1LDDA

Structure of the cul1-rbx1-skp1-f boxskp2 scf ubiquitin ligase complex
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
74
structure length
74
Chain Sequence
KYELTLQRSLPFIEGMLTNLGAMKLHKIHSFLKITVPKDWGYNRITLQQLEGYLNTLADEGRLKYIANGSYEIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Anaphase Promoting Complex
publication title Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase
total genus 21
structure length 74
sequence length 74
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08672 ANAPC2 Anaphase promoting complex (APC) subunit 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1lddA00
4CDGA 5E8IA 2XUBA 2V79A 5DUIA 1BI2A 1HXDA 3M7GA 5BPDA 2BEOA 5BS6A 4M71A 1PDNC 2K02A 5A2QZ 2FBHA 4KMUX 4LD5A 4EVIA 1D5VA 3I0TA 2RDPA 4B8XA 1U2WA 2XKPA 5E8GA 3C3WA 1P6RA 2CSOA 5DD8A 3I53A 5HDNA 3WTXC 2EV5A 2VN2A 1PP7U 2FBIA 2VBYA 5ICGA 4HF2A 2D1HA 1Q1HA 2B0LA 2K86A 1PUEE 2QM3A 4ASNA 3BZ6A 3GFLA 5EEHA 2OZ6A 2YX7A 3M1EA 3T0YA 2VONA 4U0YA 4M9ZA 3WE3A 2P7VB 4R8HA 1BI1A 2Z33A 1ZG1A 3SHFA 1FZPB 3FZVA 3Q9SA 2EK5A 3KCCA 2D2WA 1B59A 5E17F 3GUDA 2HTJA 5CVJA 2P5KA 3SFZA 5TJJA 1FBSA 1IRGA 2M8EA 3V8LA 4EJTA 1Z9CA 2CGPA 3G3ZA 2RGVA 2QQ9A 5DUKA 1FC3A 3TKYA 4L0YB 3BWGA 5HVQC 4KN4X 5JFRA 3K1NA 3LSTA 1TNSA 2EB7A 2HFHA 3CTAA 3KE2A 4UXNA 4UVBA 1RIOH 3C7JA 1FX7A 2XKOA 4MQVA 4HLXA 3HRMA 4L5IA 2KJCA 1KQ0A 1W4MA 2DK5A 3E6MA 4S04A 3T5XA 4ZZDA 4MEXF 1DPRA 1S8NA 1H9TA 2NRAC 3WTUC 3R61A 1T39A 1FSEA 2LF7A 1TNTA 2NNYA 2RKHA 1IXCA 4EJUA 1Z6TA 1HQCA 5LBQA 4FX4A 3WTWC 2PFBA 3CDHA 2ZCWA 3V4GA 1KU7A 2A6EF 3ZMUA 1E17A 1IXRC 1S6LA 3GF2A 2QZ8A 4Z2YA 1LEBA 2EFQA 2G7UA 2HKXA 2CFXA 3COAC 1ZREA 4E70A 2E1NA 3H3ZA 1YW7A 4GYIA 4IHTA 1STZA 5D5WB 2LKPA 1F5TA 1DUXC 5F64A 1FYMA 1S3JA 3RTRA 1F9NA 2O61A 1O7FA 4ZYEA 3VODA 4BAYA 2HYGD 4M6YA 1W5TA 2XGXA 4HBLA 1W7PD 5FD5A 1FSHA 3HRUA 2EFNA 1SFEA 2VBZA 2FXAA 4Q4ZF 2KIMA 3WTSC 2HS5A 4EJVA 1TBXA 1IN7A 4M73A 4LLGF 1HW5A 4RS8A 4G6DA 4EM1A 5JI6A 3IC7A 1XMAA 4CICA 3GW2A 5E18F 1J5YA 5BPIA 3O6BB 4Q47A 1U5TC 2YPRA 1CF7B 3LAJA 2COMA 2FSWA 1K6OA 4M72A 5D5UB 3BOQA 4HF1A 3JAMK 2OA4A 1IXSB 1TW3A 1OYWA 3VEPA 2E1CA 1YIOA 4BXUA 4YIIA 4KN7X 4M6XA 4IJAA 2C6YA 1P92A 4UV9A 1D3YA 2WV0A 4I7HA 1KQ9A 3T1BA 5JR3A 2H6CA 1SD5A 4ON0A 2XAHA 1A04A 1YW9A 1UCRA 4WCGA 1LDDA 1FNNA 3FMSA 3KP6A 3TOAA 1BN5A 1O3TA 3ZN1A 3SQNA 1W7PA 3GFIA 2Q2EA 2DTRA 3MEXA 2JTVA 1HKTA 2GA1A 4L5JA 3F8MA 2A3SA 5LRRA 2EJRA 4LFUA 2IPQX 3NRVA 3HTUA 4I98B 3REOA 3I59A 3WGGA 3I58A 1XSVA 4LGWA 1LEAA 3K9TA 2HTSA 1I6XA 3CUOA 4HQEA 4U0VA 5FD6A 1O3RA 3E6CC 1YLFA 2OU2A 1YFHA 2GWRA 3E6DA 4Q5SF 1QGPA 3HIFA 3DFGA 3LWFA 2H94A 3BP8A 4DQ2A 3S2WA 4L9JA 2DU9A 1BC8C 1USTA 1WSUA 2DBBA 2H09A 4U0WA 3O2PE 2VODA 4AIKA 2OBPA 1IN5A 1J0RA 3R0JA 2AS5F 4ESJA 4G7HF 1LQ1A 4U7BA 5D5VB 3HSRA 3MCZA 1CGPA 1XCBA 5CJ9A 2LF8A 2LDUA 5HLGA 2DW4A 2FEZA 5DD4A 4G7ZF 2IRFG 1FPQA 2P6SA 4BQAA 1OKRA 4I2OA 1F4KA 3W6KB 1YS6A 4O3MA 1D8KA 3KFWX 2UZKA 3GVAA 3IWZA 2MBFA 4P9UA 1SAXA 4KNYA 1IW7F 2E7XA 3ELKA 3LQQA 1ZG3A 2HWVA 4G7OF 3NQOA 2MLGA 2O0YA 3CO7C 5E1ZB 5D6FA 1REPC 3K1MA 4Y17A 2RQPA 3U2RA 5H20A 3HHGA 4A0YA 1U78A 4H0EA 3WTVC 1ON2A 2PBIA 3F8NA 3IRQA 2R7FA 5DEQA 4D0PA 4P55A 5DCMA 4UUVA 1XN7A 3ZMZA 2HQRA 1Z91A 2AXLA 4ZYDA 2FBKA 2MH9A 2O6GE 3MAJA 4XLPF 1BI3A 4JQFA 2XROA 4XSXF 1LJ9A 1XSXA 3KEOA 3ZMDA 2PJPA 2DAOA 3HYIA 3WGHA 1QO0D 1DDNA 2W85A 1YG2A 3KP4A 3RJPA 4OIRF 4HDUA 1J59A 4HDVA 2YSRA 3C18A 3KLNA 3K0LA 1XGNA 4CXFA 1YTYA 4UVAA 3WTTC 3P7NA 2W24A 2VC1A 3RKYA 5KK1A 4BNCA 4RGRA 2MLKA 4GO1A 2KRFA 1R23A 3CUQA 3M8EA 1GXQA 5FLXZ 2HYFA 2F5CA 5L3DA 3HRSA 3RKWA 3I71A 4I01A 3TO9A 1T98A 1HKQA 1BBYA 4OMZA 2Z9OA 5LGNA 3QP6A 1F1ZA 4HLYA 3MWMA 2OAZA 2IT0A 5DV5A 1UHWA 4LLLA 2ADUA 3F6VA 2XIGA 2YU3A 4YFNF 5EEGA 3BDDA 3R60A 2EFWA 4MTEA 4HW0A 4NB5A 1BIAA 1U3EM 5LGUA 2NS0A 2O8XA 2O3FA 3ISPA 2L3DA 1SFXA 4PZJA 2L02A 1QQIA 1HBXG 4WF2A 1J7KA 1ZLKA 4JBAA 1USSA 2RVCA 1BC7C 3RIRA 4LB6B 4IRIA 4NHJA 2P6TA 5HS9A 1G3YA 2YX4A 5ICEA 2P8TA 1KYWA 3EYIA 3H3UA 2H6BA 2XVCA 2IP2A 4OU0A 5AIPA 5HS8A 1TQMA 4A6DA 3GZ5A 2IA0A 4WXDA 4P9FA 3F72A 1P4AA 2Y0MA 3HOSA 2Q8KA 5CVVA 3B02A 1JE8A 2W57A 4EGZA 3KZYA 3BJAA 2G7HA 4CO8A 2XAQA 2X0LA 2EA2A 1Z05A 2HR3A 2FRHA 4JK1X 5FLXK 2VOOA 2O03A 1UHMA 1H0MA 4PGHA 1ZH5A 1ZHFA 4A12A 1B1BA 5LLQA 2L01A 4PGGA 3ERED 2A07F 2VOPA 1DPUA 4KYWA 3E5UA 4R79A 4ENNA 1EV7A 1GXPA 1R1UA 2DK8A 3KP5A 5A2QK 4LG0B 2GQQA 2HZTA 1R36A 3IHUA 4HYEA 4A0XA 3QPTA 2Y48A 1G3TA 5LHIA 4KDPA 3GLXA 3ZMVA 3FXUA 2RV8A 4EV0A 2L54A 3PQJA 3ABTA 2JZYA 3KEQA 2W84A 1QZZA 3DXJF 3ZP5A 1T2KA 2STTA 1I5ZA 3T8RA 1OR7A 3TDZC 4XLNF 1E2XA 1I1GA 2JSCA 1R5GA 3JTGA 2GZWA 4A6EA 2ISZA 2BBYA 2HGCA 3ZQ7A 1BM9A 3K2ZA 2OD5A 3BJOA 1XGOA 4LG0A 2EFPA 1U5TB 1ZRCA 1SMYF 2HDCA 4HZFA 2UWMA 5HLHA 2PQ8A 1B6AA 1U6GA 1K78B 3V7CA 1J2XA 4LK0F 3RI4A 2FOKA 2PMHA 5BOXA 5IT9Z 1R58A 2ZO4A 3GX4X 2GXGA 1DP7P 3WGIA 3E97A 2ZNZA 2KKOA 6PAXA 4UNOA 4ZYHA 1QZYA 2DO7A 3RDIA 3JSPA 1R22A 2QBYB 4EQQA 1U5TA 3L09A 1LVAA 4HX8A 5HDGA 3QOPA 4GCVA 5L3GA 4A5MA 3J80Z 1MKMA 4FHTA 1CF7A 3HRTA 2F5EA 1FYKA 2BYVE 3I54A 5BQTA 4RB0A 1YS7A 4G6QA 4G8XA 5HLIA 2GXBA 3HTSB 4EJWA 2IW5A 4ENJA 1FLIA 5LRSA 5LEJA 2VXZA 3PQKA 1XDUA 2FQ3A 2BGCA 5ICFA 2ISYA 3BPXA 5H6RA 3IWFA 3P9KA 5ED4A 5CYVA 1B4AA 1BI0A 4GGGA 3ABUA 4OIOF 2F5DA 3EETA 1WQ2A 2J5OA 3L9FA 4I0AA 2VT3A 2NNNA 2FMLA 3GFMA 4L9NA 2F2EA 3FX3A 2VE9A 1G6NA 1YO5C 2QQBA 1FYLA 2ELHA 1ZLJA 3ZMSA 5CVRA 2M30A 5D6EA 1XGMA 4MHGA 1XD7A 2EA4A 4A0ZA 5IT9K 1K7AA 2OQRA 3FM3A 3CO6C 4FX0A 4KMFA 1X3UA 3DPLC 1Z7UA 2XASA 3DKWA 3F22A 1FY7A 5CLSA 5D8KB 1ZYRF 1ZGAA 2VBWA 3HHHA 2RC4A 2M87A 5DDGA 3N97A 2UXNA 1HSTA 1FWZA 1ZRFA 2Z3YA 1S29A 3FMRA 4O6JA 1K79A 3ECOA 3L00A 1XMKA 3GYHX 3DQVC 4CGZA 2E7WA 4DNCA 4I0BA 3RYPA 3K1PA 3W6JB 4KIFA 4HQMA 2QQAA 1O7LA 1JHFA 2MA3A 1O3SA 3P9IA 1IAWA 1O57A 5J6XA 1MDMB 3J80K 4ENMA 1J75A 2DQLA 1Z1DA 2F5FA 2CQKA 4ZH4F 1YYVA 2KIFA 3LAPA 1IN4A 3FHZA 2DQRA 2LSOA 4KICA 3QP5A 4Y15A 4TV7A 1MZBA 2TDXA 1GHCA 4O5VA 3P9CA 3E5XA 1LB2A 4HX7A 4I02A 3EQLF 4CHUA 2IJLA 4HV6A 1ZG5A 2P5LC 3GWZA 4WWCA 2ZKZA 4PDKA 4IRGA 2P4WA 4EGYA 1LDJA 4QLCU 2ZFWA 3DEUA 2EFOA 3RKXA 3V8JA 3QU6A 3LFKA 2ZXJA 3WG9A 3F21A 2JPCA 4RAZA 1OPCA 4KT5C 3KETA 3G73A 1QPMA 5AONA 2JRTA 3KP2A 1IF1A 1HKSA 2WC2A 2IA2A 3ECHA 2OZUA 1FT9A 5K5OA 4HX4A 4BHPA 4YIFA 1R5HA 5E1WA 5BMZA 3Q9VA 1MJAA 2MC3A 2YR2A 1RZ4A 3FM5A 2DT5A 3WTZA 3MFKA 3FXRA 4N9IA 1HSJA 2K27A 1WWXA 1ULYA 3EDPA 5FB2A 3DV8A 4HF0A 1SD7A 2MD5A 3V8KA 1FP1D 2K4BA 4IVNA 3RYRA 3F8CA 5LGTA 3GZ6A 4PCQA 4IXAA 2V1XA 2QLZA 4M74A 3OOPA 3FF5A 1ZRDA 4RGSA 2W25A 5D5XB 1IN8A 4EM0B 3ML6A 2L4MA 2A6HF 3FXQA 3TDUC 1QBJA 3SXYA 1S7AA 4A2UA 5CVUA 2D1VA 1SMTA 3LA3A 1TW2A 5ERIA 2KJBA 1ON1A 2VT2A 2QWWA 4LLNA 2FNPA 3WU0A 2DPUA 4AVPA 2X4HA 4AIJA 1BJAA 1EH6A 4Y13A 3CJNA 4NQWA 4UVCA 3WE2A 1KU2A 3TGNA 3R4KA 1MJBA 4KA4A 4XRFA 3D5LA 1AOYA 5LHHA 3HOTA 4MTDA 2XHKA 3DP7A 2HKOA 2FMYA 4WX9A 4YG2F 2M45A 2BV6A 1MD0A 2IVMA 4EMSA 1G3WA 2JT1A 3JSOA 4YFKF 4RB3C 1P4WA 1SD6A 1YQAA 4U88A 5L3CA 4G9YA 2STWA 1G3SA 4RGUA 1P2FA 3L2CA 2DLLA 5J8CA 4HAMA 3QRFF 1XB4A 2CG4A 4M9SA 3U9GA 4L9TA 4A5NA 3LA2A 4UV8A 4S05A 1T6SA 2ETHA 3F6OA 1EH7A 5HDKA 5DYMA 1JXSA 2A5YB 4KFCA 3TO7A 4CZZA 1P4XA 3JAMZ 1I1SA 1V4RA 2J5PA 4MEYF 3HUGA 3F3XA 5FFXA 5K5RA 2K7LA 3IRRA 4L0ZB 2ESHA 2HQNA 1KGSA 2PLYA 1FBQA 2DFIA 1MGTA 4ESBA 4ETSA 3V7SA 3E6BA 5CVIA 3WODF 2G9WA 4GYGA 4UHTA 3ROUA 4B09A 3BROA 4EJOA 1R1VA 4Q48A 2FNAA 2OQGA 2QENA 2EV6A 1MJ9A 1XDSA 3IKVA 2A69F 5F1RA 4N9HA 1JGSA 1BIBA 1HW1A 1KQ8A 1RNLA 4XSZF 2LNBA 4ESFA 1L3LA 3WTYC 2A68F 1XCVA 4P5OA 1IRFA 2M5WA 4IRHA 4KIGA 2V1DA 1WKMA 4R1HA 3I5UA 5ICCA 3RPUA 2NAZA 3ZN0A 5FGMA 1IN6A 3KZZA 3MZHA 1ZAOA 5L3FA 3ZMTA 1L0OC 4L18B 3EYYA 3AAFA 4RB1A 3PFIA 1IZ1A 3B73A 2GIVA 4IPAA 5KVRA 4WK8F 4P96A 3I4PA 3VFZA 2HEOA 3DF8A 1C0WA 4AWXB 4BHBA 2L4AA 2CWEA 1QNTA 1HW2A 3GO5A 1PP8F 4HA8A 5H6QA 3H92A 2WWYA 4IHSA 3U1DA 2R3SA 5L3EA 1Z6RA 5TRDA 1W7PB 2P7CB 5J8FA 2FF4A 2FA5A 2ZBKA 2P5VA 3NEUA 2XAFA 2XRNA 1T38A 1K78A 2PMUA 4MGRA 1B9MA 2MH2A 1G4DA 3ZPLA 2PEXA 2JPBA 2PI0A 3V7RA 5FO5A 4OIQF 3RPQA 5LHGA 4OIPF 3O3KA 1KU9A 2PG4A 2CO5A 4ENKA 3C1DA 3I59B 1IUYA 2WTEA 4M9XA 1S7OA 5E1XA 5IT3A 2Z5UA 4WXHA 5LEKA 2QBYA 1V3FA 5ILUA 4EM2A 4L9VA 2ZJ2A 2DPDA 1TLHB 4RGXA 1VTNC 2V1UA 3SZPA 2VC0A 2XAJA 3MQ0A 4BH9A 5D4RA 2FE3A 1OMIA 1RUNA 2R7DA 4LMYA 3HSEA 4XBFA 4GXOA 1SD4A 4IF4A 2QVOA 5JHUA 2H27A 3LQRA 4LJZF 2Z99A 1J9IA 4OINF 3IKTA 2RNJA 2ZNYA 1H9GA 2ZMEB 3F23A 2BE5F 1XGSA 1LDKB 4OOIA 2PN6A 2D45A 3E3VA 1R1TA 2RN7A 2VE8A 1D8JA 4AD9A 3J81Z 2KIUA 4AIHA 1FOKA 3JW4A 3BY6A 5HS7A 5ILSA 1B9NA 5DCFA 1AWCA 3VB2A 4N0BA 4QWQA 2A61A 4ZZLA 1O3QA 1W5SA 5FFZA 3EUHA 1YW8A 4FT8A 1UFMA 2V6CA 5K5QA 2IA1A 3TO6A 5JVTA 2ACJA 1NHAA 3DPTA 3VOEA 4K2EA 4F7ZA 2ZMEA 4I09A 4YFXF 1UB9A 3TOBA 1KA8A 5ILVA 2XAGA 1WRJA 5F6FA 2EV0A 1TQPA 3QPHA 2CW0F 3E5QA 1OYIA 3T8TA 1U8RA 3J7AO 3ULQB 3GFJA 1KU3A 1BOAA 5E20A 4KUMA 3BJ6A 5D8LB 3LA7A 4RAYA 2QUFA 1ODDA 2CYYA 1LNWA 3R0AA 1ZN2A 5DCMB 2UXXA 4CYDA 3QAHA 2DI3A 2HOEA 3GXOA 5L3BA 2NYXA 4U7DA 1ONVA 5K1YA 4LK1F 3QU3A 4RB2C 4ZYGA 2XV4S 1ZGJA 1Y0UA 4WXCA 5AIQA 3OV8A 3FMQA 1MDMA 1ZARA 3SZTA 1TQIA 3GEZA 3I64A 4MNUA 1JHHA 3FWEA 1R7JA 3CUQB 2GA2A 2EWNA 3IL2A 1GVJA 4HOBA 2VBXA 3KLOA 5D4SA 1R00A 3CLOA 3D0SA 3F8BA 3JTHA 3Q5FA 1RUOA 2K4JA 3J81K 1FBUA 4MQ9F 2M1BA 3F8FA 4OMYA 4HV5A 1SFUA 4G94A 5HOOA 3BPVA 3CUQC 2QYOA 1RI7A 3WU1B 1KYZA 3HSFA 3M9AA 1TTYA 3MZYA 3L7WA 2ESNA 2V9VA 2FU4A 3KP3A 3M8FA 3R6SA 2Y75A 1XSDA 1T0FA 4BHCA 2Q0OA 3TQNA 2GAUA 1WI9A 1I27A 4KIBA 1EH8A 4LB5A 3N4MA 1FP2A 1OYYA 3KP7A 3K69A 4BYYA
chains in the Genus database with same CATH superfamily
4CDGA 5E8IA 4MIMA 4QSHA 3OL3A 4ZYAA 3X2QH 2XUBA 3W6VA 2IS6A 2V79A 5DUIA 1BI2A 1ZQ3P 1HXDA 1MNEA 3M7GA 3M07A 5BPDA 3FXLA 2BEOA 4F92B 5BS6A 4PSWA 1Z77A 4M71A 2BXZA 3DCFA 4FCYA 1PDNC 2K02A 1TWHJ 2FBHA 5A2QZ 1EA3A 2WY7Q 4KMUX 2CRGA 3PNYA 4LD5A 2DA2A 1YRNA 3CCQI 4EVIA 1D5VA 1MMSA 3I0TA 2O5RA 4PUSA 2BW3A 1VQOI 1WVRA 1X3ZB 4X6AJ 2RDPA 4XQFA 2L9VA 5KAFC 2H1KA 4B8XA 1U2WA 2XKPA 5E8GA 3C3WA 2ELKA 1P6RA 2CSOA 3C2BA 3SEQA 5DD8A 3I53A 5DS9A 4A69C 2Y31A 5HDNA 3WTXC 2EV5A 1S9HA 1VFCA 3U21A 2VN2A 1PP7U 2FBIA 2VBYA 2WAFA 2JN6A 3ERMA 2IGOA 5ICGA 4A3LJ 4DYCA 4HF2A 1IDZA 2D1HA 1JTYA 1Q1HA 2B0LA 2LLKA 1BR1A 2K86A 4I76A 4A3EJ 1PUEE 2QM3A 4ASNA 3HGGA 2HXIA 3AG2H 1SAUA 3BZ6A 2E34A 3PUBA 3GFLA 1BOBA 5EEHA 2HPIA 4A3BJ 2OZ6A 2YX7A 2P0WA 2LBFB 3M1EA 3S1RJ 2JWTA 3T0YA 2XGEA 4XLHA 4QIWN 2VONA 2CUJA 4U0YA 4BEHA 4M9ZA 4ABZA 5GPAA 3WE3A 2XF7A 3MKZA 2P7VB 4R8HA 1BI1A 3CMAI 3C2GA 2KQRA 2H8WA 2Z33A 1ZG1A 3SHFA 1FZPB 3FZVA 3Q9SA 2EK5A 3KCCA 4BQOA 4BACA 2D2WA 1B59A 3SYTA 2DDBA 4M3GA 5E17F 3GUDA 2HTJA 5CVJA 3O8HA 2P5KA 3SFZA 5TJJA 1FBSA 3ZCOA 1IRGA 3ZRGA 1R6RA 2M8EA 3V8LA 3GLLA 4EJTA 4CCLA 1Z9CA 2CGPA 3G3ZA 3IP4B 3HPGA 3JRHA 2QSFX 2JUCA 2QQ9A 2RGVA 1ITYA 5DUKA 2R5YB 3FHNA 3WG7H 1FC3A 3TKYA 4L0YB 4MFEA 4W1UA 4J01A 5CQGA 3BWGA 5HVQC 4E7IA 4KN4X 5JFRA 3OYIA 3K1NA 2Z2SB 3LSTA 1TNSA 2EB7A 4NBQA 4A3GJ 2HFHA 2PX9A 3CTAA 2WB1N 3KE2A 2LKXA 1JUSA 4UXNA 2LBFA 4UVBA 5EEAA 3C7JA 1RIOH 3CCJI 1FX7A 1FEXA 2XKOA 2JA7J 4MQVA 1EKEA 4HLXA 3HRMA 3JRAA 4L5IA 2ZB9A 2EILH 2KJCA 2VPLA 1KQ0A 1W4MA 2DK5A 2VKEA 4Y4RA 3E6MA 3WHCA 4IX7A 4S04A 3T5XA 4ZZDA 4MEXF 4B3XA 1DPRA 2E1OA 4UB8C 2DT6A 2GOXB 1S8NA 2BOLA 1ETQA 1H9TA 2NRAC 3WTUC 3OIQA 3R61A 1T39A 3DLAA 3O8GA 1FSEA 3TBIA 3HKZN 2LF7A 2HZDA 1YI2I 5GAGJ 2IAIA 5FLMJ 1TNTA 3FKIJ 4KISA 2NNYA 2RKHA 2LREA 1IXCA 4EJUA 2DMNA 1Z6TA 4Y33A 3SDGA 5J1UA 2DA3A 3CP2A 1HQCA 2CV2A 5LBQA 4FX4A 3DTIA 3WTWC 4CZCA 2PFBA 1OR7C 2ZCWA 3CDHA 3V4GA 2A6EF 1SFOJ 1KU7A 3ZMUA 2TCTA 1E17A 1IXRC 1BW5A 1S6LA 3GF2A 2QZ8A 3PNVA 4Z2YA 2CQNA 1LEBA 2EFQA 2G7UA 3SJMA 2HKXA 3OYCA 1YJNI 3ZXSA 1DGRM 3DU6A 1WH7A 2CFXA 3COAC 1ZREA 4E70A 2E1NA 2Y0SA 3H3ZA 2R7RA 1YW7A 3FXOA 4GYIA 2JRMA 1K83J 4IHTA 1STZA 5D5WB 4LOCA 2BY2A 2LKPA 1F5TA 1DUXC 5F64A 3EUAA 4BY7J 1WJFA 1MMNA 1FYMA 2X6XA 1S3JA 3RTRA 1F9NA 2O61A 3W2AA 1O7FA 4RM3A 4ZYEA 3S32A 3VODA 2HYGD 4M6YA 4BAYA 1W5TA 2XGXA 4HBLA 1W7PD 5FD5A 5BNGA 2UV1A 1FSHA 3HRUA 1MMDA 2EFNA 1WPKA 1SFEA 2VBZA 2FXAA 4Q4ZF 2KIMA 3WTSC 2HS5A 1PJRA 4EJVA 3BTJA 1TBXA 2L7ZA 1IN7A 3H5AA 4M73A 4LLGF 1HW5A 4RS8A 4D5CA 4G6DA 1OLTA 3K4BA 4EM1A 1MBKA 5JI6A 2CQQA 2LTPA 1FJLA 1MMGA 3IC7A 1XMAA 4CICA 5FKLA 3GW2A 5E18F 3GTGJ 5F04A 3H1CA 2VKDA 1J5YA 5BPIA 3O6BB 4Q47A 4CSWA 3CP8A 1U5TC 1FMWA 1YX5A 1IRXA 2YPRA 1CF7B 1RESA 3LAJA 2Y9ZA 1RKWA 2ZSHB 2COMA 2FSWA 1K6OA 3LL7A 4M72A 2EZIA 1W1WE 5D5UB 3CZ6A 3VSLA 3BOQA 4XK4A 4HF1A 1K61A 2G0EA 3JAMK 2OA4A 1VQ8I 1IXSB 1TW3A 3J7AY 1OYWA 1FTTA 4B44A 5CPRB 3VEPA 3K4JA 2E1CA 1P9QC 1YIOA 1YJ9I 2KZVA 2NVQJ 1X3WB 4BXUA 4YIIA 2IS4A 1MH3A 4KN7X 1RR7A 4M6XA 5F27A 4IJAA 4Y7NJ 2C6YA 1P92A 4UV9A 3HOXJ 3G6EI 1D3YA 2WV0A 4I7HA 4Y3OA 1KQ9A 3T1BA 1MSFC 1SFKA 5JR3A 2H6CA 1VZ0A 4B3AA 1SD5A 5B1AH 4ON0A 2XAHA 3DKYA 4ZDPA 1A04A 1GV2A 1UCRA 1YW9A 2VB6A 4WCGA 4IZZA 2EIJH 1LDDA 1FNNA 3CLQA 3FXJA 3FMSA 3KP6A 3TOAA 1JTXA 2E1MC 3CCRI 4U87A 1BN5A 3L2VA 1O3TA 3ZN1A 2Y9YA 1NK2P 3SQNA 1W7PA 3GFIA 2WY8Q 2Q2EA 2CW7A 3FISA 1YIJI 2BZTA 2CQXA 2DTRA 3MEXA 1HF0A 1XS9A 2JTVA 5GAHJ 2K9LA 1HKTA 2GA1A 2E36A 2WAEA 4L5JA 2R7SA 3F8MA 5GP9A 4F3QA 1WZ2A 2A3SA 2HVSA 4DYRA 5LRRA 2XB0X 4AU7A 2EJRA 4LFUA 1J09A 2QKLB 2IPQX 2FX0A 3NRVA 2L7KA 3HTUA 1XMXA 3PO2J 3IH3A 2MFZA 4I98B 3REOA 3I59A 1LFBA 1MIJA 3WGGA 3I58A 2VJIA 1XSVA 4LGWA 2DMPA 3S1NJ 1LEAA 4PSXA 2ECCA 4XMYA 3K9TA 2HTSA 1VQ4I 1ETYA 1I6XA 4FETA 3CUOA 4HQEA 2WA0A 4U0VA 5IP7J 2BHZA 4DBQA 1IUFA 5FD6A 4BE0A 1O3RA 3E6CC 2KISA 1YLFA 3K2AA 1XG1A 2OU2A 1PUFB 1YFHA 4XN3A 2BY3A 2GWRA 3TEDA 3E6DA 1MBHA 4Q5SF 1QGPA 3HIFA 2VJ5A 3DFGA 4E7KA 3LWFA 3OMYA 2H94A 3BP8A 4DQ2A 2RQQA 5HNFA 1R71A 2VQCA 3S2WA 4L9JA 3L2QA 2DU9A 2R7QA 1BC8C 1USTA 1WSUA 2DBBA 2ZSIB 5FKKA 2H09A 3OYNA 3NWSA 4U0WA 1YJWI 3U1KA 3O2PE 2VODA 4AIKA 2OBPA 3AL0B 4XKCA 3S17J 1IN5A 4B47A 1J0RA 3S14J 3R0JA 2AS5F 4ESJA 1VQNI 2KDOA 2ZC2A 4G7HF 1LQ1A 4U7BA 5D5VB 1Y39A 3HSRA 3MCZA 1CGPA 3W3CA 1XCBA 2OUMA 3BLYA 5CJ9A 2LF8A 2LDUA 2LR8A 5HLGA 2DW4A 4XORA 1VQ7I 4DJAA 2FEZA 2WV1A 5DD4A 3PL8A 4G7ZF 4KT6A 4D1QA 2IRFG 3H0DA 2DT7B 1FPQA 4MO7A 2O8KA 2DTZA 1Z21A 3HDDA 2P6SA 2FD5A 3GCMA 2R7TA 4AC0A 4BQAA 4F55A 2H1LA 2XB5A 1U8BA 2QEXI 1OKRA 4I2OA 2Z1DA 4ZJZA 1F4KA 3W6KB 3GTMJ 1YS6A 4O3MA 1D8KA 3KFWX 3DBRB 2UZKA 2Y0SN 3GVAA 3ZQHA 1QPIA 2WB1A 4NC8A 2L7MP 2OTJI 1U0JA 3IWZA 2DN0A 2MBFA 4P9UA 4E7SA 1IW7F 1SAXA 4KNYA 1OCOH 5E79C 2KMUA 2E7XA 1QA6A 5EGOA 1JT6A 3ELKA 4OAYA 2R7ZJ 3LQQA 1ZG3A 1WJ5A 2HWVA 2DFFA 4G7OF 3HJEA 3NQOA 2MLGA 2O0YA 3CO7C 4XLCA 4B48A 3OYAA 1PVEA 5E1ZB 5D6FA 1IC8A 1REPC 1SVLA 4CCOA 3K1MA 4Y17A 2RQPA 3U2RA 5C4JJ 5H20A 3FBIB 3HHGA 4A0YA 3OYGA 4BE2A 1U78A 4H0EA 4JOMA 3HKZA 3WTVC 4M3FA 1ON2A 2PBIA 3F8NA 3IRQA 4BDYA 2MD0A 4JX4A 5M3FJ 2JUGA 4A3IJ 4BJ6C 2R7FA 5DEQA 4D0PA 2L9SA 3HG9A 4P55A 5DCMA 4UUVA 2ID6A 1XN7A 3ZMZA 2HQRA 1V55H 1Z91A 1EJ9A 2K9QA 3K70D 2VIXA 2AXLA 4ZYDA 1JJ8C 2FBKA 2MH9A 2O6GE 2Y30A 3MAJA 2P81A 4XLPF 2ZXIA 2KPMA 2ZFUA 3KEYA 4FE4A 2V9KA 1T33A 3KPHA 4LG3A 4XR6A 1BI3A 4JQFA 2WAQN 3A03A 2MABA 2XROA 2JA6J 4L5EA 4XSXF 1LJ9A 1XSXA 3KEOA 3ZMDA 2EPFA 3KIOA 2LY1A 2PJPA 2FJ1A 2DAOA 3FK7A 3HYIA 2QKMB 3WGHA 1QO0D 1DDNA 2W85A 2M9HA 5E3NA 1IJWC 2GXAA 1Z7LA 1YG2A 3KP4A 3RJPA 3OYBA 5GPCA 2PJRB 4OIRF 1K4TA 1QHHD 3DTKA 4XONA 4HDUA 1K6YA 3ZQCA 1J59A 4HDVA 4BQNA 2YSRA 3C18A 3KLNA 3K0LA 1XGNA 3MKYB 4CXFA 1RRJA 3I9V2 2M2EA 1YTYA 4UVAA 3WTTC 5JHFA 3GTQJ 2R4GA 3P7NA 2W24A 3GBGA 2VC1A 5FKMA 3RKYA 5KK1A 4BNCA 4KITB 4RGRA 2MLKA 2JA2A 2ZXWH 4GO1A 4V2GA 3BG7A 2KRFA 1R23A 4IHXA 3CUQA 3M8EA 1GXQA 5FLXZ 1OFCX 2LG4A 2ME0A 2HYFA 2F5CA 2W4SA 2NVXJ 5L3DA 2EIKH 4A93J 3M3YJ 3HRSA 1QVUA 4BY1J 1BR4A 3RKWA 3I71A 4I01A 2COBA 3TO9A 1T98A 3N05A 1HKQA 1BBYA 4OMZA 3CF2A 2Z9OA 2AHQA 1V54H 3L2WA 5LGNA 2XAUA 3QP6A 1F1ZA 4QPQA 4HLYA 3S3MA 3MWMA 1X1CA 2OAZA 2EZKA 2OJED 4PJMA 2IT0A 5DV5A 4BYYA 1UHWA 2VPRA 3BR5A 1AKHB 2DDAA 4NQWB 4LLLA 2X6WA 3CMMA 2ADUA 4DIQA 1DGWY 3K4CA 1IDYA 2MYSA 3QOEA 3RQ4A 3F6VA 2L9RA 5JLXA 2M7BA 2KRHA 2XIGA 2YU3A 4YFNF 5EEGA 3OS0A 3BDDA 4RA2A 5IOYA 1V5FA 1TWAJ 3R60A 2EFWA 2VASA 4MTEA 1ERDA 2X6OA 3HPHA 1APLC 4Y52J 1UG0A 2BHYA 1JKRC 2DXIA 2R93J 4HW0A 4NB5A 2K9SA 1BIAA 5F0CA 3BR0A 1U3EM 3S2HJ 3CESA 5F0HA 1FMVA 1FOWA 5LGUA 1Q1VA 2F4MB 2XPUA 2NS0A 2O8XA 1TP4A 4A3FJ 2O3FA 3ISPA 2L3DA 2VL8A 5F0FA 5K7ZA 1SFXA 3S3NA 4HPQA 4PZJA 2L02A 1QQIA 1HBXG 4WF2A 4BE1A 1OCRH 1J7KA 1ZLKA 1Y56A 1X2MA 5FKOA 3S1MJ 4JBAA 1USSA 1T56A 2RVCA 1E0EA 1Y1VJ 1BC7C 3FXMA 3RIRA 4LB6B 4IRIA 4NHJA 2P6TA 3BQYA 1XTAA 5HS9A 1G3YA 3OL4A 1KONA 5K7HA 2YX4A 5ICEA 2P8TA 2X1EA 1KYWA 2CH0A 3EYIA 3H3UA 5J40A 2H6BA 2XVCA 1B72B 3HUGB 4QPOA 3PIPF 2Y2ZA 3DBHB 2IP2A 4OU0A 5AIPA 2VI6A 2L0KA 3QPLA 5HS8A 2R0QC 1TQMA 4A6DA 3GZ5A 2IA0A 4WXDA 4S0HB 4P9FA 2L7FP 2OV7A 2WADA 3DEWA 1E3OC 3HOYJ 2GOMA 4BU2A 1YE9A 3F72A 1P4AA 2Y0MA 5J3LA 4PJNA 3JRCA 4GRIA 1JUMA 3HOSA 2Q8KA 5CVVA 1JUPA 2QQ8A 3B02A 3MKWB 1JE8A 4LITA 2W57A 2MW8A 4EGZA 3SZGA 2IGNA 1FIAA 3KZYA 3BJAA 3RPUD 1W5CC 1ZR2A 2G7HA 3OY9A 4CO8A 2XAQA 2X0LA 2XSDC 2EA2A 3MN2A 2E2JJ 3CJQB 1Z05A 4IQJA 4BL0B 2HR3A 2FRHA 4G6TB 4JK1X 3MMYB 4AUXA 5FLXK 3L2RA 2VOOA 3AG1H 1B72A 4FISA 2O03A 1WCMJ 4X1EA 5EYRA 1UHMA 5FLVA 3LSGA 3AG4H 1MNDA 1H0MA 2K9MA 4PGHA 1ZH5A 2HPMA 4XKWA 1ZHFA 4A12A 1B1BA 5LLQA 2L01A 4PGGA 3ERED 2A07F 2YU9J 2VOPA 1DPUA 4KYWA 3E5UA 3JRIA 4R79A 4ENNA 1GVDA 2HOAA 1LE8B 1EV7A 4NNJA 5KHDA 2LC2A 1GXPA 2F6CA 1R1UA 2DK8A 2R5YA 3KP5A 5A2QK 2OC6A 4MLOA 2GQQA 4LG0B 5EJCA 2HZTA 1R36A 3IHUA 5J1YA 4HYEA 4A0XA 2PMZN 3HL2A 3HZJA 3QPTA 2Y48A 1YOVB 1XC5A 1G3TA 1P7IA 3UKGA 5LHIA 4KDPA 3GLXA 4N4OB 2BY1A 3ZMVA 3FXUA 2KFDA 2FQ4A 3UNGC 3HOVJ 2NXNB 2RV8A 4UUSB 4EV0A 2L54A 3PQJA 4HNUA 1D1CA 3ABTA 3IH4A 3WHBA 2A5WA 1S7EA 2X6YA 2JZYA 3KEQA 1MBGA 5GTIC 1A35A 1WHUA 2W84A 1QZZA 3DXJF 3ZP5A 1T2KA 2STTA 4XKVA 1SVMA 1I5ZA 3T8RA 1OR7A 3TDZC 1S5LC 2NOJB 4XLNF 3ZQGA 1E2XA 1I1GA 2JSCA 1R5GA 4RDUA 4M3DA 1ETKA 3BR3A 5M5XJ 3JTGA 2GZWA 4A6EA 2R5ZB 2ISZA 3CMEI 1A5JA 2BBYA 5LFAA 2XPWA 2HGCA 3ZQ7A 2DJNA 1BM9A 3K2ZA 4HRIA 2OD5A 3BJOA 1XGOA 4LG0A 5IP6A 1SC7A 3NARA 1I39A 2EFPA 3DKXA 5JVGF 1X1AA 1U5TB 1ZRCA 1SMYF 2HDCA 4HZFA 2QA4I 2UWMA 5HLHA 3H5NA 3JRDA 3HGYA 3LSHA 2PQ8A 1B6AA 1U6GA 1K78B 3V7CA 2R92J 3I56I 1J2XA 4LK0F 4UUSA 1F43A 3RI4A 2KT0A 3C2HA 2X9DA 2FOKA 2PMHA 5BOXA 5IT9Z 4P1WA 1R58A 2ZO4A 3IV5A 3GX4X 2GXGA 4I6ZA 2XF5A 5IP9J 2M34A 3CF5F 1DP7P 2X48A 1T95A 3Q0WA 3WGIA 3LSPA 3E97A 2CS3A 4IHVA 2ZNZA 2KKOA 1VQLI 6PAXA 4UNOA 1UJ8A 4CH7A 4ZYHA 3ZQQA 1QZYA 5TISC 3F0CA 2HQ5A 3PSIA 4BKXA 2DO7A 1TWFJ 3RDIA 2WAQA 2ME6A 3JSPA 1R22A 2R5ZA 1GT0C 3S15J 3QODA 2CV1A 5IYCJ 2QBYB 1RKTA 2UUZA 3CC4I 4RLFA 4EQQA 4IOCF 4CCMA 2XDVA 2X51A 1QZEA 3A0BC 1U5TA 1W0TA 3VYSB 2E1MB 1N78A 4RLQA 1EF4A 1Z3YA 3WU2C 4UUTA 5IPAA 2BY0A 3L2UA 3CCSI 1TWGJ 3L09A 1VI0A 4ZDLA 1LVAA 3K4KA 4HX8A 4FASD 3K7AJ 1U9NA 5HDGA 3G71I 3QOPA 1SANA 4GCVA 5L3GA 3HOUJ 2CMPA 4A5MA 3J80Z 1MKMA 4FHTA 4IKFA 1NG6A 4GDFA 1CF7A 3HRTA 1R9TJ 3GTPJ 4A3DJ 2F5EA 4RM2A 1FYKA 1JGGA 2BYVE 3I54A 5BQTA 4A3MJ 1XPXA 2E35A 2X1DA 1GUUA 4RB0A 1YS7A 2CUFA 2LH9A 4G6QA 3FKJA 4G8XA 5HLIA 2GXBA 1IG7A 3HTSB 4EJWA 2IW5A 4ENJA 1FLIA 2EIMH 5LRSA 5LEJA 2M4KA 2VXZA 3PQKA 4HSRA 1XDUA 2VKVA 3A1YA 4D7NA 4B4CA 2FQ3A 2H8RA 2BGCA 4A3KJ 5ICFA 2DOFA 1UAAA 2DA5A 3V42A 4BS9A 3BQZA 2ISYA 3BPXA 5H6RA 4CA0A 5EDNA 3IWFA 3P9KA 5ED4A 5CYVA 1B4AA 1BI0A 1D0YA 2NVYJ 3LNQA 1FIPA 2IGKA 3K6GA 4GGGA 3ABUA 4OIOF 2BVMA 2F5DA 3EETA 1WQ2A 2J5OA 3L9FA 1B8IB 1RR8C 1AU7A 1I6HJ 4I0AA 2VT3A 2NNNA 2FMLA 3ASOH 1G59A 2QGUA 3GTLJ 2DJIA 3GFMA 4L9NA 2F2EA 3FX3A 2VE9A 4XLFA 3K4LA 5B5EC 1G6NA 1LKXA 2K85A 2LFBA 1NK3P 3CD6I 2EBIA 3EUHC 1YO5C 2K3FA 2JVGA 1RPWA 2QQBA 2VQGA 1FYLA 3JRBA 2ELHA 1ZLJA 2DYSH 1G8XA 3ZMSA 5CVRA 2M30A 2DMUA 5LD2C 5D6EA 2ZJRF 3FBNB 3HB9A 1XGMA 2ZXHA 4MHGA 1XD7A 2EA4A 4M3EA 2ZMEC 3OOUA 2JSPA 3CCYA 4A0ZA 5E3OA 5IT9K 3M1CA 3AFHA 1ZELA 1K7AA 3BCBA 2OQRA 2W00A 3FM3A 1Z67A 4FX0A 3CO6C 1DU0A 4KMFA 1X3UA 3DPLC 1Z7UA 3OYMA 1D1BA 2AQFA 2XASA 2DMQA 3S1QJ 3DKWA 2QF7A 4E4HA 3F22A 1FY7A 4PJJA 4BBRJ 4PJ0C 5CLSA 5D8KB 1ZYRF 3KZIC 2R7UA 3H9GA 1ZGAA 2VBWA 3HHHA 2RC4A 2M87A 3ABLH 5DDGA 3N97A 1B8IA 2UXNA 2V4JC 5HODA 1HSTA 1FWZA 2KP6A 1F36A 3ESWB 3GMEA 3DEEA 1PUFA 1ZRFA 2Z3YA 1S29A 3FMRA 4O6JA 1K79A 2VLAA 3ECOA 3L00A 1XMKA 3GYHX 3DQVC 4CGZA 2JK3A 1QRYA 2OCEA 2HNHA 3FDYA 2E7WA 4DNCA 4J19A 1GDTA 1R4NB 4I0BA 3RYPA 4DZPA 3K1PA 3W6JB 4KIFA 4HQMA 2B63J 1X2NA 3CQZJ 2QQAA 1VQKI 2JMWA 1KZHA 4IEJA 3CJRB 1O7LA 1JHFA 4KJZA 2MA3A 1IO2A 4JP0A 4D7MA 1O3SA 3P9IA 2MSYA 4XN0A 1IAWA 1O57A 3JRFA 2OCCH 5J6XA 3VDXA 1WJAA 1MDMB 3J80K 5EF6A 4ENMA 4CUGA 2HI3A 2DQLA 4PFOA 2VKHA 1J75A 2V6EA 1Z1DA 2F5FA 2CQKA 4YIRX 1X19A 1YYVA 4RAGA 2KIFA 4ZH4F 3LAPA 1IN4A 3FHZA 1YX3A 2DQRA 2LSOA 3QP5A 4KICA 4Y15A 4TV7A 5J4VA 3E7LA 4CCJA 1MZBA 2VJJA 4XLEA 4ZDOA 3BR2A 2TDXA 3KX2A 1GHCA 4O5VA 3S3OA 1MH4A 3P9CA 4ITVA 3E5XA 1JJ6C 3SDBA 2EH3A 1LB2A 4HX7A 2GM4A 4I02A 1NG7A 4XKBA 3EQLF 2PMZA 2NVTJ 4CHUA 2IJLA 4HV6A 4HSTA 1ZG5A 3BR6A 2M3AA 2P5LC 2ZJPF 3GWZA 2K5CA 2D5VA 4WWCA 2ZKZA 4PDKA 4IRGA 2DYRH 2P4WA 1ETXA 4EGYA 1LDJA 5B1BH 3TP3A 3S16J 4QLCU 4YRVA 5EZHA 3A01B 2ZFWA 1MW7A 3DEUA 2EFOA 2XPVA 2GIZA 3RKXA 3V8JA 3QU6A 4C3HJ 3LFKA 2ZXJA 3OR1C 3S8PA 3WG9A 3F21A 2JPCA 4RAZA 4FTHA 1OPCA 4IQ4A 4KT5C 2HDDA 1JI8A 3KETA 3G73A 1Y6IA 1QPMA 3E0JB 2DFHA 5AONA 2MG4A 2JRTA 3KP2A 4BGDA 1IF1A 5FRNA 1HKSA 2WC2A 2IA2A 3ECHA 2I8DA 2OZUA 3H35A 2E2IJ 2EZHA 4C3JJ 3TP0A 1FT9A 5EZGA 5K5OA 4FE7A 4HX4A 2LMDA 4BHPA 4YIFA 3BTCA 3BG3A 4XLAA 2BXYA 2ID3A 4ZTJA 1R5HA 5E1WA 5BMZA 1Y8RB 1ENHA 2E5ZA 3Q9VA 1MJAA 1T0FC 2MC3A 2DODA 1MBEA 5J1RA 3VYTB 2JA8J 5H2FC 2YR2A 1AHDP 1SEUA 2GLOA 1RZ4A 3FM5A 2DT5A 3VYRB 3WTZA 1YHQI 3MFKA 2W1OA 3FXRA 4N9IA 1HSJA 2K27A 1WWXA 1P7JA 4A3CJ 5K7FA 1TWCJ 1MMAA 1ULYA 3EDPA 1UG2A 5FB2A 3DV8A 4HF0A 1SD7A 2MD5A 3V8KA 3H9JA 1FP1D 2K4BA 3OWTA 4B43A 1H8AC 2HDWA 2DMTA 4G12A 1X1DA 4IVNA 1MBJA 3RYRA 1OCPA 3H5RA 3F8CA 1OJLA 4A3JJ 3ASNH 4C2TA 3PO3J 4C3IJ 2V9PA 4BUPA 1DP3A 9ANTA 5LGTA 3CCEI 3GZ6A 4PCQA 4IXAA 5KNLA 1U9OA 2PJRA 4H4KC 1T8IA 1Z3XA 3B6AA 4DOZA 4F52A 2E60A 2V1XA 3D1NI 4B1RA 2QLZA 4M74A 2K3PA 3OOPA 4II2A 2XSJC 4CCKA 3FF5A 2XGCA 1ZRDA 4RGSA 1LFPA 2W25A 4C9YA 5D5XB 2Q1ZB 1VQ6I 1IN8A 2IXSA 4EM0B 3ML6A 3MVPA 3RQIA 2L4MA 1VQ5I 3HOZJ 2LK2A 2A6HF 2CUZA 3FXQA 4ZTFA 2RNGA 1DU6A 2K40A 2EQRA 4EATA 2CFOA 1LPQA 3TDUC 1QBJA 3K4NA 3HEFA 2OTLI 3SXYA 1IRZA 3GTJJ 1SVOA 1PYVA 5HLTA 2R7OA 2K9NA 1S7AA 5C4XJ 4BEHB 4A2UA 1CQTA 4AIDA 5CVUA 2D1VA 1SMTA 3LA3A 3OYHA 1TW2A 1QVTA 5ERIA 2KJBA 3I3LA 1ON1A 2VT2A 1OCTC 2QWWA 4LLNA 2FNPA 2M4GA 2OPTA 2L5QA 3DBLB 3J7YJ 2VXDA 3WU0A 2DPUA 4AVPA 3OYLA 2X4HA 3DWLE 4AIJA 1BJAA 1EH6A 3PNTA 3I4NJ 3BC8A 4Y13A 1AKHA 4XL9A 2ZJQF 2CJJA 3CJNA 4NQWA 4UVCA 1VQPI 1K4SA 3WE2A 1KU2A 3TGNA 3R4KA 1MJBA 2V26A 4KA4A 1T08B 4XRFA 3D5LA 3BT9A 2V1NA 1AOYA 1R4MB 3J7ZI 2NS7A 5LHHA 2XHKA 4MTDA 3HOTA 3DP7A 2HKOA 2M0CA 1POGA 2R7WA 3KYDB 2FMYA 4OAZA 4WX9A 4YG2F 1IGNA 2M45A 1OCCH 4XRSA 2BV6A 1MD0A 4BXXJ 2GBYA 4YELA 4F91B 2IVMA 5GTHC 4EMSA 1G3WA 2JT1A 3JSOA 4YFKF 4RB3C 1P4WA 2MGQA 3LMMA 1SD6A 1YQAA 4U88A 4BJ5C 5L3CA 2HYJA 2A05A 4G9YA 1YITI 1W36D 3QPSA 2XC7A 2STWA 1G3SA 2AQEA 1I3QJ 3PUFA 4RGUA 3NWTA 2DOEA 1P2FA 1HA8A 1Y8QB 3L2CA 2DLLA 5J8CA 2XF6A 2HU9A 4HAMA 3QRFF 2O9LA 1XB4A 2X1CA 4PK4A 2CG4A 4M9SA 1W0UA 5J4YA 3U9GA 4L9TA 1ETWA 2F48A 3LA2A 4A5NA 4LIUA 1MNMC 4UV8A 4AYBN 4S05A 1D0XA 3DLLF 5B3SH 3H0GJ 1GLNA 1UHSA 1T6SA 2Z16A 2YS9A 1D1AA 2ETHA 4DBRA 3ZR8X 3F6OA 3CDLA 1EH7A 5F1JA 5DYMA 2DCEA 5HDKA 1JXSA 2A5YB 4KFCA 3TO7A 4CZZA 3B6CA 5C44J 1BR2A 1P4XA 3JAMZ 1I1SA 1V4RA 3ABMH 2J5PA 4MEYF 3HUGA 2HXOA 3F3XA 3CDIA 2JJ7A 3OS1A 3BG9A 5FFXA 5K5RA 1WJBA 2K7LA 3IRRA 3IAM2 2ESHA 1IV6A 4L0ZB 3L1PA 3HBLA 2HQNA 1RC9A 1ACIA 1O4XA 1KGSA 2PLYA 4E7ZA 1HDDC 3DPUA 1FBQA 2DFIA 3LSMA 1MGTA 4ESBA 3W2WA 3RKQA 4ETSA 3V7SA 3E6BA 5CVIA 3ZOBA 5FKNA 3WODF 2G9WA 4GYGA 4N4NB 4UHTA 3ROUA 3CCMI 2IBDA 4E7HA 3JREA 2ICWG 4B09A 3BROA 2RAEA 4EJOA 3BR1A 1JKPC 2WBMA 3EPZA 1W36C 1R1VA 4Q48A 4JX5A 2FNAA 2OQGA 2QENA 2W82A 1H88C 2EV6A 1I50J 3BTIA 3OIOA 1RETA 3H9QA 1BJZA 4GFBA 1MJ9A 1A36A 2NOGA 4C2UA 1XDSA 3IKVA 2A69F 3LSJA 4PJLA 5F1RA 4N9HA 1JGSA 1LFUP 1D0ZA 1BIBA 1NTCA 1HW1A 2M7AA 2OF7A 4F93B 5JLWA 5DM6F 3K4MA 1KQ8A 4D5FA 1RNLA 4XSZF 2LNBA 3VSKA 2DA4A 4ESFA 3OR2C 1L3LA 3WTYC 2KIQA 1IV8A 3KYCB 1R49A 2I5UA 3CJTB 2A68F 1QU3A 1XCVA 3MKLA 1A31A 3BTLA 4HG2A 1IRFA 4P5OA 2M5WA 4IRHA 1LE8A 2KHMA 1ETOA 4KIGA 3OYEA 4XOPA 5EG0B 2V1DA 1WKMA 4R1HA 3I5UA 5ICCA 4EEFG 3RPUA 2NAZA 3ZN0A 5FGMA 1IN6A 2HVRA 2L9NA 3KZZA 3MZHA 2IGMA 2HQAA 1ZAOA 4JX6A 3PIOF 5L3FA 3ZMTA 1L0OC 1E3HA 4L18B 3EYYA 4V2FA 4DYQA 3AAFA 2LYCA 4RB1A 1HC8A 1OISA 2YUSA 2FOWA 3PFIA 1IZ1A 3B73A 2GIVA 4IPAA 2N8GA 5KVRA 4WK8F 3S93A 3G4SI 2EINH 4P96A 3I4PA 3VFZA 2HEOA 3DF8A 3D5SC 2IEKA 3CCVI 5M5YJ 2KDZA 1C0WA 2JQ7A 2DA6A 3IH2A 4AWXB 2XGDA 1HCRA 4BHBA 2L4AA 2CWEA 1QNTA 4E7LA 2E5NA 5F08A 1UELB 2NS8A 2KL4A 4XICA 3CMYA 1HW2A 3GO5A 1PP8F 4HA8A 2JVHA 3EUKL 3M8JA 1TT0A 4XM3A 3CCLI 5EG0A 5H6QA 3CC2I 3H92A 2WWYA 5FRMA 4UY8I 4IHSA 3U1DA 1AA7A 2R3SA 5L3EA 3GZNB 1Z6RA 3KYLA 1W7PB 5TRDA 2P7CB 5J8FA 2FF4A 2FA5A 2ZBKA 4CYCB 1XX5A 2DFEA 2Q2EB 2P5VA 5FJ8J 2ECBA 3NEUA 2XAFA 2XRNA 1T38A 2LOOA 1K78A 2PMUA 4MGRA 4CCNA 4AM3A 2CQ7A 1B9MA 2MH2A 3IUOA 3PFYA 1G4DA 3ZPLA 1HDPA 2PEXA 2JPBA 2CV0A 4I99C 1MSEC 3G1MA 4RAFA 4IHYA 2PI0A 1ZR4A 3MD2A 3DTEA 3V7RA 3QYEA 3PSFA 3TMOA 5FO5A 5TGTA 3OIPA 1H89C 3QYFA 3RPQA 5LHGA 4OIQF 4OIPF 3O3KA 1JT0A 2R7XA 1KU9A 1JKOC 2PG4A 2CO5A 1ZKGA 3P5JA 4ENKA 5KAIC 3C1DA 3TW6A 3I59B 2CW8A 1IUYA 2WTEA 4M9XA 3A2KA 3G2BA 1S7OA 3RZDJ 5E1XA 3VYUB 5IT3A 2Z5UA 4HEA2 4WXHA 1DQUA 1X1BA 5HNHA 1ZTRA 4NDLA 5LEKA 1TZLA 2NVUB 3TW7A 3HM5A 2QBYA 1V3FA 5ILUA 4EM2A 4L9VA 3PJRA 2LY2A 2ZJ2A 1TLHB 4RGXA 2DPDA 2LY9A 1HOMA 2V7FA 1VTNC 2V1UA 3SZPA 2R7VA 4CYCA 4BXFA 5DM7F 2VC0A 2XAJA 3MQ0A 2M0MA 4BH9A 4IO9F 5D4RA 2FE3A 1OMIA 1RUNA 2R7DA 4HNTA 3DU5A 4LMYA 4W97A 3HSEA 4XBFA 2HOSA 3M4OJ 4GXOA 1SD4A 4IF4A 3S2DJ 2QVOA 1UMQA 1I3AA 5JHUA 3AKZA 2H27A 3HOWJ 4BBSJ 2XRLA 4ANJA 3LQRA 4LJZF 2LKSA 3GTOJ 2Z99A 1J9IA 4OINF 2KRCA 1GV5A 2RNJA 2ZNYA 3ABKH 3IKTA 1H9GA 1X4PA 2X85A 2ZMEB 3FIWA 3F23A 2BE5F 4UB6C 5IYDJ 1XGSA 2LRDA 1LDKB 2AXTC 2PN6A 4OOIA 2D45A 3E3VA 3QQAA 5IYBJ 2DA1A 3PM1A 1TC3C 1R1TA 1OQYA 1WJCA 2RN7A 2IS2A 1JKQC 2VE8A 1D8JA 4AD9A 3J81Z 2KIUA 2CU7A 4AIHA 1N77A 1FOKA 3JW4A 3BY6A 5HS7A 5ILSA 3NAUA 1B9NA 5DCFA 1AWCA 3VB2A 4N0BA 4QWQA 1TT5B 2F4IA 3H36A 2A61A 2TRTA 3BZCA 4ZZLA 1O3QA 1W5SA 5IOZA 5FFZA 3RCOA 1VQMI 3EUHA 3Q0VA 1YW8A 2I10A 3FK6A 4NC6A 3QWLA 2E71A 4FT8A 4ZC3A 1UFMA 1X4OA 2V6CA 3K10A 5K5QA 1OCZH 2IA1A 2RREA 1TL8A 3TO6A 5JVTA 5DTDA 2B9SA 1NHAA 3DPTA 2ACJA 2JA5J 3BCAA 2EZLA 3ONQA 2F4OB 4BDZA 3VOEA 5EGOB 4K2EA 1FTZA 3BG5A 2ZMEA 4I09A 3ZQFA 4F7ZA 1UB9A 4YFXF 3LSRA 3D5RC 1Y1WJ 3TOBA 2ELJA 1KA8A 5ILVA 2XAGA 5C3EJ 1WRJA 5F6FA 4E7JA 2EV0A 1TQPA 3QPHA 3HC7A 1V5GA 2CW0F 2HVQA 1WH5A 2QSGX 1V5EA 3E5QA 1OYIA 4MFDA 3T8TA 2B7EA 2VJ4A 1U8RA 3J7AO 2FUG2 3ULQB 3GFJA 1KU3A 1BOAA 3LSIA 2HOTA 5E20A 5KCMA 4KUMA 3BJ6A 4BJTA 3FXKA 3OYJA 4XIDA 5D8LB 3AL0C 3LA7A 5M3MJ 4RAYA 4AYBA 1N25A 2QUFA 3G1LA 1ODDA 2CYYA 3LOCA 1NH3A 1LNWA 3R0AA 1ETVA 3CCUI 2MC4A 4PFPA 1ZN2A 1VNDA 1ZK8A 5B66C 3A02A 3OSFA 5DCMB 3UR3C 4IOAF 4XRMA 2E19A 2UXXA 3A4CA 4IL6C 5J47A 3I55I 3ZQLA 4DW6A 4CYDA 4OWRB 3F9KA 3BG6A 2LP0A 1BL0A 3Q3SA 1D5YA 3QAHA 3SEZA 1BA5A 2DI3A 1LUJB 2HOEA 3GXOA 5L3BA 1N75A 1MBFA 1WFXA 2NYXA 4U7DA 3MZ8A 2E2HJ 2VUMJ 3OYKA 3JCUC 3JR9A 1ONVA 1ZGWA 5K1YA 2AO9A 3VPRA 4QTRA 4LK1F 3QU3A 5E3MA 4RB2C 1WJDA 3I4MJ 4ZYGA 3OYFA 4M3BA 2XV4S 1ZGJA 1Y0UA 4WXCA 1VF9A 4RMNA 2QCOA 5AIQA 3OV8A 1LVKA 3FMQA 2M8GX 3LFUA 5M5WJ 4II3A 3QYBA 3RSNA 1S72I 3ZQIA 4E6KG 1ORKA 1Z0XA 2LVSA 3Q0UA 4FQGA 1ZARA 3TL4X 1MDMA 3SZTA 2VQLA 4C2MJ 4J00A 1TQIA 2VQHA 3GEZA 3I64A 4MNUA 1JHHA 3FWEA 2CUEA 2DA7A 1HLVA 4NUBA 1R7JA 4DGWB 3IAS2 3E1SA 4IHWA 3CUQB 2GA2A 2KLOA 4BQQA 5CQEA 2F5VA 2EWNA 3HXLA 3IL2A 4C30A 1GVJA 4HOBA 2VBXA 3KLOA 5D4SA 3OSGA 3OYDA 1R00A 3CLOA 3D0SA 3F8BA 4V19K 3JTHA 3Q5FA 1RUOA 2K4JA 4RBOA 3AG3H 3J81K 1FBUA 4MQ9F 1G2HA 1WGXA 4LIVA 2O7OA 4AVZA 2M1BA 2W48A 3F8FA 5IY5H 4OMYA 4HNVA 1QHGA 2KZGA 3GTKJ 1FOXA 1Y0NA 2W7NA 4HV5A 3SFIA 1BW6A 4JYKA 5E3LA 4XNFA 3LSKA 4G94A 1SFUA 4XOTA 1WJEA 5HOOA 3BPVA 4D9JA 3CUQC 1M1EB 4X0GA 2QYOA 2LD5A 2QSHX 1A6QA 1RI7A 1WI3A 3G1OA 5GAEJ 2A6TA 3WU1B 3RZOJ 1KYZA 1YRNB 1UZCA 3HSFA 1E3PA 1TTYA 3M9AA 4Z6YA 3MZYA 5CKTA 3L7WA 2IS1A 2ESNA 2V9VA 2BVLA 3ZGKA 2FU4A 2BW3B 3W2VA 3A01A 3KP3A 3M8FA 3R6SA 2Y75A 1XSDA 3CC7I 3OS2A 1T0FA 4DZJA 4BHCA 1X58A 3VWBA 2Q0OA 4NC7A 2Y69H 3TQNA 4XRSG 1VQ9I 3JRGA 3H3VK 2GAUA 4M6VA 4YEJA 5GADJ 3BZKA 1A6IA 1FOYA 1I27A 1WI9A 2DOAA 1EH8A 4KIBA 5FROA 1X1PA 1R5ID 4LB5A 3N4MA 1FP2A 1OYYA 3A0HC 3K69A 3KP7A 2L2OA 3K70C
chains in the Genus database with same CATH topology
4CDGA 5E8IA 2XUBA 2V79A 5DUIA 1BI2A 1HXDA 3M7GA 5BPDA 2BEOA 5BS6A 4M71A 1PDNC 2K02A 5A2QZ 2FBHA 4KMUX 4LD5A 4EVIA 1D5VA 3I0TA 2RDPA 4B8XA 1U2WA 2XKPA 5E8GA 3C3WA 1P6RA 2CSOA 5DD8A 3I53A 5HDNA 3WTXC 2EV5A 2VN2A 1PP7U 2FBIA 2VBYA 5ICGA 4HF2A 2D1HA 1Q1HA 2B0LA 2K86A 1PUEE 2QM3A 4ASNA 3BZ6A 3GFLA 5EEHA 2OZ6A 2YX7A 3M1EA 3T0YA 2VONA 4U0YA 4M9ZA 3WE3A 2P7VB 4R8HA 1BI1A 2Z33A 1ZG1A 3SHFA 1FZPB 3FZVA 3Q9SA 2EK5A 3KCCA 2D2WA 1B59A 5E17F 3GUDA 2HTJA 5CVJA 2P5KA 3SFZA 5TJJA 1FBSA 1IRGA 2M8EA 3V8LA 4EJTA 1Z9CA 2CGPA 3G3ZA 2RGVA 2QQ9A 5DUKA 1FC3A 3TKYA 4L0YB 3BWGA 5HVQC 4KN4X 5JFRA 3K1NA 3LSTA 1TNSA 2EB7A 2HFHA 3CTAA 3KE2A 4UXNA 4UVBA 1RIOH 3C7JA 1FX7A 2XKOA 4MQVA 4HLXA 3HRMA 4L5IA 2KJCA 1KQ0A 1W4MA 2DK5A 3E6MA 4S04A 3T5XA 4ZZDA 4MEXF 1DPRA 1S8NA 1H9TA 2NRAC 3WTUC 3R61A 1T39A 1FSEA 2LF7A 1TNTA 2NNYA 2RKHA 1IXCA 4EJUA 1Z6TA 1HQCA 5LBQA 4FX4A 3WTWC 2PFBA 3CDHA 2ZCWA 3V4GA 1KU7A 2A6EF 3ZMUA 1E17A 1IXRC 1S6LA 3GF2A 2QZ8A 4Z2YA 1LEBA 2EFQA 2G7UA 2HKXA 2CFXA 3COAC 1ZREA 4E70A 2E1NA 3H3ZA 1YW7A 4GYIA 4IHTA 1STZA 5D5WB 2LKPA 1F5TA 1DUXC 5F64A 1FYMA 1S3JA 3RTRA 1F9NA 2O61A 1O7FA 4ZYEA 3VODA 4BAYA 2HYGD 4M6YA 1W5TA 2XGXA 4HBLA 1W7PD 5FD5A 1FSHA 3HRUA 2EFNA 1SFEA 2VBZA 2FXAA 4Q4ZF 2KIMA 3WTSC 2HS5A 4EJVA 1TBXA 1IN7A 4M73A 4LLGF 1HW5A 4RS8A 4G6DA 4EM1A 5JI6A 3IC7A 1XMAA 4CICA 3GW2A 5E18F 1J5YA 5BPIA 3O6BB 4Q47A 1U5TC 2YPRA 1CF7B 3LAJA 2COMA 2FSWA 1K6OA 4M72A 5D5UB 3BOQA 4HF1A 3JAMK 2OA4A 1IXSB 1TW3A 1OYWA 3VEPA 2E1CA 1YIOA 4BXUA 4YIIA 4KN7X 4M6XA 4IJAA 2C6YA 1P92A 4UV9A 1D3YA 2WV0A 4I7HA 1KQ9A 3T1BA 5JR3A 2H6CA 1SD5A 4ON0A 2XAHA 1A04A 1YW9A 1UCRA 4WCGA 1LDDA 1FNNA 3FMSA 3KP6A 3TOAA 1BN5A 1O3TA 3ZN1A 3SQNA 1W7PA 3GFIA 2Q2EA 2DTRA 3MEXA 2JTVA 1HKTA 2GA1A 4L5JA 3F8MA 2A3SA 5LRRA 2EJRA 4LFUA 2IPQX 3NRVA 3HTUA 4I98B 3REOA 3I59A 3WGGA 3I58A 1XSVA 4LGWA 1LEAA 3K9TA 2HTSA 1I6XA 3CUOA 4HQEA 4U0VA 5FD6A 1O3RA 3E6CC 1YLFA 2OU2A 1YFHA 2GWRA 3E6DA 4Q5SF 1QGPA 3HIFA 3DFGA 3LWFA 2H94A 3BP8A 4DQ2A 3S2WA 4L9JA 2DU9A 1BC8C 1USTA 1WSUA 2DBBA 2H09A 4U0WA 3O2PE 2VODA 4AIKA 2OBPA 1IN5A 1J0RA 3R0JA 2AS5F 4ESJA 4G7HF 1LQ1A 4U7BA 5D5VB 3HSRA 3MCZA 1CGPA 1XCBA 5CJ9A 2LF8A 2LDUA 5HLGA 2DW4A 2FEZA 5DD4A 4G7ZF 2IRFG 1FPQA 2P6SA 4BQAA 1OKRA 4I2OA 1F4KA 3W6KB 1YS6A 4O3MA 1D8KA 3KFWX 2UZKA 3GVAA 3IWZA 2MBFA 4P9UA 1SAXA 4KNYA 1IW7F 2E7XA 3ELKA 3LQQA 1ZG3A 2HWVA 4G7OF 3NQOA 2MLGA 2O0YA 3CO7C 5E1ZB 5D6FA 1REPC 3K1MA 4Y17A 2RQPA 3U2RA 5H20A 3HHGA 4A0YA 1U78A 4H0EA 3WTVC 1ON2A 2PBIA 3F8NA 3IRQA 2R7FA 5DEQA 4D0PA 4P55A 5DCMA 4UUVA 1XN7A 3ZMZA 2HQRA 1Z91A 2AXLA 4ZYDA 2FBKA 2MH9A 2O6GE 3MAJA 4XLPF 1BI3A 4JQFA 2XROA 4XSXF 1LJ9A 1XSXA 3KEOA 3ZMDA 2PJPA 2DAOA 3HYIA 3WGHA 1QO0D 1DDNA 2W85A 1YG2A 3KP4A 3RJPA 4OIRF 4HDUA 1J59A 4HDVA 2YSRA 3C18A 3KLNA 3K0LA 1XGNA 4CXFA 1YTYA 4UVAA 3WTTC 3P7NA 2W24A 2VC1A 3RKYA 5KK1A 4BNCA 4RGRA 2MLKA 4GO1A 2KRFA 1R23A 3CUQA 3M8EA 1GXQA 5FLXZ 2HYFA 2F5CA 5L3DA 3HRSA 3RKWA 3I71A 4I01A 3TO9A 1T98A 1HKQA 1BBYA 4OMZA 2Z9OA 5LGNA 3QP6A 1F1ZA 4HLYA 3MWMA 2OAZA 2IT0A 5DV5A 1UHWA 4LLLA 2ADUA 3F6VA 2XIGA 2YU3A 4YFNF 5EEGA 3BDDA 3R60A 2EFWA 4MTEA 4HW0A 4NB5A 1BIAA 1U3EM 5LGUA 2NS0A 2O8XA 2O3FA 3ISPA 2L3DA 1SFXA 4PZJA 2L02A 1QQIA 1HBXG 4WF2A 1J7KA 1ZLKA 4JBAA 1USSA 2RVCA 1BC7C 3RIRA 4LB6B 4IRIA 4NHJA 2P6TA 5HS9A 1G3YA 2YX4A 5ICEA 2P8TA 1KYWA 3EYIA 3H3UA 2H6BA 2XVCA 2IP2A 4OU0A 5AIPA 5HS8A 1TQMA 4A6DA 3GZ5A 2IA0A 4WXDA 4P9FA 3F72A 1P4AA 2Y0MA 3HOSA 2Q8KA 5CVVA 3B02A 1JE8A 2W57A 4EGZA 3KZYA 3BJAA 2G7HA 4CO8A 2XAQA 2X0LA 2EA2A 1Z05A 2HR3A 2FRHA 4JK1X 5FLXK 2VOOA 2O03A 1UHMA 1H0MA 4PGHA 1ZH5A 1ZHFA 4A12A 1B1BA 5LLQA 2L01A 4PGGA 3ERED 2A07F 2VOPA 1DPUA 4KYWA 3E5UA 4R79A 4ENNA 1EV7A 1GXPA 1R1UA 2DK8A 3KP5A 5A2QK 4LG0B 2GQQA 2HZTA 1R36A 3IHUA 4HYEA 4A0XA 3QPTA 2Y48A 1G3TA 5LHIA 4KDPA 3GLXA 3ZMVA 3FXUA 2RV8A 4EV0A 2L54A 3PQJA 3ABTA 2JZYA 3KEQA 2W84A 1QZZA 3DXJF 3ZP5A 1T2KA 2STTA 1I5ZA 3T8RA 1OR7A 3TDZC 4XLNF 1E2XA 1I1GA 2JSCA 1R5GA 3JTGA 2GZWA 4A6EA 2ISZA 2BBYA 2HGCA 3ZQ7A 1BM9A 3K2ZA 2OD5A 3BJOA 1XGOA 4LG0A 2EFPA 1U5TB 1ZRCA 1SMYF 2HDCA 4HZFA 2UWMA 5HLHA 2PQ8A 1B6AA 1U6GA 1K78B 3V7CA 1J2XA 4LK0F 3RI4A 2FOKA 2PMHA 5BOXA 5IT9Z 1R58A 2ZO4A 3GX4X 2GXGA 1DP7P 3WGIA 3E97A 2ZNZA 2KKOA 6PAXA 4UNOA 4ZYHA 1QZYA 2DO7A 3RDIA 3JSPA 1R22A 2QBYB 4EQQA 1U5TA 3L09A 1LVAA 4HX8A 5HDGA 3QOPA 4GCVA 5L3GA 4A5MA 3J80Z 1MKMA 4FHTA 1CF7A 3HRTA 2F5EA 1FYKA 2BYVE 3I54A 5BQTA 4RB0A 1YS7A 4G6QA 4G8XA 5HLIA 2GXBA 3HTSB 4EJWA 2IW5A 4ENJA 1FLIA 5LRSA 5LEJA 2VXZA 3PQKA 1XDUA 2FQ3A 2BGCA 5ICFA 2ISYA 3BPXA 5H6RA 3IWFA 3P9KA 5ED4A 5CYVA 1B4AA 1BI0A 4GGGA 3ABUA 4OIOF 2F5DA 3EETA 1WQ2A 2J5OA 3L9FA 4I0AA 2VT3A 2NNNA 2FMLA 3GFMA 4L9NA 2F2EA 3FX3A 2VE9A 1G6NA 1YO5C 2QQBA 1FYLA 2ELHA 1ZLJA 3ZMSA 5CVRA 2M30A 5D6EA 1XGMA 4MHGA 1XD7A 2EA4A 4A0ZA 5IT9K 1K7AA 2OQRA 3FM3A 3CO6C 4FX0A 4KMFA 1X3UA 3DPLC 1Z7UA 2XASA 3DKWA 3F22A 1FY7A 5CLSA 5D8KB 1ZYRF 1ZGAA 2VBWA 3HHHA 2RC4A 2M87A 5DDGA 3N97A 2UXNA 1HSTA 1FWZA 1ZRFA 2Z3YA 1S29A 3FMRA 4O6JA 1K79A 3ECOA 3L00A 1XMKA 3GYHX 3DQVC 4CGZA 2E7WA 4DNCA 4I0BA 3RYPA 3K1PA 3W6JB 4KIFA 4HQMA 2QQAA 1O7LA 1JHFA 2MA3A 1O3SA 3P9IA 1IAWA 1O57A 5J6XA 1MDMB 3J80K 4ENMA 1J75A 2DQLA 1Z1DA 2F5FA 2CQKA 4ZH4F 1YYVA 2KIFA 3LAPA 1IN4A 3FHZA 2DQRA 2LSOA 4KICA 3QP5A 4Y15A 4TV7A 1MZBA 2TDXA 1GHCA 4O5VA 3P9CA 3E5XA 1LB2A 4HX7A 4I02A 3EQLF 4CHUA 2IJLA 4HV6A 1ZG5A 2P5LC 3GWZA 4WWCA 2ZKZA 4PDKA 4IRGA 2P4WA 4EGYA 1LDJA 4QLCU 2ZFWA 3DEUA 2EFOA 3RKXA 3V8JA 3QU6A 3LFKA 2ZXJA 3WG9A 3F21A 2JPCA 4RAZA 1OPCA 4KT5C 3KETA 3G73A 1QPMA 5AONA 2JRTA 3KP2A 1IF1A 1HKSA 2WC2A 2IA2A 3ECHA 2OZUA 1FT9A 5K5OA 4HX4A 4BHPA 4YIFA 1R5HA 5E1WA 5BMZA 3Q9VA 1MJAA 2MC3A 2YR2A 1RZ4A 3FM5A 2DT5A 3WTZA 3MFKA 3FXRA 4N9IA 1HSJA 2K27A 1WWXA 1ULYA 3EDPA 5FB2A 3DV8A 4HF0A 1SD7A 2MD5A 3V8KA 1FP1D 2K4BA 4IVNA 3RYRA 3F8CA 5LGTA 3GZ6A 4PCQA 4IXAA 2V1XA 2QLZA 4M74A 3OOPA 3FF5A 1ZRDA 4RGSA 2W25A 5D5XB 1IN8A 4EM0B 3ML6A 2L4MA 2A6HF 3FXQA 3TDUC 1QBJA 3SXYA 1S7AA 4A2UA 5CVUA 2D1VA 1SMTA 3LA3A 1TW2A 5ERIA 2KJBA 1ON1A 2VT2A 2QWWA 4LLNA 2FNPA 3WU0A 2DPUA 4AVPA 2X4HA 4AIJA 1BJAA 1EH6A 4Y13A 3CJNA 4NQWA 4UVCA 3WE2A 1KU2A 3TGNA 3R4KA 1MJBA 4KA4A 4XRFA 3D5LA 1AOYA 5LHHA 3HOTA 4MTDA 2XHKA 3DP7A 2HKOA 2FMYA 4WX9A 4YG2F 2M45A 2BV6A 1MD0A 2IVMA 4EMSA 1G3WA 2JT1A 3JSOA 4YFKF 4RB3C 1P4WA 1SD6A 1YQAA 4U88A 5L3CA 4G9YA 2STWA 1G3SA 4RGUA 1P2FA 3L2CA 2DLLA 5J8CA 4HAMA 3QRFF 1XB4A 2CG4A 4M9SA 3U9GA 4L9TA 4A5NA 3LA2A 4UV8A 4S05A 1T6SA 2ETHA 3F6OA 1EH7A 5HDKA 5DYMA 1JXSA 2A5YB 4KFCA 3TO7A 4CZZA 1P4XA 3JAMZ 1I1SA 1V4RA 2J5PA 4MEYF 3HUGA 3F3XA 5FFXA 5K5RA 2K7LA 3IRRA 4L0ZB 2ESHA 2HQNA 1KGSA 2PLYA 1FBQA 2DFIA 1MGTA 4ESBA 4ETSA 3V7SA 3E6BA 5CVIA 3WODF 2G9WA 4GYGA 4UHTA 3ROUA 4B09A 3BROA 4EJOA 1R1VA 4Q48A 2FNAA 2OQGA 2QENA 2EV6A 1MJ9A 1XDSA 3IKVA 2A69F 5F1RA 4N9HA 1JGSA 1BIBA 1HW1A 1KQ8A 1RNLA 4XSZF 2LNBA 4ESFA 1L3LA 3WTYC 2A68F 1XCVA 4P5OA 1IRFA 2M5WA 4IRHA 4KIGA 2V1DA 1WKMA 4R1HA 3I5UA 5ICCA 3RPUA 2NAZA 3ZN0A 5FGMA 1IN6A 3KZZA 3MZHA 1ZAOA 5L3FA 3ZMTA 1L0OC 4L18B 3EYYA 3AAFA 4RB1A 3PFIA 1IZ1A 3B73A 2GIVA 4IPAA 5KVRA 4WK8F 4P96A 3I4PA 3VFZA 2HEOA 3DF8A 1C0WA 4AWXB 4BHBA 2L4AA 2CWEA 1QNTA 1HW2A 3GO5A 1PP8F 4HA8A 5H6QA 3H92A 2WWYA 4IHSA 3U1DA 2R3SA 5L3EA 1Z6RA 5TRDA 1W7PB 2P7CB 5J8FA 2FF4A 2FA5A 2ZBKA 2P5VA 3NEUA 2XAFA 2XRNA 1T38A 1K78A 2PMUA 4MGRA 1B9MA 2MH2A 1G4DA 3ZPLA 2PEXA 2JPBA 2PI0A 3V7RA 5FO5A 4OIQF 3RPQA 5LHGA 4OIPF 3O3KA 1KU9A 2PG4A 2CO5A 4ENKA 3C1DA 3I59B 1IUYA 2WTEA 4M9XA 1S7OA 5E1XA 5IT3A 2Z5UA 4WXHA 5LEKA 2QBYA 1V3FA 5ILUA 4EM2A 4L9VA 2ZJ2A 2DPDA 1TLHB 4RGXA 1VTNC 2V1UA 3SZPA 2VC0A 2XAJA 3MQ0A 4BH9A 5D4RA 2FE3A 1OMIA 1RUNA 2R7DA 4LMYA 3HSEA 4XBFA 4GXOA 1SD4A 4IF4A 2QVOA 5JHUA 2H27A 3LQRA 4LJZF 2Z99A 1J9IA 4OINF 3IKTA 2RNJA 2ZNYA 1H9GA 2ZMEB 3F23A 2BE5F 1XGSA 1LDKB 4OOIA 2PN6A 2D45A 3E3VA 1R1TA 2RN7A 2VE8A 1D8JA 4AD9A 3J81Z 2KIUA 4AIHA 1FOKA 3JW4A 3BY6A 5HS7A 5ILSA 1B9NA 5DCFA 1AWCA 3VB2A 4N0BA 4QWQA 2A61A 4ZZLA 1O3QA 1W5SA 5FFZA 3EUHA 1YW8A 4FT8A 1UFMA 2V6CA 5K5QA 2IA1A 3TO6A 5JVTA 2ACJA 1NHAA 3DPTA 3VOEA 4K2EA 4F7ZA 2ZMEA 4I09A 4YFXF 1UB9A 3TOBA 1KA8A 5ILVA 2XAGA 1WRJA 5F6FA 2EV0A 1TQPA 3QPHA 2CW0F 3E5QA 1OYIA 3T8TA 1U8RA 3J7AO 3ULQB 3GFJA 1KU3A 1BOAA 5E20A 4KUMA 3BJ6A 5D8LB 3LA7A 4RAYA 2QUFA 1ODDA 2CYYA 1LNWA 3R0AA 1ZN2A 5DCMB 2UXXA 4CYDA 3QAHA 2DI3A 2HOEA 3GXOA 5L3BA 2NYXA 4U7DA 1ONVA 5K1YA 4LK1F 3QU3A 4RB2C 4ZYGA 2XV4S 1ZGJA 1Y0UA 4WXCA 5AIQA 3OV8A 3FMQA 1MDMA 1ZARA 3SZTA 1TQIA 3GEZA 3I64A 4MNUA 1JHHA 3FWEA 1R7JA 3CUQB 2GA2A 2EWNA 3IL2A 1GVJA 4HOBA 2VBXA 3KLOA 5D4SA 1R00A 3CLOA 3D0SA 3F8BA 3JTHA 3Q5FA 1RUOA 2K4JA 3J81K 1FBUA 4MQ9F 2M1BA 3F8FA 4OMYA 4HV5A 1SFUA 4G94A 5HOOA 3BPVA 3CUQC 2QYOA 1RI7A 3WU1B 1KYZA 3HSFA 3M9AA 1TTYA 3MZYA 3L7WA 2ESNA 2V9VA 2FU4A 3KP3A 3M8FA 3R6SA 2Y75A 1XSDA 1T0FA 4BHCA 2Q0OA 3TQNA 2GAUA 1WI9A 1I27A 4KIBA 1EH8A 4LB5A 3N4MA 1FP2A 1OYYA 3KP7A 3K69A 4BYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CDG A;  5E8I A;  2XUB A;  2V79 A;  5DUI A;  1BI2 A;  1HXD A;  3M7G A;  5BPD A;  2BEO A;  5BS6 A;  4M71 A;  1PDN C;  2K02 A;  5A2Q Z;  2FBH A;  4KMU X;  4LD5 A;  4EVI A;  1D5V A;  3I0T A;  2RDP A;  4B8X A;  1U2W A;  2XKP A;  5E8G A;  3C3W A;  1P6R A;  2CSO A;  5DD8 A;  3I53 A;  5HDN A;  3WTX C;  2EV5 A;  2VN2 A;  1PP7 U;  2FBI A;  2VBY A;  5ICG A;  4HF2 A;  2D1H A;  1Q1H A;  2B0L A;  2K86 A;  1PUE E;  2QM3 A;  4ASN A;  3BZ6 A;  3GFL A;  5EEH A;  2OZ6 A;  2YX7 A;  3M1E A;  3T0Y A;  2VON A;  4U0Y A;  4M9Z A;  3WE3 A;  2P7V B;  4R8H A;  1BI1 A;  2Z33 A;  1ZG1 A;  3SHF A;  1FZP B;  3FZV A;  3Q9S A;  2EK5 A;  3KCC A;  2D2W A;  1B59 A;  5E17 F;  3GUD A;  2HTJ A;  5CVJ A;  2P5K A;  3SFZ A;  5TJJ A;  1FBS A;  1IRG A;  2M8E A;  3V8L A;  4EJT A;  1Z9C A;  2CGP A;  3G3Z A;  2RGV A;  2QQ9 A;  5DUK A;  1FC3 A;  3TKY A;  4L0Y B;  3BWG A;  5HVQ C;  4KN4 X;  5JFR A;  3K1N A;  3LST A;  1TNS A;  2EB7 A;  2HFH A;  3CTA A;  3KE2 A;  4UXN A;  4UVB A;  1RIO H;  3C7J A;  1FX7 A;  2XKO A;  4MQV A;  4HLX A;  3HRM A;  4L5I A;  2KJC A;  1KQ0 A;  1W4M A;  2DK5 A;  3E6M A;  4S04 A;  3T5X A;  4ZZD A;  4MEX F;  1DPR A;  1S8N A;  1H9T A;  2NRA C;  3WTU C;  3R61 A;  1T39 A;  1FSE A;  2LF7 A;  1TNT A;  2NNY A;  2RKH A;  1IXC A;  4EJU A;  1Z6T A;  1HQC A;  5LBQ A;  4FX4 A;  3WTW C;  2PFB A;  3CDH A;  2ZCW A;  3V4G A;  1KU7 A;  2A6E F;  3ZMU A;  1E17 A;  1IXR C;  1S6L A;  3GF2 A;  2QZ8 A;  4Z2Y A;  1LEB A;  2EFQ A;  2G7U A;  2HKX A;  2CFX A;  3COA C;  1ZRE A;  4E70 A;  2E1N A;  3H3Z A;  1YW7 A;  4GYI A;  4IHT A;  1STZ A;  5D5W B;  2LKP A;  1F5T A;  1DUX C;  5F64 A;  1FYM A;  1S3J A;  3RTR A;  1F9N A;  2O61 A;  1O7F A;  4ZYE A;  3VOD A;  4BAY A;  2HYG D;  4M6Y A;  1W5T A;  2XGX A;  4HBL A;  1W7P D;  5FD5 A;  1FSH A;  3HRU A;  2EFN A;  1SFE A;  2VBZ A;  2FXA A;  4Q4Z F;  2KIM A;  3WTS C;  2HS5 A;  4EJV A;  1TBX A;  1IN7 A;  4M73 A;  4LLG F;  1HW5 A;  4RS8 A;  4G6D A;  4EM1 A;  5JI6 A;  3IC7 A;  1XMA A;  4CIC A;  3GW2 A;  5E18 F;  1J5Y A;  5BPI A;  3O6B B;  4Q47 A;  1U5T C;  2YPR A;  1CF7 B;  3LAJ A;  2COM A;  2FSW A;  1K6O A;  4M72 A;  5D5U B;  3BOQ A;  4HF1 A;  3JAM K;  2OA4 A;  1IXS B;  1TW3 A;  1OYW A;  3VEP A;  2E1C A;  1YIO A;  4BXU A;  4YII A;  4KN7 X;  4M6X A;  4IJA A;  2C6Y A;  1P92 A;  4UV9 A;  1D3Y A;  2WV0 A;  4I7H A;  1KQ9 A;  3T1B A;  5JR3 A;  2H6C A;  1SD5 A;  4ON0 A;  2XAH A;  1A04 A;  1YW9 A;  1UCR A;  4WCG A;  1LDD A;  1FNN A;  3FMS A;  3KP6 A;  3TOA A;  1BN5 A;  1O3T A;  3ZN1 A;  3SQN A;  1W7P A;  3GFI A;  2Q2E A;  2DTR A;  3MEX A;  2JTV A;  1HKT A;  2GA1 A;  4L5J A;  3F8M A;  2A3S A;  5LRR A;  2EJR A;  4LFU A;  2IPQ X;  3NRV A;  3HTU A;  4I98 B;  3REO A;  3I59 A;  3WGG A;  3I58 A;  1XSV A;  4LGW A;  1LEA A;  3K9T A;  2HTS A;  1I6X A;  3CUO A;  4HQE A;  4U0V A;  5FD6 A;  1O3R A;  3E6C C;  1YLF A;  2OU2 A;  1YFH A;  2GWR A;  3E6D A;  4Q5S F;  1QGP A;  3HIF A;  3DFG A;  3LWF A;  2H94 A;  3BP8 A;  4DQ2 A;  3S2W A;  4L9J A;  2DU9 A;  1BC8 C;  1UST A;  1WSU A;  2DBB A;  2H09 A;  4U0W A;  3O2P E;  2VOD A;  4AIK A;  2OBP A;  1IN5 A;  1J0R A;  3R0J A;  2AS5 F;  4ESJ A;  4G7H F;  1LQ1 A;  4U7B A;  5D5V B;  3HSR A;  3MCZ A;  1CGP A;  1XCB A;  5CJ9 A;  2LF8 A;  2LDU A;  5HLG A;  2DW4 A;  2FEZ A;  5DD4 A;  4G7Z F;  2IRF G;  1FPQ A;  2P6S A;  4BQA A;  1OKR A;  4I2O A;  1F4K A;  3W6K B;  1YS6 A;  4O3M A;  1D8K A;  3KFW X;  2UZK A;  3GVA A;  3IWZ A;  2MBF A;  4P9U A;  1SAX A;  4KNY A;  1IW7 F;  2E7X A;  3ELK A;  3LQQ A;  1ZG3 A;  2HWV A;  4G7O F;  3NQO A;  2MLG A;  2O0Y A;  3CO7 C;  5E1Z B;  5D6F A;  1REP C;  3K1M A;  4Y17 A;  2RQP A;  3U2R A;  5H20 A;  3HHG A;  4A0Y A;  1U78 A;  4H0E A;  3WTV C;  1ON2 A;  2PBI A;  3F8N A;  3IRQ A;  2R7F A;  5DEQ A;  4D0P A;  4P55 A;  5DCM A;  4UUV A;  1XN7 A;  3ZMZ A;  2HQR A;  1Z91 A;  2AXL A;  4ZYD A;  2FBK A;  2MH9 A;  2O6G E;  3MAJ A;  4XLP F;  1BI3 A;  4JQF A;  2XRO A;  4XSX F;  1LJ9 A;  1XSX A;  3KEO A;  3ZMD A;  2PJP A;  2DAO A;  3HYI A;  3WGH A;  1QO0 D;  1DDN A;  2W85 A;  1YG2 A;  3KP4 A;  3RJP A;  4OIR F;  4HDU A;  1J59 A;  4HDV A;  2YSR A;  3C18 A;  3KLN A;  3K0L A;  1XGN A;  4CXF A;  1YTY A;  4UVA A;  3WTT C;  3P7N A;  2W24 A;  2VC1 A;  3RKY A;  5KK1 A;  4BNC A;  4RGR A;  2MLK A;  4GO1 A;  2KRF A;  1R23 A;  3CUQ A;  3M8E A;  1GXQ A;  5FLX Z;  2HYF A;  2F5C A;  5L3D A;  3HRS A;  3RKW A;  3I71 A;  4I01 A;  3TO9 A;  1T98 A;  1HKQ A;  1BBY A;  4OMZ A;  2Z9O A;  5LGN A;  3QP6 A;  1F1Z A;  4HLY A;  3MWM A;  2OAZ A;  2IT0 A;  5DV5 A;  1UHW A;  4LLL A;  2ADU A;  3F6V A;  2XIG A;  2YU3 A;  4YFN F;  5EEG A;  3BDD A;  3R60 A;  2EFW A;  4MTE A;  4HW0 A;  4NB5 A;  1BIA A;  1U3E M;  5LGU A;  2NS0 A;  2O8X A;  2O3F A;  3ISP A;  2L3D A;  1SFX A;  4PZJ A;  2L02 A;  1QQI A;  1HBX G;  4WF2 A;  1J7K A;  1ZLK A;  4JBA A;  1USS A;  2RVC A;  1BC7 C;  3RIR A;  4LB6 B;  4IRI A;  4NHJ A;  2P6T A;  5HS9 A;  1G3Y A;  2YX4 A;  5ICE A;  2P8T A;  1KYW A;  3EYI A;  3H3U A;  2H6B A;  2XVC A;  2IP2 A;  4OU0 A;  5AIP A;  5HS8 A;  1TQM A;  4A6D A;  3GZ5 A;  2IA0 A;  4WXD A;  4P9F A;  3F72 A;  1P4A A;  2Y0M A;  3HOS A;  2Q8K A;  5CVV A;  3B02 A;  1JE8 A;  2W57 A;  4EGZ A;  3KZY A;  3BJA A;  2G7H A;  4CO8 A;  2XAQ A;  2X0L A;  2EA2 A;  1Z05 A;  2HR3 A;  2FRH A;  4JK1 X;  5FLX K;  2VOO A;  2O03 A;  1UHM A;  1H0M A;  4PGH A;  1ZH5 A;  1ZHF A;  4A12 A;  1B1B A;  5LLQ A;  2L01 A;  4PGG A;  3ERE D;  2A07 F;  2VOP A;  1DPU A;  4KYW A;  3E5U A;  4R79 A;  4ENN A;  1EV7 A;  1GXP A;  1R1U A;  2DK8 A;  3KP5 A;  5A2Q K;  4LG0 B;  2GQQ A;  2HZT A;  1R36 A;  3IHU A;  4HYE A;  4A0X A;  3QPT A;  2Y48 A;  1G3T A;  5LHI A;  4KDP A;  3GLX A;  3ZMV A;  3FXU A;  2RV8 A;  4EV0 A;  2L54 A;  3PQJ A;  3ABT A;  2JZY A;  3KEQ A;  2W84 A;  1QZZ A;  3DXJ F;  3ZP5 A;  1T2K A;  2STT A;  1I5Z A;  3T8R A;  1OR7 A;  3TDZ C;  4XLN F;  1E2X A;  1I1G A;  2JSC A;  1R5G A;  3JTG A;  2GZW A;  4A6E A;  2ISZ A;  2BBY A;  2HGC A;  3ZQ7 A;  1BM9 A;  3K2Z A;  2OD5 A;  3BJO A;  1XGO A;  4LG0 A;  2EFP A;  1U5T B;  1ZRC A;  1SMY F;  2HDC A;  4HZF A;  2UWM A;  5HLH A;  2PQ8 A;  1B6A A;  1U6G A;  1K78 B;  3V7C A;  1J2X A;  4LK0 F;  3RI4 A;  2FOK A;  2PMH A;  5BOX A;  5IT9 Z;  1R58 A;  2ZO4 A;  3GX4 X;  2GXG A;  1DP7 P;  3WGI A;  3E97 A;  2ZNZ A;  2KKO A;  6PAX A;  4UNO A;  4ZYH A;  1QZY A;  2DO7 A;  3RDI A;  3JSP A;  1R22 A;  2QBY B;  4EQQ A;  1U5T A;  3L09 A;  1LVA A;  4HX8 A;  5HDG A;  3QOP A;  4GCV A;  5L3G A;  4A5M A;  3J80 Z;  1MKM A;  4FHT A;  1CF7 A;  3HRT A;  2F5E A;  1FYK A;  2BYV E;  3I54 A;  5BQT A;  4RB0 A;  1YS7 A;  4G6Q A;  4G8X A;  5HLI A;  2GXB A;  3HTS B;  4EJW A;  2IW5 A;  4ENJ A;  1FLI A;  5LRS A;  5LEJ A;  2VXZ A;  3PQK A;  1XDU A;  2FQ3 A;  2BGC A;  5ICF A;  2ISY A;  3BPX A;  5H6R A;  3IWF A;  3P9K A;  5ED4 A;  5CYV A;  1B4A A;  1BI0 A;  4GGG A;  3ABU A;  4OIO F;  2F5D A;  3EET A;  1WQ2 A;  2J5O A;  3L9F A;  4I0A A;  2VT3 A;  2NNN A;  2FML A;  3GFM A;  4L9N A;  2F2E A;  3FX3 A;  2VE9 A;  1G6N A;  1YO5 C;  2QQB A;  1FYL A;  2ELH A;  1ZLJ A;  3ZMS A;  5CVR A;  2M30 A;  5D6E A;  1XGM A;  4MHG A;  1XD7 A;  2EA4 A;  4A0Z A;  5IT9 K;  1K7A A;  2OQR A;  3FM3 A;  3CO6 C;  4FX0 A;  4KMF A;  1X3U A;  3DPL C;  1Z7U A;  2XAS A;  3DKW A;  3F22 A;  1FY7 A;  5CLS A;  5D8K B;  1ZYR F;  1ZGA A;  2VBW A;  3HHH A;  2RC4 A;  2M87 A;  5DDG A;  3N97 A;  2UXN A;  1HST A;  1FWZ A;  1ZRF A;  2Z3Y A;  1S29 A;  3FMR A;  4O6J A;  1K79 A;  3ECO A;  3L00 A;  1XMK A;  3GYH X;  3DQV C;  4CGZ A;  2E7W A;  4DNC A;  4I0B A;  3RYP A;  3K1P A;  3W6J B;  4KIF A;  4HQM A;  2QQA A;  1O7L A;  1JHF A;  2MA3 A;  1O3S A;  3P9I A;  1IAW A;  1O57 A;  5J6X A;  1MDM B;  3J80 K;  4ENM A;  1J75 A;  2DQL A;  1Z1D A;  2F5F A;  2CQK A;  4ZH4 F;  1YYV A;  2KIF A;  3LAP A;  1IN4 A;  3FHZ A;  2DQR A;  2LSO A;  4KIC A;  3QP5 A;  4Y15 A;  4TV7 A;  1MZB A;  2TDX A;  1GHC A;  4O5V A;  3P9C A;  3E5X A;  1LB2 A;  4HX7 A;  4I02 A;  3EQL F;  4CHU A;  2IJL A;  4HV6 A;  1ZG5 A;  2P5L C;  3GWZ A;  4WWC A;  2ZKZ A;  4PDK A;  4IRG A;  2P4W A;  4EGY A;  1LDJ A;  4QLC U;  2ZFW A;  3DEU A;  2EFO A;  3RKX A;  3V8J A;  3QU6 A;  3LFK A;  2ZXJ A;  3WG9 A;  3F21 A;  2JPC A;  4RAZ A;  1OPC A;  4KT5 C;  3KET A;  3G73 A;  1QPM A;  5AON A;  2JRT A;  3KP2 A;  1IF1 A;  1HKS A;  2WC2 A;  2IA2 A;  3ECH A;  2OZU A;  1FT9 A;  5K5O A;  4HX4 A;  4BHP A;  4YIF A;  1R5H A;  5E1W A;  5BMZ A;  3Q9V A;  1MJA A;  2MC3 A;  2YR2 A;  1RZ4 A;  3FM5 A;  2DT5 A;  3WTZ A;  3MFK A;  3FXR A;  4N9I A;  1HSJ A;  2K27 A;  1WWX A;  1ULY A;  3EDP A;  5FB2 A;  3DV8 A;  4HF0 A;  1SD7 A;  2MD5 A;  3V8K A;  1FP1 D;  2K4B A;  4IVN A;  3RYR A;  3F8C A;  5LGT A;  3GZ6 A;  4PCQ A;  4IXA A;  2V1X A;  2QLZ A;  4M74 A;  3OOP A;  3FF5 A;  1ZRD A;  4RGS A;  2W25 A;  5D5X B;  1IN8 A;  4EM0 B;  3ML6 A;  2L4M A;  2A6H F;  3FXQ A;  3TDU C;  1QBJ A;  3SXY A;  1S7A A;  4A2U A;  5CVU A;  2D1V A;  1SMT A;  3LA3 A;  1TW2 A;  5ERI A;  2KJB A;  1ON1 A;  2VT2 A;  2QWW A;  4LLN A;  2FNP A;  3WU0 A;  2DPU A;  4AVP A;  2X4H A;  4AIJ A;  1BJA A;  1EH6 A;  4Y13 A;  3CJN A;  4NQW A;  4UVC A;  3WE2 A;  1KU2 A;  3TGN A;  3R4K A;  1MJB A;  4KA4 A;  4XRF A;  3D5L A;  1AOY A;  5LHH A;  3HOT A;  4MTD A;  2XHK A;  3DP7 A;  2HKO A;  2FMY A;  4WX9 A;  4YG2 F;  2M45 A;  2BV6 A;  1MD0 A;  2IVM A;  4EMS A;  1G3W A;  2JT1 A;  3JSO A;  4YFK F;  4RB3 C;  1P4W A;  1SD6 A;  1YQA A;  4U88 A;  5L3C A;  4G9Y A;  2STW A;  1G3S A;  4RGU A;  1P2F A;  3L2C A;  2DLL A;  5J8C A;  4HAM A;  3QRF F;  1XB4 A;  2CG4 A;  4M9S A;  3U9G A;  4L9T A;  4A5N A;  3LA2 A;  4UV8 A;  4S05 A;  1T6S A;  2ETH A;  3F6O A;  1EH7 A;  5HDK A;  5DYM A;  1JXS A;  2A5Y B;  4KFC A;  3TO7 A;  4CZZ A;  1P4X A;  3JAM Z;  1I1S A;  1V4R A;  2J5P A;  4MEY F;  3HUG A;  3F3X A;  5FFX A;  5K5R A;  2K7L A;  3IRR A;  4L0Z B;  2ESH A;  2HQN A;  1KGS A;  2PLY A;  1FBQ A;  2DFI A;  1MGT A;  4ESB A;  4ETS A;  3V7S A;  3E6B A;  5CVI A;  3WOD F;  2G9W A;  4GYG A;  4UHT A;  3ROU A;  4B09 A;  3BRO A;  4EJO A;  1R1V A;  4Q48 A;  2FNA A;  2OQG A;  2QEN A;  2EV6 A;  1MJ9 A;  1XDS A;  3IKV A;  2A69 F;  5F1R A;  4N9H A;  1JGS A;  1BIB A;  1HW1 A;  1KQ8 A;  1RNL A;  4XSZ F;  2LNB A;  4ESF A;  1L3L A;  3WTY C;  2A68 F;  1XCV A;  4P5O A;  1IRF A;  2M5W A;  4IRH A;  4KIG A;  2V1D A;  1WKM A;  4R1H A;  3I5U A;  5ICC A;  3RPU A;  2NAZ A;  3ZN0 A;  5FGM A;  1IN6 A;  3KZZ A;  3MZH A;  1ZAO A;  5L3F A;  3ZMT A;  1L0O C;  4L18 B;  3EYY A;  3AAF A;  4RB1 A;  3PFI A;  1IZ1 A;  3B73 A;  2GIV A;  4IPA A;  5KVR A;  4WK8 F;  4P96 A;  3I4P A;  3VFZ A;  2HEO A;  3DF8 A;  1C0W A;  4AWX B;  4BHB A;  2L4A A;  2CWE A;  1QNT A;  1HW2 A;  3GO5 A;  1PP8 F;  4HA8 A;  5H6Q A;  3H92 A;  2WWY A;  4IHS A;  3U1D A;  2R3S A;  5L3E A;  1Z6R A;  5TRD A;  1W7P B;  2P7C B;  5J8F A;  2FF4 A;  2FA5 A;  2ZBK A;  2P5V A;  3NEU A;  2XAF A;  2XRN A;  1T38 A;  1K78 A;  2PMU A;  4MGR A;  1B9M A;  2MH2 A;  1G4D A;  3ZPL A;  2PEX A;  2JPB A;  2PI0 A;  3V7R A;  5FO5 A;  4OIQ F;  3RPQ A;  5LHG A;  4OIP F;  3O3K A;  1KU9 A;  2PG4 A;  2CO5 A;  4ENK A;  3C1D A;  3I59 B;  1IUY A;  2WTE A;  4M9X A;  1S7O A;  5E1X A;  5IT3 A;  2Z5U A;  4WXH A;  5LEK A;  2QBY A;  1V3F A;  5ILU A;  4EM2 A;  4L9V A;  2ZJ2 A;  2DPD A;  1TLH B;  4RGX A;  1VTN C;  2V1U A;  3SZP A;  2VC0 A;  2XAJ A;  3MQ0 A;  4BH9 A;  5D4R A;  2FE3 A;  1OMI A;  1RUN A;  2R7D A;  4LMY A;  3HSE A;  4XBF A;  4GXO A;  1SD4 A;  4IF4 A;  2QVO A;  5JHU A;  2H27 A;  3LQR A;  4LJZ F;  2Z99 A;  1J9I A;  4OIN F;  3IKT A;  2RNJ A;  2ZNY A;  1H9G A;  2ZME B;  3F23 A;  2BE5 F;  1XGS A;  1LDK B;  4OOI A;  2PN6 A;  2D45 A;  3E3V A;  1R1T A;  2RN7 A;  2VE8 A;  1D8J A;  4AD9 A;  3J81 Z;  2KIU A;  4AIH A;  1FOK A;  3JW4 A;  3BY6 A;  5HS7 A;  5ILS A;  1B9N A;  5DCF A;  1AWC A;  3VB2 A;  4N0B A;  4QWQ A;  2A61 A;  4ZZL A;  1O3Q A;  1W5S A;  5FFZ A;  3EUH A;  1YW8 A;  4FT8 A;  1UFM A;  2V6C A;  5K5Q A;  2IA1 A;  3TO6 A;  5JVT A;  2ACJ A;  1NHA A;  3DPT A;  3VOE A;  4K2E A;  4F7Z A;  2ZME A;  4I09 A;  4YFX F;  1UB9 A;  3TOB A;  1KA8 A;  5ILV A;  2XAG A;  1WRJ A;  5F6F A;  2EV0 A;  1TQP A;  3QPH A;  2CW0 F;  3E5Q A;  1OYI A;  3T8T A;  1U8R A;  3J7A O;  3ULQ B;  3GFJ A;  1KU3 A;  1BOA A;  5E20 A;  4KUM A;  3BJ6 A;  5D8L B;  3LA7 A;  4RAY A;  2QUF A;  1ODD A;  2CYY A;  1LNW A;  3R0A A;  1ZN2 A;  5DCM B;  2UXX A;  4CYD A;  3QAH A;  2DI3 A;  2HOE A;  3GXO A;  5L3B A;  2NYX A;  4U7D A;  1ONV A;  5K1Y A;  4LK1 F;  3QU3 A;  4RB2 C;  4ZYG A;  2XV4 S;  1ZGJ A;  1Y0U A;  4WXC A;  5AIQ A;  3OV8 A;  3FMQ A;  1MDM A;  1ZAR A;  3SZT A;  1TQI A;  3GEZ A;  3I64 A;  4MNU A;  1JHH A;  3FWE A;  1R7J A;  3CUQ B;  2GA2 A;  2EWN A;  3IL2 A;  1GVJ A;  4HOB A;  2VBX A;  3KLO A;  5D4S A;  1R00 A;  3CLO A;  3D0S A;  3F8B A;  3JTH A;  3Q5F A;  1RUO A;  2K4J A;  3J81 K;  1FBU A;  4MQ9 F;  2M1B A;  3F8F A;  4OMY A;  4HV5 A;  1SFU A;  4G94 A;  5HOO A;  3BPV A;  3CUQ C;  2QYO A;  1RI7 A;  3WU1 B;  1KYZ A;  3HSF A;  3M9A A;  1TTY A;  3MZY A;  3L7W A;  2ESN A;  2V9V A;  2FU4 A;  3KP3 A;  3M8F A;  3R6S A;  2Y75 A;  1XSD A;  1T0F A;  4BHC A;  2Q0O A;  3TQN A;  2GAU A;  1WI9 A;  1I27 A;  4KIB A;  1EH8 A;  4LB5 A;  3N4M A;  1FP2 A;  1OYY A;  3KP7 A;  3K69 A;  4BYY A; 
#chains in the Genus database with same CATH topology
 4CDG A;  5E8I A;  4MIM A;  4QSH A;  3OL3 A;  4ZYA A;  3X2Q H;  2XUB A;  3W6V A;  2IS6 A;  2V79 A;  5DUI A;  1BI2 A;  1ZQ3 P;  1HXD A;  1MNE A;  3M7G A;  3M07 A;  5BPD A;  3FXL A;  2BEO A;  4F92 B;  5BS6 A;  4PSW A;  1Z77 A;  4M71 A;  2BXZ A;  3DCF A;  4FCY A;  1PDN C;  2K02 A;  1TWH J;  2FBH A;  5A2Q Z;  1EA3 A;  2WY7 Q;  4KMU X;  2CRG A;  3PNY A;  4LD5 A;  2DA2 A;  1YRN A;  3CCQ I;  4EVI A;  1D5V A;  1MMS A;  3I0T A;  2O5R A;  4PUS A;  2BW3 A;  1VQO I;  1WVR A;  1X3Z B;  4X6A J;  2RDP A;  4XQF A;  2L9V A;  5KAF C;  2H1K A;  4B8X A;  1U2W A;  2XKP A;  5E8G A;  3C3W A;  2ELK A;  1P6R A;  2CSO A;  3C2B A;  3SEQ A;  5DD8 A;  3I53 A;  5DS9 A;  4A69 C;  2Y31 A;  5HDN A;  3WTX C;  2EV5 A;  1S9H A;  1VFC A;  3U21 A;  2VN2 A;  1PP7 U;  2FBI A;  2VBY A;  2WAF A;  2JN6 A;  3ERM A;  2IGO A;  5ICG A;  4A3L J;  4DYC A;  4HF2 A;  1IDZ A;  2D1H A;  1JTY A;  1Q1H A;  2B0L A;  2LLK A;  1BR1 A;  2K86 A;  4I76 A;  4A3E J;  1PUE E;  2QM3 A;  4ASN A;  3HGG A;  2HXI A;  3AG2 H;  1SAU A;  3BZ6 A;  2E34 A;  3PUB A;  3GFL A;  1BOB A;  5EEH A;  2HPI A;  4A3B J;  2OZ6 A;  2YX7 A;  2P0W A;  2LBF B;  3M1E A;  3S1R J;  2JWT A;  3T0Y A;  2XGE A;  4XLH A;  4QIW N;  2VON A;  2CUJ A;  4U0Y A;  4BEH A;  4M9Z A;  4ABZ A;  5GPA A;  3WE3 A;  2XF7 A;  3MKZ A;  2P7V B;  4R8H A;  1BI1 A;  3CMA I;  3C2G A;  2KQR A;  2H8W A;  2Z33 A;  1ZG1 A;  3SHF A;  1FZP B;  3FZV A;  3Q9S A;  2EK5 A;  3KCC A;  4BQO A;  4BAC A;  2D2W A;  1B59 A;  3SYT A;  2DDB A;  4M3G A;  5E17 F;  3GUD A;  2HTJ A;  5CVJ A;  3O8H A;  2P5K A;  3SFZ A;  5TJJ A;  1FBS A;  3ZCO A;  1IRG A;  3ZRG A;  1R6R A;  2M8E A;  3V8L A;  3GLL A;  4EJT A;  4CCL A;  1Z9C A;  2CGP A;  3G3Z A;  3IP4 B;  3HPG A;  3JRH A;  2QSF X;  2JUC A;  2QQ9 A;  2RGV A;  1ITY A;  5DUK A;  2R5Y B;  3FHN A;  3WG7 H;  1FC3 A;  3TKY A;  4L0Y B;  4MFE A;  4W1U A;  4J01 A;  5CQG A;  3BWG A;  5HVQ C;  4E7I A;  4KN4 X;  5JFR A;  3OYI A;  3K1N A;  2Z2S B;  3LST A;  1TNS A;  2EB7 A;  4NBQ A;  4A3G J;  2HFH A;  2PX9 A;  3CTA A;  2WB1 N;  3KE2 A;  2LKX A;  1JUS A;  4UXN A;  2LBF A;  4UVB A;  5EEA A;  3C7J A;  1RIO H;  3CCJ I;  1FX7 A;  1FEX A;  2XKO A;  2JA7 J;  4MQV A;  1EKE A;  4HLX A;  3HRM A;  3JRA A;  4L5I A;  2ZB9 A;  2EIL H;  2KJC A;  2VPL A;  1KQ0 A;  1W4M A;  2DK5 A;  2VKE A;  4Y4R A;  3E6M A;  3WHC A;  4IX7 A;  4S04 A;  3T5X A;  4ZZD A;  4MEX F;  4B3X A;  1DPR A;  2E1O A;  4UB8 C;  2DT6 A;  2GOX B;  1S8N A;  2BOL A;  1ETQ A;  1H9T A;  2NRA C;  3WTU C;  3OIQ A;  3R61 A;  1T39 A;  3DLA A;  3O8G A;  1FSE A;  3TBI A;  3HKZ N;  2LF7 A;  2HZD A;  1YI2 I;  5GAG J;  2IAI A;  5FLM J;  1TNT A;  3FKI J;  4KIS A;  2NNY A;  2RKH A;  2LRE A;  1IXC A;  4EJU A;  2DMN A;  1Z6T A;  4Y33 A;  3SDG A;  5J1U A;  2DA3 A;  3CP2 A;  1HQC A;  2CV2 A;  5LBQ A;  4FX4 A;  3DTI A;  3WTW C;  4CZC A;  2PFB A;  1OR7 C;  2ZCW A;  3CDH A;  3V4G A;  2A6E F;  1SFO J;  1KU7 A;  3ZMU A;  2TCT A;  1E17 A;  1IXR C;  1BW5 A;  1S6L A;  3GF2 A;  2QZ8 A;  3PNV A;  4Z2Y A;  2CQN A;  1LEB A;  2EFQ A;  2G7U A;  3SJM A;  2HKX A;  3OYC A;  1YJN I;  3ZXS A;  1DGR M;  3DU6 A;  1WH7 A;  2CFX A;  3COA C;  1ZRE A;  4E70 A;  2E1N A;  2Y0S A;  3H3Z A;  2R7R A;  1YW7 A;  3FXO A;  4GYI A;  2JRM A;  1K83 J;  4IHT A;  1STZ A;  5D5W B;  4LOC A;  2BY2 A;  2LKP A;  1F5T A;  1DUX C;  5F64 A;  3EUA A;  4BY7 J;  1WJF A;  1MMN A;  1FYM A;  2X6X A;  1S3J A;  3RTR A;  1F9N A;  2O61 A;  3W2A A;  1O7F A;  4RM3 A;  4ZYE A;  3S32 A;  3VOD A;  2HYG D;  4M6Y A;  4BAY A;  1W5T A;  2XGX A;  4HBL A;  1W7P D;  5FD5 A;  5BNG A;  2UV1 A;  1FSH A;  3HRU A;  1MMD A;  2EFN A;  1WPK A;  1SFE A;  2VBZ A;  2FXA A;  4Q4Z F;  2KIM A;  3WTS C;  2HS5 A;  1PJR A;  4EJV A;  3BTJ A;  1TBX A;  2L7Z A;  1IN7 A;  3H5A A;  4M73 A;  4LLG F;  1HW5 A;  4RS8 A;  4D5C A;  4G6D A;  1OLT A;  3K4B A;  4EM1 A;  1MBK A;  5JI6 A;  2CQQ A;  2LTP A;  1FJL A;  1MMG A;  3IC7 A;  1XMA A;  4CIC A;  5FKL A;  3GW2 A;  5E18 F;  3GTG J;  5F04 A;  3H1C A;  2VKD A;  1J5Y A;  5BPI A;  3O6B B;  4Q47 A;  4CSW A;  3CP8 A;  1U5T C;  1FMW A;  1YX5 A;  1IRX A;  2YPR A;  1CF7 B;  1RES A;  3LAJ A;  2Y9Z A;  1RKW A;  2ZSH B;  2COM A;  2FSW A;  1K6O A;  3LL7 A;  4M72 A;  2EZI A;  1W1W E;  5D5U B;  3CZ6 A;  3VSL A;  3BOQ A;  4XK4 A;  4HF1 A;  1K61 A;  2G0E A;  3JAM K;  2OA4 A;  1VQ8 I;  1IXS B;  1TW3 A;  3J7A Y;  1OYW A;  1FTT A;  4B44 A;  5CPR B;  3VEP A;  3K4J A;  2E1C A;  1P9Q C;  1YIO A;  1YJ9 I;  2KZV A;  2NVQ J;  1X3W B;  4BXU A;  4YII A;  2IS4 A;  1MH3 A;  4KN7 X;  1RR7 A;  4M6X A;  5F27 A;  4IJA A;  4Y7N J;  2C6Y A;  1P92 A;  4UV9 A;  3HOX J;  3G6E I;  1D3Y A;  2WV0 A;  4I7H A;  4Y3O A;  1KQ9 A;  3T1B A;  1MSF C;  1SFK A;  5JR3 A;  2H6C A;  1VZ0 A;  4B3A A;  1SD5 A;  5B1A H;  4ON0 A;  2XAH A;  3DKY A;  4ZDP A;  1A04 A;  1GV2 A;  1UCR A;  1YW9 A;  2VB6 A;  4WCG A;  4IZZ A;  2EIJ H;  1LDD A;  1FNN A;  3CLQ A;  3FXJ A;  3FMS A;  3KP6 A;  3TOA A;  1JTX A;  2E1M C;  3CCR I;  4U87 A;  1BN5 A;  3L2V A;  1O3T A;  3ZN1 A;  2Y9Y A;  1NK2 P;  3SQN A;  1W7P A;  3GFI A;  2WY8 Q;  2Q2E A;  2CW7 A;  3FIS A;  1YIJ I;  2BZT A;  2CQX A;  2DTR A;  3MEX A;  1HF0 A;  1XS9 A;  2JTV A;  5GAH J;  2K9L A;  1HKT A;  2GA1 A;  2E36 A;  2WAE A;  4L5J A;  2R7S A;  3F8M A;  5GP9 A;  4F3Q A;  1WZ2 A;  2A3S A;  2HVS A;  4DYR A;  5LRR A;  2XB0 X;  4AU7 A;  2EJR A;  4LFU A;  1J09 A;  2QKL B;  2IPQ X;  2FX0 A;  3NRV A;  2L7K A;  3HTU A;  1XMX A;  3PO2 J;  3IH3 A;  2MFZ A;  4I98 B;  3REO A;  3I59 A;  1LFB A;  1MIJ A;  3WGG A;  3I58 A;  2VJI A;  1XSV A;  4LGW A;  2DMP A;  3S1N J;  1LEA A;  4PSX A;  2ECC A;  4XMY A;  3K9T A;  2HTS A;  1VQ4 I;  1ETY A;  1I6X A;  4FET A;  3CUO A;  4HQE A;  2WA0 A;  4U0V A;  5IP7 J;  2BHZ A;  4DBQ A;  1IUF A;  5FD6 A;  4BE0 A;  1O3R A;  3E6C C;  2KIS A;  1YLF A;  3K2A A;  1XG1 A;  2OU2 A;  1PUF B;  1YFH A;  4XN3 A;  2BY3 A;  2GWR A;  3TED A;  3E6D A;  1MBH A;  4Q5S F;  1QGP A;  3HIF A;  2VJ5 A;  3DFG A;  4E7K A;  3LWF A;  3OMY A;  2H94 A;  3BP8 A;  4DQ2 A;  2RQQ A;  5HNF A;  1R71 A;  2VQC A;  3S2W A;  4L9J A;  3L2Q A;  2DU9 A;  2R7Q A;  1BC8 C;  1UST A;  1WSU A;  2DBB A;  2ZSI B;  5FKK A;  2H09 A;  3OYN A;  3NWS A;  4U0W A;  1YJW I;  3U1K A;  3O2P E;  2VOD A;  4AIK A;  2OBP A;  3AL0 B;  4XKC A;  3S17 J;  1IN5 A;  4B47 A;  1J0R A;  3S14 J;  3R0J A;  2AS5 F;  4ESJ A;  1VQN I;  2KDO A;  2ZC2 A;  4G7H F;  1LQ1 A;  4U7B A;  5D5V B;  1Y39 A;  3HSR A;  3MCZ A;  1CGP A;  3W3C A;  1XCB A;  2OUM A;  3BLY A;  5CJ9 A;  2LF8 A;  2LDU A;  2LR8 A;  5HLG A;  2DW4 A;  4XOR A;  1VQ7 I;  4DJA A;  2FEZ A;  2WV1 A;  5DD4 A;  3PL8 A;  4G7Z F;  4KT6 A;  4D1Q A;  2IRF G;  3H0D A;  2DT7 B;  1FPQ A;  4MO7 A;  2O8K A;  2DTZ A;  1Z21 A;  3HDD A;  2P6S A;  2FD5 A;  3GCM A;  2R7T A;  4AC0 A;  4BQA A;  4F55 A;  2H1L A;  2XB5 A;  1U8B A;  2QEX I;  1OKR A;  4I2O A;  2Z1D A;  4ZJZ A;  1F4K A;  3W6K B;  3GTM J;  1YS6 A;  4O3M A;  1D8K A;  3KFW X;  3DBR B;  2UZK A;  2Y0S N;  3GVA A;  3ZQH A;  1QPI A;  2WB1 A;  4NC8 A;  2L7M P;  2OTJ I;  1U0J A;  3IWZ A;  2DN0 A;  2MBF A;  4P9U A;  4E7S A;  1IW7 F;  1SAX A;  4KNY A;  1OCO H;  5E79 C;  2KMU A;  2E7X A;  1QA6 A;  5EGO A;  1JT6 A;  3ELK A;  4OAY A;  2R7Z J;  3LQQ A;  1ZG3 A;  1WJ5 A;  2HWV A;  2DFF A;  4G7O F;  3HJE A;  3NQO A;  2MLG A;  2O0Y A;  3CO7 C;  4XLC A;  4B48 A;  3OYA A;  1PVE A;  5E1Z B;  5D6F A;  1IC8 A;  1REP C;  1SVL A;  4CCO A;  3K1M A;  4Y17 A;  2RQP A;  3U2R A;  5C4J J;  5H20 A;  3FBI B;  3HHG A;  4A0Y A;  3OYG A;  4BE2 A;  1U78 A;  4H0E A;  4JOM A;  3HKZ A;  3WTV C;  4M3F A;  1ON2 A;  2PBI A;  3F8N A;  3IRQ A;  4BDY A;  2MD0 A;  4JX4 A;  5M3F J;  2JUG A;  4A3I J;  4BJ6 C;  2R7F A;  5DEQ A;  4D0P A;  2L9S A;  3HG9 A;  4P55 A;  5DCM A;  4UUV A;  2ID6 A;  1XN7 A;  3ZMZ A;  2HQR A;  1V55 H;  1Z91 A;  1EJ9 A;  2K9Q A;  3K70 D;  2VIX A;  2AXL A;  4ZYD A;  1JJ8 C;  2FBK A;  2MH9 A;  2O6G E;  2Y30 A;  3MAJ A;  2P81 A;  4XLP F;  2ZXI A;  2KPM A;  2ZFU A;  3KEY A;  4FE4 A;  2V9K A;  1T33 A;  3KPH A;  4LG3 A;  4XR6 A;  1BI3 A;  4JQF A;  2WAQ N;  3A03 A;  2MAB A;  2XRO A;  2JA6 J;  4L5E A;  4XSX F;  1LJ9 A;  1XSX A;  3KEO A;  3ZMD A;  2EPF A;  3KIO A;  2LY1 A;  2PJP A;  2FJ1 A;  2DAO A;  3FK7 A;  3HYI A;  2QKM B;  3WGH A;  1QO0 D;  1DDN A;  2W85 A;  2M9H A;  5E3N A;  1IJW C;  2GXA A;  1Z7L A;  1YG2 A;  3KP4 A;  3RJP A;  3OYB A;  5GPC A;  2PJR B;  4OIR F;  1K4T A;  1QHH D;  3DTK A;  4XON A;  4HDU A;  1K6Y A;  3ZQC A;  1J59 A;  4HDV A;  4BQN A;  2YSR A;  3C18 A;  3KLN A;  3K0L A;  1XGN A;  3MKY B;  4CXF A;  1RRJ A;  3I9V 2;  2M2E A;  1YTY A;  4UVA A;  3WTT C;  5JHF A;  3GTQ J;  2R4G A;  3P7N A;  2W24 A;  3GBG A;  2VC1 A;  5FKM A;  3RKY A;  5KK1 A;  4BNC A;  4KIT B;  4RGR A;  2MLK A;  2JA2 A;  2ZXW H;  4GO1 A;  4V2G A;  3BG7 A;  2KRF A;  1R23 A;  4IHX A;  3CUQ A;  3M8E A;  1GXQ A;  5FLX Z;  1OFC X;  2LG4 A;  2ME0 A;  2HYF A;  2F5C A;  2W4S A;  2NVX J;  5L3D A;  2EIK H;  4A93 J;  3M3Y J;  3HRS A;  1QVU A;  4BY1 J;  1BR4 A;  3RKW A;  3I71 A;  4I01 A;  2COB A;  3TO9 A;  1T98 A;  3N05 A;  1HKQ A;  1BBY A;  4OMZ A;  3CF2 A;  2Z9O A;  2AHQ A;  1V54 H;  3L2W A;  5LGN A;  2XAU A;  3QP6 A;  1F1Z A;  4QPQ A;  4HLY A;  3S3M A;  3MWM A;  1X1C A;  2OAZ A;  2EZK A;  2OJE D;  4PJM A;  2IT0 A;  5DV5 A;  4BYY A;  1UHW A;  2VPR A;  3BR5 A;  1AKH B;  2DDA A;  4NQW B;  4LLL A;  2X6W A;  3CMM A;  2ADU A;  4DIQ A;  1DGW Y;  3K4C A;  1IDY A;  2MYS A;  3QOE A;  3RQ4 A;  3F6V A;  2L9R A;  5JLX A;  2M7B A;  2KRH A;  2XIG A;  2YU3 A;  4YFN F;  5EEG A;  3OS0 A;  3BDD A;  4RA2 A;  5IOY A;  1V5F A;  1TWA J;  3R60 A;  2EFW A;  2VAS A;  4MTE A;  1ERD A;  2X6O A;  3HPH A;  1APL C;  4Y52 J;  1UG0 A;  2BHY A;  1JKR C;  2DXI A;  2R93 J;  4HW0 A;  4NB5 A;  2K9S A;  1BIA A;  5F0C A;  3BR0 A;  1U3E M;  3S2H J;  3CES A;  5F0H A;  1FMV A;  1FOW A;  5LGU A;  1Q1V A;  2F4M B;  2XPU A;  2NS0 A;  2O8X A;  1TP4 A;  4A3F J;  2O3F A;  3ISP A;  2L3D A;  2VL8 A;  5F0F A;  5K7Z A;  1SFX A;  3S3N A;  4HPQ A;  4PZJ A;  2L02 A;  1QQI A;  1HBX G;  4WF2 A;  4BE1 A;  1OCR H;  1J7K A;  1ZLK A;  1Y56 A;  1X2M A;  5FKO A;  3S1M J;  4JBA A;  1USS A;  1T56 A;  2RVC A;  1E0E A;  1Y1V J;  1BC7 C;  3FXM A;  3RIR A;  4LB6 B;  4IRI A;  4NHJ A;  2P6T A;  3BQY A;  1XTA A;  5HS9 A;  1G3Y A;  3OL4 A;  1KON A;  5K7H A;  2YX4 A;  5ICE A;  2P8T A;  2X1E A;  1KYW A;  2CH0 A;  3EYI A;  3H3U A;  5J40 A;  2H6B A;  2XVC A;  1B72 B;  3HUG B;  4QPO A;  3PIP F;  2Y2Z A;  3DBH B;  2IP2 A;  4OU0 A;  5AIP A;  2VI6 A;  2L0K A;  3QPL A;  5HS8 A;  2R0Q C;  1TQM A;  4A6D A;  3GZ5 A;  2IA0 A;  4WXD A;  4S0H B;  4P9F A;  2L7F P;  2OV7 A;  2WAD A;  3DEW A;  1E3O C;  3HOY J;  2GOM A;  4BU2 A;  1YE9 A;  3F72 A;  1P4A A;  2Y0M A;  5J3L A;  4PJN A;  3JRC A;  4GRI A;  1JUM A;  3HOS A;  2Q8K A;  5CVV A;  1JUP A;  2QQ8 A;  3B02 A;  3MKW B;  1JE8 A;  4LIT A;  2W57 A;  2MW8 A;  4EGZ A;  3SZG A;  2IGN A;  1FIA A;  3KZY A;  3BJA A;  3RPU D;  1W5C C;  1ZR2 A;  2G7H A;  3OY9 A;  4CO8 A;  2XAQ A;  2X0L A;  2XSD C;  2EA2 A;  3MN2 A;  2E2J J;  3CJQ B;  1Z05 A;  4IQJ A;  4BL0 B;  2HR3 A;  2FRH A;  4G6T B;  4JK1 X;  3MMY B;  4AUX A;  5FLX K;  3L2R A;  2VOO A;  3AG1 H;  1B72 A;  4FIS A;  2O03 A;  1WCM J;  4X1E A;  5EYR A;  1UHM A;  5FLV A;  3LSG A;  3AG4 H;  1MND A;  1H0M A;  2K9M A;  4PGH A;  1ZH5 A;  2HPM A;  4XKW A;  1ZHF A;  4A12 A;  1B1B A;  5LLQ A;  2L01 A;  4PGG A;  3ERE D;  2A07 F;  2YU9 J;  2VOP A;  1DPU A;  4KYW A;  3E5U A;  3JRI A;  4R79 A;  4ENN A;  1GVD A;  2HOA A;  1LE8 B;  1EV7 A;  4NNJ A;  5KHD A;  2LC2 A;  1GXP A;  2F6C A;  1R1U A;  2DK8 A;  2R5Y A;  3KP5 A;  5A2Q K;  2OC6 A;  4MLO A;  2GQQ A;  4LG0 B;  5EJC A;  2HZT A;  1R36 A;  3IHU A;  5J1Y A;  4HYE A;  4A0X A;  2PMZ N;  3HL2 A;  3HZJ A;  3QPT A;  2Y48 A;  1YOV B;  1XC5 A;  1G3T A;  1P7I A;  3UKG A;  5LHI A;  4KDP A;  3GLX A;  4N4O B;  2BY1 A;  3ZMV A;  3FXU A;  2KFD A;  2FQ4 A;  3UNG C;  3HOV J;  2NXN B;  2RV8 A;  4UUS B;  4EV0 A;  2L54 A;  3PQJ A;  4HNU A;  1D1C A;  3ABT A;  3IH4 A;  3WHB A;  2A5W A;  1S7E A;  2X6Y A;  2JZY A;  3KEQ A;  1MBG A;  5GTI C;  1A35 A;  1WHU A;  2W84 A;  1QZZ A;  3DXJ F;  3ZP5 A;  1T2K A;  2STT A;  4XKV A;  1SVM A;  1I5Z A;  3T8R A;  1OR7 A;  3TDZ C;  1S5L C;  2NOJ B;  4XLN F;  3ZQG A;  1E2X A;  1I1G A;  2JSC A;  1R5G A;  4RDU A;  4M3D A;  1ETK A;  3BR3 A;  5M5X J;  3JTG A;  2GZW A;  4A6E A;  2R5Z B;  2ISZ A;  3CME I;  1A5J A;  2BBY A;  5LFA A;  2XPW A;  2HGC A;  3ZQ7 A;  2DJN A;  1BM9 A;  3K2Z A;  4HRI A;  2OD5 A;  3BJO A;  1XGO A;  4LG0 A;  5IP6 A;  1SC7 A;  3NAR A;  1I39 A;  2EFP A;  3DKX A;  5JVG F;  1X1A A;  1U5T B;  1ZRC A;  1SMY F;  2HDC A;  4HZF A;  2QA4 I;  2UWM A;  5HLH A;  3H5N A;  3JRD A;  3HGY A;  3LSH A;  2PQ8 A;  1B6A A;  1U6G A;  1K78 B;  3V7C A;  2R92 J;  3I56 I;  1J2X A;  4LK0 F;  4UUS A;  1F43 A;  3RI4 A;  2KT0 A;  3C2H A;  2X9D A;  2FOK A;  2PMH A;  5BOX A;  5IT9 Z;  4P1W A;  1R58 A;  2ZO4 A;  3IV5 A;  3GX4 X;  2GXG A;  4I6Z A;  2XF5 A;  5IP9 J;  2M34 A;  3CF5 F;  1DP7 P;  2X48 A;  1T95 A;  3Q0W A;  3WGI A;  3LSP A;  3E97 A;  2CS3 A;  4IHV A;  2ZNZ A;  2KKO A;  1VQL I;  6PAX A;  4UNO A;  1UJ8 A;  4CH7 A;  4ZYH A;  3ZQQ A;  1QZY A;  5TIS C;  3F0C A;  2HQ5 A;  3PSI A;  4BKX A;  2DO7 A;  1TWF J;  3RDI A;  2WAQ A;  2ME6 A;  3JSP A;  1R22 A;  2R5Z A;  1GT0 C;  3S15 J;  3QOD A;  2CV1 A;  5IYC J;  2QBY B;  1RKT A;  2UUZ A;  3CC4 I;  4RLF A;  4EQQ A;  4IOC F;  4CCM A;  2XDV A;  2X51 A;  1QZE A;  3A0B C;  1U5T A;  1W0T A;  3VYS B;  2E1M B;  1N78 A;  4RLQ A;  1EF4 A;  1Z3Y A;  3WU2 C;  4UUT A;  5IPA A;  2BY0 A;  3L2U A;  3CCS I;  1TWG J;  3L09 A;  1VI0 A;  4ZDL A;  1LVA A;  3K4K A;  4HX8 A;  4FAS D;  3K7A J;  1U9N A;  5HDG A;  3G71 I;  3QOP A;  1SAN A;  4GCV A;  5L3G A;  3HOU J;  2CMP A;  4A5M A;  3J80 Z;  1MKM A;  4FHT A;  4IKF A;  1NG6 A;  4GDF A;  1CF7 A;  3HRT A;  1R9T J;  3GTP J;  4A3D J;  2F5E A;  4RM2 A;  1FYK A;  1JGG A;  2BYV E;  3I54 A;  5BQT A;  4A3M J;  1XPX A;  2E35 A;  2X1D A;  1GUU A;  4RB0 A;  1YS7 A;  2CUF A;  2LH9 A;  4G6Q A;  3FKJ A;  4G8X A;  5HLI A;  2GXB A;  1IG7 A;  3HTS B;  4EJW A;  2IW5 A;  4ENJ A;  1FLI A;  2EIM H;  5LRS A;  5LEJ A;  2M4K A;  2VXZ A;  3PQK A;  4HSR A;  1XDU A;  2VKV A;  3A1Y A;  4D7N A;  4B4C A;  2FQ3 A;  2H8R A;  2BGC A;  4A3K J;  5ICF A;  2DOF A;  1UAA A;  2DA5 A;  3V42 A;  4BS9 A;  3BQZ A;  2ISY A;  3BPX A;  5H6R A;  4CA0 A;  5EDN A;  3IWF A;  3P9K A;  5ED4 A;  5CYV A;  1B4A A;  1BI0 A;  1D0Y A;  2NVY J;  3LNQ A;  1FIP A;  2IGK A;  3K6G A;  4GGG A;  3ABU A;  4OIO F;  2BVM A;  2F5D A;  3EET A;  1WQ2 A;  2J5O A;  3L9F A;  1B8I B;  1RR8 C;  1AU7 A;  1I6H J;  4I0A A;  2VT3 A;  2NNN A;  2FML A;  3ASO H;  1G59 A;  2QGU A;  3GTL J;  2DJI A;  3GFM A;  4L9N A;  2F2E A;  3FX3 A;  2VE9 A;  4XLF A;  3K4L A;  5B5E C;  1G6N A;  1LKX A;  2K85 A;  2LFB A;  1NK3 P;  3CD6 I;  2EBI A;  3EUH C;  1YO5 C;  2K3F A;  2JVG A;  1RPW A;  2QQB A;  2VQG A;  1FYL A;  3JRB A;  2ELH A;  1ZLJ A;  2DYS H;  1G8X A;  3ZMS A;  5CVR A;  2M30 A;  2DMU A;  5LD2 C;  5D6E A;  2ZJR F;  3FBN B;  3HB9 A;  1XGM A;  2ZXH A;  4MHG A;  1XD7 A;  2EA4 A;  4M3E A;  2ZME C;  3OOU A;  2JSP A;  3CCY A;  4A0Z A;  5E3O A;  5IT9 K;  3M1C A;  3AFH A;  1ZEL A;  1K7A A;  3BCB A;  2OQR A;  2W00 A;  3FM3 A;  1Z67 A;  4FX0 A;  3CO6 C;  1DU0 A;  4KMF A;  1X3U A;  3DPL C;  1Z7U A;  3OYM A;  1D1B A;  2AQF A;  2XAS A;  2DMQ A;  3S1Q J;  3DKW A;  2QF7 A;  4E4H A;  3F22 A;  1FY7 A;  4PJJ A;  4BBR J;  4PJ0 C;  5CLS A;  5D8K B;  1ZYR F;  3KZI C;  2R7U A;  3H9G A;  1ZGA A;  2VBW A;  3HHH A;  2RC4 A;  2M87 A;  3ABL H;  5DDG A;  3N97 A;  1B8I A;  2UXN A;  2V4J C;  5HOD A;  1HST A;  1FWZ A;  2KP6 A;  1F36 A;  3ESW B;  3GME A;  3DEE A;  1PUF A;  1ZRF A;  2Z3Y A;  1S29 A;  3FMR A;  4O6J A;  1K79 A;  2VLA A;  3ECO A;  3L00 A;  1XMK A;  3GYH X;  3DQV C;  4CGZ A;  2JK3 A;  1QRY A;  2OCE A;  2HNH A;  3FDY A;  2E7W A;  4DNC A;  4J19 A;  1GDT A;  1R4N B;  4I0B A;  3RYP A;  4DZP A;  3K1P A;  3W6J B;  4KIF A;  4HQM A;  2B63 J;  1X2N A;  3CQZ J;  2QQA A;  1VQK I;  2JMW A;  1KZH A;  4IEJ A;  3CJR B;  1O7L A;  1JHF A;  4KJZ A;  2MA3 A;  1IO2 A;  4JP0 A;  4D7M A;  1O3S A;  3P9I A;  2MSY A;  4XN0 A;  1IAW A;  1O57 A;  3JRF A;  2OCC H;  5J6X A;  3VDX A;  1WJA A;  1MDM B;  3J80 K;  5EF6 A;  4ENM A;  4CUG A;  2HI3 A;  2DQL A;  4PFO A;  2VKH A;  1J75 A;  2V6E A;  1Z1D A;  2F5F A;  2CQK A;  4YIR X;  1X19 A;  1YYV A;  4RAG A;  2KIF A;  4ZH4 F;  3LAP A;  1IN4 A;  3FHZ A;  1YX3 A;  2DQR A;  2LSO A;  3QP5 A;  4KIC A;  4Y15 A;  4TV7 A;  5J4V A;  3E7L A;  4CCJ A;  1MZB A;  2VJJ A;  4XLE A;  4ZDO A;  3BR2 A;  2TDX A;  3KX2 A;  1GHC A;  4O5V A;  3S3O A;  1MH4 A;  3P9C A;  4ITV A;  3E5X A;  1JJ6 C;  3SDB A;  2EH3 A;  1LB2 A;  4HX7 A;  2GM4 A;  4I02 A;  1NG7 A;  4XKB A;  3EQL F;  2PMZ A;  2NVT J;  4CHU A;  2IJL A;  4HV6 A;  4HST A;  1ZG5 A;  3BR6 A;  2M3A A;  2P5L C;  2ZJP F;  3GWZ A;  2K5C A;  2D5V A;  4WWC A;  2ZKZ A;  4PDK A;  4IRG A;  2DYR H;  2P4W A;  1ETX A;  4EGY A;  1LDJ A;  5B1B H;  3TP3 A;  3S16 J;  4QLC U;  4YRV A;  5EZH A;  3A01 B;  2ZFW A;  1MW7 A;  3DEU A;  2EFO A;  2XPV A;  2GIZ A;  3RKX A;  3V8J A;  3QU6 A;  4C3H J;  3LFK A;  2ZXJ A;  3OR1 C;  3S8P A;  3WG9 A;  3F21 A;  2JPC A;  4RAZ A;  4FTH A;  1OPC A;  4IQ4 A;  4KT5 C;  2HDD A;  1JI8 A;  3KET A;  3G73 A;  1Y6I A;  1QPM A;  3E0J B;  2DFH A;  5AON A;  2MG4 A;  2JRT A;  3KP2 A;  4BGD A;  1IF1 A;  5FRN A;  1HKS A;  2WC2 A;  2IA2 A;  3ECH A;  2I8D A;  2OZU A;  3H35 A;  2E2I J;  2EZH A;  4C3J J;  3TP0 A;  1FT9 A;  5EZG A;  5K5O A;  4FE7 A;  4HX4 A;  2LMD A;  4BHP A;  4YIF A;  3BTC A;  3BG3 A;  4XLA A;  2BXY A;  2ID3 A;  4ZTJ A;  1R5H A;  5E1W A;  5BMZ A;  1Y8R B;  1ENH A;  2E5Z A;  3Q9V A;  1MJA A;  1T0F C;  2MC3 A;  2DOD A;  1MBE A;  5J1R A;  3VYT B;  2JA8 J;  5H2F C;  2YR2 A;  1AHD P;  1SEU A;  2GLO A;  1RZ4 A;  3FM5 A;  2DT5 A;  3VYR B;  3WTZ A;  1YHQ I;  3MFK A;  2W1O A;  3FXR A;  4N9I A;  1HSJ A;  2K27 A;  1WWX A;  1P7J A;  4A3C J;  5K7F A;  1TWC J;  1MMA A;  1ULY A;  3EDP A;  1UG2 A;  5FB2 A;  3DV8 A;  4HF0 A;  1SD7 A;  2MD5 A;  3V8K A;  3H9J A;  1FP1 D;  2K4B A;  3OWT A;  4B43 A;  1H8A C;  2HDW A;  2DMT A;  4G12 A;  1X1D A;  4IVN A;  1MBJ A;  3RYR A;  1OCP A;  3H5R A;  3F8C A;  1OJL A;  4A3J J;  3ASN H;  4C2T A;  3PO3 J;  4C3I J;  2V9P A;  4BUP A;  1DP3 A;  9ANT A;  5LGT A;  3CCE I;  3GZ6 A;  4PCQ A;  4IXA A;  5KNL A;  1U9O A;  2PJR A;  4H4K C;  1T8I A;  1Z3X A;  3B6A A;  4DOZ A;  4F52 A;  2E60 A;  2V1X A;  3D1N I;  4B1R A;  2QLZ A;  4M74 A;  2K3P A;  3OOP A;  4II2 A;  2XSJ C;  4CCK A;  3FF5 A;  2XGC A;  1ZRD A;  4RGS A;  1LFP A;  2W25 A;  4C9Y A;  5D5X B;  2Q1Z B;  1VQ6 I;  1IN8 A;  2IXS A;  4EM0 B;  3ML6 A;  3MVP A;  3RQI A;  2L4M A;  1VQ5 I;  3HOZ J;  2LK2 A;  2A6H F;  2CUZ A;  3FXQ A;  4ZTF A;  2RNG A;  1DU6 A;  2K40 A;  2EQR A;  4EAT A;  2CFO A;  1LPQ A;  3TDU C;  1QBJ A;  3K4N A;  3HEF A;  2OTL I;  3SXY A;  1IRZ A;  3GTJ J;  1SVO A;  1PYV A;  5HLT A;  2R7O A;  2K9N A;  1S7A A;  5C4X J;  4BEH B;  4A2U A;  1CQT A;  4AID A;  5CVU A;  2D1V A;  1SMT A;  3LA3 A;  3OYH A;  1TW2 A;  1QVT A;  5ERI A;  2KJB A;  3I3L A;  1ON1 A;  2VT2 A;  1OCT C;  2QWW A;  4LLN A;  2FNP A;  2M4G A;  2OPT A;  2L5Q A;  3DBL B;  3J7Y J;  2VXD A;  3WU0 A;  2DPU A;  4AVP A;  3OYL A;  2X4H A;  3DWL E;  4AIJ A;  1BJA A;  1EH6 A;  3PNT A;  3I4N J;  3BC8 A;  4Y13 A;  1AKH A;  4XL9 A;  2ZJQ F;  2CJJ A;  3CJN A;  4NQW A;  4UVC A;  1VQP I;  1K4S A;  3WE2 A;  1KU2 A;  3TGN A;  3R4K A;  1MJB A;  2V26 A;  4KA4 A;  1T08 B;  4XRF A;  3D5L A;  3BT9 A;  2V1N A;  1AOY A;  1R4M B;  3J7Z I;  2NS7 A;  5LHH A;  2XHK A;  4MTD A;  3HOT A;  3DP7 A;  2HKO A;  2M0C A;  1POG A;  2R7W A;  3KYD B;  2FMY A;  4OAZ A;  4WX9 A;  4YG2 F;  1IGN A;  2M45 A;  1OCC H;  4XRS A;  2BV6 A;  1MD0 A;  4BXX J;  2GBY A;  4YEL A;  4F91 B;  2IVM A;  5GTH C;  4EMS A;  1G3W A;  2JT1 A;  3JSO A;  4YFK F;  4RB3 C;  1P4W A;  2MGQ A;  3LMM A;  1SD6 A;  1YQA A;  4U88 A;  4BJ5 C;  5L3C A;  2HYJ A;  2A05 A;  4G9Y A;  1YIT I;  1W36 D;  3QPS A;  2XC7 A;  2STW A;  1G3S A;  2AQE A;  1I3Q J;  3PUF A;  4RGU A;  3NWT A;  2DOE A;  1P2F A;  1HA8 A;  1Y8Q B;  3L2C A;  2DLL A;  5J8C A;  2XF6 A;  2HU9 A;  4HAM A;  3QRF F;  2O9L A;  1XB4 A;  2X1C A;  4PK4 A;  2CG4 A;  4M9S A;  1W0U A;  5J4Y A;  3U9G A;  4L9T A;  1ETW A;  2F48 A;  3LA2 A;  4A5N A;  4LIU A;  1MNM C;  4UV8 A;  4AYB N;  4S05 A;  1D0X A;  3DLL F;  5B3S H;  3H0G J;  1GLN A;  1UHS A;  1T6S A;  2Z16 A;  2YS9 A;  1D1A A;  2ETH A;  4DBR A;  3ZR8 X;  3F6O A;  3CDL A;  1EH7 A;  5F1J A;  5DYM A;  2DCE A;  5HDK A;  1JXS A;  2A5Y B;  4KFC A;  3TO7 A;  4CZZ A;  3B6C A;  5C44 J;  1BR2 A;  1P4X A;  3JAM Z;  1I1S A;  1V4R A;  3ABM H;  2J5P A;  4MEY F;  3HUG A;  2HXO A;  3F3X A;  3CDI A;  2JJ7 A;  3OS1 A;  3BG9 A;  5FFX A;  5K5R A;  1WJB A;  2K7L A;  3IRR A;  3IAM 2;  2ESH A;  1IV6 A;  4L0Z B;  3L1P A;  3HBL A;  2HQN A;  1RC9 A;  1ACI A;  1O4X A;  1KGS A;  2PLY A;  4E7Z A;  1HDD C;  3DPU A;  1FBQ A;  2DFI A;  3LSM A;  1MGT A;  4ESB A;  3W2W A;  3RKQ A;  4ETS A;  3V7S A;  3E6B A;  5CVI A;  3ZOB A;  5FKN A;  3WOD F;  2G9W A;  4GYG A;  4N4N B;  4UHT A;  3ROU A;  3CCM I;  2IBD A;  4E7H A;  3JRE A;  2ICW G;  4B09 A;  3BRO A;  2RAE A;  4EJO A;  3BR1 A;  1JKP C;  2WBM A;  3EPZ A;  1W36 C;  1R1V A;  4Q48 A;  4JX5 A;  2FNA A;  2OQG A;  2QEN A;  2W82 A;  1H88 C;  2EV6 A;  1I50 J;  3BTI A;  3OIO A;  1RET A;  3H9Q A;  1BJZ A;  4GFB A;  1MJ9 A;  1A36 A;  2NOG A;  4C2U A;  1XDS A;  3IKV A;  2A69 F;  3LSJ A;  4PJL A;  5F1R A;  4N9H A;  1JGS A;  1LFU P;  1D0Z A;  1BIB A;  1NTC A;  1HW1 A;  2M7A A;  2OF7 A;  4F93 B;  5JLW A;  5DM6 F;  3K4M A;  1KQ8 A;  4D5F A;  1RNL A;  4XSZ F;  2LNB A;  3VSK A;  2DA4 A;  4ESF A;  3OR2 C;  1L3L A;  3WTY C;  2KIQ A;  1IV8 A;  3KYC B;  1R49 A;  2I5U A;  3CJT B;  2A68 F;  1QU3 A;  1XCV A;  3MKL A;  1A31 A;  3BTL A;  4HG2 A;  1IRF A;  4P5O A;  2M5W A;  4IRH A;  1LE8 A;  2KHM A;  1ETO A;  4KIG A;  3OYE A;  4XOP A;  5EG0 B;  2V1D A;  1WKM A;  4R1H A;  3I5U A;  5ICC A;  4EEF G;  3RPU A;  2NAZ A;  3ZN0 A;  5FGM A;  1IN6 A;  2HVR A;  2L9N A;  3KZZ A;  3MZH A;  2IGM A;  2HQA A;  1ZAO A;  4JX6 A;  3PIO F;  5L3F A;  3ZMT A;  1L0O C;  1E3H A;  4L18 B;  3EYY A;  4V2F A;  4DYQ A;  3AAF A;  2LYC A;  4RB1 A;  1HC8 A;  1OIS A;  2YUS A;  2FOW A;  3PFI A;  1IZ1 A;  3B73 A;  2GIV A;  4IPA A;  2N8G A;  5KVR A;  4WK8 F;  3S93 A;  3G4S I;  2EIN H;  4P96 A;  3I4P A;  3VFZ A;  2HEO A;  3DF8 A;  3D5S C;  2IEK A;  3CCV I;  5M5Y J;  2KDZ A;  1C0W A;  2JQ7 A;  2DA6 A;  3IH2 A;  4AWX B;  2XGD A;  1HCR A;  4BHB A;  2L4A A;  2CWE A;  1QNT A;  4E7L A;  2E5N A;  5F08 A;  1UEL B;  2NS8 A;  2KL4 A;  4XIC A;  3CMY A;  1HW2 A;  3GO5 A;  1PP8 F;  4HA8 A;  2JVH A;  3EUK L;  3M8J A;  1TT0 A;  4XM3 A;  3CCL I;  5EG0 A;  5H6Q A;  3CC2 I;  3H92 A;  2WWY A;  5FRM A;  4UY8 I;  4IHS A;  3U1D A;  1AA7 A;  2R3S A;  5L3E A;  3GZN B;  1Z6R A;  3KYL A;  1W7P B;  5TRD A;  2P7C B;  5J8F A;  2FF4 A;  2FA5 A;  2ZBK A;  4CYC B;  1XX5 A;  2DFE A;  2Q2E B;  2P5V A;  5FJ8 J;  2ECB A;  3NEU A;  2XAF A;  2XRN A;  1T38 A;  2LOO A;  1K78 A;  2PMU A;  4MGR A;  4CCN A;  4AM3 A;  2CQ7 A;  1B9M A;  2MH2 A;  3IUO A;  3PFY A;  1G4D A;  3ZPL A;  1HDP A;  2PEX A;  2JPB A;  2CV0 A;  4I99 C;  1MSE C;  3G1M A;  4RAF A;  4IHY A;  2PI0 A;  1ZR4 A;  3MD2 A;  3DTE A;  3V7R A;  3QYE A;  3PSF A;  3TMO A;  5FO5 A;  5TGT A;  3OIP A;  1H89 C;  3QYF A;  3RPQ A;  5LHG A;  4OIQ F;  4OIP F;  3O3K A;  1JT0 A;  2R7X A;  1KU9 A;  1JKO C;  2PG4 A;  2CO5 A;  1ZKG A;  3P5J A;  4ENK A;  5KAI C;  3C1D A;  3TW6 A;  3I59 B;  2CW8 A;  1IUY A;  2WTE A;  4M9X A;  3A2K A;  3G2B A;  1S7O A;  3RZD J;  5E1X A;  3VYU B;  5IT3 A;  2Z5U A;  4HEA 2;  4WXH A;  1DQU A;  1X1B A;  5HNH A;  1ZTR A;  4NDL A;  5LEK A;  1TZL A;  2NVU B;  3TW7 A;  3HM5 A;  2QBY A;  1V3F A;  5ILU A;  4EM2 A;  4L9V A;  3PJR A;  2LY2 A;  2ZJ2 A;  1TLH B;  4RGX A;  2DPD A;  2LY9 A;  1HOM A;  2V7F A;  1VTN C;  2V1U A;  3SZP A;  2R7V A;  4CYC A;  4BXF A;  5DM7 F;  2VC0 A;  2XAJ A;  3MQ0 A;  2M0M A;  4BH9 A;  4IO9 F;  5D4R A;  2FE3 A;  1OMI A;  1RUN A;  2R7D A;  4HNT A;  3DU5 A;  4LMY A;  4W97 A;  3HSE A;  4XBF A;  2HOS A;  3M4O J;  4GXO A;  1SD4 A;  4IF4 A;  3S2D J;  2QVO A;  1UMQ A;  1I3A A;  5JHU A;  3AKZ A;  2H27 A;  3HOW J;  4BBS J;  2XRL A;  4ANJ A;  3LQR A;  4LJZ F;  2LKS A;  3GTO J;  2Z99 A;  1J9I A;  4OIN F;  2KRC A;  1GV5 A;  2RNJ A;  2ZNY A;  3ABK H;  3IKT A;  1H9G A;  1X4P A;  2X85 A;  2ZME B;  3FIW A;  3F23 A;  2BE5 F;  4UB6 C;  5IYD J;  1XGS A;  2LRD A;  1LDK B;  2AXT C;  2PN6 A;  4OOI A;  2D45 A;  3E3V A;  3QQA A;  5IYB J;  2DA1 A;  3PM1 A;  1TC3 C;  1R1T A;  1OQY A;  1WJC A;  2RN7 A;  2IS2 A;  1JKQ C;  2VE8 A;  1D8J A;  4AD9 A;  3J81 Z;  2KIU A;  2CU7 A;  4AIH A;  1N77 A;  1FOK A;  3JW4 A;  3BY6 A;  5HS7 A;  5ILS A;  3NAU A;  1B9N A;  5DCF A;  1AWC A;  3VB2 A;  4N0B A;  4QWQ A;  1TT5 B;  2F4I A;  3H36 A;  2A61 A;  2TRT A;  3BZC A;  4ZZL A;  1O3Q A;  1W5S A;  5IOZ A;  5FFZ A;  3RCO A;  1VQM I;  3EUH A;  3Q0V A;  1YW8 A;  2I10 A;  3FK6 A;  4NC6 A;  3QWL A;  2E71 A;  4FT8 A;  4ZC3 A;  1UFM A;  1X4O A;  2V6C A;  3K10 A;  5K5Q A;  1OCZ H;  2IA1 A;  2RRE A;  1TL8 A;  3TO6 A;  5JVT A;  5DTD A;  2B9S A;  1NHA A;  3DPT A;  2ACJ A;  2JA5 J;  3BCA A;  2EZL A;  3ONQ A;  2F4O B;  4BDZ A;  3VOE A;  5EGO B;  4K2E A;  1FTZ A;  3BG5 A;  2ZME A;  4I09 A;  3ZQF A;  4F7Z A;  1UB9 A;  4YFX F;  3LSR A;  3D5R C;  1Y1W J;  3TOB A;  2ELJ A;  1KA8 A;  5ILV A;  2XAG A;  5C3E J;  1WRJ A;  5F6F A;  4E7J A;  2EV0 A;  1TQP A;  3QPH A;  3HC7 A;  1V5G A;  2CW0 F;  2HVQ A;  1WH5 A;  2QSG X;  1V5E A;  3E5Q A;  1OYI A;  4MFD A;  3T8T A;  2B7E A;  2VJ4 A;  1U8R A;  3J7A O;  2FUG 2;  3ULQ B;  3GFJ A;  1KU3 A;  1BOA A;  3LSI A;  2HOT A;  5E20 A;  5KCM A;  4KUM A;  3BJ6 A;  4BJT A;  3FXK A;  3OYJ A;  4XID A;  5D8L B;  3AL0 C;  3LA7 A;  5M3M J;  4RAY A;  4AYB A;  1N25 A;  2QUF A;  3G1L A;  1ODD A;  2CYY A;  3LOC A;  1NH3 A;  1LNW A;  3R0A A;  1ETV A;  3CCU I;  2MC4 A;  4PFP A;  1ZN2 A;  1VND A;  1ZK8 A;  5B66 C;  3A02 A;  3OSF A;  5DCM B;  3UR3 C;  4IOA F;  4XRM A;  2E19 A;  2UXX A;  3A4C A;  4IL6 C;  5J47 A;  3I55 I;  3ZQL A;  4DW6 A;  4CYD A;  4OWR B;  3F9K A;  3BG6 A;  2LP0 A;  1BL0 A;  3Q3S A;  1D5Y A;  3QAH A;  3SEZ A;  1BA5 A;  2DI3 A;  1LUJ B;  2HOE A;  3GXO A;  5L3B A;  1N75 A;  1MBF A;  1WFX A;  2NYX A;  4U7D A;  3MZ8 A;  2E2H J;  2VUM J;  3OYK A;  3JCU C;  3JR9 A;  1ONV A;  1ZGW A;  5K1Y A;  2AO9 A;  3VPR A;  4QTR A;  4LK1 F;  3QU3 A;  5E3M A;  4RB2 C;  1WJD A;  3I4M J;  4ZYG A;  3OYF A;  4M3B A;  2XV4 S;  1ZGJ A;  1Y0U A;  4WXC A;  1VF9 A;  4RMN A;  2QCO A;  5AIQ A;  3OV8 A;  1LVK A;  3FMQ A;  2M8G X;  3LFU A;  5M5W J;  4II3 A;  3QYB A;  3RSN A;  1S72 I;  3ZQI A;  4E6K G;  1ORK A;  1Z0X A;  2LVS A;  3Q0U A;  4FQG A;  1ZAR A;  3TL4 X;  1MDM A;  3SZT A;  2VQL A;  4C2M J;  4J00 A;  1TQI A;  2VQH A;  3GEZ A;  3I64 A;  4MNU A;  1JHH A;  3FWE A;  2CUE A;  2DA7 A;  1HLV A;  4NUB A;  1R7J A;  4DGW B;  3IAS 2;  3E1S A;  4IHW A;  3CUQ B;  2GA2 A;  2KLO A;  4BQQ A;  5CQE A;  2F5V A;  2EWN A;  3HXL A;  3IL2 A;  4C30 A;  1GVJ A;  4HOB A;  2VBX A;  3KLO A;  5D4S A;  3OSG A;  3OYD A;  1R00 A;  3CLO A;  3D0S A;  3F8B A;  4V19 K;  3JTH A;  3Q5F A;  1RUO A;  2K4J A;  4RBO A;  3AG3 H;  3J81 K;  1FBU A;  4MQ9 F;  1G2H A;  1WGX A;  4LIV A;  2O7O A;  4AVZ A;  2M1B A;  2W48 A;  3F8F A;  5IY5 H;  4OMY A;  4HNV A;  1QHG A;  2KZG A;  3GTK J;  1FOX A;  1Y0N A;  2W7N A;  4HV5 A;  3SFI A;  1BW6 A;  4JYK A;  5E3L A;  4XNF A;  3LSK A;  4G94 A;  1SFU A;  4XOT A;  1WJE A;  5HOO A;  3BPV A;  4D9J A;  3CUQ C;  1M1E B;  4X0G A;  2QYO A;  2LD5 A;  2QSH X;  1A6Q A;  1RI7 A;  1WI3 A;  3G1O A;  5GAE J;  2A6T A;  3WU1 B;  3RZO J;  1KYZ A;  1YRN B;  1UZC A;  3HSF A;  1E3P A;  1TTY A;  3M9A A;  4Z6Y A;  3MZY A;  5CKT A;  3L7W A;  2IS1 A;  2ESN A;  2V9V A;  2BVL A;  3ZGK A;  2FU4 A;  2BW3 B;  3W2V A;  3A01 A;  3KP3 A;  3M8F A;  3R6S A;  2Y75 A;  1XSD A;  3CC7 I;  3OS2 A;  1T0F A;  4DZJ A;  4BHC A;  1X58 A;  3VWB A;  2Q0O A;  4NC7 A;  2Y69 H;  3TQN A;  4XRS G;  1VQ9 I;  3JRG A;  3H3V K;  2GAU A;  4M6V A;  4YEJ A;  5GAD J;  3BZK A;  1A6I A;  1FOY A;  1I27 A;  1WI9 A;  2DOA A;  1EH8 A;  4KIB A;  5FRO A;  1X1P A;  1R5I D;  4LB5 A;  3N4M A;  1FP2 A;  1OYY A;  3A0H C;  3K69 A;  3KP7 A;  2L2O A;  3K70 C; 
#chains in the Genus database with same CATH homology
 4CDG A;  5E8I A;  2XUB A;  2V79 A;  5DUI A;  1BI2 A;  1HXD A;  3M7G A;  5BPD A;  2BEO A;  5BS6 A;  4M71 A;  1PDN C;  2K02 A;  5A2Q Z;  2FBH A;  4KMU X;  4LD5 A;  4EVI A;  1D5V A;  3I0T A;  2RDP A;  4B8X A;  1U2W A;  2XKP A;  5E8G A;  3C3W A;  1P6R A;  2CSO A;  5DD8 A;  3I53 A;  5HDN A;  3WTX C;  2EV5 A;  2VN2 A;  1PP7 U;  2FBI A;  2VBY A;  5ICG A;  4HF2 A;  2D1H A;  1Q1H A;  2B0L A;  2K86 A;  1PUE E;  2QM3 A;  4ASN A;  3BZ6 A;  3GFL A;  5EEH A;  2OZ6 A;  2YX7 A;  3M1E A;  3T0Y A;  2VON A;  4U0Y A;  4M9Z A;  3WE3 A;  2P7V B;  4R8H A;  1BI1 A;  2Z33 A;  1ZG1 A;  3SHF A;  1FZP B;  3FZV A;  3Q9S A;  2EK5 A;  3KCC A;  2D2W A;  1B59 A;  5E17 F;  3GUD A;  2HTJ A;  5CVJ A;  2P5K A;  3SFZ A;  5TJJ A;  1FBS A;  1IRG A;  2M8E A;  3V8L A;  4EJT A;  1Z9C A;  2CGP A;  3G3Z A;  2RGV A;  2QQ9 A;  5DUK A;  1FC3 A;  3TKY A;  4L0Y B;  3BWG A;  5HVQ C;  4KN4 X;  5JFR A;  3K1N A;  3LST A;  1TNS A;  2EB7 A;  2HFH A;  3CTA A;  3KE2 A;  4UXN A;  4UVB A;  1RIO H;  3C7J A;  1FX7 A;  2XKO A;  4MQV A;  4HLX A;  3HRM A;  4L5I A;  2KJC A;  1KQ0 A;  1W4M A;  2DK5 A;  3E6M A;  4S04 A;  3T5X A;  4ZZD A;  4MEX F;  1DPR A;  1S8N A;  1H9T A;  2NRA C;  3WTU C;  3R61 A;  1T39 A;  1FSE A;  2LF7 A;  1TNT A;  2NNY A;  2RKH A;  1IXC A;  4EJU A;  1Z6T A;  1HQC A;  5LBQ A;  4FX4 A;  3WTW C;  2PFB A;  3CDH A;  2ZCW A;  3V4G A;  1KU7 A;  2A6E F;  3ZMU A;  1E17 A;  1IXR C;  1S6L A;  3GF2 A;  2QZ8 A;  4Z2Y A;  1LEB A;  2EFQ A;  2G7U A;  2HKX A;  2CFX A;  3COA C;  1ZRE A;  4E70 A;  2E1N A;  3H3Z A;  1YW7 A;  4GYI A;  4IHT A;  1STZ A;  5D5W B;  2LKP A;  1F5T A;  1DUX C;  5F64 A;  1FYM A;  1S3J A;  3RTR A;  1F9N A;  2O61 A;  1O7F A;  4ZYE A;  3VOD A;  4BAY A;  2HYG D;  4M6Y A;  1W5T A;  2XGX A;  4HBL A;  1W7P D;  5FD5 A;  1FSH A;  3HRU A;  2EFN A;  1SFE A;  2VBZ A;  2FXA A;  4Q4Z F;  2KIM A;  3WTS C;  2HS5 A;  4EJV A;  1TBX A;  1IN7 A;  4M73 A;  4LLG F;  1HW5 A;  4RS8 A;  4G6D A;  4EM1 A;  5JI6 A;  3IC7 A;  1XMA A;  4CIC A;  3GW2 A;  5E18 F;  1J5Y A;  5BPI A;  3O6B B;  4Q47 A;  1U5T C;  2YPR A;  1CF7 B;  3LAJ A;  2COM A;  2FSW A;  1K6O A;  4M72 A;  5D5U B;  3BOQ A;  4HF1 A;  3JAM K;  2OA4 A;  1IXS B;  1TW3 A;  1OYW A;  3VEP A;  2E1C A;  1YIO A;  4BXU A;  4YII A;  4KN7 X;  4M6X A;  4IJA A;  2C6Y A;  1P92 A;  4UV9 A;  1D3Y A;  2WV0 A;  4I7H A;  1KQ9 A;  3T1B A;  5JR3 A;  2H6C A;  1SD5 A;  4ON0 A;  2XAH A;  1A04 A;  1YW9 A;  1UCR A;  4WCG A;  1LDD A;  1FNN A;  3FMS A;  3KP6 A;  3TOA A;  1BN5 A;  1O3T A;  3ZN1 A;  3SQN A;  1W7P A;  3GFI A;  2Q2E A;  2DTR A;  3MEX A;  2JTV A;  1HKT A;  2GA1 A;  4L5J A;  3F8M A;  2A3S A;  5LRR A;  2EJR A;  4LFU A;  2IPQ X;  3NRV A;  3HTU A;  4I98 B;  3REO A;  3I59 A;  3WGG A;  3I58 A;  1XSV A;  4LGW A;  1LEA A;  3K9T A;  2HTS A;  1I6X A;  3CUO A;  4HQE A;  4U0V A;  5FD6 A;  1O3R A;  3E6C C;  1YLF A;  2OU2 A;  1YFH A;  2GWR A;  3E6D A;  4Q5S F;  1QGP A;  3HIF A;  3DFG A;  3LWF A;  2H94 A;  3BP8 A;  4DQ2 A;  3S2W A;  4L9J A;  2DU9 A;  1BC8 C;  1UST A;  1WSU A;  2DBB A;  2H09 A;  4U0W A;  3O2P E;  2VOD A;  4AIK A;  2OBP A;  1IN5 A;  1J0R A;  3R0J A;  2AS5 F;  4ESJ A;  4G7H F;  1LQ1 A;  4U7B A;  5D5V B;  3HSR A;  3MCZ A;  1CGP A;  1XCB A;  5CJ9 A;  2LF8 A;  2LDU A;  5HLG A;  2DW4 A;  2FEZ A;  5DD4 A;  4G7Z F;  2IRF G;  1FPQ A;  2P6S A;  4BQA A;  1OKR A;  4I2O A;  1F4K A;  3W6K B;  1YS6 A;  4O3M A;  1D8K A;  3KFW X;  2UZK A;  3GVA A;  3IWZ A;  2MBF A;  4P9U A;  1SAX A;  4KNY A;  1IW7 F;  2E7X A;  3ELK A;  3LQQ A;  1ZG3 A;  2HWV A;  4G7O F;  3NQO A;  2MLG A;  2O0Y A;  3CO7 C;  5E1Z B;  5D6F A;  1REP C;  3K1M A;  4Y17 A;  2RQP A;  3U2R A;  5H20 A;  3HHG A;  4A0Y A;  1U78 A;  4H0E A;  3WTV C;  1ON2 A;  2PBI A;  3F8N A;  3IRQ A;  2R7F A;  5DEQ A;  4D0P A;  4P55 A;  5DCM A;  4UUV A;  1XN7 A;  3ZMZ A;  2HQR A;  1Z91 A;  2AXL A;  4ZYD A;  2FBK A;  2MH9 A;  2O6G E;  3MAJ A;  4XLP F;  1BI3 A;  4JQF A;  2XRO A;  4XSX F;  1LJ9 A;  1XSX A;  3KEO A;  3ZMD A;  2PJP A;  2DAO A;  3HYI A;  3WGH A;  1QO0 D;  1DDN A;  2W85 A;  1YG2 A;  3KP4 A;  3RJP A;  4OIR F;  4HDU A;  1J59 A;  4HDV A;  2YSR A;  3C18 A;  3KLN A;  3K0L A;  1XGN A;  4CXF A;  1YTY A;  4UVA A;  3WTT C;  3P7N A;  2W24 A;  2VC1 A;  3RKY A;  5KK1 A;  4BNC A;  4RGR A;  2MLK A;  4GO1 A;  2KRF A;  1R23 A;  3CUQ A;  3M8E A;  1GXQ A;  5FLX Z;  2HYF A;  2F5C A;  5L3D A;  3HRS A;  3RKW A;  3I71 A;  4I01 A;  3TO9 A;  1T98 A;  1HKQ A;  1BBY A;  4OMZ A;  2Z9O A;  5LGN A;  3QP6 A;  1F1Z A;  4HLY A;  3MWM A;  2OAZ A;  2IT0 A;  5DV5 A;  1UHW A;  4LLL A;  2ADU A;  3F6V A;  2XIG A;  2YU3 A;  4YFN F;  5EEG A;  3BDD A;  3R60 A;  2EFW A;  4MTE A;  4HW0 A;  4NB5 A;  1BIA A;  1U3E M;  5LGU A;  2NS0 A;  2O8X A;  2O3F A;  3ISP A;  2L3D A;  1SFX A;  4PZJ A;  2L02 A;  1QQI A;  1HBX G;  4WF2 A;  1J7K A;  1ZLK A;  4JBA A;  1USS A;  2RVC A;  1BC7 C;  3RIR A;  4LB6 B;  4IRI A;  4NHJ A;  2P6T A;  5HS9 A;  1G3Y A;  2YX4 A;  5ICE A;  2P8T A;  1KYW A;  3EYI A;  3H3U A;  2H6B A;  2XVC A;  2IP2 A;  4OU0 A;  5AIP A;  5HS8 A;  1TQM A;  4A6D A;  3GZ5 A;  2IA0 A;  4WXD A;  4P9F A;  3F72 A;  1P4A A;  2Y0M A;  3HOS A;  2Q8K A;  5CVV A;  3B02 A;  1JE8 A;  2W57 A;  4EGZ A;  3KZY A;  3BJA A;  2G7H A;  4CO8 A;  2XAQ A;  2X0L A;  2EA2 A;  1Z05 A;  2HR3 A;  2FRH A;  4JK1 X;  5FLX K;  2VOO A;  2O03 A;  1UHM A;  1H0M A;  4PGH A;  1ZH5 A;  1ZHF A;  4A12 A;  1B1B A;  5LLQ A;  2L01 A;  4PGG A;  3ERE D;  2A07 F;  2VOP A;  1DPU A;  4KYW A;  3E5U A;  4R79 A;  4ENN A;  1EV7 A;  1GXP A;  1R1U A;  2DK8 A;  3KP5 A;  5A2Q K;  4LG0 B;  2GQQ A;  2HZT A;  1R36 A;  3IHU A;  4HYE A;  4A0X A;  3QPT A;  2Y48 A;  1G3T A;  5LHI A;  4KDP A;  3GLX A;  3ZMV A;  3FXU A;  2RV8 A;  4EV0 A;  2L54 A;  3PQJ A;  3ABT A;  2JZY A;  3KEQ A;  2W84 A;  1QZZ A;  3DXJ F;  3ZP5 A;  1T2K A;  2STT A;  1I5Z A;  3T8R A;  1OR7 A;  3TDZ C;  4XLN F;  1E2X A;  1I1G A;  2JSC A;  1R5G A;  3JTG A;  2GZW A;  4A6E A;  2ISZ A;  2BBY A;  2HGC A;  3ZQ7 A;  1BM9 A;  3K2Z A;  2OD5 A;  3BJO A;  1XGO A;  4LG0 A;  2EFP A;  1U5T B;  1ZRC A;  1SMY F;  2HDC A;  4HZF A;  2UWM A;  5HLH A;  2PQ8 A;  1B6A A;  1U6G A;  1K78 B;  3V7C A;  1J2X A;  4LK0 F;  3RI4 A;  2FOK A;  2PMH A;  5BOX A;  5IT9 Z;  1R58 A;  2ZO4 A;  3GX4 X;  2GXG A;  1DP7 P;  3WGI A;  3E97 A;  2ZNZ A;  2KKO A;  6PAX A;  4UNO A;  4ZYH A;  1QZY A;  2DO7 A;  3RDI A;  3JSP A;  1R22 A;  2QBY B;  4EQQ A;  1U5T A;  3L09 A;  1LVA A;  4HX8 A;  5HDG A;  3QOP A;  4GCV A;  5L3G A;  4A5M A;  3J80 Z;  1MKM A;  4FHT A;  1CF7 A;  3HRT A;  2F5E A;  1FYK A;  2BYV E;  3I54 A;  5BQT A;  4RB0 A;  1YS7 A;  4G6Q A;  4G8X A;  5HLI A;  2GXB A;  3HTS B;  4EJW A;  2IW5 A;  4ENJ A;  1FLI A;  5LRS A;  5LEJ A;  2VXZ A;  3PQK A;  1XDU A;  2FQ3 A;  2BGC A;  5ICF A;  2ISY A;  3BPX A;  5H6R A;  3IWF A;  3P9K A;  5ED4 A;  5CYV A;  1B4A A;  1BI0 A;  4GGG A;  3ABU A;  4OIO F;  2F5D A;  3EET A;  1WQ2 A;  2J5O A;  3L9F A;  4I0A A;  2VT3 A;  2NNN A;  2FML A;  3GFM A;  4L9N A;  2F2E A;  3FX3 A;  2VE9 A;  1G6N A;  1YO5 C;  2QQB A;  1FYL A;  2ELH A;  1ZLJ A;  3ZMS A;  5CVR A;  2M30 A;  5D6E A;  1XGM A;  4MHG A;  1XD7 A;  2EA4 A;  4A0Z A;  5IT9 K;  1K7A A;  2OQR A;  3FM3 A;  3CO6 C;  4FX0 A;  4KMF A;  1X3U A;  3DPL C;  1Z7U A;  2XAS A;  3DKW A;  3F22 A;  1FY7 A;  5CLS A;  5D8K B;  1ZYR F;  1ZGA A;  2VBW A;  3HHH A;  2RC4 A;  2M87 A;  5DDG A;  3N97 A;  2UXN A;  1HST A;  1FWZ A;  1ZRF A;  2Z3Y A;  1S29 A;  3FMR A;  4O6J A;  1K79 A;  3ECO A;  3L00 A;  1XMK A;  3GYH X;  3DQV C;  4CGZ A;  2E7W A;  4DNC A;  4I0B A;  3RYP A;  3K1P A;  3W6J B;  4KIF A;  4HQM A;  2QQA A;  1O7L A;  1JHF A;  2MA3 A;  1O3S A;  3P9I A;  1IAW A;  1O57 A;  5J6X A;  1MDM B;  3J80 K;  4ENM A;  1J75 A;  2DQL A;  1Z1D A;  2F5F A;  2CQK A;  4ZH4 F;  1YYV A;  2KIF A;  3LAP A;  1IN4 A;  3FHZ A;  2DQR A;  2LSO A;  4KIC A;  3QP5 A;  4Y15 A;  4TV7 A;  1MZB A;  2TDX A;  1GHC A;  4O5V A;  3P9C A;  3E5X A;  1LB2 A;  4HX7 A;  4I02 A;  3EQL F;  4CHU A;  2IJL A;  4HV6 A;  1ZG5 A;  2P5L C;  3GWZ A;  4WWC A;  2ZKZ A;  4PDK A;  4IRG A;  2P4W A;  4EGY A;  1LDJ A;  4QLC U;  2ZFW A;  3DEU A;  2EFO A;  3RKX A;  3V8J A;  3QU6 A;  3LFK A;  2ZXJ A;  3WG9 A;  3F21 A;  2JPC A;  4RAZ A;  1OPC A;  4KT5 C;  3KET A;  3G73 A;  1QPM A;  5AON A;  2JRT A;  3KP2 A;  1IF1 A;  1HKS A;  2WC2 A;  2IA2 A;  3ECH A;  2OZU A;  1FT9 A;  5K5O A;  4HX4 A;  4BHP A;  4YIF A;  1R5H A;  5E1W A;  5BMZ A;  3Q9V A;  1MJA A;  2MC3 A;  2YR2 A;  1RZ4 A;  3FM5 A;  2DT5 A;  3WTZ A;  3MFK A;  3FXR A;  4N9I A;  1HSJ A;  2K27 A;  1WWX A;  1ULY A;  3EDP A;  5FB2 A;  3DV8 A;  4HF0 A;  1SD7 A;  2MD5 A;  3V8K A;  1FP1 D;  2K4B A;  4IVN A;  3RYR A;  3F8C A;  5LGT A;  3GZ6 A;  4PCQ A;  4IXA A;  2V1X A;  2QLZ A;  4M74 A;  3OOP A;  3FF5 A;  1ZRD A;  4RGS A;  2W25 A;  5D5X B;  1IN8 A;  4EM0 B;  3ML6 A;  2L4M A;  2A6H F;  3FXQ A;  3TDU C;  1QBJ A;  3SXY A;  1S7A A;  4A2U A;  5CVU A;  2D1V A;  1SMT A;  3LA3 A;  1TW2 A;  5ERI A;  2KJB A;  1ON1 A;  2VT2 A;  2QWW A;  4LLN A;  2FNP A;  3WU0 A;  2DPU A;  4AVP A;  2X4H A;  4AIJ A;  1BJA A;  1EH6 A;  4Y13 A;  3CJN A;  4NQW A;  4UVC A;  3WE2 A;  1KU2 A;  3TGN A;  3R4K A;  1MJB A;  4KA4 A;  4XRF A;  3D5L A;  1AOY A;  5LHH A;  3HOT A;  4MTD A;  2XHK A;  3DP7 A;  2HKO A;  2FMY A;  4WX9 A;  4YG2 F;  2M45 A;  2BV6 A;  1MD0 A;  2IVM A;  4EMS A;  1G3W A;  2JT1 A;  3JSO A;  4YFK F;  4RB3 C;  1P4W A;  1SD6 A;  1YQA A;  4U88 A;  5L3C A;  4G9Y A;  2STW A;  1G3S A;  4RGU A;  1P2F A;  3L2C A;  2DLL A;  5J8C A;  4HAM A;  3QRF F;  1XB4 A;  2CG4 A;  4M9S A;  3U9G A;  4L9T A;  4A5N A;  3LA2 A;  4UV8 A;  4S05 A;  1T6S A;  2ETH A;  3F6O A;  1EH7 A;  5HDK A;  5DYM A;  1JXS A;  2A5Y B;  4KFC A;  3TO7 A;  4CZZ A;  1P4X A;  3JAM Z;  1I1S A;  1V4R A;  2J5P A;  4MEY F;  3HUG A;  3F3X A;  5FFX A;  5K5R A;  2K7L A;  3IRR A;  4L0Z B;  2ESH A;  2HQN A;  1KGS A;  2PLY A;  1FBQ A;  2DFI A;  1MGT A;  4ESB A;  4ETS A;  3V7S A;  3E6B A;  5CVI A;  3WOD F;  2G9W A;  4GYG A;  4UHT A;  3ROU A;  4B09 A;  3BRO A;  4EJO A;  1R1V A;  4Q48 A;  2FNA A;  2OQG A;  2QEN A;  2EV6 A;  1MJ9 A;  1XDS A;  3IKV A;  2A69 F;  5F1R A;  4N9H A;  1JGS A;  1BIB A;  1HW1 A;  1KQ8 A;  1RNL A;  4XSZ F;  2LNB A;  4ESF A;  1L3L A;  3WTY C;  2A68 F;  1XCV A;  4P5O A;  1IRF A;  2M5W A;  4IRH A;  4KIG A;  2V1D A;  1WKM A;  4R1H A;  3I5U A;  5ICC A;  3RPU A;  2NAZ A;  3ZN0 A;  5FGM A;  1IN6 A;  3KZZ A;  3MZH A;  1ZAO A;  5L3F A;  3ZMT A;  1L0O C;  4L18 B;  3EYY A;  3AAF A;  4RB1 A;  3PFI A;  1IZ1 A;  3B73 A;  2GIV A;  4IPA A;  5KVR A;  4WK8 F;  4P96 A;  3I4P A;  3VFZ A;  2HEO A;  3DF8 A;  1C0W A;  4AWX B;  4BHB A;  2L4A A;  2CWE A;  1QNT A;  1HW2 A;  3GO5 A;  1PP8 F;  4HA8 A;  5H6Q A;  3H92 A;  2WWY A;  4IHS A;  3U1D A;  2R3S A;  5L3E A;  1Z6R A;  5TRD A;  1W7P B;  2P7C B;  5J8F A;  2FF4 A;  2FA5 A;  2ZBK A;  2P5V A;  3NEU A;  2XAF A;  2XRN A;  1T38 A;  1K78 A;  2PMU A;  4MGR A;  1B9M A;  2MH2 A;  1G4D A;  3ZPL A;  2PEX A;  2JPB A;  2PI0 A;  3V7R A;  5FO5 A;  4OIQ F;  3RPQ A;  5LHG A;  4OIP F;  3O3K A;  1KU9 A;  2PG4 A;  2CO5 A;  4ENK A;  3C1D A;  3I59 B;  1IUY A;  2WTE A;  4M9X A;  1S7O A;  5E1X A;  5IT3 A;  2Z5U A;  4WXH A;  5LEK A;  2QBY A;  1V3F A;  5ILU A;  4EM2 A;  4L9V A;  2ZJ2 A;  2DPD A;  1TLH B;  4RGX A;  1VTN C;  2V1U A;  3SZP A;  2VC0 A;  2XAJ A;  3MQ0 A;  4BH9 A;  5D4R A;  2FE3 A;  1OMI A;  1RUN A;  2R7D A;  4LMY A;  3HSE A;  4XBF A;  4GXO A;  1SD4 A;  4IF4 A;  2QVO A;  5JHU A;  2H27 A;  3LQR A;  4LJZ F;  2Z99 A;  1J9I A;  4OIN F;  3IKT A;  2RNJ A;  2ZNY A;  1H9G A;  2ZME B;  3F23 A;  2BE5 F;  1XGS A;  1LDK B;  4OOI A;  2PN6 A;  2D45 A;  3E3V A;  1R1T A;  2RN7 A;  2VE8 A;  1D8J A;  4AD9 A;  3J81 Z;  2KIU A;  4AIH A;  1FOK A;  3JW4 A;  3BY6 A;  5HS7 A;  5ILS A;  1B9N A;  5DCF A;  1AWC A;  3VB2 A;  4N0B A;  4QWQ A;  2A61 A;  4ZZL A;  1O3Q A;  1W5S A;  5FFZ A;  3EUH A;  1YW8 A;  4FT8 A;  1UFM A;  2V6C A;  5K5Q A;  2IA1 A;  3TO6 A;  5JVT A;  2ACJ A;  1NHA A;  3DPT A;  3VOE A;  4K2E A;  4F7Z A;  2ZME A;  4I09 A;  4YFX F;  1UB9 A;  3TOB A;  1KA8 A;  5ILV A;  2XAG A;  1WRJ A;  5F6F A;  2EV0 A;  1TQP A;  3QPH A;  2CW0 F;  3E5Q A;  1OYI A;  3T8T A;  1U8R A;  3J7A O;  3ULQ B;  3GFJ A;  1KU3 A;  1BOA A;  5E20 A;  4KUM A;  3BJ6 A;  5D8L B;  3LA7 A;  4RAY A;  2QUF A;  1ODD A;  2CYY A;  1LNW A;  3R0A A;  1ZN2 A;  5DCM B;  2UXX A;  4CYD A;  3QAH A;  2DI3 A;  2HOE A;  3GXO A;  5L3B A;  2NYX A;  4U7D A;  1ONV A;  5K1Y A;  4LK1 F;  3QU3 A;  4RB2 C;  4ZYG A;  2XV4 S;  1ZGJ A;  1Y0U A;  4WXC A;  5AIQ A;  3OV8 A;  3FMQ A;  1MDM A;  1ZAR A;  3SZT A;  1TQI A;  3GEZ A;  3I64 A;  4MNU A;  1JHH A;  3FWE A;  1R7J A;  3CUQ B;  2GA2 A;  2EWN A;  3IL2 A;  1GVJ A;  4HOB A;  2VBX A;  3KLO A;  5D4S A;  1R00 A;  3CLO A;  3D0S A;  3F8B A;  3JTH A;  3Q5F A;  1RUO A;  2K4J A;  3J81 K;  1FBU A;  4MQ9 F;  2M1B A;  3F8F A;  4OMY A;  4HV5 A;  1SFU A;  4G94 A;  5HOO A;  3BPV A;  3CUQ C;  2QYO A;  1RI7 A;  3WU1 B;  1KYZ A;  3HSF A;  3M9A A;  1TTY A;  3MZY A;  3L7W A;  2ESN A;  2V9V A;  2FU4 A;  3KP3 A;  3M8F A;  3R6S A;  2Y75 A;  1XSD A;  1T0F A;  4BHC A;  2Q0O A;  3TQN A;  2GAU A;  1WI9 A;  1I27 A;  4KIB A;  1EH8 A;  4LB5 A;  3N4M A;  1FP2 A;  1OYY A;  3KP7 A;  3K69 A;  4BYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...