DSWA 4GTPA 3DRAA 4LNBA 3DSTA 3Q7FA 3E37A 1O1SA 1N9AA 2F0YA 4YDOA 4MBGA 3KSLA 2H6HA 1DCEA 2ZIRA 2R2LA 3KSQA 1N4PA 1FT1A 1SA5A 1TN7A 3Q78A 3Q73A 3HXCA 4GTQA 3SFYA 1KZPA 3PZ3A 1O1TA 2ZISA 1LD8A 1TN8A 3E32A 1KZOA 2BEDA 3DPYA 2H6IA 4GTSA 1D8EA 3C72A 1N4RA 1S63A 3PZ1A 1LTXA 1JCRA 4EHMA 3DSSA 1JCQA 3E34A 1LD7A 2IEJA 1X81A 3HXFA 1SA4A 1TNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TNZ A;  1N4Q A;  4L9P A;  3EU5 A;  1TNO A;  1D8D A;  1TNU A;  1N94 A;  3EUV A;  3Q7A A;  4GTT A;  2H6G A;  1QBQ A;  2H6F A;  1NI1 A;  1TNY A;  3DSV A;  3HXB A;  1MZC A;  3Q75 A;  4GTR A;  1JCS A;  1O5M A;  3PZ2 A;  4GTM A;  3HXE A;  4GTO A;  1N95 A;  3E30 A;  3DSU A;  3DSX A;  1N4S A;  1NL4 A;  3PZ4 A;  4LNG A;  3SFX A;  1S64 A;  4YDE A;  1O1R A;  3E33 A;  3HXD A;  3Q79 A;  4GTV A;  1FT2 A;  1FPP A;  1TN6 A;  3DSW A;  4GTP A;  3DRA A;  4LNB A;  3DST A;  3Q7F A;  3E37 A;  1O1S A;  1N9A A;  2F0Y A;  4YDO A;  4MBG A;  3KSL A;  2H6H A;  1DCE A;  2ZIR A;  2R2L A;  3KSQ A;  1N4P A;  1FT1 A;  1SA5 A;  1TN7 A;  3Q78 A;  3Q73 A;  3HXC A;  4GTQ A;  3SFY A;  1KZP A;  3PZ3 A;  1O1T A;  2ZIS A;  1LD8 A;  1TN8 A;  3E32 A;  1KZO A;  2BED A;  3DPY A;  2H6I A;  4GTS A;  1D8E A;  3C72 A;  1N4R A;  1S63 A;  3PZ1 A;  1LTX A;  1JCR A;  4EHM A;  3DSS A;  1JCQ A;  3E34 A;  1LD7 A;  2IEJ A;  1X81 A;  3HXF A;  1SA4 A;  1TNB A; 
#chains in the Genus database with same CATH topology
 4JD2 G;  3EU5 A;  2QY7 A;  4BTA A;  3B7U X;  4E85 A;  4HI8 A;  5FTP A;  1U2V G;  2X6I A;  4W9R A;  5EDS A;  1UN9 A;  1YCS B;  4U0Z A;  4APO A;  3DSU A;  3DSX A;  1N4S A;  3RAU A;  2GRL A;  3ASG A;  1BU9 A;  2I1K A;  1BD8 A;  4L2Y A;  4LCT A;  3ZU7 B;  3LVR E;  3C5R A;  2L6B A;  3CHP A;  2BUG A;  1IQU A;  2CFZ A;  4LNB A;  2PZI A;  3TWV A;  3FH8 A;  1OCO E;  3IHY A;  2L9B A;  4I17 A;  2MHK A;  4PS8 A;  4O1P A;  4F3V A;  1DC2 A;  1W3B A;  3LEW A;  3AU4 A;  3Q73 A;  4JXT A;  5CRV A;  4GA0 A;  4TRQ A;  3ZGQ A;  2FUL A;  1WDY A;  2GRN B;  3HDX A;  3NAW A;  1RZ4 A;  4FHJ A;  1OWN A;  2DYS E;  1Z3X A;  5DIZ A;  3CK9 A;  2VSN A;  3AG1 E;  2OOE A;  3LVQ E;  3C3O A;  3OXL A;  4TXQ A;  4WUY A;  1H19 A;  3FY4 A;  3IBE A;  4BES A;  4AXH A;  4Y6W A;  2XRZ A;  1IXV A;  3B7S A;  1E90 A;  2V4L A;  1IHG A;  1OWL A;  5FZS A;  3UUX A;  2GRO B;  5ENR D;  3CQG B;  3FUN A;  3CK7 A;  3RRU A;  4CDM A;  2XGM A;  1NA3 A;  3BEE A;  5AEN A;  4JB8 P;  4DUI A;  2C0L A;  5JJT A;  4U8Y D;  4HI9 A;  1OWM A;  2PQN A;  3SBT B;  3E37 A;  1DCE A;  1ELW A;  3L54 A;  1RW2 A;  5D0O D;  3ZNG A;  4K5A B;  3RK6 A;  1Q2Z A;  1K1A A;  3PNL B;  4B94 A;  4HFG A;  4A55 A;  3QWW A;  1TN7 A;  1QQE A;  2J08 A;  2XZD G;  3FU3 A;  1KZP A;  5EX3 A;  4GZC A;  5G2N A;  3ULY A;  3PRZ A;  4KYO B;  1HF8 A;  3C3Q A;  3CHO A;  3CVL A;  3CHR A;  4CZ2 D;  3PNT B;  1SW6 A;  5EYL A;  4AOF A;  1N4R A;  2ZU6 B;  2WMN A;  3T5X A;  3G2W A;  3D9L A;  2IJG X;  1SA4 A;  3ASD A;  3JUE A;  3D9P A;  3G2U A;  5IY5 E;  2X6J A;  2FF4 A;  3CVQ A;  2P2C P;  3QK0 A;  2XPZ A;  3TAX A;  3APF A;  2ZGD A;  1V55 E;  2KXP C;  2P9K G;  5BV0 A;  1S0P A;  4I9E A;  4KVM A;  3LPZ A;  4HB5 A;  1H6P A;  1N95 A;  3D3M A;  3U4T A;  2V4H C;  3EJN A;  4GYO A;  3J5P A;  2B0O E;  5JHA A;  3NZS A;  2OVB A;  1FCH A;  3LY7 A;  4O1O A;  1O1S A;  3FEX A;  4HS2 A;  3KSL A;  4CDN A;  4JA9 A;  4B0Z A;  4JC8 A;  3MV2 B;  1X5B A;  4GTQ A;  4OAU C;  5ENP D;  4EEC A;  4DPR A;  2XEV A;  3AS4 A;  5DBK A;  5B1A E;  5LOZ A;  5BXO A;  2LSU A;  4RQI A;  2F8X K;  1MX4 A;  3TWR A;  5AIJ A;  2PM7 A;  1SVX A;  2IEJ A;  4BSZ B;  4UI9 C;  1X81 A;  1NA0 A;  4QQI A;  4JEH A;  4AP2 A;  3I4R B;  3TWX A;  2P9L G;  4TXP A;  1TEZ A;  4J8D A;  5G04 J;  4NAC A;  1NI1 A;  3ZN3 A;  2WQH A;  3FUL A;  3PZ2 A;  3ONL A;  2J07 A;  4M7C A;  4DX2 A;  1HZ4 A;  4NIK A;  3ZHE B;  2WXR A;  2KAT A;  4XZ4 A;  3WG7 E;  3TG5 A;  4GU5 A;  5KJN A;  2DBA A;  1KT1 A;  3R9M A;  1ZBP A;  3TXN A;  2J9Q A;  5ENN A;  3Q7F A;  3V30 A;  4ACK A;  5LP0 A;  3TXM A;  4CEM A;  3ESK A;  3LJN A;  4JEU A;  3TWT A;  4GA1 A;  2QZA A;  4HXI A;  5ANL A;  3KSQ A;  3D9K A;  3L82 A;  4B89 A;  2NYJ A;  4LER A;  4DLO A;  4M3O A;  1UOH A;  2DWZ A;  4FHK A;  1HX8 A;  3RKV A;  3Q9N C;  4FC8 A;  4N5Q A;  1SQM A;  4EBA G;  1MHQ A;  2R03 A;  3L08 A;  3L9T A;  4FA6 A;  1IQR A;  1ELK A;  5FJY A;  2RKK A;  1WG0 A;  4L7T A;  4ANX A;  4APF A;  3NOG D;  2P9I G;  2A5U A;  3UIN C;  2P9U G;  1TNB A;  1QNF A;  4EZK A;  4Q96 A;  3L6A A;  1EYH A;  1QBQ A;  2VYI A;  1BI7 B;  2LNI A;  2FEZ A;  4OVV A;  2F37 A;  2VSX E;  1ELR A;  3LS8 A;  3VLE A;  3UIP C;  4BSX A;  1KT0 A;  3CVV A;  3P1U A;  1OUV A;  1HXI A;  2WXO A;  2UWJ G;  3KD7 A;  4YVQ C;  2DVW A;  4ZHB A;  2XZT G;  2WXK A;  4Z68 A;  2XCB A;  2RD0 A;  3UMV A;  5D2M C;  4EQF A;  4I6G A;  5AJL A;  2AXZ A;  4MKT A;  4YDO A;  3OXG A;  2IY0 C;  4UQX A;  4ATZ D;  4V3I A;  4J8E A;  3T9K A;  4YND A;  5FZQ A;  4ACL A;  5HKP A;  3Q47 B;  4U7E B;  3UT7 A;  1OT8 A;  3SFY A;  1OWP A;  3SFZ A;  3QKY A;  3ABK E;  3CQC B;  1MQS A;  2Y3A A;  3SY2 A;  3FTV A;  3NF1 A;  4WWO A;  2IO3 C;  2H6I A;  3D9J A;  5BUZ A;  3R7Q A;  5FIN A;  4EHM A;  4XEI G;  2X3M A;  1TJF A;  4FAD A;  2YQ8 A;  1HFA A;  3ZYM A;  2MRI A;  3UTM A;  1XNF A;  3QB2 A;  1N94 A;  4BWR A;  3R9A B;  3FFL A;  4UWH A;  5LCW C;  3AS5 A;  1TNY A;  4RSY A;  4FLH A;  4F1P A;  5HS0 A;  5T3R A;  3FTX A;  2WB2 A;  2GW1 A;  4RLY A;  3ABL E;  2LAH A;  3FUE A;  4U0S A;  4DJA A;  2ZGG A;  3TWQ A;  3PUJ A;  2XGS A;  1TN6 A;  4H7X A;  5AQB A;  2XEH A;  4GYW A;  4GZD A;  4MBG A;  3CVX A;  4GPK A;  4G25 A;  2AWI A;  1EPU A;  3ESL A;  4WWN A;  3ZKJ A;  1U3D A;  1Z5S C;  3FH5 A;  4N2Q A;  1E8X A;  1Z3Y A;  5JJ6 A;  4EPZ A;  3AS8 A;  3HXC A;  3UX4 A;  4H7Y A;  1K8K G;  4MRU A;  1DNP A;  4ILG A;  4ILH B;  1S70 B;  2EIJ E;  2AXU A;  5CMW A;  4IRU A;  3JCK C;  1FVH A;  3U9W A;  1WY6 A;  3TWU A;  5B1B E;  4UWF A;  4GYY A;  1JCR A;  4AV7 A;  3DSS A;  1JCQ A;  3ZUV B;  3IV0 A;  3SHF A;  2NC9 A;  1UG3 A;  3KAE A;  3Q9U C;  5CED B;  3VLF A;  3S7F A;  4GMR A;  2FO7 A;  3RRM B;  3T8K A;  3CGH A;  3CSF A;  4JHR A;  4Q94 A;  4Y6C A;  5EIB E;  4OAV B;  1HH8 A;  4PS3 A;  1YMP A;  5C1D A;  1O5M A;  4CYM D;  4LSZ E;  1KLX A;  4I1O B;  3CKC A;  5KJK A;  1E8Y A;  4QFV A;  2XGO A;  1ZB1 A;  3CV0 A;  2I2O A;  2I1J A;  2ETC A;  3LDZ A;  2UY1 B;  4G8K A;  5AQA A;  3UI2 A;  3MKQ B;  3DSW A;  3DRA A;  3MJW A;  3ZYK A;  3CHQ A;  5H7P A;  1HS6 A;  2UY1 A;  2HYZ A;  3MKQ A;  3R7R A;  1XGW A;  2ZIR A;  4N3B A;  3ZIM A;  1FT1 A;  5FQ6 A;  3PEV B;  4URK A;  3EHM A;  3Q78 A;  4MS6 A;  3UIO C;  2JLB A;  4EBA A;  2CHW A;  3EHN A;  4RG9 A;  3LYA A;  2CHZ A;  5EX0 A;  5EKQ D;  3TG4 A;  2R05 A;  3QWV A;  4BER A;  2BF0 X;  3W9F A;  3CVY A;  1SZA A;  4TV3 A;  4WNF A;  4HLL A;  4A1G A;  2WXI A;  2XQ0 A;  4G2V A;  3CVN A;  2XS1 A;  1G3N B;  3UM2 A;  5ARF A;  4BEP A;  1PAQ A;  3MCX A;  4BX9 A;  3PUK A;  4ILI A;  2LUH A;  4B93 B;  3HVE A;  2KZT A;  1N4Q A;  3BG1 B;  2J8S D;  4U63 A;  5CBN A;  3SI5 A;  3S2A A;  4KZC A;  5AQ9 A;  2QC9 A;  5HI7 A;  2ION A;  3HXB A;  4HOS A;  4GTR A;  2A5E A;  2EIN E;  4GTM A;  1K1B A;  2LO6 A;  3OTN A;  4WWP A;  3UPV A;  3O48 A;  2B6C A;  3AG4 E;  2FBN A;  5BPP A;  4AM9 A;  3E33 A;  1UW4 B;  3BQO A;  4PS7 A;  4GTP A;  2J4D A;  5FQ4 A;  2DCP A;  3RJV A;  2R2L A;  5E76 A;  2VGY A;  5FWQ A;  2WXP A;  2Y4T A;  3AAA C;  4FJY A;  3ZVV A;  1H0A A;  4G1T A;  3RSE G;  2R17 C;  2RG8 A;  2V8S E;  4UI9 J;  1IHB A;  3B7T A;  1N52 A;  4R7L A;  3LXU X;  2L0I A;  2DZN A;  3CKB A;  3FTY A;  4KMO A;  5G55 A;  4F6R D;  3E32 A;  3AG3 E;  4N5C A;  5E75 A;  4XIF A;  2Y4U A;  3TWW A;  3TL5 A;  4XE0 A;  4U0U A;  2MYO A;  3MV3 B;  2BTD A;  1KPS B;  2XHE A;  1TNZ A;  3B7R L;  1TNO A;  1D8D A;  3ONK A;  1N0Q A;  3LY8 A;  4ME2 A;  3GW4 A;  1OY3 D;  2MOW A;  3TGO A;  2NSZ A;  3JQ0 A;  4IUL A;  3JXJ A;  4U8H A;  3Q75 A;  5CCL A;  2IO2 C;  3EHR A;  4GTO A;  4J0U A;  3JXI A;  4O6F A;  4DRX E;  4HRM B;  2EIL E;  2WXG A;  5KJL A;  2CG3 A;  1BI8 B;  3ZRH A;  1S64 A;  3L16 A;  2L0T B;  5AN8 A;  2OND A;  1YA0 A;  2WVI A;  4GTV A;  4ANV A;  3CVU A;  3QOU A;  3SZ7 A;  5KJM A;  3SNX A;  3MKR A;  4WNG A;  1DCQ A;  3ASH A;  3ZFW A;  4DX6 D;  3UKR G;  3JYS A;  5KNH D;  2WPV A;  3RRN B;  4J8S A;  4FJZ A;  3NZU A;  5J90 A;  4XI0 A;  4TUU A;  3FUF A;  4AJW A;  3FHE A;  3BUA A;  5A23 A;  5D66 A;  3FEY A;  4KXK B;  1HE8 A;  1OCR E;  2J49 A;  3QNK A;  3ZW3 A;  2GRP B;  4FUL A;  2QYJ A;  2PL2 A;  4J8Y A;  2WM9 A;  3AG2 E;  1L5J A;  4I1A A;  1YYH A;  2GRM A;  4BT9 A;  4KVO A;  4JPS A;  4HOT A;  1UN8 A;  2DZO A;  1N54 A;  4GCN A;  4HNA D;  3S7J A;  5JMN D;  3CEQ A;  2CFU A;  2KM4 A;  2FO1 E;  3EUV A;  2AVP A;  3PS6 A;  2WQ6 A;  4UI9 K;  1NP7 A;  3MX3 A;  4NQ0 A;  2M63 A;  2WXF A;  2AW6 A;  2XPY A;  4OVU A;  1E8W A;  1HO8 A;  1OXJ A;  1TR4 A;  4G11 A;  2KBX A;  2ZXW E;  3L13 A;  2PNN A;  2IU1 A;  4ATG A;  4XX5 A;  3P2B A;  3MYV A;  3C3R A;  3HRA A;  2OCC E;  2X38 A;  4CGW A;  1H2T C;  3UM3 A;  3IEG A;  1AWC B;  2HO1 A;  1VDY A;  4DLQ A;  2F0Y A;  3Q49 B;  4PDX A;  4I9C A;  4ZFH A;  3MEK A;  3EU9 A;  4Q69 A;  4OYS A;  2ILR A;  5AJD A;  1Y8M A;  3DPD A;  3ZYQ A;  3T8M A;  3RO2 A;  3PVL A;  1TJC A;  2EQX A;  3AJI A;  4NRH B;  1TN8 A;  5G05 C;  3FDH A;  5LCW J;  1SZ9 A;  3NOC D;  4YVO A;  3SBS A;  2XRY A;  3B13 A;  3C72 A;  2EIM E;  2VSO E;  3K9I A;  4GPM A;  5ENS D;  5KBA A;  3UT8 A;  1JUQ A;  3IHV A;  5FZR A;  5BV1 A;  3HXF A;  2E0I A;  2Y69 E;  3KEZ A;  2P9N G;  5KCM A;  2V5Q C;  2ETB A;  2R02 A;  3V2X A;  1A5E A;  1QZ2 A;  1OCZ E;  1WM5 A;  3FH7 A;  5JJ7 A;  3DEO A;  4FP7 A;  3WXX A;  1JCS A;  3ASF A;  2PM6 A;  4HRN A;  4P29 A;  2F8Y A;  3E30 A;  3ZXP A;  3V79 K;  2OEW A;  3CST A;  4LEU A;  2GRQ B;  3MA5 A;  5CER B;  3PEU B;  4JZY A;  2A4Z A;  2H6H A;  3BU8 A;  3FWV A;  2DIW A;  3E4B A;  4DI4 A;  4U04 A;  1ZU2 A;  5LX8 A;  4LUN U;  1QYM A;  4GMJ A;  5EN5 D;  3VTY A;  4IN3 B;  1D9S A;  4UQZ A;  1HG5 A;  2C2L A;  3V2O A;  4F1S A;  1IYG A;  3PZ3 A;  1O1T A;  1DVP A;  3NB2 A;  4N3A A;  3ISM C;  2CHX A;  5BXU A;  2OEV A;  5AAO A;  2VSY A;  3FUM A;  2J4B A;  4YDY A;  5EID A;  1N11 A;  4BFR A;  4DX5 D;  3UT4 A;  4C0M A;  3SGH A;  1TNU A;  2ETA A;  1P5Q A;  3S7D A;  1LF8 A;  4C9B B;  4DX7 D;  3DSV A;  3EIQ C;  3UXG A;  5HRY A;  4BET A;  3CHS A;  2WXM A;  4AY5 A;  4K5B A;  3ML9 A;  3LCA A;  3PRE A;  3I3N A;  3DBS A;  4LNG A;  5T8I A;  4ABN A;  3FTZ A;  4J6I A;  1MX6 A;  4CCA A;  3URZ A;  3D9N A;  5FT9 A;  3Q79 A;  1E7V A;  4XKC A;  4EZL A;  2LSV A;  3CLJ A;  3MGB A;  1INZ A;  5CHE E;  3DST A;  1N9A A;  4A63 B;  2LXM A;  4G8L A;  4JA7 A;  3FUD A;  4RG6 A;  2HM8 A;  2AXV A;  4F7A A;  2IQC A;  3SQV A;  3V31 A;  2P58 C;  2I9C A;  4HLE A;  3CR3 A;  3ABM E;  2WXL A;  2DYR E;  2WQ7 A;  4N39 A;  2WXH A;  3U64 A;  4TXR A;  3T5V A;  2GRR B;  3RU0 A;  2NXP A;  2C0M A;  4I1M A;  3DEP A;  5C2Y A;  2V5F A;  4GZ6 A;  4WNE A;  3ULQ A;  4CT0 A;  1H2U A;  4JHK A;  1S63 A;  3D9O A;  5EYP F;  2QYU A;  3FU6 A;  3I4G A;  3C98 A;  3E34 A;  5CMY A;  1LD7 A;  3EHQ A;  4JL0 A;  2BKG A;  4JVS A;  4HVB A;  1U3C A;  2XPI A;  2VGX B;  2Y0B G;  3ML8 A;  3GZ1 A;  3QC1 A;  5CEA A;  2H6F A;  5BW8 C;  4HBD A;  1PC2 A;  2VGX A;  2KZT B;  3HVE B;  4DI3 A;  3NBN B;  1Y6I A;  5BNW A;  3G2T A;  4BTB A;  5AYW D;  2EIK E;  2XS8 A;  3CVW A;  2BKK B;  1NL4 A;  3CK8 A;  4KBQ A;  2WXJ A;  1OCC E;  3O4Z A;  1O1R A;  2XEE A;  4DK5 A;  3HXD A;  3G2S A;  1FT2 A;  3DXM G;  3ZPJ A;  3KS2 A;  1HU3 A;  2AJA A;  3GZ2 A;  2I6H A;  4BY6 A;  2XCC A;  3FUJ A;  1H6K A;  3CIA A;  3APC A;  3QDN A;  3U3W A;  4L1B A;  2Q7F A;  3PE3 A;  4BX8 A;  1MJ0 A;  2YNQ A;  3OAW A;  1PY1 A;  5KNG A;  3SO8 A;  4LNU D;  2CG2 A;  5ARG A;  3HHM A;  4D10 C;  2HE0 A;  5JHB A;  3J5Q B;  5EIL A;  1IKN D;  4XKB A;  2VGE A;  5FQ8 A;  3DXK G;  2OVF A;  3W9G A;  4G26 A;  3ENE A;  4CRW A;  4JHJ A;  1NFI E;  3QJZ A;  4L9P A;  5ITZ F;  2H6G A;  3NQP A;  3ZXS A;  4G24 A;  2IOL A;  4WND A;  3BG0 B;  3F6Q A;  4LG6 A;  3APD A;  3TWS A;  4UQY A;  3QAQ A;  3HXE A;  3D9M A;  2KCL A;  5FIO A;  3OXF A;  4K5C A;  5AQ7 A;  5A7D B;  3QWP A;  1UJJ A;  2X6H A;  4L2L A;  3PZ4 A;  5D0Q D;  3HYM B;  2E2E A;  1K3Z D;  3CVP A;  4GZ5 A;  4XI9 A;  3Q4A B;  4KT6 B;  1HG2 A;  4FLB A;  4U96 D;  2P9S G;  5CRU A;  3AU5 A;  3Q5M A;  3L17 A;  4N3C A;  4LRZ A;  4NUR A;  2JEK A;  3I5P A;  3X2Q E;  2GGF A;  3ASO E;  1A17 A;  4C0E A;  4N2S A;  3GYZ A;  5A6C A;  3DWL G;  4HOR A;  3U66 A;  1FVF A;  1SA5 A;  4FU3 A;  4HRL A;  2Y1L E;  1WAO 1;  3PZD A;  2KCK A;  4CT4 A;  2X6F A;  3FUK A;  2FI7 A;  1UJK A;  2ZIS A;  4GAA A;  4U07 A;  4UUC A;  1JPL A;  1KZO A;  4YDW A;  1H2V C;  2BED A;  4E6H A;  1MYO A;  4TUM A;  4O60 A;  1D8E A;  3B7B A;  4B8C B;  4AEZ C;  1H6O A;  3IXE A;  4X8Q A;  3EDT B;  5LFA A;  4B8A A;  1NZN A;  2KC7 A;  2IOS A;  3ULE G;  3S7B A;  3ASN E;  3IKO B;  2RFM A;  3Q7A A;  3PH0 C;  3SD5 A;  1E8Z A;  4I2Z A;  3D9H A;  4G23 A;  4IYP A;  2HR2 A;  3FU5 A;  4I43 A;  3ZHE A;  3JUI A;  2WXN A;  1N0R A;  5FQ7 A;  5JA4 D;  4HOQ A;  4F53 A;  1JWG A;  4CDR A;  2LXL A;  4A1S A;  4I6E A;  3FTS A;  3SFX A;  4YDE A;  1BPO A;  4GCO A;  1FPP A;  4HOU A;  1GW6 A;  2OV8 A;  4I2W A;  5G04 C;  4DX1 A;  5G05 J;  1Z6T A;  4UWL A;  1V54 E;  3G2V A;  4HQD A;  4J8F A;  3FP3 A;  1N4P A;  4ANU A;  5CEC B;  1E96 B;  2VTB B;  3LJ3 A;  3QAR A;  4WAF A;  3UM0 A;  4MLP A;  4PH4 B;  3LKU A;  1AP7 A;  2VTB A;  1LD8 A;  4I6J A;  3HG0 D;  2PQR A;  5CBO A;  4GML A;  3DPY A;  3RO3 A;  2VJ8 A;  4EZJ A;  5M72 A;  5HQ8 A;  3RIB A;  2YHE A;  5B3S E;  5BT1 A;  5CCM A;  3SF4 A;  4A3V A;  4CGV A;  2WXQ A;  3N71 A;  4GTT A;  4GA2 A;  5ANR A;  2WMO A;  1BLX B;  1MZC A;  4K0R A;  2V0P A;  4GZ3 A;  4JW1 A;  2QFC A;  4AVX A;  5KWD A;  3FUI A;  3FUH A;  4AY6 A;  1TYQ G;  1MX2 A;  3Q15 A;  3UKU G;  1EDU A;  4UWK A;  2YIN A;  2YHC A;  3KEA A;  4L23 A;  3UQ3 A;  3GZS A;  3HIZ A;  4U95 D;  2J09 A;  3FU0 A;  2JAB A;  5ENT D;  3VTX A;  3MZL B;  2XEN A;  3FTW A;  3ZYL A;  4PUC A;  3UM1 A;  3L22 A;  3VLD A;  3PE4 A;  5T4Y A;  4BT8 A;  2IF4 A;  1JWF A;  3EIJ A;  4UWG A;  4GB9 A;  3ZEF A;  4K03 A;  2X6K A;  3PDN A;  4RVB A;  2P9P G;  4ANW A;  5ENO D;  3D9I A;  1OWO A;  5ENQ D;  1E7U A;  3B95 A;  2RFA A;  3LY9 A;  4U8V D;  2L6J A;  1EF1 C;  2LAI A;  2R5S A;  1B89 A;  4J7W A;  4GTS A;  3JQ1 A;  2VQ2 A;  4A3T A;  3PZ1 A;  1LTX A;  3FTU A;  4C48 B;  2IFU A;  5J08 A;  4AIF A;  5AAR A;  2R59 A;  3TJP A;  3CHM A;  2KCV A;  4KZ0 A; 
#chains in the Genus database with same CATH homology
 1TNZ A;  1N4Q A;  4L9P A;  3EU5 A;  1TNO A;  1D8D A;  1TNU A;  1N94 A;  3EUV A;  3Q7A A;  4GTT A;  2H6G A;  1QBQ A;  2H6F A;  1NI1 A;  1TNY A;  3DSV A;  3HXB A;  1MZC A;  3Q75 A;  4GTR A;  1JCS A;  1O5M A;  3PZ2 A;  4GTM A;  3HXE A;  4GTO A;  1N95 A;  3E30 A;  3DSU A;  3DSX A;  1N4S A;  1NL4 A;  3PZ4 A;  4LNG A;  3SFX A;  1S64 A;  4YDE A;  1O1R A;  3E33 A;  3HXD A;  3Q79 A;  4GTV A;  1FT2 A;  1FPP A;  1TN6 A;  3DSW A;  4GTP A;  3DRA A;  4LNB A;  3DST A;  3Q7F A;  3E37 A;  1O1S A;  1N9A A;  2F0Y A;  4YDO A;  4MBG A;  3KSL A;  2H6H A;  1DCE A;  2ZIR A;  2R2L A;  3KSQ A;  1N4P A;  1FT1 A;  1SA5 A;  1TN7 A;  3Q78 A;  3Q73 A;  3HXC A;  4GTQ A;  3SFY A;  1KZP A;  3PZ3 A;  1O1T A;  2ZIS A;  1LD8 A;  1TN8 A;  3E32 A;  1KZO A;  2BED A;  3DPY A;  2H6I A;  4GTS A;  1D8E A;  3C72 A;  1N4R A;  1S63 A;  3PZ1 A;  1LTX A;  1JCR A;  4EHM A;  3DSS A;  1JCQ A;  3E34 A;  1LD7 A;  2IEJ A;  1X81 A;  3HXF A;  1SA4 A;  1TNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...