1LDDA

Structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
74
structure length
74
Chain Sequence
KYELTLQRSLPFIEGMLTNLGAMKLHKIHSFLKITVPKDWGYNRITLQQLEGYLNTLADEGRLKYIANGSYEIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase
molecule keywords Anaphase Promoting Complex
total genus 21
structure length 74
sequence length 74
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08672 ANAPC2 Anaphase promoting complex (APC) subunit 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1lddA00
4WXDA 4F7ZA 3ECOA 1DPRA 1HQCA 4BXUA 4S04A 3F8FA 2FE3A 3EETA 3QP6A 2KJBA 3F23A 4WK8F 1HBXG 3IKVA 1GXQA 5DCMA 3BZ6A 1R1TA 2E1NA 1L0OC 4G94A 1HW2A 2FU4A 3U1DA 1S29A 5LHHA 3WGIA 4HDUA 2VOPA 1S7AA 2OQGA 1XD7A 2G9WA 4QLCU 4EV0A 3E6BA 1R22A 4MTDA 4IPAA 1G3YA 5E1XA 4A0ZA 5LRSA 1DUXC 1R1VA 1Z05A 4IVNA 5D6FA 3CUQA 4G6QA 3J81K 2HDCA 1R00A 3Q9VA 1HW5A 5BPDA 1UHWA 3ABUA 2W84A 2HGCA 4G7OF 5CVRA 2QM3A 4UHTA 3B73A 4EJWA 4LB5A 1TQMA 2XROA 3FXQA 4ON0A 2MA3A 2WC2A 3RIRA 1J9IA 5ILSA 2KKOA 5ICEA 3EYIA 2ZJ2A 1WRJA 4NB5A 1SFEA 2FMYA 1BN5A 1HKTA 2A61A 3K2ZA 3CDHA 5HS9A 3CUOA 3I59A 3BWGA 4HLYA 5FFZA 5JVTA 2Z5UA 5FGMA 3H3ZA 1K79A 3RYPA 3KE2A 2EV6A 3GUDA 3WODF 2P5VA 4G8XA 3I54A 1ZREA 2NYXA 2VT3A 3FX3A 5BQTA 4L5IA 2AXLA 4KUMA 3FMRA 3R4KA 1B6AA 2GWRA 4OMYA 5HVQC 1G3TA 3E6CC 1ZGJA 3E6MA 5DCMB 2QQ9A 2ZO4A 5HDGA 1G6NA 2UWMA 2YSRA 1YLFA 1FPQA 3DQVC 5HS7A 3T5XA 5D6EA 2KRFA 2FBKA 2BYVE 3KP3A 2XAQA 2PMUA 1J75A 1DPUA 1R5HA 1XB4A 5ERIA 1LDJA 3R0JA 4OIRF 4M72A 2QBYA 3BDDA 4PZJA 1EH6A 4S05A 2O03A 5DUIA 1TLHB 4UXNA 1FT9A 1TW2A 3C3WA 4UVCA 1PDNC 4L9NA 4M9SA 4ESBA 1J59A 1RNLA 4FX0A 3LWFA 2EB7A 3CUQC 1TNTA 2KIFA 3GXOA 2RNJA 3CO7C 2OD5A 4N9HA 5E8GA 3DV8A 1LJ9A 1W5TA 4MEXF 2VBZA 5DV5A 1R58A 3V7CA 3GFLA 5FO5A 4A2UA 2FXAA 3U9GA 3ULQB 5D8KB 3VB2A 3TO6A 2Q8KA 3ELKA 3QAHA 3KFWX 3TOBA 1F4KA 2FBHA 3TDUC 5A2QK 5FD5A 3HUGA 4EJVA 1T98A 2IW5A 2X0LA 3WU1B 4YIFA 5FB2A 2WWYA 4OMZA 1TQPA 1FWZA 1OR7A 4OOIA 1CGPA 4HX8A 2JT1A 2L3DA 1QGPA 2HYFA 2DQRA 5DYMA 1WI9A 4HF0A 2ISYA 4IF4A 3KEQA 2EA4A 3O6BB 3CLOA 5ICCA 3F6VA 5D8LB 2M87A 3ZPLA 2XAJA 3HSFA 1R1UA 2BGCA 2HOEA 5HDNA 3WTYC 2M8EA 1FSEA 4G7HF 2JRTA 4L5JA 5CVUA 1RUOA 2VBWA 4A0YA 2FBIA 1B59A 2RVCA 1W7PA 1LDDA 2A69F 1E17A 4HW0A 1RZ4A 1ZN2A 2UXXA 1HKQA 2RGVA 2JZYA 3ZMDA 2FEZA 2JPCA 1G3WA 4EVIA 5D4RA 1B9NA 3WTZA 2M5WA 3MWMA 4EMSA 5CVVA 3J80Z 2MLKA 1YQAA 3GFMA 2NAZA 4EJUA 3FXRA 4I7HA 2DT5A 1P4AA 3GWZA 3HRTA 1XSVA 2QENA 3GZ6A 2H09A 1KYZA 5E20A 3TKYA 3VOEA 2P8TA 5A2QZ 1QBJA 2MH9A 1BOAA 1PP7U 1UHMA 4HOBA 4B09A 3O3KA 1WQ2A 4GYIA 1TNSA 4CHUA 4ZH4F 1BI1A 1NHAA 5E17F 2Z3YA 1BI3A 2R3SA 4P96A 3I58A 2L4AA 1LEBA 1CF7B 3LFKA 1U5TC 2FNAA 3D0SA 2DAOA 1PUEE 2HZTA 1R36A 2ZFWA 1I5ZA 3K69A 4ASNA 4A0XA 1MJAA 3T8RA 5JFRA 4FX4A 4M6YA 2ADUA 2V79A 2ACJA 5BS6A 1SAXA 4CO8A 1IF1A 2RQPA 4MQ9F 3WE2A 1YYVA 4RGUA 1S6LA 2OZ6A 1QZZA 2DI3A 2PMHA 4XRFA 5L3GA 4YIIA 2JPBA 4HX4A 1XGMA 3EUHA 1BC7C 3C18A 1U5TB 3KETA 3GO5A 4LB6B 3F8NA 4KT5C 1FBQA 2XGXA 1GVJA 3ZN1A 4IJAA 1W7PD 2YR2A 2ZCWA 1KQ9A 4KMUX 4EM2A 2PFBA 1ZRCA 3LSTA 1YW9A 3GFJA 5J8CA 1CF7A 5ILVA 2A5YB 3VFZA 3L7WA 2FA5A 1AOYA 5BOXA 2RC4A 2FSWA 1S3JA 3ZP5A 4HV5A 4IRIA 3N4MA 3GW2A 1W7PB 5HLIA 5ICGA 1Z6TA 3REOA 1W4MA 4CXFA 4HYEA 5LEKA 2STTA 3Q9SA 1WWXA 1SD4A 5F1RA 1Y0UA 4GGGA 1FP2A 2OZUA 3AAFA 4MQVA 3JW4A 3E3VA 1A04A 4JBAA 2XAGA 1U2WA 5H20A 5K5QA 3KP6A 3CJNA 4N0BA 3LQQA 4M9ZA 4K2EA 2CQKA 2CYYA 1USSA 2BE5F 1U3EM 2XVCA 1R23A 1KGSA 1F9NA 3I71A 4R1HA 4HAMA 3OV8A 3RKWA 4N9IA 3MEXA 1SFUA 4HDVA 2HTJA 4I2OA 3F72A 5FLXK 4I01A 2DQLA 5J8FA 3MCZA 1D3YA 3M7GA 1ON1A 1LVAA 2GA2A 2VODA 3HRMA 3SFZA 3HRUA 3V8JA 3I0TA 1FLIA 2F5FA 1R5GA 3BROA 2VE8A 2HS5A 2QUFA 2GQQA 2IA1A 1RIOH 2B0LA 5H6QA 2STWA 2ZMEB 4IHTA 2O0YA 1HXDA 2EK5A 1X3UA 4FT8A 4XBFA 1J5YA 3KEOA 5CLSA 1QZYA 2HQNA 5EEGA 3F3XA 5LHIA 5HLHA 2PLYA 1J0RA 1EV7A 2RDPA 1FBUA 4CDGA 1T39A 2UXNA 3V8KA 1FY7A 2EWNA 2R7FA 2ESNA 3IL2A 1ZG3A 2E1CA 2BBYA 4PGGA 4P9UA 2OAZA 1H9TA 3T0YA 2PEXA 2WTEA 1B1BA 1XCVA 2FMLA 3ZN0A 2ZXJA 4Z2YA 1D5VA 4HF2A 3ROUA 3QU3A 2H94A 4KNYA 1MDMB 5CVIA 4XLNF 4WWCA 1ZYRF 1S7OA 1L3LA 2IT0A 3H92A 5AIQA 1IRFA 3KZYA 1IRGA 3DP7A 2WV0A 3EDPA 4LD5A 5FLXZ 1QPMA 3HIFA 5KK1A 1E2XA 3IRQA 4ZYEA 4KIBA 1XDSA 5KVRA 1ON2A 2LNBA 1FP1D 2GAUA 2ZNYA 5D5UB 1VTNC 1T2KA 2CO5A 3ZMZA 5JR3A 2V1XA 4I02A 2VC0A 4LK1F 3MFKA 1XMAA 2VBYA 4YFNF 4ZZDA 1K6OA 1LQ1A 4I98B 4LK0F 4RB2C 4KA4A 1G4DA 4E70A 2OQRA 4PGHA 2QBYB 5ED4A 4R8HA 1IN4A 3HTSB 3GVAA 2K02A 3FMSA 3LA2A 1EH7A 1J2XA 2O6GE 5DDGA 3NQOA 1IAWA 5LLQA 3I64A 1JE8A 1TBXA 4U0VA 4EJTA 4BHBA 2MD5A 3L00A 4LMYA 2HFHA 2K7LA 2ESHA 2G7UA 4OU0A 3SZPA 4AIJA 3WU0A 1DDNA 4BAYA 4Q4ZF 2TDXA 4YG2F 4HX7A 3DPTA 2FNPA 3IKTA 4RGXA 2IA0A 2R7DA 2O8XA 2QWWA 4RS8A 1YFHA 2ETHA 3SXYA 3MAJA 3TOAA 2PQ8A 1IN7A 3DPLC 3FF5A 4O5VA 3ISPA 4RAYA 1FNNA 5D5VB 2X4HA 2D1HA 1UFMA 3QPHA 4U0WA 4HA8A 3J80K 1B9MA 1GXPA 5DUKA 4ENNA 1V3FA 1JXSA 2V1DA 2K86A 1T6SA 1I27A 2EV0A 1BIAA 1SD7A 3E5QA 5L3CA 3ERED 1ZLJA 3F8MA 5E18F 2QLZA 3CTAA 3K9TA 2VOOA 2OBPA 2Q2EA 3W6JB 5LGNA 1ODDA 3KP2A 1Z1DA 2CGPA 4GXOA 2W25A 3V4GA 4R79A 4P5OA 5D5XB 1BC8C 3DF8A 1P2FA 4LFUA 2H6BA 3S2WA 2LSOA 4U88A 3QU6A 2P4WA 2M1BA 2LF8A 1FYMA 3KLOA 1ZRDA 2Z9OA 1V4RA 1FX7A 1OYYA 4ENKA 1P92A 3HRSA 3P9KA 2FQ3A 4KIFA 3HSRA 3I53A 1QNTA 2EFPA 3GF2A 1KQ0A 2W24A 4NQWA 2K27A 2XRNA 3PQJA 1SMTA 3KZZA 4UV8A 3ZMVA 5DEQA 4CGZA 4A5MA 4O3MA 2KJCA 3JTHA 5IT9K 4EGYA 5EEHA 2P5KA 1BM9A 4A5NA 4AD9A 2P5LC 3TO7A 4BNCA 1KU2A 4DNCA 3BJ6A 2HTSA 4YFKF 4TV7A 1KQ8A 3KP4A 1TQIA 2VONA 2Q0OA 1F1ZA 4Y15A 1LB2A 1FOKA 5D5WB 3TGNA 3W6KB 1QQIA 2VC1A 3BJOA 4Q48A 1ZHFA 1FYKA 2XASA 1BI0A 2GA1A 5ICFA 3WGHA 5FFXA 2Z33A 3NRVA 5LGTA 1IN6A 2NNNA 4HZFA 5K5OA 3JTGA 2PG4A 4OIQF 2LKPA 2O3FA 3MZYA 3JSOA 1BIBA 1H9GA 1MJ9A 4FHTA 2PI0A 3IHUA 4HBLA 3HOSA 3OOPA 2AS5F 1MGTA 3V7SA 1ZLKA 1U8RA 3KLNA 2HQRA 1BJAA 4IRHA 4LJZF 2Y0MA 1AWCA 4EJOA 2QZ8A 3BOQA 5IT3A 1IXCA 4L0YB 4M73A 3ZMUA 4EM1A 5F64A 4U7DA 2KIUA 3WTWC 5IT9Z 2L02A 3F8BA 4EQQA 2XAFA 2COMA 2DFIA 2MBFA 3EYYA 4EM0B 1XDUA 4ZYGA 4LG0A 1ZRFA 5F6FA 2V6CA 1Z6RA 4EGZA 3V7RA 2PBIA 2HR3A 1OPCA 3ZMSA 1XGSA 3MZHA 1P6RA 2DTRA 2Z99A 1HKSA 2XAHA 4CYDA 2EFQA 1PP8F 2J5PA 4AWXB 3HTUA 2HKOA 1HSTA 2FRHA 3ZMTA 3J7AO 4HQEA 5K5RA 4G6DA 3NEUA 2FOKA 5LGUA 2W57A 3FZVA 3JAMZ 1O3SA 3J81Z 3E6DA 5E1WA 4O6JA 1GHCA 1TW3A 1T38A 4B8XA 1LEAA 2D2WA 1HSJA 3FM5A 1XMKA 1U78A 1MKMA 2YX7A 4GO1A 4ZYHA 2MLGA 4ETSA 5BPIA 3LAPA 2GIVA 3G73A 5L3BA 2DPDA 4RB1A 1KU3A 3E5UA 3HHHA 2FF4A 4BQAA 4OIOF 3I5UA 3KP7A 4KICA 1STZA 3E97A 3BJAA 3R0AA 4ESJA 2J5OA 3FWEA 1XCBA 4WX9A 3SZTA 3DXJF 3O2PE 2IJLA 4I0BA 4HV6A 3JAMK 2UZKA 2XV4S 1S8NA 3PFIA 2OU2A 4G7ZF 4XSXF 4WXHA 1Z9CA 2M45A 2VXZA 1LNWA 4JQFA 3L2CA 1Z91A 3L9FA 3HYIA 3RDIA 4M74A 4L9JA 1O3TA 3RPQA 3GLXA 1XGNA 1RI7A 4L9VA 4JK1X 2DO7A 4U0YA 5K1YA 5LBQA 3GX4X 1I1SA 2IP2A 2IPQX 1EH8A 1SFXA 2DK5A 4UVAA 1BI2A 3HSEA 3TQNA 4U7BA 4DQ2A 2ISZA 4MHGA 1XGOA 1OYWA 5LHGA 1IN8A 1FSHA 3GFIA 4L0ZB 4LLLA 1IXSB 2V9VA 3R6SA 3FHZA 2K4JA 4BYYA 2CFXA 5JI6A 1IXRC 2XIGA 3M8FA 1UCRA 4LLGF 3FXUA 3HOTA 2VE9A 2A6EF 4P9FA 1MJBA 3DKWA 4UVBA 5LRRA 4RAZA 1D8KA 2O61A 5CVJA 1LDKB 2NRAC 2MH2A 3ML6A 2ZKZA 2RV8A 2EJRA 2C6YA 2YU3A 3GYHX 1TTYA 4YFXF 2RN7A 2E7XA 1B4AA 4UUVA 3KP5A 2DW4A 4Y13A 1USTA 4Q5SF 2P7CB 2EA2A 1O57A 2YPRA 2NNYA 1XN7A 3LA3A 2F5EA 1K78B 2F5DA 2HYGD 3QRFF 4A6DA 2DLLA 2A6HF 2BV6A 1ZG5A 2A07F 2QYOA 5DCFA 1IUYA 1G3SA 2QVOA 3E5XA 1YTYA 1J7KA 2H6CA 3U2RA 1YS7A 3SQNA 2GXBA 4RB0A 3LQRA 1ONVA 5AIPA 3P9CA 5HOOA 1K78A 4XLPF 4KIGA 2YX4A 1T0FA 1ZGAA 4A12A 4BHCA 4A6EA 2DPUA 3C7JA 1W5SA 4ENJA 4WF2A 3CUQB 4HLXA 2ELHA 3N97A 2M30A 1IW7F 1OYIA 5TRDA 3RKYA 4P55A 3SHFA 4ZZLA 3T8TA 1MZBA 3WTXC 4MGRA 1O3RA 1Q1HA 4Y17A 1IZ1A 3CO6C 3BPVA 3Q5FA 3WE3A 2DU9A 3KCCA 3P9IA 4KMFA 2EFNA 4HF1A 2OA4A 4KFCA 1O7LA 2HKXA 1XSXA 4IHSA 3FM3A 5BMZA 1REPC 2IVMA 4ENMA 2XUBA 2BEOA 3V8LA 4OIPF 5L3FA 3IWZA 3LA7A 1YIOA 4HQMA 3R60A 3QPTA 2EV5A 5CYVA 1H0MA 2K4BA 1SD5A 1ZARA 2IA2A 3FMQA 2E7WA 1OKRA 1MDMA 1YW8A 4QWQA 2QQAA 2VT2A 3M8EA 3K0LA 1BBYA 1P4WA 5DD4A 3I59B 3GEZA 4LGWA 2ZNZA 2CSOA 2A3SA 3P7NA 1WSUA 1UB9A 2IRFG 1R7JA 1RUNA 3ECHA 2VBXA 2CWEA 4KDPA 2ZBKA 3ABTA 3IRRA 2A68F 1OMIA 5FD6A 3WTVC 5L3EA 4WXCA 4KYWA 2D45A 4ZYDA 2L54A 1ZH5A 3GZ5A 1F5TA 5E8IA 4AIHA 4IXAA 3QP5A 4RB3C 1KA8A 1ZG1A 3L09A 4Q47A 4RGSA 2P6TA 2H27A 3IC7A 4NHJA 4M6XA 3F8CA 2PN6A 1SD6A 2D1VA 1HW1A 1I6XA 2XKPA 2G7HA 2EFWA 6PAXA 3M1EA 3RPUA 4D0PA 2NS0A 1FBSA 2CW0F 4I0AA 2P7VB 2Y75A 3RI4A 3WTTC 1FZPB 3T1BA 5D4SA 2W85A 3H3UA 4I09A 4L9TA 1IN5A 3F22A 3G3ZA 3I4PA 5ILUA 4XSZF 1U6GA 4CICA 4UNOA 2DK8A 3BPXA 4PDKA 4KN7X 5LEJA 3R61A 4BHPA 3WG9A 3RYRA 3K1NA 3IWFA 5HLGA 4MTEA 2Y48A 3K1MA 3TO9A 1QO0D 4OINF 2JTVA 1KYWA 3MQ0A 5AONA 1FYLA 4M9XA 1XSDA 1YG2A 4M71A 4UV9A 1FC3A 4G9YA 1D8JA 4H0EA 2JSCA 3HHGA 1Z7UA 3F21A 2KIMA 5E1ZB 1YW7A 2PJPA 2XKOA 1P4XA 1JHFA 1JGSA 1ZAOA 1YO5C 2RKHA 2P6SA 2XHKA 5J6XA 4AIKA 3ZQ7A 3EQLF 1JHHA 4ESFA 2GXGA 5JHUA 4MNUA 2HEOA 4CZZA 2L01A 4RGRA 2CG4A 3VODA 1KU9A 4IRGA 2LF7A 3RKXA 5DD8A 2LDUA 3C1DA 1O7FA 3BP8A 2ZMEA 4AVPA 1KU7A 3M9AA 4MEYF 3DEUA 5TJJA 3TDZC 1O3QA 3LAJA 2V1UA 2L4MA 3PQKA 5H6RA 5HDKA 2F2EA 4PCQA 3WGGA 2QQBA 5HS8A 4L18B 3DFGA 1YS6A 2F5CA 2MC3A 1K7AA 4LG0B 3JSPA 3F6OA 3BY6A 1DP7P 3VEPA 1SMYF 1U5TA 5CJ9A 4LLNA 3QOPA 4GCVA 1MD0A 3WTSC 4BH9A 4GYGA 1WKMA 1ULYA 3WTUC 3COAC 3RJPA 5L3DA 2DBBA 3RTRA 1I1GA 4WCGA 2VN2A 2GZWA 2EFOA 3B02A 3D5LA 2HWVA 1C0WA 4KN4X 3K1PA
chains in the Genus database with same CATH superfamily
1A6IA 3GBGA 4WXDA 4F7ZA 3ECOA 1EJ9A 1DPRA 1HQCA 2M4GA 4B4CA 3NWSA 4BXUA 4XONA 3HZJA 4S04A 4XKWA 3F8FA 1M1EB 2FE3A 4M3BA 2V9PA 3EETA 4E4HA 3QP6A 1TWAJ 2HOSA 4Y3OA 4C30A 2KJBA 3F23A 4WK8F 1HBXG 1D0ZA 1S5LC 2W48A 2R0QC 4UY8I 3IKVA 1TP4A 1GXQA 5DCMA 3BZ6A 1R1TA 1IG7A 2HNHA 2E1NA 1L0OC 2OUMA 4G94A 4PSXA 3OR2C 1HW2A 2FU4A 3U1DA 1S29A 3MVPA 5LHHA 3WGIA 4HDUA 3KX2A 2VOPA 1S7AA 3BG5A 4CCMA 1VQ7I 2OQGA 1XD7A 4PJNA 4YRVA 2W4SA 3K4BA 4X0GA 1OLTA 2G9WA 4C3IJ 3Q0WA 3CC7I 3AFHA 2NS8A 4QLCU 2ZJPF 2QQ8A 1UMQA 3KIOA 2E60A 4EV0A 2KISA 3E6BA 5IOZA 1ETKA 1R22A 1WJFA 4IPAA 4OAZA 4MTDA 1G3YA 2XAUA 1KONA 2KP6A 5JLXA 3BR3A 3I56I 5E1XA 2Y0SN 4BXFA 4A0ZA 5LRSA 1DUXC 1R1VA 3LSRA 1JKPC 4PUSA 4JYKA 1Z05A 3F9KA 3MKZA 4D5CA 3OL4A 4DIQA 4IVNA 5D6FA 3CUQA 2RQQA 2RREA 4G6QA 1AKHB 4DYRA 3J81K 2HDCA 3ZXSA 2JA6J 1R00A 2OF7A 3BG6A 3Q9VA 1H88C 1WGXA 1A31A 1HW5A 1MMNA 5BPDA 1UHWA 3ABUA 1POGA 2W84A 2UV1A 1TWGJ 3PUFA 2HGCA 4G7OF 5CVRA 1D0XA 1WJEA 2QM3A 4II2A 1IO2A 4F55A 4UHTA 5C4JJ 3B73A 4EJWA 4XLCA 2QSGX 4IX7A 3WG7H 5HNFA 4LB5A 1TQMA 2GIZA 4CCNA 2F4IA 2XROA 1GV2A 2JRMA 3FXQA 2HQAA 4ON0A 2MA3A 2WC2A 3RIRA 2E1MB 1J9IA 1MH3A 2BVMA 5ILSA 4J00A 2KKOA 3RCOA 4NC8A 5ICEA 4M3GA 3EYIA 2E5ZA 3ZCOA 3M4OJ 2ZJ2A 1LFUP 1R4MB 1WRJA 4NB5A 1SFEA 2ZB9A 3W2AA 2FMYA 3FXMA 1BN5A 2L7FP 1HKTA 2A61A 3K2ZA 5J4YA 3CDHA 5FLVA 4NQWB 1NG7A 5HS9A 3CUOA 3I59A 1YI2I 3BWGA 3OSFA 4HLYA 5FFZA 4QTRA 1JT6A 3JRAA 5JVTA 2Z5UA 5FGMA 3H3ZA 1K79A 5KAIC 3RYPA 3ASOH 3KE2A 2EV6A 3GUDA 3VYTB 4IZZA 1MSFC 2COBA 1V55H 1ZQ3P 3WODF 2P5VA 2EIKH 2HXIA 3I54A 4G8XA 1ZREA 2K9NA 2NYXA 2VT3A 2MC4A 3FX3A 5BQTA 4L5IA 2E2IJ 2R7VA 2W1OA 3BTJA 2PJRB 4XMYA 4D5FA 2AXLA 4XICA 3AG3H 4M3EA 4KUMA 3FMRA 3R4KA 4IQ4A 1PYVA 1B6AA 3FIWA 4B3XA 2JQ7A 2GWRA 5JVGF 4H4KC 3A1YA 4OMYA 5HVQC 2F5VA 1G3TA 1IUFA 3E6CC 1ZGJA 2KPMA 2JA7J 3E6MA 5DCMB 3L2RA 2QQ9A 2ZO4A 1BW5A 1XTAA 5HDGA 1G6NA 2UWMA 2IGKA 2IXSA 2YSRA 4CCOA 2DYSH 1YLFA 1APLC 4XQFA 5J40A 1FPQA 2XSDC 2E5NA 3DQVC 5HS7A 3PSIA 4CZCA 3SYTA 4CUGA 3T5XA 3ZR8X 5D6EA 2KRFA 2CFOA 3BT9A 2FBKA 1IDYA 2BYVE 2ECCA 3I4NJ 3L2QA 1ACIA 3CCYA 3KP3A 2XAQA 2PMUA 1XG1A 1K61A 1Y56A 2V9KA 2WY8Q 1J75A 1DPUA 1R5HA 1XB4A 2OV7A 5ERIA 4EATA 1XC5A 4HPQA 2HVSA 4QIWN 3HOWJ 1LDJA 2VKDA 3R0JA 3JRFA 4OIRF 2EIMH 4M72A 2QSHX 2HU9A 2QBYA 3BDDA 1S9HA 4PZJA 3CCQI 3H5RA 1EH6A 1A36A 1B72A 4S05A 2O03A 2WAFA 5DUIA 1TLHB 1I6HJ 2HVRA 4UXNA 1GVDA 1FT9A 3TW6A 3ZQCA 2HYJA 2KFDA 1TW2A 3C3WA 4UVCA 1PDNC 4NC7A 5LFAA 4L9NA 1FMVA 2QF7A 2B7EA 4M9SA 4ESBA 1J59A 1RNLA 1J09A 4FX0A 3H35A 4B44A 2X51A 5GPCA 1LKXA 3LWFA 2X1EA 5E3LA 2EB7A 2CQQA 4C9YA 3CUQC 1TNTA 1OCZH 2KIFA 3GXOA 2R7SA 2LY2A 1RKWA 2RNJA 1T33A 3CO7C 3K4LA 2OD5A 4N9HA 2IBDA 2MFZA 1LE8B 1R6RA 2R93J 1ZR4A 1W5CC 5E8GA 4BDYA 4A3CJ 2JJ7A 1JKOC 3BR1A 1JJ8C 4PJJA 2V7FA 3X2QH 1R71A 3DV8A 3CP8A 3OYFA 1LJ9A 3A01A 1W5TA 1JTYA 4MEXF 2VBZA 1RETA 1MBGA 5DV5A 1R58A 2LOOA 3V7CA 3BTCA 3GFLA 4YIRX 1N77A 1MNEA 5FO5A 4A2UA 1LPQA 1JUMA 2FXAA 1OCRH 3U9GA 3ZQFA 5J1YA 3S1RJ 4E7KA 3DLLF 1BR4A 3ULQB 5D8KB 1DGRM 4A3MJ 3VB2A 3TO6A 1D5YA 1GDTA 2Q8KA 2LRDA 3ELKA 3ESWB 3GLLA 3QAHA 3UKGA 3HOUJ 3L2VA 3KFWX 3TOBA 1P7JA 5EZGA 1F4KA 2FBHA 2KQRA 3TDUC 5A2QK 3S2HJ 2XPUA 1RESA 4HNVA 5FD5A 2RNGA 3HUGA 4CH7A 2L9SA 3A03A 4EJVA 2ICWG 4B1RA 1T98A 2IW5A 1YE9A 2X0LA 4YIFA 3WU1B 2E34A 5FB2A 2ZMEC 2WWYA 3CDIA 4OMZA 1E3PA 1TQPA 1FWZA 3S1QJ 1OR7A 4OOIA 1CGPA 1Y6IA 4HX8A 1Z0XA 2Z2SB 3TW7A 2JT1A 2L3DA 4A3FJ 1QGPA 3CD6I 2HYFA 2VJJA 3EUHC 4XN0A 3QPLA 2DQRA 5DYMA 4UUSA 1WI9A 4RMNA 5FKLA 2FX0A 2ISYA 4HF0A 3KEQA 4IF4A 1LFBA 1WH5A 2EA4A 3CLOA 3O6BB 5ICCA 3V42A 4EEFG 3F6VA 1IRZA 4ZDPA 4JX5A 5D8LB 3S1NJ 2M87A 1IJWC 3PIPF 1VQKI 2TRTA 3ZPLA 2XAJA 3HSFA 1R1UA 3DLAA 2BGCA 2X48A 2QKLB 1TWCJ 2HOEA 5HDNA 3WTYC 5J4VA 2M8EA 4YEJA 1I3AA 2CQNA 2R7ZJ 3H9QA 3D5SC 3G1MA 1FSEA 5CKTA 2KDOA 4G7HF 2CU7A 2JRTA 3FXKA 4L5JA 5CVUA 2ME6A 5EYRA 3WU2C 5LD2C 1RUOA 1Z21A 2CV1A 2GXAA 2VBWA 4A0YA 1FOWA 2FBIA 2K3FA 2WY7Q 3HOVJ 2L7ZA 4L5EA 1B59A 4UUTA 1X3WB 2GBYA 4S0HB 2KZVA 1Y1WJ 2RVCA 1W7PA 1LDDA 2A69F 2TCTA 1IC8A 1E17A 4HW0A 1D1CA 2R7XA 3GTOJ 1RZ4A 1MMDA 2UXXA 1ZN2A 3LMMA 1HKQA 2RGVA 3IUOA 3L2WA 2JZYA 3ZMDA 2FEZA 2JPCA 2DJIA 1OCTC 1G3WA 2HPIA 4C3JJ 4EVIA 4XRSG 5D4RA 2MGQA 1B9NA 4AM3A 3WTZA 2M5WA 2V4JC 3A0HC 3MWMA 4EMSA 5CVVA 3J80Z 1HOMA 2MLKA 1EF4A 1T8IA 1YQAA 3GFMA 4CA0A 1MNDA 2NAZA 3NARA 4EJUA 3FXRA 4I7HA 2DT5A 4F93B 1P4AA 3GWZA 1DU0A 4PK4A 3HRTA 1XSVA 5F08A 2QENA 3GZ6A 3OSGA 3MKYB 2H09A 4P1WA 1FJLA 1ZR2A 1HLVA 1KYZA 3G2BA 5E20A 5IP9J 2M7BA 3TKYA 3VOEA 2P8TA 2F6CA 5A2QZ 1QBJA 3WHCA 1RR8C 2LKSA 2LK2A 2Q2EB 3PO3J 2MH9A 3OYLA 1BOAA 1UZCA 1PP7U 1UHMA 4PSWA 1S7EA 4HOBA 4B09A 3O3KA 1X2MA 2DN0A 1WQ2A 3OYDA 1Y8QB 4GYIA 1TNSA 4Z6YA 2Y69H 4ZH4F 1BL0A 4CHUA 3GZNB 3HPHA 1BI1A 1NHAA 5E17F 3CCVI 2NXNB 2Z16A 2Z3YA 1BI3A 2R3SA 3FK6A 4P96A 2EZLA 2R7WA 5EZHA 3FKJA 3K4JA 3BCAA 3I58A 2L4AA 1LEBA 5GAEJ 2MW8A 1CF7B 3LFKA 3G6EI 2VASA 2OTJI 3IAM2 1U5TC 2FNAA 3D0SA 2DAOA 4ZDOA 1R4NB 2DFFA 1OISA 2PX9A 1H89C 3FHNA 1PUEE 3MD2A 2HZTA 2K9QA 1R36A 3RQIA 2ZFWA 3PSFA 1I5ZA 1OCCH 3CJRB 3K69A 4ASNA 2XC7A 4A0XA 1MJAA 1F43A 1BA5A 3T8RA 5JFRA 3IH4A 4ZC3A 2X9DA 4FX4A 4M6YA 2ADUA 2V79A 2ACJA 5BS6A 1SAXA 4CO8A 5EEAA 1IF1A 2DYRH 5IYCJ 2RQPA 5CQEA 2VB6A 4MQ9F 3WE2A 1Y0NA 2O5RA 1YYVA 2M7AA 4DYCA 4RGUA 2LLKA 1MBFA 1S6LA 2BY3A 2OZ6A 2R7RA 1QZZA 2DI3A 2PMHA 4ABZA 4XRFA 1ETVA 3IV5A 3ZQHA 5L3GA 1ENHA 1XX5A 4YIIA 2JPBA 4DZPA 3S1MJ 2VJIA 4HX4A 5TISC 2HQ5A 1XGMA 2X6OA 4JP0A 3EUHA 2BW3A 1BC7C 2FUG2 5E3OA 5KCMA 2KL4A 2XGDA 3ZQIA 3C18A 1U5TB 3KETA 3LSPA 3GO5A 4LB6B 4GDFA 3F8NA 3OWTA 3PNVA 4KT5C 1FBQA 5F0FA 2XGXA 1GVJA 3ZN1A 2IS2A 4E6KG 4IJAA 1W7PD 2YR2A 2ZCWA 1KQ9A 4KMUX 5FRNA 3CESA 4EM2A 4DGWB 3OYCA 2PFBA 1ZRCA 3H3VK 3LSTA 3OL3A 1JI8A 1PJRA 1YW9A 3H36A 2DDAA 3GFJA 5J8CA 4OWRB 1I39A 1CF7A 4BQOA 4A3DJ 4CCJA 2WAEA 2X1CA 3AKZA 5ILVA 2A5YB 2WV1A 3VFZA 2F4MB 3L7WA 2FA5A 1X1DA 4PFOA 3FISA 1AOYA 5BOXA 2RC4A 2FSWA 3IAS2 5B1BH 1S3JA 3ZP5A 1WH7A 4Y4RA 4HV5A 4IRIA 3N4MA 3GW2A 1V5GA 2KRCA 1W7PB 5HLIA 1OCPA 1WJAA 2M9HA 5ICGA 1Z6TA 2DDBA 2XSJC 3REOA 1O4XA 2LY9A 1W4MA 4CXFA 3K4CA 4HYEA 1ZK8A 4DW6A 5LEKA 2STTA 3Q9SA 1WWXA 1SD4A 5F1RA 2DFHA 3KPHA 1Y0UA 3N05A 2VKEA 4DBRA 4GGGA 2Y2ZA 1JT0A 5HLTA 4IEJA 2FJ1A 1FP2A 3BCBA 2OZUA 2O9LA 3AAFA 3C2HA 4BDZA 2BW3B 2R7UA 2AQEA 3S16J 2RAEA 4IL6C 3JW4A 4MQVA 3E3VA 1A04A 4JBAA 2XAGA 3JCUC 3ABMH 1SC7A 1U2WA 3LSMA 5H20A 5K5QA 1BR1A 3KP6A 3CJNA 4HNTA 4N0BA 2ZSHB 3OYBA 3LQQA 4M9ZA 4K2EA 4N4NB 2H8RA 2CQKA 2CYYA 1USSA 2BE5F 4DYQA 5JLWA 1U3EM 4IHXA 2XVCA 2LMDA 1R23A 1KGSA 1F9NA 3I71A 1VF9A 4R1HA 4HAMA 3OV8A 3RKWA 4LITA 4N9IA 1ETOA 4U87A 3MEXA 1Y8RB 4HDVA 1SFUA 2HTJA 5M5XJ 4I2OA 2BOLA 3F72A 5J47A 5FLXK 1YHQI 4I01A 2DQLA 5J8FA 3MCZA 1D3YA 3M7GA 4A3GJ 4NNJA 1FTTA 1ON1A 1LVAA 2GA2A 2VODA 3HRMA 2R5ZB 3SFZA 2DOEA 3HRUA 3V8JA 3I0TA 4XIDA 1ZELA 2F5FA 1R5GA 1FLIA 1UAAA 4PJLA 1SFKA 3BROA 4ITVA 1WPKA 4KJZA 2VE8A 2BVLA 2HS5A 2NVYJ 2GQQA 2QUFA 3ZQLA 2IA1A 1JKQC 3QOEA 3UNGC 1RIOH 2B0LA 1IRXA 2EQRA 5F04A 5H6QA 2STWA 2ZMEB 3Q3SA 3AG4H 3CC2I 4IHTA 2O0YA 1HXDA 2EK5A 1X3UA 4FT8A 4XBFA 1J5YA 3KEOA 2AXTC 5CLSA 1QZYA 2HQNA 3H5NA 3O8HA 4UB6C 5EEGA 2I8DA 3F3XA 5LHIA 5HLHA 5B5EC 3K6GA 2PLYA 1J0RA 1EV7A 1WJ5A 4E7LA 1A35A 2VL8A 2W7NA 2RDPA 1FBUA 4CDGA 1T39A 2UXNA 3ABLH 1QRYA 1W0TA 3V8KA 4AUXA 1FY7A 2EWNA 2DA5A 3LSJA 4Y33A 4CYCB 3L1PA 4V2FA 5E3MA 2DOFA 3JRHA 3S15J 3BZCA 4IOCF 2R7FA 3HUGB 2ESNA 3IL2A 1ZG3A 3CDLA 3I3LA 4A3EJ 1B8IA 2BBYA 4PGGA 4P9UA 4BE0A 2E1CA 2BXZA 3FKIJ 2A6TA 3H5AA 1MBKA 2OAZA 1H9TA 5M3MJ 3T0YA 2PEXA 2WTEA 3M1CA 1B1BA 1XCVA 2FMLA 2M0MA 4M6VA 3ZN0A 2DTZA 2ZXJA 2V1NA 3IH2A 3OR1C 4Z2YA 1D5VA 4HF2A 2X1DA 4F91B 3ROUA 3QU3A 2H94A 2LG4A 4PJMA 1VNDA 4KNYA 2E71A 2H8WA 1U9OA 1MSEC 1HDPA 1MDMB 3B6CA 5CVIA 4XLNF 4DZJA 2DA7A 4WWCA 1ETXA 2HOAA 4XLHA 1ZYRF 1NH3A 1S7OA 2JA2A 1L3LA 3OS2A 2IT0A 3H92A 5AIQA 1IRFA 1YITI 2DA3A 3A02A 3KZYA 4AYBA 1IRGA 3DP7A 2WV0A 4BBRJ 3EDPA 4LD5A 5FLXZ 3DTEA 2DMUA 1QPMA 3HIFA 5KK1A 5DTDA 1E2XA 1X58A 3IRQA 4ZYEA 1NTCA 1ZTRA 3LNQA 2LKXA 4KIBA 1XDSA 3BR6A 1ON2A 5KVRA 3DBLB 2LNBA 3VSLA 1X4OA 2GM4A 1FP1D 2GAUA 2ZNYA 1U8BA 5D5UB 2PMZN 4BUPA 1Y39A 1KZHA 1HA8A 3IH3A 1VTNC 1T2KA 2CO5A 3ZMZA 2V1XA 5JR3A 4I02A 2VC0A 4LK1F 3MFKA 1XMAA 2LVSA 2VBYA 4YFNF 4ZZDA 4I98B 1LQ1A 1K6OA 4LK0F 1GLNA 1YX3A 4RB2C 4KA4A 1G4DA 4E70A 1VI0A 2OQRA 4PGHA 2QBYB 4C3HJ 4D7MA 5ED4A 5H2FC 4R8HA 2QEXI 1IN4A 4J01A 3QYBA 3HTSB 2IS4A 3GVAA 4M3DA 2K02A 5F0HA 3FMSA 2KIQA 3LA2A 1EH7A 2R5YA 2XGCA 1J2XA 5DDGA 1WJBA 2DODA 3NQOA 2O6GE 1IAWA 5LLQA 3I64A 2N8GA 1JE8A 1TBXA 2E2HJ 4MIMA 4U0VA 2LP0A 4EJTA 1VQLI 1OJLA 4BHBA 2MD5A 3L00A 2A05A 4LMYA 4QPOA 2HFHA 3K4KA 1X19A 5J3LA 4MFDA 2K7LA 2ESHA 2G7UA 4OU0A 3SZPA 4AIJA 2ME0A 3WU0A 5IP7J 4ANJA 1DDNA 4BAYA 1WJCA 2HI3A 4Q4ZF 2TDXA 1MIJA 2Y9YA 2ZSIB 4YG2F 1AHDP 3VYSB 4RAFA 3FK7A 4HX7A 9ANTA 3DPUA 2MABA 3DPTA 3HC7A 3D1NI 4BE1A 2FNPA 3OIPA 3IKTA 4RGXA 2IA0A 2R7DA 1X1AA 3ZQGA 2O8XA 1IDZA 2QWWA 4RS8A 1PVEA 1YFHA 3UR3C 5EGOA 1WVRA 3BZKA 1AKHA 2UUZA 1P9QC 2ETHA 2E35A 3DKYA 3MAJA 3SXYA 5F1JA 3TOAA 1ETWA 2PQ8A 1IN7A 3DPLC 2JSPA 2CS3A 3S14J 1SVMA 3FF5A 2FQ4A 4O5VA 4IHVA 5EG0A 1JTXA 3ISPA 4RAYA 1FNNA 5D5VB 2WAQN 1VQ5I 2D5VA 1NG6A 2X4HA 2M8GX 3OYHA 5DS9A 2D1HA 3CF5F 1UFMA 3E1SA 3QPHA 4U0WA 1QU3A 2XF7A 4JX6A 3ONQA 4BQQA 3HDDA 4HA8A 1GT0C 4DBQA 3J80K 4XRSA 1B72B 1DU6A 1B9MA 1EA3A 1UG0A 3U1KA 1GXPA 5DUKA 2DA6A 1V3FA 4ENNA 1JXSA 2L9NA 2V1DA 2K86A 1T6SA 1I27A 1IV8A 3E5QA 1BIAA 1SD7A 2EV0A 1WI3A 5L3CA 3ERED 1ZLJA 3F8MA 4XLFA 5E18F 3PNTA 2QLZA 3CTAA 3K4NA 3OIQA 1U0JA 3K9TA 4A69C 2OBPA 4MFEA 2VOOA 2Q2EA 3W6JB 1YIJI 5LGNA 1B8IB 1ODDA 3KP2A 3S17J 1Z1DA 5K7HA 3EUAA 1QHHD 2CGPA 5M5YJ 3BQZA 4GXOA 2W25A 3V4GA 4PJ0C 4HRIA 1OQYA 4G6TB 4R79A 2L9VA 4P5OA 4XLEA 5D5XB 1PUFA 1P7IA 1BC8C 3DF8A 2CJJA 1P2FA 2JVHA 4LFUA 2XB5A 2KHMA 4FTHA 4A3BJ 2H6BA 1QVTA 1JKRC 4E7IA 3S2WA 1UG2A 1ETYA 2LSOA 4U88A 5FKMA 2ZXHA 3QU6A 3JRBA 3CCLI 4G12A 2ELKA 3S2DJ 5B66C 1D1AA 2M34A 3KEYA 2P4WA 2M1BA 2LF8A 1FYMA 2BY1A 4AU7A 1FIAA 3KLOA 4ZTJA 2OC6A 3HBLA 1ZRDA 2Z9OA 1V4RA 1TZLA 2BHZA 1K6YA 1FX7A 1OYYA 2E19A 2DMTA 2LBFB 4ENKA 2GOXB 1CQTA 1P92A 3HRSA 3P9KA 2FQ3A 3LSIA 4KIFA 5IYBJ 1I50J 2BY0A 3HSRA 2NOGA 4XLAA 4Y52J 3BR0A 3I53A 4F52A 4Y7NJ 4NBQA 3VYRB 1QNTA 2EFPA 1NK3P 2MD0A 2VKHA 1QHGA 2L9RA 3GF2A 1KQ0A 1U9NA 2W24A 4NQWA 3CCMI 4BS9A 2OPTA 2LD5A 2K27A 2XRNA 3PQJA 5IYDJ 3GCMA 5IP6A 5CQGA 2M4KA 1SMTA 3KZZA 4UV8A 3ZMVA 5DEQA 4QPQA 5BNGA 3RQ4A 2E1OA 4CGZA 2BHYA 4A5MA 1AU7A 4O3MA 2KJCA 3CCEI 2QSFX 4IHYA 3JTHA 5IT9K 4EGYA 5FJ8J 4RM2A 2VJ4A 5EEHA 2P5KA 1BM9A 3G1OA 4A5NA 4BGDA 3OYMA 5FROA 4FE7A 4AD9A 2P5LC 5KAFC 4BJ6C 2JMWA 3O8GA 3GTQJ 2CRGA 3HOZJ 5M5WJ 2LH9A 3RZDJ 3TO7A 2I5UA 1HDDC 3H0DA 4BNCA 1KU2A 4DNCA 1YX5A 3FXLA 3OIOA 2VQCA 2MSYA 3BJ6A 2HTSA 2IEKA 3BR2A 1IV6A 1A5JA 4YFKF 3KYCB 4TV7A 1FIPA 4A3KJ 1KQ8A 3KP4A 2VQGA 1TQIA 1G8XA 1Z3YA 2VONA 2Q0OA 4BEHB 1F1ZA 4LIUA 4Y15A 4LIVA 1LB2A 2JVGA 4AVZA 1FOKA 4UB8C 5D5WB 3TGNA 1TL8A 1MMSA 3W6KB 2E2JJ 3I55I 2HDWA 1MBHA 2R7QA 5FKOA 2IAIA 3GTGJ 1QQIA 2DOAA 3BG7A 4AC0A 2VC1A 3BJOA 4B43A 4BY1J 4Q48A 1X1CA 4ZJZA 1ZHFA 1FYKA 2IGNA 3LOCA 3SFIA 2XASA 1BI0A 2GA1A 5ICFA 2DA2A 3WGHA 2M0CA 5FFXA 2Z33A 3NRVA 2IGOA 5LGTA 2ZFUA 5GAGJ 1IN6A 1MMGA 2NNNA 4HZFA 3VSKA 5K5OA 3JTGA 2PG4A 4OIQF 3D5RC 2LKPA 3BTLA 2O3FA 2LY1A 3MZYA 3JSOA 1BIBA 2KT0A 3AL0B 1W36C 1H9GA 4I6ZA 1HF0A 1MJ9A 1V54H 2K9SA 1LE8A 5GTHC 4FHTA 3PJRA 4D9JA 2LC2A 2PI0A 1TWFJ 3IHUA 2Q1ZB 4HBLA 3HOSA 5B3SH 2R5ZA 4X1EA 3GTJJ 3OOPA 2ELJA 1FOYA 2NVTJ 5F27A 2X6XA 2AS5F 1MGTA 3V7SA 3JRGA 2R4GA 1Z67A 1ZLKA 4BY7J 1U8RA 3DKXA 2OJED 2Y9ZA 3KLNA 2ZJQF 2HQRA 1T08B 4E7SA 1BJAA 4IRHA 4LJZF 3P5JA 2Y0MA 3S3NA 1AWCA 3EUKL 4EJOA 2QZ8A 3BOQA 5IT3A 3CCUI 1IXCA 3K10A 4M73A 3ZOBA 3ZMUA 4EM1A 4L0YB 5F64A 3BG3A 4U7DA 2KIUA 1V5FA 1RKTA 3QYEA 1S72I 1AA7A 4CCKA 3WTWC 1VZ0A 3Q0VA 3DCFA 3RPUD 3DTKA 5IT9Z 2L02A 3F8BA 4CCLA 4EQQA 5JHFA 2XAFA 2COMA 2VPRA 3BQYA 3HJEA 2DFIA 2MBFA 3EYYA 4EM0B 1XDUA 4ZYGA 4AYBN 4LG0A 2GOMA 4RA2A 3RZOJ 1E3HA 1ZRFA 5F6FA 4I99C 5GTIC 2L5QA 3KYLA 1R9TJ 2KDZA 2R7OA 2V6CA 1Z6RA 4EGZA 1W0UA 3V7RA 2PBIA 5EGOB 1OCOH 3PIOF 2HR3A 1OPCA 3SJMA 3ZMSA 3JRCA 1XGSA 1JGGA 4DOZA 3JR9A 3MZHA 4A93J 1P6RA 2DTRA 2Z99A 1HKSA 2XAHA 2GLOA 4CYDA 2EFQA 4QSHA 3TL4X 3VDXA 1PP8F 2J5PA 4AWXB 3HTUA 2HKOA 2W00A 1HSTA 2FRHA 3ZMTA 3J7AO 4HQEA 2VLAA 4IKFA 4BQNA 5K5RA 4G6DA 2IS1A 3NEUA 1T56A 2FOKA 1ZKGA 2QKMB 3G71I 3GTLJ 3CF2A 5LGUA 2W57A 1WZ2A 3CJQB 3FZVA 3FBIB 3JAMZ 5HNHA 3J81Z 1O3SA 3E6DA 5E1WA 4O6JA 1GHCA 1TW3A 1T38A 4B8XA 1NK2P 1LEAA 1TT5B 1Z7LA 2D2WA 4W1UA 4FASD 1HSJA 2K85A 3CMMA 3B6AA 2WB1N 2ZXIA 3G1LA 3FM5A 1XMKA 4IO9F 2DJNA 1U78A 2DCEA 1MKMA 2X6YA 4AIDA 4DJAA 2YX7A 3DU6A 5KNLA 4GO1A 3Q0UA 4ZYHA 2MLGA 4ETSA 5BPIA 3FXOA 1RPWA 3LAPA 2WBMA 2GIVA 3G73A 5L3BA 4KISA 3DBHB 1KU3A 4RB1A 2DPDA 3KZIC 3E5UA 3HHHA 2FF4A 4LG3A 4A3LJ 4BQAA 4OIOF 2BY2A 3I5UA 3KP7A 3H9JA 4KICA 1STZA 3E97A 1ERDA 3BJAA 5FKNA 2VUMJ 3R0AA 4KITB 4ESJA 2J5OA 2L0KA 3S93A 2EINH 2HDDA 3FWEA 3I4MJ 1XCBA 5J1RA 4WX9A 3W2VA 1UHSA 3SZTA 3DXJF 3O2PE 3TP0A 3RKQA 2IJLA 3OOUA 4I0BA 4HV6A 1IGNA 3E0JB 1XS9A 3JAMK 2UZKA 2XV4S 3CMYA 1S8NA 2JN6A 4CYCA 1VQ6I 5DM6F 3BLYA 3PFIA 5FRMA 2OU2A 1JUSA 4XNFA 4G7ZF 4XSXF 4WXHA 2QCOA 2AO9A 1Z9CA 1E3OC 2XPWA 2M45A 2VXZA 1LNWA 4JQFA 2KLOA 2PJRA 2K40A 3L2CA 1Z91A 2DMPA 2V26A 3L9FA 2AQFA 3HYIA 3VWBA 3RDIA 4M74A 4L9JA 3GTKJ 1EKEA 1WFXA 3ZRGA 1N75A 4D1QA 3RPQA 1O3TA 3GLXA 2NVQJ 1XGNA 1R5ID 4OAYA 1SAUA 3I9V2 1RI7A 3OS0A 1UJ8A 4L9VA 1RRJA 4J19A 4JK1X 1SVOA 2DO7A 2M2EA 5GADJ 1VQOI 3S8PA 1I3QJ 1BR2A 2NVUB 5K7FA 2G0EA 3DU5A 4F3QA 4U0YA 5K1YA 2CUEA 5LBQA 3GX4X 1I1SA 3OYEA 3FDYA 2IP2A 2IPQX 4RAGA 1EH8A 3MN2A 3HOYJ 1SFXA 2DK5A 4UVAA 1BI2A 4D7NA 3HSEA 3CCSI 3HPGA 3SDGA 4V19K 2VJ5A 2XF6A 3TQNA 4U7BA 4DQ2A 2ISZA 2JA5J 4MHGA 1XGOA 3H9GA 1OYWA 3GTMJ 3NWTA 5LHGA 1IN8A 3LL7A 1FSHA 3GFIA 4L0ZB 4LLLA 1IXSB 2V9VA 3QODA 1E0EA 2DXIA 3R6SA 1R49A 2ZC2A 2L7KA 3FHZA 2K4JA 4BYYA 2CFXA 5JI6A 4X6AJ 2MG4A 1IXRC 1GUUA 2XIGA 3PUBA 3M8FA 2DA1A 3PO2J 1K83J 1UCRA 3FXUA 3QQAA 4LLGF 3HOTA 2Y30A 1DP3A 2ZJRF 2OCEA 1X2NA 1UELB 3LFUA 4JOMA 2VE9A 2A6EF 4P9FA 1YOVB 1MJBA 3DKWA 4UVBA 1VQ9I 1GV5A 2K9MA 3CQZJ 4XL9A 1BJZA 2QGUA 4RAZA 5LRRA 1D8KA 2O61A 2CUZA 5CVJA 1LDKB 2NRAC 2MH2A 1K4SA 2O8KA 1YJ9I 1YJWI 2WAQA 3ML6A 2ZKZA 2FOWA 2RV8A 2BXYA 2EJRA 1X4PA 3C2BA 2ID3A 2C6YA 4HG2A 3M8JA 2YS9A 2JWTA 2WADA 2YU3A 3W3CA 1TTYA 4YFXF 3GYHX 4PFPA 1TT0A 2RN7A 2E7XA 1B4AA 1JJ6C 4UUVA 4RLFA 3KP5A 2DW4A 4KT6A 2W82A 4Y13A 1USTA 3J7AY 4Q5SF 2NOJB 5EF6A 2P7CB 2EA2A 3ABKH 4I76A 1O57A 5GP9A 2YPRA 2NNYA 3W2WA 2CV2A 1XN7A 3LA3A 2F5EA 4A3JJ 1K78B 2F5DA 2HYGD 3QRFF 4XORA 4A6DA 5IOYA 1FEXA 1MBJA 1SEUA 2DLLA 4CSWA 2A6HF 2BV6A 1ZG5A 2A07F 2QYOA 5C44J 2JUCA 3BR5A 5DCFA 1IUYA 1G3SA 1ETQA 5M3FJ 2QVOA 3E5XA 1MBEA 1YTYA 2LR8A 1J7KA 2H6CA 3U2RA 1YS7A 3SQNA 1W36D 2GXBA 3MKLA 5FKKA 2EPFA 4RB0A 3HGYA 1N78A 3LQRA 3K70D 1ONVA 1WCMJ 5AIPA 4RDUA 1XPXA 1VQPI 3P9CA 3PL8A 3JRDA 4E7ZA 5HOOA 2VPLA 1Z77A 1K78A 4XLPF 2EZKA 2YX4A 4KIGA 1T0FA 2FD5A 1ZGAA 4A12A 4BHCA 4A6EA 2DPUA 3G4SI 3C7JA 1W5SA 4ENJA 3U21A 2JUGA 1ORKA 3QPSA 3RSNA 4GFBA 4WF2A 5IY5H 3CUQB 4HLXA 1DQUA 2YU9J 2ELHA 3N97A 1MNMC 3A4CA 2M30A 1IW7F 1OYIA 2DT6A 3J7YJ 2X85A 5TRDA 4BXXJ 3RKYA 4P55A 3SHFA 4ZZLA 3T8TA 3IP4B 1MZBA 1JUPA 4BJ5C 3WTXC 4MGRA 3A2KA 1T95A 5TGTA 2R92J 2XDVA 1O3RA 1Q1HA 3QYFA 4BE2A 3SZGA 4Y17A 5E79C 1IZ1A 3C2GA 5EDNA 3H1CA 3CO6C 3BPVA 2QA4I 3Q5FA 3WE3A 2DU9A 2KMUA 3KCCA 3W6VA 1SANA 1OFCX 1YJNI 3P9IA 3A01B 4KMFA 5C3EJ 2EFNA 4HF1A 2OA4A 4KFCA 3OMYA 1O7LA 3AG1H 2CUFA 2VXDA 2E36A 2HKXA 1XSXA 2CQXA 1RR7A 4C2MJ 4IHSA 2ECBA 1W1WE 3FM3A 5BMZA 2NVXJ 4LOCA 2R5YB 1REPC 5K7ZA 4RM3A 2IVMA 4BBSJ 4ENMA 1SFOJ 3JREA 2XUBA 4C2TA 3HXLA 3PM1A 4XOTA 5B1AH 2BEOA 2KRHA 3V8LA 4OIPF 5L3FA 3IWZA 3LA7A 1YIOA 3PNYA 4HQMA 4W97A 3R60A 5GAHJ 2CW8A 3QWLA 3QPTA 3S3OA 2EV5A 2XB0X 2X6WA 2K4BA 4XM3A 2K5CA 5CYVA 1SD5A 1ZARA 1H0MA 1FOXA 2IA2A 3FMQA 1DGWY 3OYIA 2AHQA 2E7WA 1OKRA 1MDMA 2O7OA 1YW8A 1WHUA 4QWQA 4ZTFA 2EILH 2QQAA 2VT2A 4FQGA 3OY9A 3HL2A 2HZDA 3SEZA 4C2UA 3M8EA 3K0LA 1BBYA 1P4WA 5DD4A 3OYKA 1YRNA 1X1PA 3I59B 3TEDA 2WB1A 3BG9A 4A3IJ 3LSHA 3GEZA 3HKZN 3HB9A 4LGWA 2ZNZA 2EIJH 2R7TA 2CSOA 2A3SA 3P7NA 1WSUA 3OYGA 1UB9A 2IRFG 1R7JA 1PUFB 2EZIA 3DEEA 1RUNA 2JA8J 3ECHA 2DMNA 2VBXA 3NAUA 3ASNH 2CWEA 4KDPA 1Z3XA 3OYNA 2Y0SA 2ZBKA 3ABTA 3IRRA 1VQNI 4FISA 2A68F 2H1KA 1OMIA 5FD6A 4NC6A 1HC8A 3WTVC 5L3EA 3DWLE 4WXCA 3SDBA 1T0FC 1F36A 3E7LA 4ZYAA 4KYWA 4N4OB 2Y31A 2VKVA 4ZDLA 2CUJA 3A0BC 4E7JA 2D45A 5GPAA 3GMEA 4ZYDA 2L54A 3WHBA 1QPIA 1ZH5A 3K4MA 2DA4A 3GZ5A 1ZGWA 1F5TA 4BL0B 2E1MC 4AIHA 5E8IA 4IXAA 3QP5A 4RB3C 3TMOA 1KA8A 1ZG1A 3L09A 4Q47A 4E7HA 2CQ7A 2CV0A 4RGSA 4IOAF 2P6TA 2H27A 4F92B 1FTZA 2LYCA 3HGGA 3IC7A 4B48A 4NHJA 4M6XA 3F8CA 2PN6A 1SD6A 2D1VA 3FBNB 3CCJI 1HW1A 3HKZA 2XPVA 2HPMA 1I6XA 2XKPA 4XKVA 1N25A 3HM5A 4FE4A 2DMQA 4MO7A 2G7HA 2F48A 1LVKA 3M3YJ 2EFWA 6PAXA 2L2OA 3M1EA 3RPUA 2A5WA 2EBIA 4D0PA 2NS0A 3MKWB 1SVLA 3KYDB 1FBSA 4XKCA 2CW0F 4I0AA 2P7VB 2Y75A 1XMXA 3RI4A 3WTTC 1YRNB 2B63J 3OS1A 3JRIA 1FZPB 3T1BA 5D4SA 1D1BA 4FCYA 2W85A 3H3UA 2P81A 4XN3A 4I09A 4HEA2 1IN5A 2Z1DA 4FETA 4L9TA 3F22A 3OYAA 4YELA 3G3ZA 3I4PA 4XR6A 5ILUA 1K4TA 2LBFA 4XSZF 1VQ4I 4II3A 1U6GA 3TBIA 1LFPA 2LTPA 4CICA 4UNOA 2DK8A 3BPXA 3CLQA 2ZXWH 3CP2A 1RC9A 2I10A 4PDKA 3HG9A 4MLOA 4KN7X 3FXJA 5LEJA 3R61A 2K3PA 4RBOA 5EG0B 4GRIA 4BHPA 3WG9A 1TWHJ 4BJTA 3RYRA 3K1NA 3IWFA 1Y1VJ 5HLGA 4NUBA 2B9SA 4MTEA 3HOXJ 4BEHA 4BU2A 2Y48A 3K1MA 3TO9A 1QO0D 3MMYB 4XKBA 3CZ6A 2VIXA 4OINF 1VQMI 1G59A 2JTVA 1KYWA 3MQ0A 1MH4A 5AONA 2EH3A 2K9LA 2IS6A 4M9XA 1XSDA 1FYLA 5IPAA 1YG2A 4M71A 4UV9A 1FC3A 4G9YA 2XRLA 2MYSA 1V5EA 3J7ZI 2OTLI 4IQJA 3DBRB 2M3AA 1D8JA 4XRMA 4H0EA 2ID6A 2JSCA 4UUSB 1VQ8I 3HHGA 2HOTA 5C4XJ 3CMAI 3PFYA 1HCRA 2HVQA 3H0GJ 1Z7UA 3F21A 1QA6A 2XF5A 1Q1VA 1A6QA 2KIMA 5E1ZB 4B47A 3K2AA 1ITYA 3AG2H 1YW7A 4BACA 2XKOA 2PJPA 1P4XA 3ZGKA 3K70C 1JHFA 1JGSA 1BOBA 3GTPJ 1ZAOA 2H1LA 1YO5C 3DEWA 3ERMA 2RKHA 2P6SA 2XHKA 5J6XA 5KHDA 4AIKA 4V2GA 3EQLF 3ZQ7A 5DM7F 1JHHA 3AL0C 4ESFA 2GXGA 4M3FA 2YUSA 5JHUA 4MNUA 3OYJA 1QZEA 2HEOA 4CZZA 2L01A 4RGRA 2CG4A 5HODA 2KZGA 2LREA 2PMZA 1KU9A 1X1BA 3VODA 4IRGA 1G2HA 2LF7A 3RKXA 5DD8A 3DTIA 3S3MA 2LDUA 2EZHA 2WA0A 3EPZA 5F0CA 3C1DA 2CMPA 2OCCH 1OR7C 4BKXA 1O7FA 3BP8A 2ZMEA 3L2UA 4JX4A 4AVPA 1VFCA 1KU7A 4B3AA 2BZTA 3M9AA 4MEYF 3DEUA 5TJJA 2DFEA 3SEQA 3TDZC 1O3QA 3LAJA 2V1UA 2L4MA 3BC8A 3HEFA 3PQKA 5H6RA 1LUJB 3MZ8A 5HDKA 1MMAA 5FLMJ 3CJTB 2F2EA 4PCQA 3WGGA 1D0YA 2QQBA 5HS8A 2L7MP 4L18B 3DFGA 5CPRB 1YS6A 2F5CA 2VQLA 4HSTA 3TP3A 2MC3A 1K7AA 4LG0B 3JSPA 3F6OA 3BY6A 3VEPA 1FMWA 1DP7P 1WJDA 1SMYF 2NS7A 5E3NA 1U5TA 5CJ9A 4LLNA 2VQHA 4NDLA 3CMEI 4RLQA 3QOPA 4GCVA 3VYUB 1MD0A 2F4OB 3WTSC 2CW7A 4BH9A 4GYGA 2DT7B 2LFBA 4IHWA 1WKMA 1ULYA 2IGMA 3WTUC 3COAC 3RJPA 5L3DA 4HNUA 3S32A 3VPRA 5J1UA 3K7AJ 2JK3A 5EJCA 2DBBA 3RTRA 3M07A 1I1GA 2HXOA 4XK4A 4WCGA 4HSRA 2VN2A 1X3ZB 2GZWA 2P0WA 2VI6A 2EFOA 2CH0A 3F0CA 1QVUA 3B02A 3D5LA 2XGEA 1BW6A 2V6EA 3ZQQA 3BTIA 4XOPA 2HWVA 1C0WA 1H8AC 3CCRI 4KN4X 1TC3C 3CC4I 3K1PA 1MW7A 3LSKA 3LSGA
chains in the Genus database with same CATH topology
4WXDA 4F7ZA 3ECOA 1DPRA 1HQCA 4BXUA 4S04A 3F8FA 2FE3A 3EETA 3QP6A 2KJBA 3F23A 4WK8F 1HBXG 3IKVA 1GXQA 5DCMA 3BZ6A 1R1TA 2E1NA 1L0OC 4G94A 1HW2A 2FU4A 3U1DA 1S29A 5LHHA 3WGIA 4HDUA 2VOPA 1S7AA 2OQGA 1XD7A 2G9WA 4QLCU 4EV0A 3E6BA 1R22A 4MTDA 4IPAA 1G3YA 5E1XA 4A0ZA 5LRSA 1DUXC 1R1VA 1Z05A 4IVNA 5D6FA 3CUQA 4G6QA 3J81K 2HDCA 1R00A 3Q9VA 1HW5A 5BPDA 1UHWA 3ABUA 2W84A 2HGCA 4G7OF 5CVRA 2QM3A 4UHTA 3B73A 4EJWA 4LB5A 1TQMA 2XROA 3FXQA 4ON0A 2MA3A 2WC2A 3RIRA 1J9IA 5ILSA 2KKOA 5ICEA 3EYIA 2ZJ2A 1WRJA 4NB5A 1SFEA 2FMYA 1BN5A 1HKTA 2A61A 3K2ZA 3CDHA 5HS9A 3CUOA 3I59A 3BWGA 4HLYA 5FFZA 5JVTA 2Z5UA 5FGMA 3H3ZA 1K79A 3RYPA 3KE2A 2EV6A 3GUDA 3WODF 2P5VA 4G8XA 3I54A 1ZREA 2NYXA 2VT3A 3FX3A 5BQTA 4L5IA 2AXLA 4KUMA 3FMRA 3R4KA 1B6AA 2GWRA 4OMYA 5HVQC 1G3TA 3E6CC 1ZGJA 3E6MA 5DCMB 2QQ9A 2ZO4A 5HDGA 1G6NA 2UWMA 2YSRA 1YLFA 1FPQA 3DQVC 5HS7A 3T5XA 5D6EA 2KRFA 2FBKA 2BYVE 3KP3A 2XAQA 2PMUA 1J75A 1DPUA 1R5HA 1XB4A 5ERIA 1LDJA 3R0JA 4OIRF 4M72A 2QBYA 3BDDA 4PZJA 1EH6A 4S05A 2O03A 5DUIA 1TLHB 4UXNA 1FT9A 1TW2A 3C3WA 4UVCA 1PDNC 4L9NA 4M9SA 4ESBA 1J59A 1RNLA 4FX0A 3LWFA 2EB7A 3CUQC 1TNTA 2KIFA 3GXOA 2RNJA 3CO7C 2OD5A 4N9HA 5E8GA 3DV8A 1LJ9A 1W5TA 4MEXF 2VBZA 5DV5A 1R58A 3V7CA 3GFLA 5FO5A 4A2UA 2FXAA 3U9GA 3ULQB 5D8KB 3VB2A 3TO6A 2Q8KA 3ELKA 3QAHA 3KFWX 3TOBA 1F4KA 2FBHA 3TDUC 5A2QK 5FD5A 3HUGA 4EJVA 1T98A 2IW5A 2X0LA 3WU1B 4YIFA 5FB2A 2WWYA 4OMZA 1TQPA 1FWZA 1OR7A 4OOIA 1CGPA 4HX8A 2JT1A 2L3DA 1QGPA 2HYFA 2DQRA 5DYMA 1WI9A 4HF0A 2ISYA 4IF4A 3KEQA 2EA4A 3O6BB 3CLOA 5ICCA 3F6VA 5D8LB 2M87A 3ZPLA 2XAJA 3HSFA 1R1UA 2BGCA 2HOEA 5HDNA 3WTYC 2M8EA 1FSEA 4G7HF 2JRTA 4L5JA 5CVUA 1RUOA 2VBWA 4A0YA 2FBIA 1B59A 2RVCA 1W7PA 1LDDA 2A69F 1E17A 4HW0A 1RZ4A 1ZN2A 2UXXA 1HKQA 2RGVA 2JZYA 3ZMDA 2FEZA 2JPCA 1G3WA 4EVIA 5D4RA 1B9NA 3WTZA 2M5WA 3MWMA 4EMSA 5CVVA 3J80Z 2MLKA 1YQAA 3GFMA 2NAZA 4EJUA 3FXRA 4I7HA 2DT5A 1P4AA 3GWZA 3HRTA 1XSVA 2QENA 3GZ6A 2H09A 1KYZA 5E20A 3TKYA 3VOEA 2P8TA 5A2QZ 1QBJA 2MH9A 1BOAA 1PP7U 1UHMA 4HOBA 4B09A 3O3KA 1WQ2A 4GYIA 1TNSA 4CHUA 4ZH4F 1BI1A 1NHAA 5E17F 2Z3YA 1BI3A 2R3SA 4P96A 3I58A 2L4AA 1LEBA 1CF7B 3LFKA 1U5TC 2FNAA 3D0SA 2DAOA 1PUEE 2HZTA 1R36A 2ZFWA 1I5ZA 3K69A 4ASNA 4A0XA 1MJAA 3T8RA 5JFRA 4FX4A 4M6YA 2ADUA 2V79A 2ACJA 5BS6A 1SAXA 4CO8A 1IF1A 2RQPA 4MQ9F 3WE2A 1YYVA 4RGUA 1S6LA 2OZ6A 1QZZA 2DI3A 2PMHA 4XRFA 5L3GA 4YIIA 2JPBA 4HX4A 1XGMA 3EUHA 1BC7C 3C18A 1U5TB 3KETA 3GO5A 4LB6B 3F8NA 4KT5C 1FBQA 2XGXA 1GVJA 3ZN1A 4IJAA 1W7PD 2YR2A 2ZCWA 1KQ9A 4KMUX 4EM2A 2PFBA 1ZRCA 3LSTA 1YW9A 3GFJA 5J8CA 1CF7A 5ILVA 2A5YB 3VFZA 3L7WA 2FA5A 1AOYA 5BOXA 2RC4A 2FSWA 1S3JA 3ZP5A 4HV5A 4IRIA 3N4MA 3GW2A 1W7PB 5HLIA 5ICGA 1Z6TA 3REOA 1W4MA 4CXFA 4HYEA 5LEKA 2STTA 3Q9SA 1WWXA 1SD4A 5F1RA 1Y0UA 4GGGA 1FP2A 2OZUA 3AAFA 4MQVA 3JW4A 3E3VA 1A04A 4JBAA 2XAGA 1U2WA 5H20A 5K5QA 3KP6A 3CJNA 4N0BA 3LQQA 4M9ZA 4K2EA 2CQKA 2CYYA 1USSA 2BE5F 1U3EM 2XVCA 1R23A 1KGSA 1F9NA 3I71A 4R1HA 4HAMA 3OV8A 3RKWA 4N9IA 3MEXA 1SFUA 4HDVA 2HTJA 4I2OA 3F72A 5FLXK 4I01A 2DQLA 5J8FA 3MCZA 1D3YA 3M7GA 1ON1A 1LVAA 2GA2A 2VODA 3HRMA 3SFZA 3HRUA 3V8JA 3I0TA 1FLIA 2F5FA 1R5GA 3BROA 2VE8A 2HS5A 2QUFA 2GQQA 2IA1A 1RIOH 2B0LA 5H6QA 2STWA 2ZMEB 4IHTA 2O0YA 1HXDA 2EK5A 1X3UA 4FT8A 4XBFA 1J5YA 3KEOA 5CLSA 1QZYA 2HQNA 5EEGA 3F3XA 5LHIA 5HLHA 2PLYA 1J0RA 1EV7A 2RDPA 1FBUA 4CDGA 1T39A 2UXNA 3V8KA 1FY7A 2EWNA 2R7FA 2ESNA 3IL2A 1ZG3A 2E1CA 2BBYA 4PGGA 4P9UA 2OAZA 1H9TA 3T0YA 2PEXA 2WTEA 1B1BA 1XCVA 2FMLA 3ZN0A 2ZXJA 4Z2YA 1D5VA 4HF2A 3ROUA 3QU3A 2H94A 4KNYA 1MDMB 5CVIA 4XLNF 4WWCA 1ZYRF 1S7OA 1L3LA 2IT0A 3H92A 5AIQA 1IRFA 3KZYA 1IRGA 3DP7A 2WV0A 3EDPA 4LD5A 5FLXZ 1QPMA 3HIFA 5KK1A 1E2XA 3IRQA 4ZYEA 4KIBA 1XDSA 5KVRA 1ON2A 2LNBA 1FP1D 2GAUA 2ZNYA 5D5UB 1VTNC 1T2KA 2CO5A 3ZMZA 5JR3A 2V1XA 4I02A 2VC0A 4LK1F 3MFKA 1XMAA 2VBYA 4YFNF 4ZZDA 1K6OA 1LQ1A 4I98B 4LK0F 4RB2C 4KA4A 1G4DA 4E70A 2OQRA 4PGHA 2QBYB 5ED4A 4R8HA 1IN4A 3HTSB 3GVAA 2K02A 3FMSA 3LA2A 1EH7A 1J2XA 2O6GE 5DDGA 3NQOA 1IAWA 5LLQA 3I64A 1JE8A 1TBXA 4U0VA 4EJTA 4BHBA 2MD5A 3L00A 4LMYA 2HFHA 2K7LA 2ESHA 2G7UA 4OU0A 3SZPA 4AIJA 3WU0A 1DDNA 4BAYA 4Q4ZF 2TDXA 4YG2F 4HX7A 3DPTA 2FNPA 3IKTA 4RGXA 2IA0A 2R7DA 2O8XA 2QWWA 4RS8A 1YFHA 2ETHA 3SXYA 3MAJA 3TOAA 2PQ8A 1IN7A 3DPLC 3FF5A 4O5VA 3ISPA 4RAYA 1FNNA 5D5VB 2X4HA 2D1HA 1UFMA 3QPHA 4U0WA 4HA8A 3J80K 1B9MA 1GXPA 5DUKA 4ENNA 1V3FA 1JXSA 2V1DA 2K86A 1T6SA 1I27A 2EV0A 1BIAA 1SD7A 3E5QA 5L3CA 3ERED 1ZLJA 3F8MA 5E18F 2QLZA 3CTAA 3K9TA 2VOOA 2OBPA 2Q2EA 3W6JB 5LGNA 1ODDA 3KP2A 1Z1DA 2CGPA 4GXOA 2W25A 3V4GA 4R79A 4P5OA 5D5XB 1BC8C 3DF8A 1P2FA 4LFUA 2H6BA 3S2WA 2LSOA 4U88A 3QU6A 2P4WA 2M1BA 2LF8A 1FYMA 3KLOA 1ZRDA 2Z9OA 1V4RA 1FX7A 1OYYA 4ENKA 1P92A 3HRSA 3P9KA 2FQ3A 4KIFA 3HSRA 3I53A 1QNTA 2EFPA 3GF2A 1KQ0A 2W24A 4NQWA 2K27A 2XRNA 3PQJA 1SMTA 3KZZA 4UV8A 3ZMVA 5DEQA 4CGZA 4A5MA 4O3MA 2KJCA 3JTHA 5IT9K 4EGYA 5EEHA 2P5KA 1BM9A 4A5NA 4AD9A 2P5LC 3TO7A 4BNCA 1KU2A 4DNCA 3BJ6A 2HTSA 4YFKF 4TV7A 1KQ8A 3KP4A 1TQIA 2VONA 2Q0OA 1F1ZA 4Y15A 1LB2A 1FOKA 5D5WB 3TGNA 3W6KB 1QQIA 2VC1A 3BJOA 4Q48A 1ZHFA 1FYKA 2XASA 1BI0A 2GA1A 5ICFA 3WGHA 5FFXA 2Z33A 3NRVA 5LGTA 1IN6A 2NNNA 4HZFA 5K5OA 3JTGA 2PG4A 4OIQF 2LKPA 2O3FA 3MZYA 3JSOA 1BIBA 1H9GA 1MJ9A 4FHTA 2PI0A 3IHUA 4HBLA 3HOSA 3OOPA 2AS5F 1MGTA 3V7SA 1ZLKA 1U8RA 3KLNA 2HQRA 1BJAA 4IRHA 4LJZF 2Y0MA 1AWCA 4EJOA 2QZ8A 3BOQA 5IT3A 1IXCA 4L0YB 4M73A 3ZMUA 4EM1A 5F64A 4U7DA 2KIUA 3WTWC 5IT9Z 2L02A 3F8BA 4EQQA 2XAFA 2COMA 2DFIA 2MBFA 3EYYA 4EM0B 1XDUA 4ZYGA 4LG0A 1ZRFA 5F6FA 2V6CA 1Z6RA 4EGZA 3V7RA 2PBIA 2HR3A 1OPCA 3ZMSA 1XGSA 3MZHA 1P6RA 2DTRA 2Z99A 1HKSA 2XAHA 4CYDA 2EFQA 1PP8F 2J5PA 4AWXB 3HTUA 2HKOA 1HSTA 2FRHA 3ZMTA 3J7AO 4HQEA 5K5RA 4G6DA 3NEUA 2FOKA 5LGUA 2W57A 3FZVA 3JAMZ 1O3SA 3J81Z 3E6DA 5E1WA 4O6JA 1GHCA 1TW3A 1T38A 4B8XA 1LEAA 2D2WA 1HSJA 3FM5A 1XMKA 1U78A 1MKMA 2YX7A 4GO1A 4ZYHA 2MLGA 4ETSA 5BPIA 3LAPA 2GIVA 3G73A 5L3BA 2DPDA 4RB1A 1KU3A 3E5UA 3HHHA 2FF4A 4BQAA 4OIOF 3I5UA 3KP7A 4KICA 1STZA 3E97A 3BJAA 3R0AA 4ESJA 2J5OA 3FWEA 1XCBA 4WX9A 3SZTA 3DXJF 3O2PE 2IJLA 4I0BA 4HV6A 3JAMK 2UZKA 2XV4S 1S8NA 3PFIA 2OU2A 4G7ZF 4XSXF 4WXHA 1Z9CA 2M45A 2VXZA 1LNWA 4JQFA 3L2CA 1Z91A 3L9FA 3HYIA 3RDIA 4M74A 4L9JA 1O3TA 3RPQA 3GLXA 1XGNA 1RI7A 4L9VA 4JK1X 2DO7A 4U0YA 5K1YA 5LBQA 3GX4X 1I1SA 2IP2A 2IPQX 1EH8A 1SFXA 2DK5A 4UVAA 1BI2A 3HSEA 3TQNA 4U7BA 4DQ2A 2ISZA 4MHGA 1XGOA 1OYWA 5LHGA 1IN8A 1FSHA 3GFIA 4L0ZB 4LLLA 1IXSB 2V9VA 3R6SA 3FHZA 2K4JA 4BYYA 2CFXA 5JI6A 1IXRC 2XIGA 3M8FA 1UCRA 4LLGF 3FXUA 3HOTA 2VE9A 2A6EF 4P9FA 1MJBA 3DKWA 4UVBA 5LRRA 4RAZA 1D8KA 2O61A 5CVJA 1LDKB 2NRAC 2MH2A 3ML6A 2ZKZA 2RV8A 2EJRA 2C6YA 2YU3A 3GYHX 1TTYA 4YFXF 2RN7A 2E7XA 1B4AA 4UUVA 3KP5A 2DW4A 4Y13A 1USTA 4Q5SF 2P7CB 2EA2A 1O57A 2YPRA 2NNYA 1XN7A 3LA3A 2F5EA 1K78B 2F5DA 2HYGD 3QRFF 4A6DA 2DLLA 2A6HF 2BV6A 1ZG5A 2A07F 2QYOA 5DCFA 1IUYA 1G3SA 2QVOA 3E5XA 1YTYA 1J7KA 2H6CA 3U2RA 1YS7A 3SQNA 2GXBA 4RB0A 3LQRA 1ONVA 5AIPA 3P9CA 5HOOA 1K78A 4XLPF 4KIGA 2YX4A 1T0FA 1ZGAA 4A12A 4BHCA 4A6EA 2DPUA 3C7JA 1W5SA 4ENJA 4WF2A 3CUQB 4HLXA 2ELHA 3N97A 2M30A 1IW7F 1OYIA 5TRDA 3RKYA 4P55A 3SHFA 4ZZLA 3T8TA 1MZBA 3WTXC 4MGRA 1O3RA 1Q1HA 4Y17A 1IZ1A 3CO6C 3BPVA 3Q5FA 3WE3A 2DU9A 3KCCA 3P9IA 4KMFA 2EFNA 4HF1A 2OA4A 4KFCA 1O7LA 2HKXA 1XSXA 4IHSA 3FM3A 5BMZA 1REPC 2IVMA 4ENMA 2XUBA 2BEOA 3V8LA 4OIPF 5L3FA 3IWZA 3LA7A 1YIOA 4HQMA 3R60A 3QPTA 2EV5A 5CYVA 1H0MA 2K4BA 1SD5A 1ZARA 2IA2A 3FMQA 2E7WA 1OKRA 1MDMA 1YW8A 4QWQA 2QQAA 2VT2A 3M8EA 3K0LA 1BBYA 1P4WA 5DD4A 3I59B 3GEZA 4LGWA 2ZNZA 2CSOA 2A3SA 3P7NA 1WSUA 1UB9A 2IRFG 1R7JA 1RUNA 3ECHA 2VBXA 2CWEA 4KDPA 2ZBKA 3ABTA 3IRRA 2A68F 1OMIA 5FD6A 3WTVC 5L3EA 4WXCA 4KYWA 2D45A 4ZYDA 2L54A 1ZH5A 3GZ5A 1F5TA 5E8IA 4AIHA 4IXAA 3QP5A 4RB3C 1KA8A 1ZG1A 3L09A 4Q47A 4RGSA 2P6TA 2H27A 3IC7A 4NHJA 4M6XA 3F8CA 2PN6A 1SD6A 2D1VA 1HW1A 1I6XA 2XKPA 2G7HA 2EFWA 6PAXA 3M1EA 3RPUA 4D0PA 2NS0A 1FBSA 2CW0F 4I0AA 2P7VB 2Y75A 3RI4A 3WTTC 1FZPB 3T1BA 5D4SA 2W85A 3H3UA 4I09A 4L9TA 1IN5A 3F22A 3G3ZA 3I4PA 5ILUA 4XSZF 1U6GA 4CICA 4UNOA 2DK8A 3BPXA 4PDKA 4KN7X 5LEJA 3R61A 4BHPA 3WG9A 3RYRA 3K1NA 3IWFA 5HLGA 4MTEA 2Y48A 3K1MA 3TO9A 1QO0D 4OINF 2JTVA 1KYWA 3MQ0A 5AONA 1FYLA 4M9XA 1XSDA 1YG2A 4M71A 4UV9A 1FC3A 4G9YA 1D8JA 4H0EA 2JSCA 3HHGA 1Z7UA 3F21A 2KIMA 5E1ZB 1YW7A 2PJPA 2XKOA 1P4XA 1JHFA 1JGSA 1ZAOA 1YO5C 2RKHA 2P6SA 2XHKA 5J6XA 4AIKA 3ZQ7A 3EQLF 1JHHA 4ESFA 2GXGA 5JHUA 4MNUA 2HEOA 4CZZA 2L01A 4RGRA 2CG4A 3VODA 1KU9A 4IRGA 2LF7A 3RKXA 5DD8A 2LDUA 3C1DA 1O7FA 3BP8A 2ZMEA 4AVPA 1KU7A 3M9AA 4MEYF 3DEUA 5TJJA 3TDZC 1O3QA 3LAJA 2V1UA 2L4MA 3PQKA 5H6RA 5HDKA 2F2EA 4PCQA 3WGGA 2QQBA 5HS8A 4L18B 3DFGA 1YS6A 2F5CA 2MC3A 1K7AA 4LG0B 3JSPA 3F6OA 3BY6A 1DP7P 3VEPA 1SMYF 1U5TA 5CJ9A 4LLNA 3QOPA 4GCVA 1MD0A 3WTSC 4BH9A 4GYGA 1WKMA 1ULYA 3WTUC 3COAC 3RJPA 5L3DA 2DBBA 3RTRA 1I1GA 4WCGA 2VN2A 2GZWA 2EFOA 3B02A 3D5LA 2HWVA 1C0WA 4KN4X 3K1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WXD A;  4F7Z A;  3ECO A;  1DPR A;  1HQC A;  4BXU A;  4S04 A;  3F8F A;  2FE3 A;  3EET A;  3QP6 A;  2KJB A;  3F23 A;  4WK8 F;  1HBX G;  3IKV A;  1GXQ A;  5DCM A;  3BZ6 A;  1R1T A;  2E1N A;  1L0O C;  4G94 A;  1HW2 A;  2FU4 A;  3U1D A;  1S29 A;  5LHH A;  3WGI A;  4HDU A;  2VOP A;  1S7A A;  2OQG A;  1XD7 A;  2G9W A;  4QLC U;  4EV0 A;  3E6B A;  1R22 A;  4MTD A;  4IPA A;  1G3Y A;  5E1X A;  4A0Z A;  5LRS A;  1DUX C;  1R1V A;  1Z05 A;  4IVN A;  5D6F A;  3CUQ A;  4G6Q A;  3J81 K;  2HDC A;  1R00 A;  3Q9V A;  1HW5 A;  5BPD A;  1UHW A;  3ABU A;  2W84 A;  2HGC A;  4G7O F;  5CVR A;  2QM3 A;  4UHT A;  3B73 A;  4EJW A;  4LB5 A;  1TQM A;  2XRO A;  3FXQ A;  4ON0 A;  2MA3 A;  2WC2 A;  3RIR A;  1J9I A;  5ILS A;  2KKO A;  5ICE A;  3EYI A;  2ZJ2 A;  1WRJ A;  4NB5 A;  1SFE A;  2FMY A;  1BN5 A;  1HKT A;  2A61 A;  3K2Z A;  3CDH A;  5HS9 A;  3CUO A;  3I59 A;  3BWG A;  4HLY A;  5FFZ A;  5JVT A;  2Z5U A;  5FGM A;  3H3Z A;  1K79 A;  3RYP A;  3KE2 A;  2EV6 A;  3GUD A;  3WOD F;  2P5V A;  4G8X A;  3I54 A;  1ZRE A;  2NYX A;  2VT3 A;  3FX3 A;  5BQT A;  4L5I A;  2AXL A;  4KUM A;  3FMR A;  3R4K A;  1B6A A;  2GWR A;  4OMY A;  5HVQ C;  1G3T A;  3E6C C;  1ZGJ A;  3E6M A;  5DCM B;  2QQ9 A;  2ZO4 A;  5HDG A;  1G6N A;  2UWM A;  2YSR A;  1YLF A;  1FPQ A;  3DQV C;  5HS7 A;  3T5X A;  5D6E A;  2KRF A;  2FBK A;  2BYV E;  3KP3 A;  2XAQ A;  2PMU A;  1J75 A;  1DPU A;  1R5H A;  1XB4 A;  5ERI A;  1LDJ A;  3R0J A;  4OIR F;  4M72 A;  2QBY A;  3BDD A;  4PZJ A;  1EH6 A;  4S05 A;  2O03 A;  5DUI A;  1TLH B;  4UXN A;  1FT9 A;  1TW2 A;  3C3W A;  4UVC A;  1PDN C;  4L9N A;  4M9S A;  4ESB A;  1J59 A;  1RNL A;  4FX0 A;  3LWF A;  2EB7 A;  3CUQ C;  1TNT A;  2KIF A;  3GXO A;  2RNJ A;  3CO7 C;  2OD5 A;  4N9H A;  5E8G A;  3DV8 A;  1LJ9 A;  1W5T A;  4MEX F;  2VBZ A;  5DV5 A;  1R58 A;  3V7C A;  3GFL A;  5FO5 A;  4A2U A;  2FXA A;  3U9G A;  3ULQ B;  5D8K B;  3VB2 A;  3TO6 A;  2Q8K A;  3ELK A;  3QAH A;  3KFW X;  3TOB A;  1F4K A;  2FBH A;  3TDU C;  5A2Q K;  5FD5 A;  3HUG A;  4EJV A;  1T98 A;  2IW5 A;  2X0L A;  3WU1 B;  4YIF A;  5FB2 A;  2WWY A;  4OMZ A;  1TQP A;  1FWZ A;  1OR7 A;  4OOI A;  1CGP A;  4HX8 A;  2JT1 A;  2L3D A;  1QGP A;  2HYF A;  2DQR A;  5DYM A;  1WI9 A;  4HF0 A;  2ISY A;  4IF4 A;  3KEQ A;  2EA4 A;  3O6B B;  3CLO A;  5ICC A;  3F6V A;  5D8L B;  2M87 A;  3ZPL A;  2XAJ A;  3HSF A;  1R1U A;  2BGC A;  2HOE A;  5HDN A;  3WTY C;  2M8E A;  1FSE A;  4G7H F;  2JRT A;  4L5J A;  5CVU A;  1RUO A;  2VBW A;  4A0Y A;  2FBI A;  1B59 A;  2RVC A;  1W7P A;  1LDD A;  2A69 F;  1E17 A;  4HW0 A;  1RZ4 A;  1ZN2 A;  2UXX A;  1HKQ A;  2RGV A;  2JZY A;  3ZMD A;  2FEZ A;  2JPC A;  1G3W A;  4EVI A;  5D4R A;  1B9N A;  3WTZ A;  2M5W A;  3MWM A;  4EMS A;  5CVV A;  3J80 Z;  2MLK A;  1YQA A;  3GFM A;  2NAZ A;  4EJU A;  3FXR A;  4I7H A;  2DT5 A;  1P4A A;  3GWZ A;  3HRT A;  1XSV A;  2QEN A;  3GZ6 A;  2H09 A;  1KYZ A;  5E20 A;  3TKY A;  3VOE A;  2P8T A;  5A2Q Z;  1QBJ A;  2MH9 A;  1BOA A;  1PP7 U;  1UHM A;  4HOB A;  4B09 A;  3O3K A;  1WQ2 A;  4GYI A;  1TNS A;  4CHU A;  4ZH4 F;  1BI1 A;  1NHA A;  5E17 F;  2Z3Y A;  1BI3 A;  2R3S A;  4P96 A;  3I58 A;  2L4A A;  1LEB A;  1CF7 B;  3LFK A;  1U5T C;  2FNA A;  3D0S A;  2DAO A;  1PUE E;  2HZT A;  1R36 A;  2ZFW A;  1I5Z A;  3K69 A;  4ASN A;  4A0X A;  1MJA A;  3T8R A;  5JFR A;  4FX4 A;  4M6Y A;  2ADU A;  2V79 A;  2ACJ A;  5BS6 A;  1SAX A;  4CO8 A;  1IF1 A;  2RQP A;  4MQ9 F;  3WE2 A;  1YYV A;  4RGU A;  1S6L A;  2OZ6 A;  1QZZ A;  2DI3 A;  2PMH A;  4XRF A;  5L3G A;  4YII A;  2JPB A;  4HX4 A;  1XGM A;  3EUH A;  1BC7 C;  3C18 A;  1U5T B;  3KET A;  3GO5 A;  4LB6 B;  3F8N A;  4KT5 C;  1FBQ A;  2XGX A;  1GVJ A;  3ZN1 A;  4IJA A;  1W7P D;  2YR2 A;  2ZCW A;  1KQ9 A;  4KMU X;  4EM2 A;  2PFB A;  1ZRC A;  3LST A;  1YW9 A;  3GFJ A;  5J8C A;  1CF7 A;  5ILV A;  2A5Y B;  3VFZ A;  3L7W A;  2FA5 A;  1AOY A;  5BOX A;  2RC4 A;  2FSW A;  1S3J A;  3ZP5 A;  4HV5 A;  4IRI A;  3N4M A;  3GW2 A;  1W7P B;  5HLI A;  5ICG A;  1Z6T A;  3REO A;  1W4M A;  4CXF A;  4HYE A;  5LEK A;  2STT A;  3Q9S A;  1WWX A;  1SD4 A;  5F1R A;  1Y0U A;  4GGG A;  1FP2 A;  2OZU A;  3AAF A;  4MQV A;  3JW4 A;  3E3V A;  1A04 A;  4JBA A;  2XAG A;  1U2W A;  5H20 A;  5K5Q A;  3KP6 A;  3CJN A;  4N0B A;  3LQQ A;  4M9Z A;  4K2E A;  2CQK A;  2CYY A;  1USS A;  2BE5 F;  1U3E M;  2XVC A;  1R23 A;  1KGS A;  1F9N A;  3I71 A;  4R1H A;  4HAM A;  3OV8 A;  3RKW A;  4N9I A;  3MEX A;  1SFU A;  4HDV A;  2HTJ A;  4I2O A;  3F72 A;  5FLX K;  4I01 A;  2DQL A;  5J8F A;  3MCZ A;  1D3Y A;  3M7G A;  1ON1 A;  1LVA A;  2GA2 A;  2VOD A;  3HRM A;  3SFZ A;  3HRU A;  3V8J A;  3I0T A;  1FLI A;  2F5F A;  1R5G A;  3BRO A;  2VE8 A;  2HS5 A;  2QUF A;  2GQQ A;  2IA1 A;  1RIO H;  2B0L A;  5H6Q A;  2STW A;  2ZME B;  4IHT A;  2O0Y A;  1HXD A;  2EK5 A;  1X3U A;  4FT8 A;  4XBF A;  1J5Y A;  3KEO A;  5CLS A;  1QZY A;  2HQN A;  5EEG A;  3F3X A;  5LHI A;  5HLH A;  2PLY A;  1J0R A;  1EV7 A;  2RDP A;  1FBU A;  4CDG A;  1T39 A;  2UXN A;  3V8K A;  1FY7 A;  2EWN A;  2R7F A;  2ESN A;  3IL2 A;  1ZG3 A;  2E1C A;  2BBY A;  4PGG A;  4P9U A;  2OAZ A;  1H9T A;  3T0Y A;  2PEX A;  2WTE A;  1B1B A;  1XCV A;  2FML A;  3ZN0 A;  2ZXJ A;  4Z2Y A;  1D5V A;  4HF2 A;  3ROU A;  3QU3 A;  2H94 A;  4KNY A;  1MDM B;  5CVI A;  4XLN F;  4WWC A;  1ZYR F;  1S7O A;  1L3L A;  2IT0 A;  3H92 A;  5AIQ A;  1IRF A;  3KZY A;  1IRG A;  3DP7 A;  2WV0 A;  3EDP A;  4LD5 A;  5FLX Z;  1QPM A;  3HIF A;  5KK1 A;  1E2X A;  3IRQ A;  4ZYE A;  4KIB A;  1XDS A;  5KVR A;  1ON2 A;  2LNB A;  1FP1 D;  2GAU A;  2ZNY A;  5D5U B;  1VTN C;  1T2K A;  2CO5 A;  3ZMZ A;  5JR3 A;  2V1X A;  4I02 A;  2VC0 A;  4LK1 F;  3MFK A;  1XMA A;  2VBY A;  4YFN F;  4ZZD A;  1K6O A;  1LQ1 A;  4I98 B;  4LK0 F;  4RB2 C;  4KA4 A;  1G4D A;  4E70 A;  2OQR A;  4PGH A;  2QBY B;  5ED4 A;  4R8H A;  1IN4 A;  3HTS B;  3GVA A;  2K02 A;  3FMS A;  3LA2 A;  1EH7 A;  1J2X A;  2O6G E;  5DDG A;  3NQO A;  1IAW A;  5LLQ A;  3I64 A;  1JE8 A;  1TBX A;  4U0V A;  4EJT A;  4BHB A;  2MD5 A;  3L00 A;  4LMY A;  2HFH A;  2K7L A;  2ESH A;  2G7U A;  4OU0 A;  3SZP A;  4AIJ A;  3WU0 A;  1DDN A;  4BAY A;  4Q4Z F;  2TDX A;  4YG2 F;  4HX7 A;  3DPT A;  2FNP A;  3IKT A;  4RGX A;  2IA0 A;  2R7D A;  2O8X A;  2QWW A;  4RS8 A;  1YFH A;  2ETH A;  3SXY A;  3MAJ A;  3TOA A;  2PQ8 A;  1IN7 A;  3DPL C;  3FF5 A;  4O5V A;  3ISP A;  4RAY A;  1FNN A;  5D5V B;  2X4H A;  2D1H A;  1UFM A;  3QPH A;  4U0W A;  4HA8 A;  3J80 K;  1B9M A;  1GXP A;  5DUK A;  4ENN A;  1V3F A;  1JXS A;  2V1D A;  2K86 A;  1T6S A;  1I27 A;  2EV0 A;  1BIA A;  1SD7 A;  3E5Q A;  5L3C A;  3ERE D;  1ZLJ A;  3F8M A;  5E18 F;  2QLZ A;  3CTA A;  3K9T A;  2VOO A;  2OBP A;  2Q2E A;  3W6J B;  5LGN A;  1ODD A;  3KP2 A;  1Z1D A;  2CGP A;  4GXO A;  2W25 A;  3V4G A;  4R79 A;  4P5O A;  5D5X B;  1BC8 C;  3DF8 A;  1P2F A;  4LFU A;  2H6B A;  3S2W A;  2LSO A;  4U88 A;  3QU6 A;  2P4W A;  2M1B A;  2LF8 A;  1FYM A;  3KLO A;  1ZRD A;  2Z9O A;  1V4R A;  1FX7 A;  1OYY A;  4ENK A;  1P92 A;  3HRS A;  3P9K A;  2FQ3 A;  4KIF A;  3HSR A;  3I53 A;  1QNT A;  2EFP A;  3GF2 A;  1KQ0 A;  2W24 A;  4NQW A;  2K27 A;  2XRN A;  3PQJ A;  1SMT A;  3KZZ A;  4UV8 A;  3ZMV A;  5DEQ A;  4CGZ A;  4A5M A;  4O3M A;  2KJC A;  3JTH A;  5IT9 K;  4EGY A;  5EEH A;  2P5K A;  1BM9 A;  4A5N A;  4AD9 A;  2P5L C;  3TO7 A;  4BNC A;  1KU2 A;  4DNC A;  3BJ6 A;  2HTS A;  4YFK F;  4TV7 A;  1KQ8 A;  3KP4 A;  1TQI A;  2VON A;  2Q0O A;  1F1Z A;  4Y15 A;  1LB2 A;  1FOK A;  5D5W B;  3TGN A;  3W6K B;  1QQI A;  2VC1 A;  3BJO A;  4Q48 A;  1ZHF A;  1FYK A;  2XAS A;  1BI0 A;  2GA1 A;  5ICF A;  3WGH A;  5FFX A;  2Z33 A;  3NRV A;  5LGT A;  1IN6 A;  2NNN A;  4HZF A;  5K5O A;  3JTG A;  2PG4 A;  4OIQ F;  2LKP A;  2O3F A;  3MZY A;  3JSO A;  1BIB A;  1H9G A;  1MJ9 A;  4FHT A;  2PI0 A;  3IHU A;  4HBL A;  3HOS A;  3OOP A;  2AS5 F;  1MGT A;  3V7S A;  1ZLK A;  1U8R A;  3KLN A;  2HQR A;  1BJA A;  4IRH A;  4LJZ F;  2Y0M A;  1AWC A;  4EJO A;  2QZ8 A;  3BOQ A;  5IT3 A;  1IXC A;  4L0Y B;  4M73 A;  3ZMU A;  4EM1 A;  5F64 A;  4U7D A;  2KIU A;  3WTW C;  5IT9 Z;  2L02 A;  3F8B A;  4EQQ A;  2XAF A;  2COM A;  2DFI A;  2MBF A;  3EYY A;  4EM0 B;  1XDU A;  4ZYG A;  4LG0 A;  1ZRF A;  5F6F A;  2V6C A;  1Z6R A;  4EGZ A;  3V7R A;  2PBI A;  2HR3 A;  1OPC A;  3ZMS A;  1XGS A;  3MZH A;  1P6R A;  2DTR A;  2Z99 A;  1HKS A;  2XAH A;  4CYD A;  2EFQ A;  1PP8 F;  2J5P A;  4AWX B;  3HTU A;  2HKO A;  1HST A;  2FRH A;  3ZMT A;  3J7A O;  4HQE A;  5K5R A;  4G6D A;  3NEU A;  2FOK A;  5LGU A;  2W57 A;  3FZV A;  3JAM Z;  1O3S A;  3J81 Z;  3E6D A;  5E1W A;  4O6J A;  1GHC A;  1TW3 A;  1T38 A;  4B8X A;  1LEA A;  2D2W A;  1HSJ A;  3FM5 A;  1XMK A;  1U78 A;  1MKM A;  2YX7 A;  4GO1 A;  4ZYH A;  2MLG A;  4ETS A;  5BPI A;  3LAP A;  2GIV A;  3G73 A;  5L3B A;  2DPD A;  4RB1 A;  1KU3 A;  3E5U A;  3HHH A;  2FF4 A;  4BQA A;  4OIO F;  3I5U A;  3KP7 A;  4KIC A;  1STZ A;  3E97 A;  3BJA A;  3R0A A;  4ESJ A;  2J5O A;  3FWE A;  1XCB A;  4WX9 A;  3SZT A;  3DXJ F;  3O2P E;  2IJL A;  4I0B A;  4HV6 A;  3JAM K;  2UZK A;  2XV4 S;  1S8N A;  3PFI A;  2OU2 A;  4G7Z F;  4XSX F;  4WXH A;  1Z9C A;  2M45 A;  2VXZ A;  1LNW A;  4JQF A;  3L2C A;  1Z91 A;  3L9F A;  3HYI A;  3RDI A;  4M74 A;  4L9J A;  1O3T A;  3RPQ A;  3GLX A;  1XGN A;  1RI7 A;  4L9V A;  4JK1 X;  2DO7 A;  4U0Y A;  5K1Y A;  5LBQ A;  3GX4 X;  1I1S A;  2IP2 A;  2IPQ X;  1EH8 A;  1SFX A;  2DK5 A;  4UVA A;  1BI2 A;  3HSE A;  3TQN A;  4U7B A;  4DQ2 A;  2ISZ A;  4MHG A;  1XGO A;  1OYW A;  5LHG A;  1IN8 A;  1FSH A;  3GFI A;  4L0Z B;  4LLL A;  1IXS B;  2V9V A;  3R6S A;  3FHZ A;  2K4J A;  4BYY A;  2CFX A;  5JI6 A;  1IXR C;  2XIG A;  3M8F A;  1UCR A;  4LLG F;  3FXU A;  3HOT A;  2VE9 A;  2A6E F;  4P9F A;  1MJB A;  3DKW A;  4UVB A;  5LRR A;  4RAZ A;  1D8K A;  2O61 A;  5CVJ A;  1LDK B;  2NRA C;  2MH2 A;  3ML6 A;  2ZKZ A;  2RV8 A;  2EJR A;  2C6Y A;  2YU3 A;  3GYH X;  1TTY A;  4YFX F;  2RN7 A;  2E7X A;  1B4A A;  4UUV A;  3KP5 A;  2DW4 A;  4Y13 A;  1UST A;  4Q5S F;  2P7C B;  2EA2 A;  1O57 A;  2YPR A;  2NNY A;  1XN7 A;  3LA3 A;  2F5E A;  1K78 B;  2F5D A;  2HYG D;  3QRF F;  4A6D A;  2DLL A;  2A6H F;  2BV6 A;  1ZG5 A;  2A07 F;  2QYO A;  5DCF A;  1IUY A;  1G3S A;  2QVO A;  3E5X A;  1YTY A;  1J7K A;  2H6C A;  3U2R A;  1YS7 A;  3SQN A;  2GXB A;  4RB0 A;  3LQR A;  1ONV A;  5AIP A;  3P9C A;  5HOO A;  1K78 A;  4XLP F;  4KIG A;  2YX4 A;  1T0F A;  1ZGA A;  4A12 A;  4BHC A;  4A6E A;  2DPU A;  3C7J A;  1W5S A;  4ENJ A;  4WF2 A;  3CUQ B;  4HLX A;  2ELH A;  3N97 A;  2M30 A;  1IW7 F;  1OYI A;  5TRD A;  3RKY A;  4P55 A;  3SHF A;  4ZZL A;  3T8T A;  1MZB A;  3WTX C;  4MGR A;  1O3R A;  1Q1H A;  4Y17 A;  1IZ1 A;  3CO6 C;  3BPV A;  3Q5F A;  3WE3 A;  2DU9 A;  3KCC A;  3P9I A;  4KMF A;  2EFN A;  4HF1 A;  2OA4 A;  4KFC A;  1O7L A;  2HKX A;  1XSX A;  4IHS A;  3FM3 A;  5BMZ A;  1REP C;  2IVM A;  4ENM A;  2XUB A;  2BEO A;  3V8L A;  4OIP F;  5L3F A;  3IWZ A;  3LA7 A;  1YIO A;  4HQM A;  3R60 A;  3QPT A;  2EV5 A;  5CYV A;  1H0M A;  2K4B A;  1SD5 A;  1ZAR A;  2IA2 A;  3FMQ A;  2E7W A;  1OKR A;  1MDM A;  1YW8 A;  4QWQ A;  2QQA A;  2VT2 A;  3M8E A;  3K0L A;  1BBY A;  1P4W A;  5DD4 A;  3I59 B;  3GEZ A;  4LGW A;  2ZNZ A;  2CSO A;  2A3S A;  3P7N A;  1WSU A;  1UB9 A;  2IRF G;  1R7J A;  1RUN A;  3ECH A;  2VBX A;  2CWE A;  4KDP A;  2ZBK A;  3ABT A;  3IRR A;  2A68 F;  1OMI A;  5FD6 A;  3WTV C;  5L3E A;  4WXC A;  4KYW A;  2D45 A;  4ZYD A;  2L54 A;  1ZH5 A;  3GZ5 A;  1F5T A;  5E8I A;  4AIH A;  4IXA A;  3QP5 A;  4RB3 C;  1KA8 A;  1ZG1 A;  3L09 A;  4Q47 A;  4RGS A;  2P6T A;  2H27 A;  3IC7 A;  4NHJ A;  4M6X A;  3F8C A;  2PN6 A;  1SD6 A;  2D1V A;  1HW1 A;  1I6X A;  2XKP A;  2G7H A;  2EFW A;  6PAX A;  3M1E A;  3RPU A;  4D0P A;  2NS0 A;  1FBS A;  2CW0 F;  4I0A A;  2P7V B;  2Y75 A;  3RI4 A;  3WTT C;  1FZP B;  3T1B A;  5D4S A;  2W85 A;  3H3U A;  4I09 A;  4L9T A;  1IN5 A;  3F22 A;  3G3Z A;  3I4P A;  5ILU A;  4XSZ F;  1U6G A;  4CIC A;  4UNO A;  2DK8 A;  3BPX A;  4PDK A;  4KN7 X;  5LEJ A;  3R61 A;  4BHP A;  3WG9 A;  3RYR A;  3K1N A;  3IWF A;  5HLG A;  4MTE A;  2Y48 A;  3K1M A;  3TO9 A;  1QO0 D;  4OIN F;  2JTV A;  1KYW A;  3MQ0 A;  5AON A;  1FYL A;  4M9X A;  1XSD A;  1YG2 A;  4M71 A;  4UV9 A;  1FC3 A;  4G9Y A;  1D8J A;  4H0E A;  2JSC A;  3HHG A;  1Z7U A;  3F21 A;  2KIM A;  5E1Z B;  1YW7 A;  2PJP A;  2XKO A;  1P4X A;  1JHF A;  1JGS A;  1ZAO A;  1YO5 C;  2RKH A;  2P6S A;  2XHK A;  5J6X A;  4AIK A;  3ZQ7 A;  3EQL F;  1JHH A;  4ESF A;  2GXG A;  5JHU A;  4MNU A;  2HEO A;  4CZZ A;  2L01 A;  4RGR A;  2CG4 A;  3VOD A;  1KU9 A;  4IRG A;  2LF7 A;  3RKX A;  5DD8 A;  2LDU A;  3C1D A;  1O7F A;  3BP8 A;  2ZME A;  4AVP A;  1KU7 A;  3M9A A;  4MEY F;  3DEU A;  5TJJ A;  3TDZ C;  1O3Q A;  3LAJ A;  2V1U A;  2L4M A;  3PQK A;  5H6R A;  5HDK A;  2F2E A;  4PCQ A;  3WGG A;  2QQB A;  5HS8 A;  4L18 B;  3DFG A;  1YS6 A;  2F5C A;  2MC3 A;  1K7A A;  4LG0 B;  3JSP A;  3F6O A;  3BY6 A;  1DP7 P;  3VEP A;  1SMY F;  1U5T A;  5CJ9 A;  4LLN A;  3QOP A;  4GCV A;  1MD0 A;  3WTS C;  4BH9 A;  4GYG A;  1WKM A;  1ULY A;  3WTU C;  3COA C;  3RJP A;  5L3D A;  2DBB A;  3RTR A;  1I1G A;  4WCG A;  2VN2 A;  2GZW A;  2EFO A;  3B02 A;  3D5L A;  2HWV A;  1C0W A;  4KN4 X;  3K1P A; 
#chains in the Genus database with same CATH topology
 1A6I A;  3GBG A;  4WXD A;  4F7Z A;  3ECO A;  1EJ9 A;  1DPR A;  1HQC A;  2M4G A;  4B4C A;  3NWS A;  4BXU A;  4XON A;  3HZJ A;  4S04 A;  4XKW A;  3F8F A;  1M1E B;  2FE3 A;  4M3B A;  2V9P A;  3EET A;  4E4H A;  3QP6 A;  1TWA J;  2HOS A;  4Y3O A;  4C30 A;  2KJB A;  3F23 A;  4WK8 F;  1HBX G;  1D0Z A;  1S5L C;  2W48 A;  2R0Q C;  4UY8 I;  3IKV A;  1TP4 A;  1GXQ A;  5DCM A;  3BZ6 A;  1R1T A;  1IG7 A;  2HNH A;  2E1N A;  1L0O C;  2OUM A;  4G94 A;  4PSX A;  3OR2 C;  1HW2 A;  2FU4 A;  3U1D A;  1S29 A;  3MVP A;  5LHH A;  3WGI A;  4HDU A;  3KX2 A;  2VOP A;  1S7A A;  3BG5 A;  4CCM A;  1VQ7 I;  2OQG A;  1XD7 A;  4PJN A;  4YRV A;  2W4S A;  3K4B A;  4X0G A;  1OLT A;  2G9W A;  4C3I J;  3Q0W A;  3CC7 I;  3AFH A;  2NS8 A;  4QLC U;  2ZJP F;  2QQ8 A;  1UMQ A;  3KIO A;  2E60 A;  4EV0 A;  2KIS A;  3E6B A;  5IOZ A;  1ETK A;  1R22 A;  1WJF A;  4IPA A;  4OAZ A;  4MTD A;  1G3Y A;  2XAU A;  1KON A;  2KP6 A;  5JLX A;  3BR3 A;  3I56 I;  5E1X A;  2Y0S N;  4BXF A;  4A0Z A;  5LRS A;  1DUX C;  1R1V A;  3LSR A;  1JKP C;  4PUS A;  4JYK A;  1Z05 A;  3F9K A;  3MKZ A;  4D5C A;  3OL4 A;  4DIQ A;  4IVN A;  5D6F A;  3CUQ A;  2RQQ A;  2RRE A;  4G6Q A;  1AKH B;  4DYR A;  3J81 K;  2HDC A;  3ZXS A;  2JA6 J;  1R00 A;  2OF7 A;  3BG6 A;  3Q9V A;  1H88 C;  1WGX A;  1A31 A;  1HW5 A;  1MMN A;  5BPD A;  1UHW A;  3ABU A;  1POG A;  2W84 A;  2UV1 A;  1TWG J;  3PUF A;  2HGC A;  4G7O F;  5CVR A;  1D0X A;  1WJE A;  2QM3 A;  4II2 A;  1IO2 A;  4F55 A;  4UHT A;  5C4J J;  3B73 A;  4EJW A;  4XLC A;  2QSG X;  4IX7 A;  3WG7 H;  5HNF A;  4LB5 A;  1TQM A;  2GIZ A;  4CCN A;  2F4I A;  2XRO A;  1GV2 A;  2JRM A;  3FXQ A;  2HQA A;  4ON0 A;  2MA3 A;  2WC2 A;  3RIR A;  2E1M B;  1J9I A;  1MH3 A;  2BVM A;  5ILS A;  4J00 A;  2KKO A;  3RCO A;  4NC8 A;  5ICE A;  4M3G A;  3EYI A;  2E5Z A;  3ZCO A;  3M4O J;  2ZJ2 A;  1LFU P;  1R4M B;  1WRJ A;  4NB5 A;  1SFE A;  2ZB9 A;  3W2A A;  2FMY A;  3FXM A;  1BN5 A;  2L7F P;  1HKT A;  2A61 A;  3K2Z A;  5J4Y A;  3CDH A;  5FLV A;  4NQW B;  1NG7 A;  5HS9 A;  3CUO A;  3I59 A;  1YI2 I;  3BWG A;  3OSF A;  4HLY A;  5FFZ A;  4QTR A;  1JT6 A;  3JRA A;  5JVT A;  2Z5U A;  5FGM A;  3H3Z A;  1K79 A;  5KAI C;  3RYP A;  3ASO H;  3KE2 A;  2EV6 A;  3GUD A;  3VYT B;  4IZZ A;  1MSF C;  2COB A;  1V55 H;  1ZQ3 P;  3WOD F;  2P5V A;  2EIK H;  2HXI A;  3I54 A;  4G8X A;  1ZRE A;  2K9N A;  2NYX A;  2VT3 A;  2MC4 A;  3FX3 A;  5BQT A;  4L5I A;  2E2I J;  2R7V A;  2W1O A;  3BTJ A;  2PJR B;  4XMY A;  4D5F A;  2AXL A;  4XIC A;  3AG3 H;  4M3E A;  4KUM A;  3FMR A;  3R4K A;  4IQ4 A;  1PYV A;  1B6A A;  3FIW A;  4B3X A;  2JQ7 A;  2GWR A;  5JVG F;  4H4K C;  3A1Y A;  4OMY A;  5HVQ C;  2F5V A;  1G3T A;  1IUF A;  3E6C C;  1ZGJ A;  2KPM A;  2JA7 J;  3E6M A;  5DCM B;  3L2R A;  2QQ9 A;  2ZO4 A;  1BW5 A;  1XTA A;  5HDG A;  1G6N A;  2UWM A;  2IGK A;  2IXS A;  2YSR A;  4CCO A;  2DYS H;  1YLF A;  1APL C;  4XQF A;  5J40 A;  1FPQ A;  2XSD C;  2E5N A;  3DQV C;  5HS7 A;  3PSI A;  4CZC A;  3SYT A;  4CUG A;  3T5X A;  3ZR8 X;  5D6E A;  2KRF A;  2CFO A;  3BT9 A;  2FBK A;  1IDY A;  2BYV E;  2ECC A;  3I4N J;  3L2Q A;  1ACI A;  3CCY A;  3KP3 A;  2XAQ A;  2PMU A;  1XG1 A;  1K61 A;  1Y56 A;  2V9K A;  2WY8 Q;  1J75 A;  1DPU A;  1R5H A;  1XB4 A;  2OV7 A;  5ERI A;  4EAT A;  1XC5 A;  4HPQ A;  2HVS A;  4QIW N;  3HOW J;  1LDJ A;  2VKD A;  3R0J A;  3JRF A;  4OIR F;  2EIM H;  4M72 A;  2QSH X;  2HU9 A;  2QBY A;  3BDD A;  1S9H A;  4PZJ A;  3CCQ I;  3H5R A;  1EH6 A;  1A36 A;  1B72 A;  4S05 A;  2O03 A;  2WAF A;  5DUI A;  1TLH B;  1I6H J;  2HVR A;  4UXN A;  1GVD A;  1FT9 A;  3TW6 A;  3ZQC A;  2HYJ A;  2KFD A;  1TW2 A;  3C3W A;  4UVC A;  1PDN C;  4NC7 A;  5LFA A;  4L9N A;  1FMV A;  2QF7 A;  2B7E A;  4M9S A;  4ESB A;  1J59 A;  1RNL A;  1J09 A;  4FX0 A;  3H35 A;  4B44 A;  2X51 A;  5GPC A;  1LKX A;  3LWF A;  2X1E A;  5E3L A;  2EB7 A;  2CQQ A;  4C9Y A;  3CUQ C;  1TNT A;  1OCZ H;  2KIF A;  3GXO A;  2R7S A;  2LY2 A;  1RKW A;  2RNJ A;  1T33 A;  3CO7 C;  3K4L A;  2OD5 A;  4N9H A;  2IBD A;  2MFZ A;  1LE8 B;  1R6R A;  2R93 J;  1ZR4 A;  1W5C C;  5E8G A;  4BDY A;  4A3C J;  2JJ7 A;  1JKO C;  3BR1 A;  1JJ8 C;  4PJJ A;  2V7F A;  3X2Q H;  1R71 A;  3DV8 A;  3CP8 A;  3OYF A;  1LJ9 A;  3A01 A;  1W5T A;  1JTY A;  4MEX F;  2VBZ A;  1RET A;  1MBG A;  5DV5 A;  1R58 A;  2LOO A;  3V7C A;  3BTC A;  3GFL A;  4YIR X;  1N77 A;  1MNE A;  5FO5 A;  4A2U A;  1LPQ A;  1JUM A;  2FXA A;  1OCR H;  3U9G A;  3ZQF A;  5J1Y A;  3S1R J;  4E7K A;  3DLL F;  1BR4 A;  3ULQ B;  5D8K B;  1DGR M;  4A3M J;  3VB2 A;  3TO6 A;  1D5Y A;  1GDT A;  2Q8K A;  2LRD A;  3ELK A;  3ESW B;  3GLL A;  3QAH A;  3UKG A;  3HOU J;  3L2V A;  3KFW X;  3TOB A;  1P7J A;  5EZG A;  1F4K A;  2FBH A;  2KQR A;  3TDU C;  5A2Q K;  3S2H J;  2XPU A;  1RES A;  4HNV A;  5FD5 A;  2RNG A;  3HUG A;  4CH7 A;  2L9S A;  3A03 A;  4EJV A;  2ICW G;  4B1R A;  1T98 A;  2IW5 A;  1YE9 A;  2X0L A;  4YIF A;  3WU1 B;  2E34 A;  5FB2 A;  2ZME C;  2WWY A;  3CDI A;  4OMZ A;  1E3P A;  1TQP A;  1FWZ A;  3S1Q J;  1OR7 A;  4OOI A;  1CGP A;  1Y6I A;  4HX8 A;  1Z0X A;  2Z2S B;  3TW7 A;  2JT1 A;  2L3D A;  4A3F J;  1QGP A;  3CD6 I;  2HYF A;  2VJJ A;  3EUH C;  4XN0 A;  3QPL A;  2DQR A;  5DYM A;  4UUS A;  1WI9 A;  4RMN A;  5FKL A;  2FX0 A;  2ISY A;  4HF0 A;  3KEQ A;  4IF4 A;  1LFB A;  1WH5 A;  2EA4 A;  3CLO A;  3O6B B;  5ICC A;  3V42 A;  4EEF G;  3F6V A;  1IRZ A;  4ZDP A;  4JX5 A;  5D8L B;  3S1N J;  2M87 A;  1IJW C;  3PIP F;  1VQK I;  2TRT A;  3ZPL A;  2XAJ A;  3HSF A;  1R1U A;  3DLA A;  2BGC A;  2X48 A;  2QKL B;  1TWC J;  2HOE A;  5HDN A;  3WTY C;  5J4V A;  2M8E A;  4YEJ A;  1I3A A;  2CQN A;  2R7Z J;  3H9Q A;  3D5S C;  3G1M A;  1FSE A;  5CKT A;  2KDO A;  4G7H F;  2CU7 A;  2JRT A;  3FXK A;  4L5J A;  5CVU A;  2ME6 A;  5EYR A;  3WU2 C;  5LD2 C;  1RUO A;  1Z21 A;  2CV1 A;  2GXA A;  2VBW A;  4A0Y A;  1FOW A;  2FBI A;  2K3F A;  2WY7 Q;  3HOV J;  2L7Z A;  4L5E A;  1B59 A;  4UUT A;  1X3W B;  2GBY A;  4S0H B;  2KZV A;  1Y1W J;  2RVC A;  1W7P A;  1LDD A;  2A69 F;  2TCT A;  1IC8 A;  1E17 A;  4HW0 A;  1D1C A;  2R7X A;  3GTO J;  1RZ4 A;  1MMD A;  2UXX A;  1ZN2 A;  3LMM A;  1HKQ A;  2RGV A;  3IUO A;  3L2W A;  2JZY A;  3ZMD A;  2FEZ A;  2JPC A;  2DJI A;  1OCT C;  1G3W A;  2HPI A;  4C3J J;  4EVI A;  4XRS G;  5D4R A;  2MGQ A;  1B9N A;  4AM3 A;  3WTZ A;  2M5W A;  2V4J C;  3A0H C;  3MWM A;  4EMS A;  5CVV A;  3J80 Z;  1HOM A;  2MLK A;  1EF4 A;  1T8I A;  1YQA A;  3GFM A;  4CA0 A;  1MND A;  2NAZ A;  3NAR A;  4EJU A;  3FXR A;  4I7H A;  2DT5 A;  4F93 B;  1P4A A;  3GWZ A;  1DU0 A;  4PK4 A;  3HRT A;  1XSV A;  5F08 A;  2QEN A;  3GZ6 A;  3OSG A;  3MKY B;  2H09 A;  4P1W A;  1FJL A;  1ZR2 A;  1HLV A;  1KYZ A;  3G2B A;  5E20 A;  5IP9 J;  2M7B A;  3TKY A;  3VOE A;  2P8T A;  2F6C A;  5A2Q Z;  1QBJ A;  3WHC A;  1RR8 C;  2LKS A;  2LK2 A;  2Q2E B;  3PO3 J;  2MH9 A;  3OYL A;  1BOA A;  1UZC A;  1PP7 U;  1UHM A;  4PSW A;  1S7E A;  4HOB A;  4B09 A;  3O3K A;  1X2M A;  2DN0 A;  1WQ2 A;  3OYD A;  1Y8Q B;  4GYI A;  1TNS A;  4Z6Y A;  2Y69 H;  4ZH4 F;  1BL0 A;  4CHU A;  3GZN B;  3HPH A;  1BI1 A;  1NHA A;  5E17 F;  3CCV I;  2NXN B;  2Z16 A;  2Z3Y A;  1BI3 A;  2R3S A;  3FK6 A;  4P96 A;  2EZL A;  2R7W A;  5EZH A;  3FKJ A;  3K4J A;  3BCA A;  3I58 A;  2L4A A;  1LEB A;  5GAE J;  2MW8 A;  1CF7 B;  3LFK A;  3G6E I;  2VAS A;  2OTJ I;  3IAM 2;  1U5T C;  2FNA A;  3D0S A;  2DAO A;  4ZDO A;  1R4N B;  2DFF A;  1OIS A;  2PX9 A;  1H89 C;  3FHN A;  1PUE E;  3MD2 A;  2HZT A;  2K9Q A;  1R36 A;  3RQI A;  2ZFW A;  3PSF A;  1I5Z A;  1OCC H;  3CJR B;  3K69 A;  4ASN A;  2XC7 A;  4A0X A;  1MJA A;  1F43 A;  1BA5 A;  3T8R A;  5JFR A;  3IH4 A;  4ZC3 A;  2X9D A;  4FX4 A;  4M6Y A;  2ADU A;  2V79 A;  2ACJ A;  5BS6 A;  1SAX A;  4CO8 A;  5EEA A;  1IF1 A;  2DYR H;  5IYC J;  2RQP A;  5CQE A;  2VB6 A;  4MQ9 F;  3WE2 A;  1Y0N A;  2O5R A;  1YYV A;  2M7A A;  4DYC A;  4RGU A;  2LLK A;  1MBF A;  1S6L A;  2BY3 A;  2OZ6 A;  2R7R A;  1QZZ A;  2DI3 A;  2PMH A;  4ABZ A;  4XRF A;  1ETV A;  3IV5 A;  3ZQH A;  5L3G A;  1ENH A;  1XX5 A;  4YII A;  2JPB A;  4DZP A;  3S1M J;  2VJI A;  4HX4 A;  5TIS C;  2HQ5 A;  1XGM A;  2X6O A;  4JP0 A;  3EUH A;  2BW3 A;  1BC7 C;  2FUG 2;  5E3O A;  5KCM A;  2KL4 A;  2XGD A;  3ZQI A;  3C18 A;  1U5T B;  3KET A;  3LSP A;  3GO5 A;  4LB6 B;  4GDF A;  3F8N A;  3OWT A;  3PNV A;  4KT5 C;  1FBQ A;  5F0F A;  2XGX A;  1GVJ A;  3ZN1 A;  2IS2 A;  4E6K G;  4IJA A;  1W7P D;  2YR2 A;  2ZCW A;  1KQ9 A;  4KMU X;  5FRN A;  3CES A;  4EM2 A;  4DGW B;  3OYC A;  2PFB A;  1ZRC A;  3H3V K;  3LST A;  3OL3 A;  1JI8 A;  1PJR A;  1YW9 A;  3H36 A;  2DDA A;  3GFJ A;  5J8C A;  4OWR B;  1I39 A;  1CF7 A;  4BQO A;  4A3D J;  4CCJ A;  2WAE A;  2X1C A;  3AKZ A;  5ILV A;  2A5Y B;  2WV1 A;  3VFZ A;  2F4M B;  3L7W A;  2FA5 A;  1X1D A;  4PFO A;  3FIS A;  1AOY A;  5BOX A;  2RC4 A;  2FSW A;  3IAS 2;  5B1B H;  1S3J A;  3ZP5 A;  1WH7 A;  4Y4R A;  4HV5 A;  4IRI A;  3N4M A;  3GW2 A;  1V5G A;  2KRC A;  1W7P B;  5HLI A;  1OCP A;  1WJA A;  2M9H A;  5ICG A;  1Z6T A;  2DDB A;  2XSJ C;  3REO A;  1O4X A;  2LY9 A;  1W4M A;  4CXF A;  3K4C A;  4HYE A;  1ZK8 A;  4DW6 A;  5LEK A;  2STT A;  3Q9S A;  1WWX A;  1SD4 A;  5F1R A;  2DFH A;  3KPH A;  1Y0U A;  3N05 A;  2VKE A;  4DBR A;  4GGG A;  2Y2Z A;  1JT0 A;  5HLT A;  4IEJ A;  2FJ1 A;  1FP2 A;  3BCB A;  2OZU A;  2O9L A;  3AAF A;  3C2H A;  4BDZ A;  2BW3 B;  2R7U A;  2AQE A;  3S16 J;  2RAE A;  4IL6 C;  3JW4 A;  4MQV A;  3E3V A;  1A04 A;  4JBA A;  2XAG A;  3JCU C;  3ABM H;  1SC7 A;  1U2W A;  3LSM A;  5H20 A;  5K5Q A;  1BR1 A;  3KP6 A;  3CJN A;  4HNT A;  4N0B A;  2ZSH B;  3OYB A;  3LQQ A;  4M9Z A;  4K2E A;  4N4N B;  2H8R A;  2CQK A;  2CYY A;  1USS A;  2BE5 F;  4DYQ A;  5JLW A;  1U3E M;  4IHX A;  2XVC A;  2LMD A;  1R23 A;  1KGS A;  1F9N A;  3I71 A;  1VF9 A;  4R1H A;  4HAM A;  3OV8 A;  3RKW A;  4LIT A;  4N9I A;  1ETO A;  4U87 A;  3MEX A;  1Y8R B;  4HDV A;  1SFU A;  2HTJ A;  5M5X J;  4I2O A;  2BOL A;  3F72 A;  5J47 A;  5FLX K;  1YHQ I;  4I01 A;  2DQL A;  5J8F A;  3MCZ A;  1D3Y A;  3M7G A;  4A3G J;  4NNJ A;  1FTT A;  1ON1 A;  1LVA A;  2GA2 A;  2VOD A;  3HRM A;  2R5Z B;  3SFZ A;  2DOE A;  3HRU A;  3V8J A;  3I0T A;  4XID A;  1ZEL A;  2F5F A;  1R5G A;  1FLI A;  1UAA A;  4PJL A;  1SFK A;  3BRO A;  4ITV A;  1WPK A;  4KJZ A;  2VE8 A;  2BVL A;  2HS5 A;  2NVY J;  2GQQ A;  2QUF A;  3ZQL A;  2IA1 A;  1JKQ C;  3QOE A;  3UNG C;  1RIO H;  2B0L A;  1IRX A;  2EQR A;  5F04 A;  5H6Q A;  2STW A;  2ZME B;  3Q3S A;  3AG4 H;  3CC2 I;  4IHT A;  2O0Y A;  1HXD A;  2EK5 A;  1X3U A;  4FT8 A;  4XBF A;  1J5Y A;  3KEO A;  2AXT C;  5CLS A;  1QZY A;  2HQN A;  3H5N A;  3O8H A;  4UB6 C;  5EEG A;  2I8D A;  3F3X A;  5LHI A;  5HLH A;  5B5E C;  3K6G A;  2PLY A;  1J0R A;  1EV7 A;  1WJ5 A;  4E7L A;  1A35 A;  2VL8 A;  2W7N A;  2RDP A;  1FBU A;  4CDG A;  1T39 A;  2UXN A;  3ABL H;  1QRY A;  1W0T A;  3V8K A;  4AUX A;  1FY7 A;  2EWN A;  2DA5 A;  3LSJ A;  4Y33 A;  4CYC B;  3L1P A;  4V2F A;  5E3M A;  2DOF A;  3JRH A;  3S15 J;  3BZC A;  4IOC F;  2R7F A;  3HUG B;  2ESN A;  3IL2 A;  1ZG3 A;  3CDL A;  3I3L A;  4A3E J;  1B8I A;  2BBY A;  4PGG A;  4P9U A;  4BE0 A;  2E1C A;  2BXZ A;  3FKI J;  2A6T A;  3H5A A;  1MBK A;  2OAZ A;  1H9T A;  5M3M J;  3T0Y A;  2PEX A;  2WTE A;  3M1C A;  1B1B A;  1XCV A;  2FML A;  2M0M A;  4M6V A;  3ZN0 A;  2DTZ A;  2ZXJ A;  2V1N A;  3IH2 A;  3OR1 C;  4Z2Y A;  1D5V A;  4HF2 A;  2X1D A;  4F91 B;  3ROU A;  3QU3 A;  2H94 A;  2LG4 A;  4PJM A;  1VND A;  4KNY A;  2E71 A;  2H8W A;  1U9O A;  1MSE C;  1HDP A;  1MDM B;  3B6C A;  5CVI A;  4XLN F;  4DZJ A;  2DA7 A;  4WWC A;  1ETX A;  2HOA A;  4XLH A;  1ZYR F;  1NH3 A;  1S7O A;  2JA2 A;  1L3L A;  3OS2 A;  2IT0 A;  3H92 A;  5AIQ A;  1IRF A;  1YIT I;  2DA3 A;  3A02 A;  3KZY A;  4AYB A;  1IRG A;  3DP7 A;  2WV0 A;  4BBR J;  3EDP A;  4LD5 A;  5FLX Z;  3DTE A;  2DMU A;  1QPM A;  3HIF A;  5KK1 A;  5DTD A;  1E2X A;  1X58 A;  3IRQ A;  4ZYE A;  1NTC A;  1ZTR A;  3LNQ A;  2LKX A;  4KIB A;  1XDS A;  3BR6 A;  1ON2 A;  5KVR A;  3DBL B;  2LNB A;  3VSL A;  1X4O A;  2GM4 A;  1FP1 D;  2GAU A;  2ZNY A;  1U8B A;  5D5U B;  2PMZ N;  4BUP A;  1Y39 A;  1KZH A;  1HA8 A;  3IH3 A;  1VTN C;  1T2K A;  2CO5 A;  3ZMZ A;  2V1X A;  5JR3 A;  4I02 A;  2VC0 A;  4LK1 F;  3MFK A;  1XMA A;  2LVS A;  2VBY A;  4YFN F;  4ZZD A;  4I98 B;  1LQ1 A;  1K6O A;  4LK0 F;  1GLN A;  1YX3 A;  4RB2 C;  4KA4 A;  1G4D A;  4E70 A;  1VI0 A;  2OQR A;  4PGH A;  2QBY B;  4C3H J;  4D7M A;  5ED4 A;  5H2F C;  4R8H A;  2QEX I;  1IN4 A;  4J01 A;  3QYB A;  3HTS B;  2IS4 A;  3GVA A;  4M3D A;  2K02 A;  5F0H A;  3FMS A;  2KIQ A;  3LA2 A;  1EH7 A;  2R5Y A;  2XGC A;  1J2X A;  5DDG A;  1WJB A;  2DOD A;  3NQO A;  2O6G E;  1IAW A;  5LLQ A;  3I64 A;  2N8G A;  1JE8 A;  1TBX A;  2E2H J;  4MIM A;  4U0V A;  2LP0 A;  4EJT A;  1VQL I;  1OJL A;  4BHB A;  2MD5 A;  3L00 A;  2A05 A;  4LMY A;  4QPO A;  2HFH A;  3K4K A;  1X19 A;  5J3L A;  4MFD A;  2K7L A;  2ESH A;  2G7U A;  4OU0 A;  3SZP A;  4AIJ A;  2ME0 A;  3WU0 A;  5IP7 J;  4ANJ A;  1DDN A;  4BAY A;  1WJC A;  2HI3 A;  4Q4Z F;  2TDX A;  1MIJ A;  2Y9Y A;  2ZSI B;  4YG2 F;  1AHD P;  3VYS B;  4RAF A;  3FK7 A;  4HX7 A;  9ANT A;  3DPU A;  2MAB A;  3DPT A;  3HC7 A;  3D1N I;  4BE1 A;  2FNP A;  3OIP A;  3IKT A;  4RGX A;  2IA0 A;  2R7D A;  1X1A A;  3ZQG A;  2O8X A;  1IDZ A;  2QWW A;  4RS8 A;  1PVE A;  1YFH A;  3UR3 C;  5EGO A;  1WVR A;  3BZK A;  1AKH A;  2UUZ A;  1P9Q C;  2ETH A;  2E35 A;  3DKY A;  3MAJ A;  3SXY A;  5F1J A;  3TOA A;  1ETW A;  2PQ8 A;  1IN7 A;  3DPL C;  2JSP A;  2CS3 A;  3S14 J;  1SVM A;  3FF5 A;  2FQ4 A;  4O5V A;  4IHV A;  5EG0 A;  1JTX A;  3ISP A;  4RAY A;  1FNN A;  5D5V B;  2WAQ N;  1VQ5 I;  2D5V A;  1NG6 A;  2X4H A;  2M8G X;  3OYH A;  5DS9 A;  2D1H A;  3CF5 F;  1UFM A;  3E1S A;  3QPH A;  4U0W A;  1QU3 A;  2XF7 A;  4JX6 A;  3ONQ A;  4BQQ A;  3HDD A;  4HA8 A;  1GT0 C;  4DBQ A;  3J80 K;  4XRS A;  1B72 B;  1DU6 A;  1B9M A;  1EA3 A;  1UG0 A;  3U1K A;  1GXP A;  5DUK A;  2DA6 A;  1V3F A;  4ENN A;  1JXS A;  2L9N A;  2V1D A;  2K86 A;  1T6S A;  1I27 A;  1IV8 A;  3E5Q A;  1BIA A;  1SD7 A;  2EV0 A;  1WI3 A;  5L3C A;  3ERE D;  1ZLJ A;  3F8M A;  4XLF A;  5E18 F;  3PNT A;  2QLZ A;  3CTA A;  3K4N A;  3OIQ A;  1U0J A;  3K9T A;  4A69 C;  2OBP A;  4MFE A;  2VOO A;  2Q2E A;  3W6J B;  1YIJ I;  5LGN A;  1B8I B;  1ODD A;  3KP2 A;  3S17 J;  1Z1D A;  5K7H A;  3EUA A;  1QHH D;  2CGP A;  5M5Y J;  3BQZ A;  4GXO A;  2W25 A;  3V4G A;  4PJ0 C;  4HRI A;  1OQY A;  4G6T B;  4R79 A;  2L9V A;  4P5O A;  4XLE A;  5D5X B;  1PUF A;  1P7I A;  1BC8 C;  3DF8 A;  2CJJ A;  1P2F A;  2JVH A;  4LFU A;  2XB5 A;  2KHM A;  4FTH A;  4A3B J;  2H6B A;  1QVT A;  1JKR C;  4E7I A;  3S2W A;  1UG2 A;  1ETY A;  2LSO A;  4U88 A;  5FKM A;  2ZXH A;  3QU6 A;  3JRB A;  3CCL I;  4G12 A;  2ELK A;  3S2D J;  5B66 C;  1D1A A;  2M34 A;  3KEY A;  2P4W A;  2M1B A;  2LF8 A;  1FYM A;  2BY1 A;  4AU7 A;  1FIA A;  3KLO A;  4ZTJ A;  2OC6 A;  3HBL A;  1ZRD A;  2Z9O A;  1V4R A;  1TZL A;  2BHZ A;  1K6Y A;  1FX7 A;  1OYY A;  2E19 A;  2DMT A;  2LBF B;  4ENK A;  2GOX B;  1CQT A;  1P92 A;  3HRS A;  3P9K A;  2FQ3 A;  3LSI A;  4KIF A;  5IYB J;  1I50 J;  2BY0 A;  3HSR A;  2NOG A;  4XLA A;  4Y52 J;  3BR0 A;  3I53 A;  4F52 A;  4Y7N J;  4NBQ A;  3VYR B;  1QNT A;  2EFP A;  1NK3 P;  2MD0 A;  2VKH A;  1QHG A;  2L9R A;  3GF2 A;  1KQ0 A;  1U9N A;  2W24 A;  4NQW A;  3CCM I;  4BS9 A;  2OPT A;  2LD5 A;  2K27 A;  2XRN A;  3PQJ A;  5IYD J;  3GCM A;  5IP6 A;  5CQG A;  2M4K A;  1SMT A;  3KZZ A;  4UV8 A;  3ZMV A;  5DEQ A;  4QPQ A;  5BNG A;  3RQ4 A;  2E1O A;  4CGZ A;  2BHY A;  4A5M A;  1AU7 A;  4O3M A;  2KJC A;  3CCE I;  2QSF X;  4IHY A;  3JTH A;  5IT9 K;  4EGY A;  5FJ8 J;  4RM2 A;  2VJ4 A;  5EEH A;  2P5K A;  1BM9 A;  3G1O A;  4A5N A;  4BGD A;  3OYM A;  5FRO A;  4FE7 A;  4AD9 A;  2P5L C;  5KAF C;  4BJ6 C;  2JMW A;  3O8G A;  3GTQ J;  2CRG A;  3HOZ J;  5M5W J;  2LH9 A;  3RZD J;  3TO7 A;  2I5U A;  1HDD C;  3H0D A;  4BNC A;  1KU2 A;  4DNC A;  1YX5 A;  3FXL A;  3OIO A;  2VQC A;  2MSY A;  3BJ6 A;  2HTS A;  2IEK A;  3BR2 A;  1IV6 A;  1A5J A;  4YFK F;  3KYC B;  4TV7 A;  1FIP A;  4A3K J;  1KQ8 A;  3KP4 A;  2VQG A;  1TQI A;  1G8X A;  1Z3Y A;  2VON A;  2Q0O A;  4BEH B;  1F1Z A;  4LIU A;  4Y15 A;  4LIV A;  1LB2 A;  2JVG A;  4AVZ A;  1FOK A;  4UB8 C;  5D5W B;  3TGN A;  1TL8 A;  1MMS A;  3W6K B;  2E2J J;  3I55 I;  2HDW A;  1MBH A;  2R7Q A;  5FKO A;  2IAI A;  3GTG J;  1QQI A;  2DOA A;  3BG7 A;  4AC0 A;  2VC1 A;  3BJO A;  4B43 A;  4BY1 J;  4Q48 A;  1X1C A;  4ZJZ A;  1ZHF A;  1FYK A;  2IGN A;  3LOC A;  3SFI A;  2XAS A;  1BI0 A;  2GA1 A;  5ICF A;  2DA2 A;  3WGH A;  2M0C A;  5FFX A;  2Z33 A;  3NRV A;  2IGO A;  5LGT A;  2ZFU A;  5GAG J;  1IN6 A;  1MMG A;  2NNN A;  4HZF A;  3VSK A;  5K5O A;  3JTG A;  2PG4 A;  4OIQ F;  3D5R C;  2LKP A;  3BTL A;  2O3F A;  2LY1 A;  3MZY A;  3JSO A;  1BIB A;  2KT0 A;  3AL0 B;  1W36 C;  1H9G A;  4I6Z A;  1HF0 A;  1MJ9 A;  1V54 H;  2K9S A;  1LE8 A;  5GTH C;  4FHT A;  3PJR A;  4D9J A;  2LC2 A;  2PI0 A;  1TWF J;  3IHU A;  2Q1Z B;  4HBL A;  3HOS A;  5B3S H;  2R5Z A;  4X1E A;  3GTJ J;  3OOP A;  2ELJ A;  1FOY A;  2NVT J;  5F27 A;  2X6X A;  2AS5 F;  1MGT A;  3V7S A;  3JRG A;  2R4G A;  1Z67 A;  1ZLK A;  4BY7 J;  1U8R A;  3DKX A;  2OJE D;  2Y9Z A;  3KLN A;  2ZJQ F;  2HQR A;  1T08 B;  4E7S A;  1BJA A;  4IRH A;  4LJZ F;  3P5J A;  2Y0M A;  3S3N A;  1AWC A;  3EUK L;  4EJO A;  2QZ8 A;  3BOQ A;  5IT3 A;  3CCU I;  1IXC A;  3K10 A;  4M73 A;  3ZOB A;  3ZMU A;  4EM1 A;  4L0Y B;  5F64 A;  3BG3 A;  4U7D A;  2KIU A;  1V5F A;  1RKT A;  3QYE A;  1S72 I;  1AA7 A;  4CCK A;  3WTW C;  1VZ0 A;  3Q0V A;  3DCF A;  3RPU D;  3DTK A;  5IT9 Z;  2L02 A;  3F8B A;  4CCL A;  4EQQ A;  5JHF A;  2XAF A;  2COM A;  2VPR A;  3BQY A;  3HJE A;  2DFI A;  2MBF A;  3EYY A;  4EM0 B;  1XDU A;  4ZYG A;  4AYB N;  4LG0 A;  2GOM A;  4RA2 A;  3RZO J;  1E3H A;  1ZRF A;  5F6F A;  4I99 C;  5GTI C;  2L5Q A;  3KYL A;  1R9T J;  2KDZ A;  2R7O A;  2V6C A;  1Z6R A;  4EGZ A;  1W0U A;  3V7R A;  2PBI A;  5EGO B;  1OCO H;  3PIO F;  2HR3 A;  1OPC A;  3SJM A;  3ZMS A;  3JRC A;  1XGS A;  1JGG A;  4DOZ A;  3JR9 A;  3MZH A;  4A93 J;  1P6R A;  2DTR A;  2Z99 A;  1HKS A;  2XAH A;  2GLO A;  4CYD A;  2EFQ A;  4QSH A;  3TL4 X;  3VDX A;  1PP8 F;  2J5P A;  4AWX B;  3HTU A;  2HKO A;  2W00 A;  1HST A;  2FRH A;  3ZMT A;  3J7A O;  4HQE A;  2VLA A;  4IKF A;  4BQN A;  5K5R A;  4G6D A;  2IS1 A;  3NEU A;  1T56 A;  2FOK A;  1ZKG A;  2QKM B;  3G71 I;  3GTL J;  3CF2 A;  5LGU A;  2W57 A;  1WZ2 A;  3CJQ B;  3FZV A;  3FBI B;  3JAM Z;  5HNH A;  3J81 Z;  1O3S A;  3E6D A;  5E1W A;  4O6J A;  1GHC A;  1TW3 A;  1T38 A;  4B8X A;  1NK2 P;  1LEA A;  1TT5 B;  1Z7L A;  2D2W A;  4W1U A;  4FAS D;  1HSJ A;  2K85 A;  3CMM A;  3B6A A;  2WB1 N;  2ZXI A;  3G1L A;  3FM5 A;  1XMK A;  4IO9 F;  2DJN A;  1U78 A;  2DCE A;  1MKM A;  2X6Y A;  4AID A;  4DJA A;  2YX7 A;  3DU6 A;  5KNL A;  4GO1 A;  3Q0U A;  4ZYH A;  2MLG A;  4ETS A;  5BPI A;  3FXO A;  1RPW A;  3LAP A;  2WBM A;  2GIV A;  3G73 A;  5L3B A;  4KIS A;  3DBH B;  1KU3 A;  4RB1 A;  2DPD A;  3KZI C;  3E5U A;  3HHH A;  2FF4 A;  4LG3 A;  4A3L J;  4BQA A;  4OIO F;  2BY2 A;  3I5U A;  3KP7 A;  3H9J A;  4KIC A;  1STZ A;  3E97 A;  1ERD A;  3BJA A;  5FKN A;  2VUM J;  3R0A A;  4KIT B;  4ESJ A;  2J5O A;  2L0K A;  3S93 A;  2EIN H;  2HDD A;  3FWE A;  3I4M J;  1XCB A;  5J1R A;  4WX9 A;  3W2V A;  1UHS A;  3SZT A;  3DXJ F;  3O2P E;  3TP0 A;  3RKQ A;  2IJL A;  3OOU A;  4I0B A;  4HV6 A;  1IGN A;  3E0J B;  1XS9 A;  3JAM K;  2UZK A;  2XV4 S;  3CMY A;  1S8N A;  2JN6 A;  4CYC A;  1VQ6 I;  5DM6 F;  3BLY A;  3PFI A;  5FRM A;  2OU2 A;  1JUS A;  4XNF A;  4G7Z F;  4XSX F;  4WXH A;  2QCO A;  2AO9 A;  1Z9C A;  1E3O C;  2XPW A;  2M45 A;  2VXZ A;  1LNW A;  4JQF A;  2KLO A;  2PJR A;  2K40 A;  3L2C A;  1Z91 A;  2DMP A;  2V26 A;  3L9F A;  2AQF A;  3HYI A;  3VWB A;  3RDI A;  4M74 A;  4L9J A;  3GTK J;  1EKE A;  1WFX A;  3ZRG A;  1N75 A;  4D1Q A;  3RPQ A;  1O3T A;  3GLX A;  2NVQ J;  1XGN A;  1R5I D;  4OAY A;  1SAU A;  3I9V 2;  1RI7 A;  3OS0 A;  1UJ8 A;  4L9V A;  1RRJ A;  4J19 A;  4JK1 X;  1SVO A;  2DO7 A;  2M2E A;  5GAD J;  1VQO I;  3S8P A;  1I3Q J;  1BR2 A;  2NVU B;  5K7F A;  2G0E A;  3DU5 A;  4F3Q A;  4U0Y A;  5K1Y A;  2CUE A;  5LBQ A;  3GX4 X;  1I1S A;  3OYE A;  3FDY A;  2IP2 A;  2IPQ X;  4RAG A;  1EH8 A;  3MN2 A;  3HOY J;  1SFX A;  2DK5 A;  4UVA A;  1BI2 A;  4D7N A;  3HSE A;  3CCS I;  3HPG A;  3SDG A;  4V19 K;  2VJ5 A;  2XF6 A;  3TQN A;  4U7B A;  4DQ2 A;  2ISZ A;  2JA5 J;  4MHG A;  1XGO A;  3H9G A;  1OYW A;  3GTM J;  3NWT A;  5LHG A;  1IN8 A;  3LL7 A;  1FSH A;  3GFI A;  4L0Z B;  4LLL A;  1IXS B;  2V9V A;  3QOD A;  1E0E A;  2DXI A;  3R6S A;  1R49 A;  2ZC2 A;  2L7K A;  3FHZ A;  2K4J A;  4BYY A;  2CFX A;  5JI6 A;  4X6A J;  2MG4 A;  1IXR C;  1GUU A;  2XIG A;  3PUB A;  3M8F A;  2DA1 A;  3PO2 J;  1K83 J;  1UCR A;  3FXU A;  3QQA A;  4LLG F;  3HOT A;  2Y30 A;  1DP3 A;  2ZJR F;  2OCE A;  1X2N A;  1UEL B;  3LFU A;  4JOM A;  2VE9 A;  2A6E F;  4P9F A;  1YOV B;  1MJB A;  3DKW A;  4UVB A;  1VQ9 I;  1GV5 A;  2K9M A;  3CQZ J;  4XL9 A;  1BJZ A;  2QGU A;  4RAZ A;  5LRR A;  1D8K A;  2O61 A;  2CUZ A;  5CVJ A;  1LDK B;  2NRA C;  2MH2 A;  1K4S A;  2O8K A;  1YJ9 I;  1YJW I;  2WAQ A;  3ML6 A;  2ZKZ A;  2FOW A;  2RV8 A;  2BXY A;  2EJR A;  1X4P A;  3C2B A;  2ID3 A;  2C6Y A;  4HG2 A;  3M8J A;  2YS9 A;  2JWT A;  2WAD A;  2YU3 A;  3W3C A;  1TTY A;  4YFX F;  3GYH X;  4PFP A;  1TT0 A;  2RN7 A;  2E7X A;  1B4A A;  1JJ6 C;  4UUV A;  4RLF A;  3KP5 A;  2DW4 A;  4KT6 A;  2W82 A;  4Y13 A;  1UST A;  3J7A Y;  4Q5S F;  2NOJ B;  5EF6 A;  2P7C B;  2EA2 A;  3ABK H;  4I76 A;  1O57 A;  5GP9 A;  2YPR A;  2NNY A;  3W2W A;  2CV2 A;  1XN7 A;  3LA3 A;  2F5E A;  4A3J J;  1K78 B;  2F5D A;  2HYG D;  3QRF F;  4XOR A;  4A6D A;  5IOY A;  1FEX A;  1MBJ A;  1SEU A;  2DLL A;  4CSW A;  2A6H F;  2BV6 A;  1ZG5 A;  2A07 F;  2QYO A;  5C44 J;  2JUC A;  3BR5 A;  5DCF A;  1IUY A;  1G3S A;  1ETQ A;  5M3F J;  2QVO A;  3E5X A;  1MBE A;  1YTY A;  2LR8 A;  1J7K A;  2H6C A;  3U2R A;  1YS7 A;  3SQN A;  1W36 D;  2GXB A;  3MKL A;  5FKK A;  2EPF A;  4RB0 A;  3HGY A;  1N78 A;  3LQR A;  3K70 D;  1ONV A;  1WCM J;  5AIP A;  4RDU A;  1XPX A;  1VQP I;  3P9C A;  3PL8 A;  3JRD A;  4E7Z A;  5HOO A;  2VPL A;  1Z77 A;  1K78 A;  4XLP F;  2EZK A;  2YX4 A;  4KIG A;  1T0F A;  2FD5 A;  1ZGA A;  4A12 A;  4BHC A;  4A6E A;  2DPU A;  3G4S I;  3C7J A;  1W5S A;  4ENJ A;  3U21 A;  2JUG A;  1ORK A;  3QPS A;  3RSN A;  4GFB A;  4WF2 A;  5IY5 H;  3CUQ B;  4HLX A;  1DQU A;  2YU9 J;  2ELH A;  3N97 A;  1MNM C;  3A4C A;  2M30 A;  1IW7 F;  1OYI A;  2DT6 A;  3J7Y J;  2X85 A;  5TRD A;  4BXX J;  3RKY A;  4P55 A;  3SHF A;  4ZZL A;  3T8T A;  3IP4 B;  1MZB A;  1JUP A;  4BJ5 C;  3WTX C;  4MGR A;  3A2K A;  1T95 A;  5TGT A;  2R92 J;  2XDV A;  1O3R A;  1Q1H A;  3QYF A;  4BE2 A;  3SZG A;  4Y17 A;  5E79 C;  1IZ1 A;  3C2G A;  5EDN A;  3H1C A;  3CO6 C;  3BPV A;  2QA4 I;  3Q5F A;  3WE3 A;  2DU9 A;  2KMU A;  3KCC A;  3W6V A;  1SAN A;  1OFC X;  1YJN I;  3P9I A;  3A01 B;  4KMF A;  5C3E J;  2EFN A;  4HF1 A;  2OA4 A;  4KFC A;  3OMY A;  1O7L A;  3AG1 H;  2CUF A;  2VXD A;  2E36 A;  2HKX A;  1XSX A;  2CQX A;  1RR7 A;  4C2M J;  4IHS A;  2ECB A;  1W1W E;  3FM3 A;  5BMZ A;  2NVX J;  4LOC A;  2R5Y B;  1REP C;  5K7Z A;  4RM3 A;  2IVM A;  4BBS J;  4ENM A;  1SFO J;  3JRE A;  2XUB A;  4C2T A;  3HXL A;  3PM1 A;  4XOT A;  5B1A H;  2BEO A;  2KRH A;  3V8L A;  4OIP F;  5L3F A;  3IWZ A;  3LA7 A;  1YIO A;  3PNY A;  4HQM A;  4W97 A;  3R60 A;  5GAH J;  2CW8 A;  3QWL A;  3QPT A;  3S3O A;  2EV5 A;  2XB0 X;  2X6W A;  2K4B A;  4XM3 A;  2K5C A;  5CYV A;  1SD5 A;  1ZAR A;  1H0M A;  1FOX A;  2IA2 A;  3FMQ A;  1DGW Y;  3OYI A;  2AHQ A;  2E7W A;  1OKR A;  1MDM A;  2O7O A;  1YW8 A;  1WHU A;  4QWQ A;  4ZTF A;  2EIL H;  2QQA A;  2VT2 A;  4FQG A;  3OY9 A;  3HL2 A;  2HZD A;  3SEZ A;  4C2U A;  3M8E A;  3K0L A;  1BBY A;  1P4W A;  5DD4 A;  3OYK A;  1YRN A;  1X1P A;  3I59 B;  3TED A;  2WB1 A;  3BG9 A;  4A3I J;  3LSH A;  3GEZ A;  3HKZ N;  3HB9 A;  4LGW A;  2ZNZ A;  2EIJ H;  2R7T A;  2CSO A;  2A3S A;  3P7N A;  1WSU A;  3OYG A;  1UB9 A;  2IRF G;  1R7J A;  1PUF B;  2EZI A;  3DEE A;  1RUN A;  2JA8 J;  3ECH A;  2DMN A;  2VBX A;  3NAU A;  3ASN H;  2CWE A;  4KDP A;  1Z3X A;  3OYN A;  2Y0S A;  2ZBK A;  3ABT A;  3IRR A;  1VQN I;  4FIS A;  2A68 F;  2H1K A;  1OMI A;  5FD6 A;  4NC6 A;  1HC8 A;  3WTV C;  5L3E A;  3DWL E;  4WXC A;  3SDB A;  1T0F C;  1F36 A;  3E7L A;  4ZYA A;  4KYW A;  4N4O B;  2Y31 A;  2VKV A;  4ZDL A;  2CUJ A;  3A0B C;  4E7J A;  2D45 A;  5GPA A;  3GME A;  4ZYD A;  2L54 A;  3WHB A;  1QPI A;  1ZH5 A;  3K4M A;  2DA4 A;  3GZ5 A;  1ZGW A;  1F5T A;  4BL0 B;  2E1M C;  4AIH A;  5E8I A;  4IXA A;  3QP5 A;  4RB3 C;  3TMO A;  1KA8 A;  1ZG1 A;  3L09 A;  4Q47 A;  4E7H A;  2CQ7 A;  2CV0 A;  4RGS A;  4IOA F;  2P6T A;  2H27 A;  4F92 B;  1FTZ A;  2LYC A;  3HGG A;  3IC7 A;  4B48 A;  4NHJ A;  4M6X A;  3F8C A;  2PN6 A;  1SD6 A;  2D1V A;  3FBN B;  3CCJ I;  1HW1 A;  3HKZ A;  2XPV A;  2HPM A;  1I6X A;  2XKP A;  4XKV A;  1N25 A;  3HM5 A;  4FE4 A;  2DMQ A;  4MO7 A;  2G7H A;  2F48 A;  1LVK A;  3M3Y J;  2EFW A;  6PAX A;  2L2O A;  3M1E A;  3RPU A;  2A5W A;  2EBI A;  4D0P A;  2NS0 A;  3MKW B;  1SVL A;  3KYD B;  1FBS A;  4XKC A;  2CW0 F;  4I0A A;  2P7V B;  2Y75 A;  1XMX A;  3RI4 A;  3WTT C;  1YRN B;  2B63 J;  3OS1 A;  3JRI A;  1FZP B;  3T1B A;  5D4S A;  1D1B A;  4FCY A;  2W85 A;  3H3U A;  2P81 A;  4XN3 A;  4I09 A;  4HEA 2;  1IN5 A;  2Z1D A;  4FET A;  4L9T A;  3F22 A;  3OYA A;  4YEL A;  3G3Z A;  3I4P A;  4XR6 A;  5ILU A;  1K4T A;  2LBF A;  4XSZ F;  1VQ4 I;  4II3 A;  1U6G A;  3TBI A;  1LFP A;  2LTP A;  4CIC A;  4UNO A;  2DK8 A;  3BPX A;  3CLQ A;  2ZXW H;  3CP2 A;  1RC9 A;  2I10 A;  4PDK A;  3HG9 A;  4MLO A;  4KN7 X;  3FXJ A;  5LEJ A;  3R61 A;  2K3P A;  4RBO A;  5EG0 B;  4GRI A;  4BHP A;  3WG9 A;  1TWH J;  4BJT A;  3RYR A;  3K1N A;  3IWF A;  1Y1V J;  5HLG A;  4NUB A;  2B9S A;  4MTE A;  3HOX J;  4BEH A;  4BU2 A;  2Y48 A;  3K1M A;  3TO9 A;  1QO0 D;  3MMY B;  4XKB A;  3CZ6 A;  2VIX A;  4OIN F;  1VQM I;  1G59 A;  2JTV A;  1KYW A;  3MQ0 A;  1MH4 A;  5AON A;  2EH3 A;  2K9L A;  2IS6 A;  4M9X A;  1XSD A;  1FYL A;  5IPA A;  1YG2 A;  4M71 A;  4UV9 A;  1FC3 A;  4G9Y A;  2XRL A;  2MYS A;  1V5E A;  3J7Z I;  2OTL I;  4IQJ A;  3DBR B;  2M3A A;  1D8J A;  4XRM A;  4H0E A;  2ID6 A;  2JSC A;  4UUS B;  1VQ8 I;  3HHG A;  2HOT A;  5C4X J;  3CMA I;  3PFY A;  1HCR A;  2HVQ A;  3H0G J;  1Z7U A;  3F21 A;  1QA6 A;  2XF5 A;  1Q1V A;  1A6Q A;  2KIM A;  5E1Z B;  4B47 A;  3K2A A;  1ITY A;  3AG2 H;  1YW7 A;  4BAC A;  2XKO A;  2PJP A;  1P4X A;  3ZGK A;  3K70 C;  1JHF A;  1JGS A;  1BOB A;  3GTP J;  1ZAO A;  2H1L A;  1YO5 C;  3DEW A;  3ERM A;  2RKH A;  2P6S A;  2XHK A;  5J6X A;  5KHD A;  4AIK A;  4V2G A;  3EQL F;  3ZQ7 A;  5DM7 F;  1JHH A;  3AL0 C;  4ESF A;  2GXG A;  4M3F A;  2YUS A;  5JHU A;  4MNU A;  3OYJ A;  1QZE A;  2HEO A;  4CZZ A;  2L01 A;  4RGR A;  2CG4 A;  5HOD A;  2KZG A;  2LRE A;  2PMZ A;  1KU9 A;  1X1B A;  3VOD A;  4IRG A;  1G2H A;  2LF7 A;  3RKX A;  5DD8 A;  3DTI A;  3S3M A;  2LDU A;  2EZH A;  2WA0 A;  3EPZ A;  5F0C A;  3C1D A;  2CMP A;  2OCC H;  1OR7 C;  4BKX A;  1O7F A;  3BP8 A;  2ZME A;  3L2U A;  4JX4 A;  4AVP A;  1VFC A;  1KU7 A;  4B3A A;  2BZT A;  3M9A A;  4MEY F;  3DEU A;  5TJJ A;  2DFE A;  3SEQ A;  3TDZ C;  1O3Q A;  3LAJ A;  2V1U A;  2L4M A;  3BC8 A;  3HEF A;  3PQK A;  5H6R A;  1LUJ B;  3MZ8 A;  5HDK A;  1MMA A;  5FLM J;  3CJT B;  2F2E A;  4PCQ A;  3WGG A;  1D0Y A;  2QQB A;  5HS8 A;  2L7M P;  4L18 B;  3DFG A;  5CPR B;  1YS6 A;  2F5C A;  2VQL A;  4HST A;  3TP3 A;  2MC3 A;  1K7A A;  4LG0 B;  3JSP A;  3F6O A;  3BY6 A;  3VEP A;  1FMW A;  1DP7 P;  1WJD A;  1SMY F;  2NS7 A;  5E3N A;  1U5T A;  5CJ9 A;  4LLN A;  2VQH A;  4NDL A;  3CME I;  4RLQ A;  3QOP A;  4GCV A;  3VYU B;  1MD0 A;  2F4O B;  3WTS C;  2CW7 A;  4BH9 A;  4GYG A;  2DT7 B;  2LFB A;  4IHW A;  1WKM A;  1ULY A;  2IGM A;  3WTU C;  3COA C;  3RJP A;  5L3D A;  4HNU A;  3S32 A;  3VPR A;  5J1U A;  3K7A J;  2JK3 A;  5EJC A;  2DBB A;  3RTR A;  3M07 A;  1I1G A;  2HXO A;  4XK4 A;  4WCG A;  4HSR A;  2VN2 A;  1X3Z B;  2GZW A;  2P0W A;  2VI6 A;  2EFO A;  2CH0 A;  3F0C A;  1QVU A;  3B02 A;  3D5L A;  2XGE A;  1BW6 A;  2V6E A;  3ZQQ A;  3BTI A;  4XOP A;  2HWV A;  1C0W A;  1H8A C;  3CCR I;  4KN4 X;  1TC3 C;  3CC4 I;  3K1P A;  1MW7 A;  3LSK A;  3LSG A; 
#chains in the Genus database with same CATH homology
 4WXD A;  4F7Z A;  3ECO A;  1DPR A;  1HQC A;  4BXU A;  4S04 A;  3F8F A;  2FE3 A;  3EET A;  3QP6 A;  2KJB A;  3F23 A;  4WK8 F;  1HBX G;  3IKV A;  1GXQ A;  5DCM A;  3BZ6 A;  1R1T A;  2E1N A;  1L0O C;  4G94 A;  1HW2 A;  2FU4 A;  3U1D A;  1S29 A;  5LHH A;  3WGI A;  4HDU A;  2VOP A;  1S7A A;  2OQG A;  1XD7 A;  2G9W A;  4QLC U;  4EV0 A;  3E6B A;  1R22 A;  4MTD A;  4IPA A;  1G3Y A;  5E1X A;  4A0Z A;  5LRS A;  1DUX C;  1R1V A;  1Z05 A;  4IVN A;  5D6F A;  3CUQ A;  4G6Q A;  3J81 K;  2HDC A;  1R00 A;  3Q9V A;  1HW5 A;  5BPD A;  1UHW A;  3ABU A;  2W84 A;  2HGC A;  4G7O F;  5CVR A;  2QM3 A;  4UHT A;  3B73 A;  4EJW A;  4LB5 A;  1TQM A;  2XRO A;  3FXQ A;  4ON0 A;  2MA3 A;  2WC2 A;  3RIR A;  1J9I A;  5ILS A;  2KKO A;  5ICE A;  3EYI A;  2ZJ2 A;  1WRJ A;  4NB5 A;  1SFE A;  2FMY A;  1BN5 A;  1HKT A;  2A61 A;  3K2Z A;  3CDH A;  5HS9 A;  3CUO A;  3I59 A;  3BWG A;  4HLY A;  5FFZ A;  5JVT A;  2Z5U A;  5FGM A;  3H3Z A;  1K79 A;  3RYP A;  3KE2 A;  2EV6 A;  3GUD A;  3WOD F;  2P5V A;  4G8X A;  3I54 A;  1ZRE A;  2NYX A;  2VT3 A;  3FX3 A;  5BQT A;  4L5I A;  2AXL A;  4KUM A;  3FMR A;  3R4K A;  1B6A A;  2GWR A;  4OMY A;  5HVQ C;  1G3T A;  3E6C C;  1ZGJ A;  3E6M A;  5DCM B;  2QQ9 A;  2ZO4 A;  5HDG A;  1G6N A;  2UWM A;  2YSR A;  1YLF A;  1FPQ A;  3DQV C;  5HS7 A;  3T5X A;  5D6E A;  2KRF A;  2FBK A;  2BYV E;  3KP3 A;  2XAQ A;  2PMU A;  1J75 A;  1DPU A;  1R5H A;  1XB4 A;  5ERI A;  1LDJ A;  3R0J A;  4OIR F;  4M72 A;  2QBY A;  3BDD A;  4PZJ A;  1EH6 A;  4S05 A;  2O03 A;  5DUI A;  1TLH B;  4UXN A;  1FT9 A;  1TW2 A;  3C3W A;  4UVC A;  1PDN C;  4L9N A;  4M9S A;  4ESB A;  1J59 A;  1RNL A;  4FX0 A;  3LWF A;  2EB7 A;  3CUQ C;  1TNT A;  2KIF A;  3GXO A;  2RNJ A;  3CO7 C;  2OD5 A;  4N9H A;  5E8G A;  3DV8 A;  1LJ9 A;  1W5T A;  4MEX F;  2VBZ A;  5DV5 A;  1R58 A;  3V7C A;  3GFL A;  5FO5 A;  4A2U A;  2FXA A;  3U9G A;  3ULQ B;  5D8K B;  3VB2 A;  3TO6 A;  2Q8K A;  3ELK A;  3QAH A;  3KFW X;  3TOB A;  1F4K A;  2FBH A;  3TDU C;  5A2Q K;  5FD5 A;  3HUG A;  4EJV A;  1T98 A;  2IW5 A;  2X0L A;  3WU1 B;  4YIF A;  5FB2 A;  2WWY A;  4OMZ A;  1TQP A;  1FWZ A;  1OR7 A;  4OOI A;  1CGP A;  4HX8 A;  2JT1 A;  2L3D A;  1QGP A;  2HYF A;  2DQR A;  5DYM A;  1WI9 A;  4HF0 A;  2ISY A;  4IF4 A;  3KEQ A;  2EA4 A;  3O6B B;  3CLO A;  5ICC A;  3F6V A;  5D8L B;  2M87 A;  3ZPL A;  2XAJ A;  3HSF A;  1R1U A;  2BGC A;  2HOE A;  5HDN A;  3WTY C;  2M8E A;  1FSE A;  4G7H F;  2JRT A;  4L5J A;  5CVU A;  1RUO A;  2VBW A;  4A0Y A;  2FBI A;  1B59 A;  2RVC A;  1W7P A;  1LDD A;  2A69 F;  1E17 A;  4HW0 A;  1RZ4 A;  1ZN2 A;  2UXX A;  1HKQ A;  2RGV A;  2JZY A;  3ZMD A;  2FEZ A;  2JPC A;  1G3W A;  4EVI A;  5D4R A;  1B9N A;  3WTZ A;  2M5W A;  3MWM A;  4EMS A;  5CVV A;  3J80 Z;  2MLK A;  1YQA A;  3GFM A;  2NAZ A;  4EJU A;  3FXR A;  4I7H A;  2DT5 A;  1P4A A;  3GWZ A;  3HRT A;  1XSV A;  2QEN A;  3GZ6 A;  2H09 A;  1KYZ A;  5E20 A;  3TKY A;  3VOE A;  2P8T A;  5A2Q Z;  1QBJ A;  2MH9 A;  1BOA A;  1PP7 U;  1UHM A;  4HOB A;  4B09 A;  3O3K A;  1WQ2 A;  4GYI A;  1TNS A;  4CHU A;  4ZH4 F;  1BI1 A;  1NHA A;  5E17 F;  2Z3Y A;  1BI3 A;  2R3S A;  4P96 A;  3I58 A;  2L4A A;  1LEB A;  1CF7 B;  3LFK A;  1U5T C;  2FNA A;  3D0S A;  2DAO A;  1PUE E;  2HZT A;  1R36 A;  2ZFW A;  1I5Z A;  3K69 A;  4ASN A;  4A0X A;  1MJA A;  3T8R A;  5JFR A;  4FX4 A;  4M6Y A;  2ADU A;  2V79 A;  2ACJ A;  5BS6 A;  1SAX A;  4CO8 A;  1IF1 A;  2RQP A;  4MQ9 F;  3WE2 A;  1YYV A;  4RGU A;  1S6L A;  2OZ6 A;  1QZZ A;  2DI3 A;  2PMH A;  4XRF A;  5L3G A;  4YII A;  2JPB A;  4HX4 A;  1XGM A;  3EUH A;  1BC7 C;  3C18 A;  1U5T B;  3KET A;  3GO5 A;  4LB6 B;  3F8N A;  4KT5 C;  1FBQ A;  2XGX A;  1GVJ A;  3ZN1 A;  4IJA A;  1W7P D;  2YR2 A;  2ZCW A;  1KQ9 A;  4KMU X;  4EM2 A;  2PFB A;  1ZRC A;  3LST A;  1YW9 A;  3GFJ A;  5J8C A;  1CF7 A;  5ILV A;  2A5Y B;  3VFZ A;  3L7W A;  2FA5 A;  1AOY A;  5BOX A;  2RC4 A;  2FSW A;  1S3J A;  3ZP5 A;  4HV5 A;  4IRI A;  3N4M A;  3GW2 A;  1W7P B;  5HLI A;  5ICG A;  1Z6T A;  3REO A;  1W4M A;  4CXF A;  4HYE A;  5LEK A;  2STT A;  3Q9S A;  1WWX A;  1SD4 A;  5F1R A;  1Y0U A;  4GGG A;  1FP2 A;  2OZU A;  3AAF A;  4MQV A;  3JW4 A;  3E3V A;  1A04 A;  4JBA A;  2XAG A;  1U2W A;  5H20 A;  5K5Q A;  3KP6 A;  3CJN A;  4N0B A;  3LQQ A;  4M9Z A;  4K2E A;  2CQK A;  2CYY A;  1USS A;  2BE5 F;  1U3E M;  2XVC A;  1R23 A;  1KGS A;  1F9N A;  3I71 A;  4R1H A;  4HAM A;  3OV8 A;  3RKW A;  4N9I A;  3MEX A;  1SFU A;  4HDV A;  2HTJ A;  4I2O A;  3F72 A;  5FLX K;  4I01 A;  2DQL A;  5J8F A;  3MCZ A;  1D3Y A;  3M7G A;  1ON1 A;  1LVA A;  2GA2 A;  2VOD A;  3HRM A;  3SFZ A;  3HRU A;  3V8J A;  3I0T A;  1FLI A;  2F5F A;  1R5G A;  3BRO A;  2VE8 A;  2HS5 A;  2QUF A;  2GQQ A;  2IA1 A;  1RIO H;  2B0L A;  5H6Q A;  2STW A;  2ZME B;  4IHT A;  2O0Y A;  1HXD A;  2EK5 A;  1X3U A;  4FT8 A;  4XBF A;  1J5Y A;  3KEO A;  5CLS A;  1QZY A;  2HQN A;  5EEG A;  3F3X A;  5LHI A;  5HLH A;  2PLY A;  1J0R A;  1EV7 A;  2RDP A;  1FBU A;  4CDG A;  1T39 A;  2UXN A;  3V8K A;  1FY7 A;  2EWN A;  2R7F A;  2ESN A;  3IL2 A;  1ZG3 A;  2E1C A;  2BBY A;  4PGG A;  4P9U A;  2OAZ A;  1H9T A;  3T0Y A;  2PEX A;  2WTE A;  1B1B A;  1XCV A;  2FML A;  3ZN0 A;  2ZXJ A;  4Z2Y A;  1D5V A;  4HF2 A;  3ROU A;  3QU3 A;  2H94 A;  4KNY A;  1MDM B;  5CVI A;  4XLN F;  4WWC A;  1ZYR F;  1S7O A;  1L3L A;  2IT0 A;  3H92 A;  5AIQ A;  1IRF A;  3KZY A;  1IRG A;  3DP7 A;  2WV0 A;  3EDP A;  4LD5 A;  5FLX Z;  1QPM A;  3HIF A;  5KK1 A;  1E2X A;  3IRQ A;  4ZYE A;  4KIB A;  1XDS A;  5KVR A;  1ON2 A;  2LNB A;  1FP1 D;  2GAU A;  2ZNY A;  5D5U B;  1VTN C;  1T2K A;  2CO5 A;  3ZMZ A;  5JR3 A;  2V1X A;  4I02 A;  2VC0 A;  4LK1 F;  3MFK A;  1XMA A;  2VBY A;  4YFN F;  4ZZD A;  1K6O A;  1LQ1 A;  4I98 B;  4LK0 F;  4RB2 C;  4KA4 A;  1G4D A;  4E70 A;  2OQR A;  4PGH A;  2QBY B;  5ED4 A;  4R8H A;  1IN4 A;  3HTS B;  3GVA A;  2K02 A;  3FMS A;  3LA2 A;  1EH7 A;  1J2X A;  2O6G E;  5DDG A;  3NQO A;  1IAW A;  5LLQ A;  3I64 A;  1JE8 A;  1TBX A;  4U0V A;  4EJT A;  4BHB A;  2MD5 A;  3L00 A;  4LMY A;  2HFH A;  2K7L A;  2ESH A;  2G7U A;  4OU0 A;  3SZP A;  4AIJ A;  3WU0 A;  1DDN A;  4BAY A;  4Q4Z F;  2TDX A;  4YG2 F;  4HX7 A;  3DPT A;  2FNP A;  3IKT A;  4RGX A;  2IA0 A;  2R7D A;  2O8X A;  2QWW A;  4RS8 A;  1YFH A;  2ETH A;  3SXY A;  3MAJ A;  3TOA A;  2PQ8 A;  1IN7 A;  3DPL C;  3FF5 A;  4O5V A;  3ISP A;  4RAY A;  1FNN A;  5D5V B;  2X4H A;  2D1H A;  1UFM A;  3QPH A;  4U0W A;  4HA8 A;  3J80 K;  1B9M A;  1GXP A;  5DUK A;  4ENN A;  1V3F A;  1JXS A;  2V1D A;  2K86 A;  1T6S A;  1I27 A;  2EV0 A;  1BIA A;  1SD7 A;  3E5Q A;  5L3C A;  3ERE D;  1ZLJ A;  3F8M A;  5E18 F;  2QLZ A;  3CTA A;  3K9T A;  2VOO A;  2OBP A;  2Q2E A;  3W6J B;  5LGN A;  1ODD A;  3KP2 A;  1Z1D A;  2CGP A;  4GXO A;  2W25 A;  3V4G A;  4R79 A;  4P5O A;  5D5X B;  1BC8 C;  3DF8 A;  1P2F A;  4LFU A;  2H6B A;  3S2W A;  2LSO A;  4U88 A;  3QU6 A;  2P4W A;  2M1B A;  2LF8 A;  1FYM A;  3KLO A;  1ZRD A;  2Z9O A;  1V4R A;  1FX7 A;  1OYY A;  4ENK A;  1P92 A;  3HRS A;  3P9K A;  2FQ3 A;  4KIF A;  3HSR A;  3I53 A;  1QNT A;  2EFP A;  3GF2 A;  1KQ0 A;  2W24 A;  4NQW A;  2K27 A;  2XRN A;  3PQJ A;  1SMT A;  3KZZ A;  4UV8 A;  3ZMV A;  5DEQ A;  4CGZ A;  4A5M A;  4O3M A;  2KJC A;  3JTH A;  5IT9 K;  4EGY A;  5EEH A;  2P5K A;  1BM9 A;  4A5N A;  4AD9 A;  2P5L C;  3TO7 A;  4BNC A;  1KU2 A;  4DNC A;  3BJ6 A;  2HTS A;  4YFK F;  4TV7 A;  1KQ8 A;  3KP4 A;  1TQI A;  2VON A;  2Q0O A;  1F1Z A;  4Y15 A;  1LB2 A;  1FOK A;  5D5W B;  3TGN A;  3W6K B;  1QQI A;  2VC1 A;  3BJO A;  4Q48 A;  1ZHF A;  1FYK A;  2XAS A;  1BI0 A;  2GA1 A;  5ICF A;  3WGH A;  5FFX A;  2Z33 A;  3NRV A;  5LGT A;  1IN6 A;  2NNN A;  4HZF A;  5K5O A;  3JTG A;  2PG4 A;  4OIQ F;  2LKP A;  2O3F A;  3MZY A;  3JSO A;  1BIB A;  1H9G A;  1MJ9 A;  4FHT A;  2PI0 A;  3IHU A;  4HBL A;  3HOS A;  3OOP A;  2AS5 F;  1MGT A;  3V7S A;  1ZLK A;  1U8R A;  3KLN A;  2HQR A;  1BJA A;  4IRH A;  4LJZ F;  2Y0M A;  1AWC A;  4EJO A;  2QZ8 A;  3BOQ A;  5IT3 A;  1IXC A;  4L0Y B;  4M73 A;  3ZMU A;  4EM1 A;  5F64 A;  4U7D A;  2KIU A;  3WTW C;  5IT9 Z;  2L02 A;  3F8B A;  4EQQ A;  2XAF A;  2COM A;  2DFI A;  2MBF A;  3EYY A;  4EM0 B;  1XDU A;  4ZYG A;  4LG0 A;  1ZRF A;  5F6F A;  2V6C A;  1Z6R A;  4EGZ A;  3V7R A;  2PBI A;  2HR3 A;  1OPC A;  3ZMS A;  1XGS A;  3MZH A;  1P6R A;  2DTR A;  2Z99 A;  1HKS A;  2XAH A;  4CYD A;  2EFQ A;  1PP8 F;  2J5P A;  4AWX B;  3HTU A;  2HKO A;  1HST A;  2FRH A;  3ZMT A;  3J7A O;  4HQE A;  5K5R A;  4G6D A;  3NEU A;  2FOK A;  5LGU A;  2W57 A;  3FZV A;  3JAM Z;  1O3S A;  3J81 Z;  3E6D A;  5E1W A;  4O6J A;  1GHC A;  1TW3 A;  1T38 A;  4B8X A;  1LEA A;  2D2W A;  1HSJ A;  3FM5 A;  1XMK A;  1U78 A;  1MKM A;  2YX7 A;  4GO1 A;  4ZYH A;  2MLG A;  4ETS A;  5BPI A;  3LAP A;  2GIV A;  3G73 A;  5L3B A;  2DPD A;  4RB1 A;  1KU3 A;  3E5U A;  3HHH A;  2FF4 A;  4BQA A;  4OIO F;  3I5U A;  3KP7 A;  4KIC A;  1STZ A;  3E97 A;  3BJA A;  3R0A A;  4ESJ A;  2J5O A;  3FWE A;  1XCB A;  4WX9 A;  3SZT A;  3DXJ F;  3O2P E;  2IJL A;  4I0B A;  4HV6 A;  3JAM K;  2UZK A;  2XV4 S;  1S8N A;  3PFI A;  2OU2 A;  4G7Z F;  4XSX F;  4WXH A;  1Z9C A;  2M45 A;  2VXZ A;  1LNW A;  4JQF A;  3L2C A;  1Z91 A;  3L9F A;  3HYI A;  3RDI A;  4M74 A;  4L9J A;  1O3T A;  3RPQ A;  3GLX A;  1XGN A;  1RI7 A;  4L9V A;  4JK1 X;  2DO7 A;  4U0Y A;  5K1Y A;  5LBQ A;  3GX4 X;  1I1S A;  2IP2 A;  2IPQ X;  1EH8 A;  1SFX A;  2DK5 A;  4UVA A;  1BI2 A;  3HSE A;  3TQN A;  4U7B A;  4DQ2 A;  2ISZ A;  4MHG A;  1XGO A;  1OYW A;  5LHG A;  1IN8 A;  1FSH A;  3GFI A;  4L0Z B;  4LLL A;  1IXS B;  2V9V A;  3R6S A;  3FHZ A;  2K4J A;  4BYY A;  2CFX A;  5JI6 A;  1IXR C;  2XIG A;  3M8F A;  1UCR A;  4LLG F;  3FXU A;  3HOT A;  2VE9 A;  2A6E F;  4P9F A;  1MJB A;  3DKW A;  4UVB A;  5LRR A;  4RAZ A;  1D8K A;  2O61 A;  5CVJ A;  1LDK B;  2NRA C;  2MH2 A;  3ML6 A;  2ZKZ A;  2RV8 A;  2EJR A;  2C6Y A;  2YU3 A;  3GYH X;  1TTY A;  4YFX F;  2RN7 A;  2E7X A;  1B4A A;  4UUV A;  3KP5 A;  2DW4 A;  4Y13 A;  1UST A;  4Q5S F;  2P7C B;  2EA2 A;  1O57 A;  2YPR A;  2NNY A;  1XN7 A;  3LA3 A;  2F5E A;  1K78 B;  2F5D A;  2HYG D;  3QRF F;  4A6D A;  2DLL A;  2A6H F;  2BV6 A;  1ZG5 A;  2A07 F;  2QYO A;  5DCF A;  1IUY A;  1G3S A;  2QVO A;  3E5X A;  1YTY A;  1J7K A;  2H6C A;  3U2R A;  1YS7 A;  3SQN A;  2GXB A;  4RB0 A;  3LQR A;  1ONV A;  5AIP A;  3P9C A;  5HOO A;  1K78 A;  4XLP F;  4KIG A;  2YX4 A;  1T0F A;  1ZGA A;  4A12 A;  4BHC A;  4A6E A;  2DPU A;  3C7J A;  1W5S A;  4ENJ A;  4WF2 A;  3CUQ B;  4HLX A;  2ELH A;  3N97 A;  2M30 A;  1IW7 F;  1OYI A;  5TRD A;  3RKY A;  4P55 A;  3SHF A;  4ZZL A;  3T8T A;  1MZB A;  3WTX C;  4MGR A;  1O3R A;  1Q1H A;  4Y17 A;  1IZ1 A;  3CO6 C;  3BPV A;  3Q5F A;  3WE3 A;  2DU9 A;  3KCC A;  3P9I A;  4KMF A;  2EFN A;  4HF1 A;  2OA4 A;  4KFC A;  1O7L A;  2HKX A;  1XSX A;  4IHS A;  3FM3 A;  5BMZ A;  1REP C;  2IVM A;  4ENM A;  2XUB A;  2BEO A;  3V8L A;  4OIP F;  5L3F A;  3IWZ A;  3LA7 A;  1YIO A;  4HQM A;  3R60 A;  3QPT A;  2EV5 A;  5CYV A;  1H0M A;  2K4B A;  1SD5 A;  1ZAR A;  2IA2 A;  3FMQ A;  2E7W A;  1OKR A;  1MDM A;  1YW8 A;  4QWQ A;  2QQA A;  2VT2 A;  3M8E A;  3K0L A;  1BBY A;  1P4W A;  5DD4 A;  3I59 B;  3GEZ A;  4LGW A;  2ZNZ A;  2CSO A;  2A3S A;  3P7N A;  1WSU A;  1UB9 A;  2IRF G;  1R7J A;  1RUN A;  3ECH A;  2VBX A;  2CWE A;  4KDP A;  2ZBK A;  3ABT A;  3IRR A;  2A68 F;  1OMI A;  5FD6 A;  3WTV C;  5L3E A;  4WXC A;  4KYW A;  2D45 A;  4ZYD A;  2L54 A;  1ZH5 A;  3GZ5 A;  1F5T A;  5E8I A;  4AIH A;  4IXA A;  3QP5 A;  4RB3 C;  1KA8 A;  1ZG1 A;  3L09 A;  4Q47 A;  4RGS A;  2P6T A;  2H27 A;  3IC7 A;  4NHJ A;  4M6X A;  3F8C A;  2PN6 A;  1SD6 A;  2D1V A;  1HW1 A;  1I6X A;  2XKP A;  2G7H A;  2EFW A;  6PAX A;  3M1E A;  3RPU A;  4D0P A;  2NS0 A;  1FBS A;  2CW0 F;  4I0A A;  2P7V B;  2Y75 A;  3RI4 A;  3WTT C;  1FZP B;  3T1B A;  5D4S A;  2W85 A;  3H3U A;  4I09 A;  4L9T A;  1IN5 A;  3F22 A;  3G3Z A;  3I4P A;  5ILU A;  4XSZ F;  1U6G A;  4CIC A;  4UNO A;  2DK8 A;  3BPX A;  4PDK A;  4KN7 X;  5LEJ A;  3R61 A;  4BHP A;  3WG9 A;  3RYR A;  3K1N A;  3IWF A;  5HLG A;  4MTE A;  2Y48 A;  3K1M A;  3TO9 A;  1QO0 D;  4OIN F;  2JTV A;  1KYW A;  3MQ0 A;  5AON A;  1FYL A;  4M9X A;  1XSD A;  1YG2 A;  4M71 A;  4UV9 A;  1FC3 A;  4G9Y A;  1D8J A;  4H0E A;  2JSC A;  3HHG A;  1Z7U A;  3F21 A;  2KIM A;  5E1Z B;  1YW7 A;  2PJP A;  2XKO A;  1P4X A;  1JHF A;  1JGS A;  1ZAO A;  1YO5 C;  2RKH A;  2P6S A;  2XHK A;  5J6X A;  4AIK A;  3ZQ7 A;  3EQL F;  1JHH A;  4ESF A;  2GXG A;  5JHU A;  4MNU A;  2HEO A;  4CZZ A;  2L01 A;  4RGR A;  2CG4 A;  3VOD A;  1KU9 A;  4IRG A;  2LF7 A;  3RKX A;  5DD8 A;  2LDU A;  3C1D A;  1O7F A;  3BP8 A;  2ZME A;  4AVP A;  1KU7 A;  3M9A A;  4MEY F;  3DEU A;  5TJJ A;  3TDZ C;  1O3Q A;  3LAJ A;  2V1U A;  2L4M A;  3PQK A;  5H6R A;  5HDK A;  2F2E A;  4PCQ A;  3WGG A;  2QQB A;  5HS8 A;  4L18 B;  3DFG A;  1YS6 A;  2F5C A;  2MC3 A;  1K7A A;  4LG0 B;  3JSP A;  3F6O A;  3BY6 A;  1DP7 P;  3VEP A;  1SMY F;  1U5T A;  5CJ9 A;  4LLN A;  3QOP A;  4GCV A;  1MD0 A;  3WTS C;  4BH9 A;  4GYG A;  1WKM A;  1ULY A;  3WTU C;  3COA C;  3RJP A;  5L3D A;  2DBB A;  3RTR A;  1I1G A;  4WCG A;  2VN2 A;  2GZW A;  2EFO A;  3B02 A;  3D5L A;  2HWV A;  1C0W A;  4KN4 X;  3K1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...