1LDGA

Plasmodium falciparum l-lactate dehydrogenase complexed with nadh and oxamate
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
315
structure length
315
Chain Sequence
APKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGSDVVIVTAGFTKAPGKSDKEWNRLDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of lactate dehydrogenase from Plasmodium falciparum reveals a new target for anti-malarial design.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Oxidoreductase
molecule keywords L-LACTATE DEHYDROGENASE
total genus 115
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1996-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ldgA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1ldgA02
1UJMA 3OECA 3U0BA 1ENYA 4TQGA 1HE3A 4CV0A 5KJCA 3STHA 1FDUA 1F17A 3EK2A 5A1TA 4CL3A 5DT9A 1PL7A 2J3JA 4A5OA 3DBHA 2E82A 2Y0CA 1X0VA 3I23A 1JLLA 4BNNA 4B7XA 1NPYA 3AU9A 4FGWA 1HDGO 5DOVA 1I33A 2CF5A 2X9VA 1IOLA 2D4AA 4Z0HO 2C54A 2H63A 3K9QO 4CMEA 1H6AA 3CMMA 3WLEA 5L4SA 4DYDA 1P77A 3MJVA 3V5NA 1GQQA 2PH5A 4RV9A 2P9CA 1ISJA 3L6OO 2FY8A 3P5SA 4IXWA 3RROA 1MX3A 1HSOA 3DZFA 3ZNNA 5TS3A 2DTXA 5JLAA 1HYGA 3ROKA 4E3ZA 5L7TA 3PK0A 3EMKA 4BMVA 3OEYA 4BNWA 1N2SA 3K31A 3JQFA 4JX8A 2IZ0A 4IDEA 4CMHA 3M1LA 1IB6A 3QWAA 4CODB 4II3A 2C07A 3D5TA 5G0SA 1DC3A 3OF2A 1U3TA 4WLVA 4WOJA 1ID1A 1XHLA 4YT5A 3ZWXA 5A9SB 3WMXA 2Y1FA 2EJVA 2D0IA 2FHSA 1NP3A 4D0RA 1J49A 3GG2A 1O5IA 2J5KA 4QTZA 3JQDA 4PLCA 3PQEA 1M66A 1ML3A 2C29D 5G4KB 2OUIA 3DC2A 1IPEA 3CH6A 4BNJA 4QECA 1E7MA 1GV0A 3ITKA 4XKJA 4D0SA 3RWBA 3RIHA 3GVPA 1R0SA 1PGQA 4Z9YA 5CG2A 2J5QA 4CL8A 1IZ0A 4ND3A 4MP6A 5EIOA 4JJFA 4E2YA 4F6LA 1BGVA 4N5LA 4GVXA 2NU7A 2X1HA 1ZK0A 2EGGA 3GRPA 2GZ1A 3NKLA 4XWYA 5G0WA 1HRDA 2O7QA 4OMUA 4AJJA 3O8QA 2POQX 1B15A 1FDVA 4IMRA 2V6MA 3TOZA 5A5FA 3GVIA 5CEFA 2GLXA 4U8GA 3GMSA 1MV8A 2YHIA 5A05A 4OQZA 4TKMA 1YWGO 1MLDA 2B69A 3KUXA 3A4VA 2YY7A 1SOWA 2BGKA 4OL9A 4YACA 2YUTA 1OMOA 2H9IA 3ANNA 5CEJA 4D41A 4PLHA 2ZB4A 4DLBA 4XYGA 3EC7A 5IXSA 3ZW8A 2CVQA 3OJEA 4PLFA 3D4OA 3MJ4A 4FW8A 1EFKA 1YH3A 1UP6A 1QV7A 1ZFNA 4NHEA 4GWGA 4E30A 4KOAA 1V0JA 4L4RA 4OHUA 4Z3DA 4IBOA 1GADO 3QWFA 5TT0A 3I52A 3PVZA 3ZGYA 1R4MB 1EBFA 3ZHBA 1IULA 2W98A 4ZGWA 4CLEA 1PJBA 4D3SA 4R4JA 4LVCA 1HDOA 1WMBA 2B5VA 3U4IA 4E5KA 1D7OA 1AXGA 1PQWA 4Y6SA 1Z82A 4CLRA 1K2WA 3NEPX 4NZ9A 1NFRA 1P0CA 3GN1A 2E37A 3GUCA 5ADHA 2P5YA 3JD2A 2OL4A 4CQLA 5L7WA 4OO3A 2VNSA 1HSZA 3PHHA 3A14A 3I83A 5GZ3A 2HMVA 3ETDA 4ZHSA 2IXAA 3OA2A 4DBVO 5ITWA 4KZPA 4UAGA 1Y9AA 2X5OA 4I5DA 1ADCA 1NQTA 2WMDA 5JDCC 5TJ9A 4CLRB 4CLHA 4P4NA 3LLVA 3RUEA 4Y8VA 4ZQFA 5FI3A 3AWDA 2BHLA 2DBQA 3GEDA 4BNKA 2IZZA 2OBYA 3OH8A 5EINA 3ASVA 5L53A 3DOJA 3VZQA 1PL8A 4DYVA 3RD5A 2BRUA 4OXKA 3RKRA 3S2EA 3EDMA 2I3GA 2HRZA 2QX7A 4BO2A 5K6AA 5F5NA 4CM6A 4WNCA 3OMLA 3WJAA 2LDXA 5JDIA 3QIVA 4JJGA 4W9NA 2R6JA 1NQAO 3WG9A 1PGNA 3PI7A 4EW6A 4A73A 1AHIA 2OMEA 5A9RA 1MA0A 1HDCA 1UDAA 3QA9A 3TZQA 1DB3A 2UUPA 4BHTA 3V8BA 3I9NA 2NVUB 2NTNA 1MC5A 4CUKA 2AQHA 1GQ2A 3MCVA 2JFHA 3WQSB 1EE9A 1XSEA 3BMQB 3PWZA 3KYDA 4BMSA 3ZWNA 1CQJA 3DHYA 3U09A 4H7PA 1LEHA 4YCAA 5C7LO 4N54A 2E49A 1UR5A 3NYWA 1E6EA 3ADOA 1IZ9A 1LLQA 1GCUA 1HEUA 3O8QB 1YJ8A 4A26A 3SJUA 4Z6KA 2UVDA 3ZHYA 4CM9D 1FJHA 2RHRA 4XB2A 1P74A 1PZFA 3JYLA 1H9BA 1OZAA 1RPNA 2IEDA 8LDHA 1NTOA 3DZKA 1VSUA 3HUDA 4PZEA 3KYCA 1P31A 3B1JA 3H5AA 2TMDA 3TRIA 1ONPA 2ZB3A 2JFGA 1ZKMA 1V3TA 3OFSA 3FD8A 2ZTMA 4EZBA 1EFLA 3AM3A 1HWYA 3AFMA 1P44A 3DL2A 4DIOA 1MUUA 3INTA 4WEQA 1QP8A 2I3AA 1GYQA 2EXXA 3ASUA 2Q45A 1PS0A 4II2A 1E3WA 1XCBA 1N1GA 5I7VA 4U6SA 4J1TA 1A9ZA 2Q2WA 3F5QA 1GAEO 1I8TA 1V3VA 4CM4A 4XDZA 4H16A 5DN9A 4B79A 1DO8A 4KUGA 4LCJA 4Y67A 1DC5A 3K8ZA 1I2BA 4RQTA 3TQHA 1Z73A 3U4DA 3QVWA 2ZB7A 3GY0A 2FR0A 1UDCA 2DBZA 4QSMA 3WFJA 4EDFA 3JQ7A 4QX6A 1ONOA 2PNFA 3QSGA 4KWIA 2PK3A 1BRMA 3OHSX 2DKNA 4CM9A 2W2LD 2BFMA 4ZJUA 2NWQA 3OQ6A 4GI2A 1L1FA 1ZK3A 2QRJA 5CPBA 3H9GA 2GRAA 1HKUA 3LVFO 2ZCUA 4Y6RA 6LDHA 3JYPA 4GBJA 3RJ9A 3NAQA 3PWKA 4IPTA 4PLTA 5AVOA 2VCYA 4R3NA 2EKPA 1DIBA 5ILOA 3QY9A 3DO5A 1HLDA 5A5EA 4A7PA 1YONA 3U3XA 2DQ4A 5B1YA 5DP1A 4E13A 2DM6A 4PG4A 1I3KA 1FDWA 3FPCA 2VYVD 1H6CA 4BO8A 4DMLA 4J9UE 3DBRA 1E3IA 3RBVA 5GZ6A 4YVFA 1HE5A 1E5LA 1HE4A 4AJHA 2UYYA 2O3SA 4KUEA 4ONEA 2GYYA 1LXCA 4RVFA 2FP4A 4IINA 1UH5A 1YS4A 4PG5A 2B4TO 3F3SA 3G0OA 1GD1O 4AJ4A 1W0CA 2BFAA 4L4XA 2FOIA 4TMFA 4DREA 5CEEA 1DHRA 3AU8A 3UAGA 4ITUA 1T4DA 1BXGB 2YZ7A 4IJWA 1ZK4A 4Q9NA 1E3LA 4YAJA 1PTJA 3HWRA 4FBGA 3VAZA 4BL5A 3UKOA 1BXGA 1CYDA 1Q0LA 2GR9A 4Q3BA 2ZYAA 2VWQA 2EWMA 1G0NA 5TIIA 4LVUA 5KKCA 3JQAA 3ONFA 3UUWA 1L7EA 2EJWA 4I1IA 1QRRA 3F5SA 3L77A 2NU8A 3GN2A 2WJPA 3G49A 1NVGA 1NFFA 1NQ5A 4FFRA 3ETGA 3ZNPA 1WMAA 1Q1NA 1Y81A 4NK5A 4PZCA 2VUUA 4XJTA 1GUZA 4AJNA 4JK3A 3GFGA 3JQ8A 5FI5A 1SOVA 3WB9A 4FS3A 3JQAD 3E6AA 1KEWA 3E9NA 3GMDA 3V1TC 1Z7BA 3PTZA 1NHWA 1GYRA 5DZSA 4HXYA 1U8FO 4PG7A 4RF3A 3AY6A 4PG6A 1ZJZA 3D4NA 3V2GA 4M86A 4MIYA 2J3KA 2EKLA 3GEGA 2W90A 3PDUA 1KVSA 4K9DA 5F1OA 4BMNA 5KJ1A 5JO0A 5JYDA 2VWHA 3ZU3A 2X5JO 1QG6A 1ISIA 1SPXA 1YB5A 2AEJA 3ICCA 3LZ6A 3WBFA 4NFHA 1YDEA 1YRLA 4BNTA 1LRLA 3PLRA 3RUDA 5G0UA 3PYMA 4UULA 3MJTA 5A3VA 2ZYGA 1GDHA 1PSDA 2JCXA 5THKA 4E5NA 2B83A 4JBGA 2NU9A 4FJ2A 1IE3A 3F9IA 3JYOA 2FSVA 1V8BA 1FDTA 3DAGA 4GAEA 1NR7A 4J43A 3Q11A 3HDJA 2ZYDA 3F6YA 4CM4B 2WM3A 3FBTA 1BHSA 3VPGA 4EYEA 1DRWA 3QQPA 2PGDA 1QLHA 3K2BA 4HP8A 4MO2A 3CUKA 4Q39A 2PFGA 3WSVA 2IEBA 4XZ3A 3U4CA 4J3FA 3NT2A 3PLNA 4FFLA 4IJKA 2GZ3A 1C0PA 1E6WA 3PHGA 2Q4EA 2A35A 4J1QA 1ZK2A 1B16A 2PD6A 5T8KC 3VDQA 4CM8A 2H5LA 1I0ZA 3KEOA 3SLKA 1CQIA 4MVJG 2D5CA 3GZNB 3P7MA 3QWIA 4J2HA 2QYSA 1PL6A 1X15A 2JAHA 3PGJA 3IJPA 2B35A 2FSSA 4BO4A 3GVXA 1IY8A 4AJLA 2BFOA 3GGOA 1DJQA 4J1NA 4E31A 1HDYA 4M55A 1ULSA 1MFPA 3U5TA 1XYGA 1UXGA 2P68A 2PY6A 2CSUA 1WW8A 5ITVA 2WWRA 1D1TA 3E9QA 4XDYA 1LC3A 4RDHA 1T24A 1EVYA 3O4RA 4R1NA 1Z6ZA 4J91A 4MOWA 4RZHA 1CEQA 4RCVA 1WDMA 3S2IA 3Q9UA 4DIFA 4WLUA 1IHXA 5AYVA 5HBRA 2D5AA 1UZMA 4XRGA 3AI3A 3RUIA 4BV9A 1HDRA 3TJRA 2Q1UA 4IGEA 3UCFA 5F21A 4L75A 5A03A 3MZ0A 1KIFA 4KWHA 4Z9XA 3AOGA 4CMIA 3RUAA 1D3AA 2PKQP 3K2EA 4AJOA 4B7CA 5L9AA 4JN6B 1UUFA 4YA6A 2J6IA 5JO9A 4UVGA 1NWCA 1PZEA 4KMSA 1K6JA 1ZIDA 1GEGA 4OJNA 3MOGA 1NVTA 4BNVA 4F46A 2DAPA 3GPDG 1S7CA 5JSFA 2Y0DA 3BAZA 3OJLA 1Q0HA 3PIDA 3B1FA 3Q3CA 1Z74A 3HB4X 4Z0TA 5U4QA 3TL3A 5MGBA 4HWKA 4DQVA 3IP3A 4WECA 2OZPA 3W4IA 3PYLA 5TGDA 4D43A 5DCUA 3HJAA 3KRTA 1WP4A 4G5HA 1XDWA 1P1RA 4D7AA 5IN4A 3DOOA 3OICA 4RF2A 2GO1A 4HFJA 3DMTA 4IDFA 1YE3A 4J2OA 4JGBA 5EQFA 4ROSA 3W8EA 1TT5B 4OOEA 1UAYA 1PJ2A 1D1SA 1QYVA 2JD1A 3U9LA 1P3DA 4O6VA 4TRNA 1LTHR 4Q3CA 2Q1TA 4E2WA 4Q3DA 4J1SA 4OYRA 4BB6A 2JAPA 4DLLA 7MDHA 3R3JA 4AJ1A 1TVEA 4YQZA 3P19A 1YVEI 3T4XA 1C3VA 2RCYA 3C7AA 3H9JA 5IG2A 5JFOA 3ON5A 1N92A 3BMQA 4QEDA 4MVJD 4RVHA 4BO5A 4HKTA 1U7TA 1VM6A 1LRKA 2IZ1A 3I9OA 2VHWA 4R41A 4AJIA 1XWFA 3JQEA 3AY7A 1BTOA 2JJYA 4M89A 3WYCA 4Q3EA 4ZA2A 5CHEA 2WYVA 1RM3A 4WLFA 3OEWA 4GL4A 4M8SA 4ALLA 3UCEA 3KYBA 1UXKA 1OBFO 4MVJF 1ZEJA 4XB1A 3VTZA 1GU7A 2NQTA 1NHGA 1PR9A 5JNLA 2Y1DA 4RZIA 3QE3A 2J3IA 3VOSA 3SX2A 4WCDA 1JN0A 1K3TA 1VI2A 5T5QA 4I5FA 4YRBA 5JAZA 1ONNA 5THQA 4J9VA 1RYEA 5IDYA 1LLCA 4YJFA 1K6XA 1V6AA 3BTOA 3WLFA 3I6IA 3BIOA 1QV6A 3AY3A 1ADGA 4R1TA 5AXDA 5G4KA 3H5RA 5F1PA 4JJIA 4IQ8A 1SAYA 3ZV3A 3INGA 2RH4A 3D3WB 2R2GA 1AHHA 1ZJYA 3RUHA 3UVEA 4PLZA 4A2CA 1I3MA 1J0XO 3H9QA 4L8VA 2VRCA 2J8ZA 3TF5A 4CPDA 3O03A 5L7YA 2O3RA 5A3JA 1E3JA 1WVGA 2YDYA 1MG5A 4R51A 4PLVA 4JCOA 1DJNA 1E7SA 4TWRA 5FF9A 3VTFA 4LRTB 4PG8A 1YGYA 2I65A 3F1KA 4FN4A 3ZWYA 4GGPA 2BGMA 4FOOA 2FPGA 3TPCA 3FNHA 2DBRA 1WDLA 1C1DA 1TT7A 1Z75A 5KCZA 3QHAA 3S8MA 1RWBA 2RBEA 2J5RA 3PFWO 4DTIA 3W8FA 3VH2A 3C7DB 2O48X 1MG0A 3FTNA 3WTBA 4ALJA 5CDGA 3PRJA 2DFVA 3PYXA 1HZJA 4IJVA 3QWBA 3OJFA 3F4BA 2C5EA 1ZXLA 4UVEA 2QRLA 3C24A 2C5AA 3KHUA 4MJLA 3CZRA 3JD1A 2AW5A 1VL6A 1TXGA 3GDGA 2IDZA 3JD0A 1A72A 3F47A 2WYWA 4GX2A 5G0VA 1NPDA 3N58A 1TA4A 5JCXA 2CY0A 1BW9B 1YOVB 2Y66A 3FHLA 3LF2A 3VPHA 5CDSA 2HK9A 2DU8A 3Q9NA 4CMJA 2YFHA 3ZH2A 1EK6A 3DB2A 1IHYA 3KM0A 3DZHA 1HDXA 2I67A 4FFPA 1JA9A 2GPTA 3ONDA 2ILTA 3ZHXA 1LSUA 1WZIA 5IAAA 1JTVA 3JQGA 3GZNA 4YRAA 4J4BA 3BMNB 3K6JA 1KOLA 4DPKA 5EPOA 4XR9A 4WCFA 1GZ6A 3S55A 4ZVVA 3H65A 1R6DA 3K5PA 5DCWA 1U3VA 1YL7A 2Q1SA 4IQ0A 1VLLA 1B3BA 1JWAB 2HMUA 4BNIA 2DT5A 3RUCA 1D4FA 5IXYA 1H0KA 3C1OA 3LT0A 1E0DA 3N74A 4DL9A 4HBGA 5I7SA 1Y6JA 4U6QA 3JYQA 5AOVA 2C7VA 2JKVA 3QWHA 4FC6A 4J7UA 2X7HA 2EP5A 1XEAA 1SNYA 5GZ1A 3M2PA 1XQ6A 2B36A 1K5HA 2G17A 4DQXA 1CJCA 1DXYA 3C85A 4ZQEA 3W1VA 4F6CA 2HU2A 1PJ3A 2GD1O 4G2NA 3ICPA 1E1KA 2CFCA 5HTOA 3BMNA 2VT2A 1CERA 1Y8QA 2C7GA 3KLPX 1R12A 2D2IA 2JCYA 2BFPA 3UHAA 1U2DA 1EDOA 4P8RA 4O63O 5DBFA 2W8ZA 4IDCA 3ZWOA 2VQ3A 3M1AA 1XGKA 4KTTE 3UCXA 4BKUA 3EHEA 1ISMA 3L0DA 4YJDA 2XF8A 5AXAA 3GHHA 4AL4A 1YXMA 4ALNA 3JV7A 4S3MA 2ZATA 3DBHB 4PGFA 2XXJA 4TZTA 4L4SA 3LLSA 3K73O 3Q1LA 1PGPA 2W4QA 3CE6A 4FFOA 1E1MA 3WXBA 1O0SA 4XX0A 2A92A 4LMRA 3LK7A 4A0SA 2GASA 5CDTA 1SZJG 2EERA 3ZWWA 5IZ4A 5EESA 2NACA 1NQOA 2GUGA 1U28A 1M67A 4GVLA 4OAQA 3ROMA 4IQGA 3WQQA 3BZUA 4LCEA 3OA0A 1P1IA 4D3DA 3AUSA 2Y68A 1A4IA 3JQAB 1LDGA 2VN8A 5CP8A 1UZNA 3GGPA 2HSDA 3H2ZA 3ZWBA 2X9NA 1H2BA 2R00A 1T4BA 1LI4A 1JAXA 3I9JA 4O59O 4RVUA 1Y8RB 3CXRA 4GQAA 2NM0A 5K0ZA 5FWNA 1KC1A 1KETA 1SMKA 2NLOA 1EVZA 3H4VA 5H82A 4HADA 3E5MA 1FDSA 1J5PA 1KY5A 2DUUA 4Z9FA 4CLOB 2Q50A 1A7AA 1ISHA 3DBLA 4NQZA 4B4VA 4I9NA 4GKVA 5KOIA 2Y1CA 3L9WA 2VHXA 1X13A 2OGUA 1NNUA 1JKFA 1JKIA 4RF4A 2O2SA 4RL6A 3R3SA 1XA0A 2C2YA 1LDNA 3PJGA 2JFFA 1LBEA 3OETA 4CMGA 1KBZA 3DBRB 1GFSA 2VWPA 3D3WA 3C8MA 1J4AA 4YAKA 5KNLA 3MEQA 1C0IA 3P2OA 1DFIA 1UXHA 2X0NA 3R6DA 3ZWMA 1PJQA 3AI1A 5BSHA 4MINA 5CDUA 1R37A 2OP1A 1N7GA 2UDPA 4K26A 5T64A 4CQMA 4ZQHA 3DMTC 4YJFB 2BI7A 3U49A 2CF6A 3GK3A 1DLIA 1ZW1A 4OKNA 3ZW9A 4CR6A 1QLJA 1E7WA 4YJGA 3COSA 4FGSA 2I66A 4HFMA 1B2LA 3JQ9A 4Q3AA 4YPOA 3CPSA 4PLWA 4WE3A 2CDCA 4R54A 3ZU4A 3TSCA 2V6FA 4FJ1A 4L76A 1N7HA 3AOEC 3V2HA 4D46A 1WZEA 1Q2XA 4E21A 7ADHA 3IUSA 4TVOA 4ND5A 4N5MA 3D5QA 4FQ8A 3WQRA 2PGLA 4ZRNA 2VZ9A 2GSDA 2BD0A 4HFRA 4W82A 5CAEA 1NPTO 1C1XB 1VKNA 4IY1A 3H5NA 2FZEA 3OIGA 1ADBA 4FPXA 1P9LA 3ANMA 1P1HA 3GNTA 4Y9DA 3W8DA 3IKVA 4DVJA 5HS6A 1UZLA 3ZN2A 4YBZA 1P1JA 4R5MA 1M2WA 3UXYA 3ZU5A 5IJZA 5LDHA 5I7EA 2PGJA 1ENZA 3G17A 3WYBA 1YKFA 4XEHA 4BNUA 1ZO8A 1TB4A 2AMFA 2WEKA 2YV2A 3HG7A 3K30A 4MVJE 1V9LA 3ULKA 3PQDA 4R9SA 4B4WA 4NBWA 1U3WA 2OO5A 1XG5A 4KDFA 3DHEA 2O4UX 4MIEA 1K89A 5T6BA 4PLYA 4E6PA 4KTVE 1GQYA 3DHNA 5A04A 3ZWPA 1IYZA 1EQUA 9LDBA 2NU6A 4MVJA 2O3JA 3HDHA 4MKZA 5ILGA 1UXJA 1R4NA 2PZLA 3GF4A 2O7SA 5G0TA 3W6ZA 2I99A 4BOYA 4LSMA 1HXHA 1B8UA 4XYEA 1BDMA 2J3HA 3HFGA 4B4UA 1ZMTA 5H81A 1T2AA 2NV6A 4GX0A 3L6DA 1R16A 2FPPA 4GSLA 4IDBA 1BVRA 3V1YA 5GY7A 1XKQA 3BMCA 5DNAA 1NBOA 1KEUA 5JAQA 4HV4A 3NT4A 4M54A 4MVJH 3ABIA 4KP7A 4TRMA 3WGHA 1F12A 4DA9A 1H93A 2NVUA 3LT2A 5JMPA 3ZHZA 4R69A 4L73A 4LGVA 2VT3A 2YQ4A 3KV3O 4J4HA 1YB4A 3ENNA 2SCUA 3DMYA 4I08A 1NX6A 2DFDA 1XU9A 1XIVA 4IDDA 3JD4A 4OSPA 4LN1A 3CKYA 4R01A 4JXKA 3RKUA 1PJLA 2QRKA 4INAA 4ALMA 4D3FA 1EK5A 3WBBA 4CLXA 4YJGB 1Y5RA 4FFMA 2EEZA 4IDGA 2DUWA 4CV1A 5B12A 4XQEA 5JXWA 5TT1A 2W2LA 4XIYA 3GEMA 4EUFA 2Y99A 2NQ8A 4O5OA 2CDAA 5TQVA 3E9MA 3C3XA 1ZVMA 3WGYA 1TLTA 5L4LA 1KYQA 3IAHA 2X86A 2GGSA 3ORFA 4ALKA 4X54A 4W7IA 5BT9A 1SCUA 2XOXA 1OFGA 1DHTA 2O2YA 3AK4A 5AXBA 4IS2A 4CR8A 4JP2A 1P0FA 4BO9A 3H3JA 3VZSA 2PKRA 3QLJA 3NDRA 2X58A 2ZQYA 1Q7GA 3MJEA 4MVJM 1ZH8A 3WFIA 3GFBA 3QP9A 4UUPA 3W6UA 4MVJP 1JVBA 5T67A 3LQFA 5AXCA 1LU9A 4L74A 1SBYA 5DOZA 3TZCA 3D64A 5EJ2A 4H15A 4BNYA 4EI2A 5C7IO 4W7HA 3ZI0A 3GC6A 3WGIA 1U5AA 4MKXA 2VRBA 1X1TA 3BYZA 3WNQA 2HQ1A 2X6TA 2H1SA 1VJTA 4MP8A 2Q2QA 1GL3A 1UDBA 3PHIA 4GKBA 1EDZA 4B3HA 3I4CA 4NBRA 1CWUA 2E48A 3ZNOA 3DAPA 2P4HX 3GUYA 2CMDA 4PRLA 4PIVA 4GX1A 1YDWA 4CM7A 3EY4A 4RO0A 1Z45A 2YHIB 3JQ6A 2NTJA 3CINA 3EGOA 5EMHA 3WGGA 3DAFA 2VZ8A 5A02A 1NAHA 3AI2A 4GMGA 1BXKA 4DXHA 1E1NA 1ARZA 1SC6A 1D8AA 2W2KB 2WE7A 3PQFA 4TRJA 1GPJA 1DRUA 4BNXA 1LX6A 1XR3A 4TSKA 2NSDA 1YQGA 3S1LA 2OXIA 2Q49A 1KVQA 4NFSA 4WEOA 4AICA 1U4SA 2ZCVA 4MP3A 4XQCA 3ZU2A 3ZV5A 2RH8A 1QORA 1U9JA 1ADFA 2GN8A 3FSRA 1U3UA 2PTGA 4DC0A 3CSDA 3WX0A 4RQUA 4EITA 1LQUA 4XRRA 3TZHA 1NASA 3OIFA 1E6UA 1XQ1A 3VH1A 5EL0A 4DC1A 1DFGA 3HNPA 1AXEA 3VPXA 1I36A 1NWHA 1SEVA 3OQBA 3TOXA 5JC8A 3DBLB 4EGFA 5DULA 2XAAA 4J7CA 3PZRA 1DBVO 2X0RA 3RFXA 1WAMA 4LMPA 4UEJA 4WNIA 3D1LA 3GDFA 1E3SA 1Y9EA 3IUPA 4WKGA 1DAPA 1O94A 3BTUA 2DTEA 4TZKA 2O50A 3BMOB 3TZ6A 3PHJA 1UP4A 1E1LA 2FRDA 1GTMA 1U8XX 2V65A 2ZQZA 1ISGA 1FK8A 1P1FA 4YT4A 3KSDO 2I9PA 3JQGB 3MWEB 3BHIA 3RAJA 4Z3KA 1DSSG 2YV3A 3GVCA 2GZ2A 3WGQA 3CZMA 3H8VA 4E33A 1ZNQO 4LW8A 1WXDA 1MP0A 3LSYA 1TI7A 4D42A 3GG9A 4KUHA 2CDBA 1V3UA 3GLQA 3E03A 4CUJA 4YWJA 4CV3A 2EF1A 3SC6A 4GX5A 3SLGA 4OXYA 1DEHA 3B70A 3OIDA 3OJ0A 4MVJI 1R0KA 2EIHA 8ADHA 3IQDB 4LSWA 2IRWA 4R1SA 1LNQA 3X2EA 3G1UA 3KOUA 1B8PA 4IIUA 2PZKA 5TNXA 2EP7A 1RJWA 4IZHA 2BLLA 5ICSA 5IF3A 3NJ4A 3FN4A 2A94A 1IUKA 4YJHA 5COAA 1E7RA 1AE1A 3CIFA 2G1UA 3BMOA 4MDHA 5CFZA 1JW9B 2PD3A 5C5IA 3TNLA 3JQ7B 4XGIA 2RHCA 2BI8A 5L4NA 4ZQGA 1E7YA 4NI5A 3JYNA 4PLGA 2GN9A 1B14A 4GPD1 5COQA 4NNJA 1LQTA 4BNHA 3GNSA 4N18A 2DC1A 3TFOA 1T2CA 4CMCA 1VE9A 2GF2A 4ILKA 5TF4A 4OKIA 1QXSA 4EJMA 2FMUA 2HAEA 3IS3A 4D79A 3GOHA 3LC1O 1H5QA 3OSUA 4HY3A 3NDIA 4K28A 4QFCA 3ZV4A 4FD3A 4LK3A 4BB5A 1PQUA 1PS9A 3RSHA 4IS3A 1BDBA 4ALIA 4DPMA 5HWSA 1N5DA 4C7KA 3Q2KA 4D45A 4W9NC 2UUOA 1E7QA 4K6CA 4IXTA 5K6AC 2Y1EA 3GDOA 3O38A 3HDYA 3WYEA 2CD9A 3KYCB 4UREA 5L95A 1O89A 4N7RA 2AE1A 1DC4A 3K96A 4JBIA 3I9MA 3VKUA 4BNLA 1QYWA 2GN6A 3GHYA 1JDJA 4OGWA 3ZZNA 2W2KA 1I10A 4J16A 3VPFA 4YR9A 1PZGA 4AJPA 4C4OA 3EAGA 3DZIA 3TWOA 3I1JA 1ZUD1 3IDSA 4KDEA 5I8WA 3ZDFA 1A27A 4TRRA 1ZEMA 3KBOA 5ER9A 5KVQA 1X7DA 3KZVA 2OP0A 3DWFA 4IIVA 3M2TA 4QXMA 1I2CA 3Q6IA 4PRKA 4BKPA 2PR2A 4FDAA 2ZKLA 4BGUA 2AQIA 4WCFC 5ER6A 5KJFA 2D3TA 1Y8QB 4ZN6A 3VDRA 2NVBA 3D3EA 3S2GA 5C3MA 4JNKA 3HQ4O 1IPFA 4RPGA 1CF2O 2VUSA 1KS9A 3HSKA 2HJSA 3KTDA 3PWSA 4HX5A 4XR4A 4XQGA 2I5PO 3EVTA 3DOCA 3QVOA 4BNGA 2V6BA 1C0KA 2HK7A 4B8WA 5DP2A 1ZK1A 2E4AA 3SBOA 4ZRMA 4C7JA 1LDEA 1BXZA 1K6IA 2HUNA 2FR8A 1YL6A 3FI9A 3GAZA 4G65A 5KKAA 1IL0A 3PPIA 4E2XA 4DIBA 3NDJA 4O1MA 3MJCA 4CM5A 3PEFA 3IKTA 4B3IA 1NFQA 4UUOA 3FF4A 4RORA 2V6GA 1PR3A 1YBMA 4NFYA 1MXHA 2RIRA 3RFVA 3X2FA 2D1YA 2BELA 5JPIA 3AUAA 3T7EA 2XXBA 2HRBA 3GT0A 4BQRA 1GY8A 3EW7A 2Z1MA 3I3OA 5L51A 2HCTA 4OQYA 5JYEA 3PJEA 3R1IA 5CDYA 1NM5A 4EJ6A 4CMBA 1LSOA 5JE8A 3AUTA 1PWXA 4IUYA 3LYLA 4PN3A 1ZXBA 3N7UA 4Y6PA 3VVBA 5JY6A 3LDHA 3INRA 4U0JA 2EV9A 1Y5MA 2PKQO 3HHPA 3DZGA 4HNHA 1E77A 3IOYA 3LT1A 3W4KA 1JWBB 1ZMOA 1E3EA 3KYDB 4J7XA 1HYHA 1JKJA 2VRCD 4BO3A 1PQPA 1KERA 4LISA 5MDHA 1WLYA 3WMWA 4QO8A 2WSBA 3QVTA 1ENOA 4MKRA 3R0IA 2TMGA 2WYUA 3FBGA 1VJ1A 3FRJA 1VRWA 3EUWA 5EERA 2WD7B 1QYCA 4IM7A 2A4KA 2R00C 1P33A 2P5UA 4P4LA 4AVYA 2EKQA 1Z7EA 2VYVA 4XYBA 5DBGA 4OH1A 5CG1A 2QZ9A 3DONA 5IN5A 4YAEA 2Z5LA 4CMEC 4U0KA 3I9KA 3V2UA 3BMCB 3BTSA 2D8AA 1DAOA 2PWZA 2WDZA 3VVCA 2Q2VA 4BO7A 1GEEA 4DBZA 1H9AA 2G5CA 4K6FA 2VOJA 4J49A 1LDYA 3WICA 3AFNA 5L3ZA 3CTMA 4JQCA 1TT5A 3TDKA 4RGBA 3FNGA 1O8CA 4UEOA 3IMFA 2EW8A 4BV8A 2WTBA 3AW9A 4CQMB 2C59A 2BF7A 3OJOA 2I76A 4NPCA 4EEZA 5JBIA 1KVRA 2Y1OA 3RQSA 3FWZA 1F8FA 3JTMA 1EBUA 1EUZA 4PCVA 2YV1A 2HMSA 1U4OA 1UAGA 3D4PA 3KEQA 4J0FA 5F1KA 2ZB8A 1B26A 2O3TA 1BVUA 2PLAA 3QV1A 2EG9A 3JQBA 1R4MA 3WIDA 2Y0EA 2Z95A 3CMCO 4BNMA 2P9EA 4ZU3A 4YRDA 2Y67A 2AXQA 4I5GA 2X4GA 3PIIA 1U5CA 1QR6A 1QMGA 3VZRA 4RLHA 3D0OA 2PV7A 4CMKA 2CNBA 3H7AA 3EZYA 2Q46A 3HN2A 4JROA 1VL8A 5EN4A 3PGXA 5LC1A 4CM3A 3QRWA 4CR7A 3KLMX 3IJRA 4AJ2A 4CM1A 2X22A 1Q7BA 1EVIA 5C7OO 2B0JA 2O4CA 1GR0A 4XYLA 1I30A 3BHMA 3SVTA 4S1VA 3GRKA 5KJ6A 3RFTA 2VOEA 2NUAA 3ST7A 4D44A 4URFA 3GGGA 2VHYA 3JQ9C 2ZTLA 3DR3A 1ZSNA 3BA1A 4R68A 4UVHA 3ZCXA 5KVSA 2O3QA 5L40A 3KB6A 3WJ7A 1YB1A 1VPDA 3DZBA 1YL5A 3WOHA 1R0LA 2PH3A 5IZCA 3I5MA 1YJQA 4WLEA 3JD3A 2ZTVA 4Q3NA 3TL2A 1LJ8A 2ZIZA 4XGNA 3QVXA 1GZ4A 5AQ1A 3RBZA 3NGLA 3L9XA 3H9EO 4L0QA 1YQDA 1EEHA 5TC4A 2F00A 3L4SO 1DIHA 2Q3EA 4FCCA 3PXXA 4P4GA 5BSEA 3CEAA 4GH5A 4B7UA 3NRCA 3O26A 1MB4A 4Y98A 5K9ZA 2D59A 1MGOA 2IODA 1SO8A 4EBFA 1PJSA 4YDRA 4BVAA 3HDQA 4NBUA 5A06A 1PJTA 5JAMA 3A28A 2VHVA 1U2GA 3RI3A 3WGTA 2Z1NA 5LCXA 3ADPA 5GMOA 3DTTA 3AOEA 3MJSA 3ENKA 3MWDB 4IMPA 5JW6A 4IZIA 4QO7A 4FC7A 4PLPA 1VJ0A 5I8ZA 4BIIA 1PEDA 1PGOA 1PWZA 1NXQA 3RC1A 1NVMB 4K1LA 4QFDA 4BO6A 3VHRA 4BKQA 2O3UA 3GA0A 1YBAA 4H3VA 4YJHB 1KY4A 1ULUA 1L7DA 3SJ7A 1OC4A 3WR5A 5BSFA 1PGJA 1EE2A 5HM8A 2YDXA 4ZQBA 3WS7A 2B4QA 3DFZA 4WPGA 5T8KA 4WJZA 1A7KA 3F1LA 1MC4A 4OM8A 3OQ1A 4XD2A 3RASA 4A03A 4UVDA 3GQVA 2Y93A 5B37A 1AUPA 2CZCA 3SXPA 1DIGA 1W4ZA 1PZHA 2OOSA 1F8GA 1H94A 5JY1A 4WOKA 2IYPA 2X5KO 3WGOA 4E5PA 5LDGA 4OSOA 1NAIA 3IC5A 5B4TA 1G0OA 3A1NA 1A9YA 4FJ0A 4HFNA 4IJUA 3T7CA 4I5EA 3PZBA 1HZZA 2VTDA 1YOVA 1BSVA 1BW9A 1RYDA 1AGNA 3FNEA 1DIAA 4WUVA 5DDIP 1DDOA 1VSVA 1K0UA 2GN4A 4RVSA 3DXFA 5F3RA 4RPHA 2DTDA 2VZ0A 3ITDA 4YB8A 1Y7TA 4O0LA 2P9GA 2F1KA 5J23A 2DVMA 2YYYA 3UGKA 3WWYA 1JQBA 3RBXA 3NX4A 1EZ4A 3JQ8B 3QJ5A 4ND1A 5I9MA 1KEPA 1G1AA 1LSSA 5FFFA 1M6HA 2VHZA 1YQXA 3RUFA 4E4YA 1OOEA 4J0EA 3WIEA 3E5RA 3KETA 3F4LA 3VH4A 1Y8RA 4FB5A 2V7PA 1W8DA 2HJRA 2HMTA 4ZD6A 3P2YA 1T2FA 3ZV6A 2E6UX 2QHXA 4FIZA 3B1KA 1J6UA 4LRSB 2HMWA 1RKXA 2FN7A 3NJ8A 1OAAA 2LDBA 3G3EA 2EGHA 1QYXA 4ND2A 4BKRA 4PVCA 1OI7A 2JL1A 3GAFA 4GSKA 4M49A 2G0TA 3UH1A 3ZWAA 1E3WB 4TROA 1GUFA 4AFNA 4YAIA 4YTEA 1M76A 3HADA 5HRUA 4J6FA 4EJ0A 4ID9A 2QZZA 3PJFA 4YXFA 1CIVA 3HE3A 2ZJ1A 3O9ZA 3H9UA 3OP4A 4WCFB 3FCOA 4CV2A 4I9UA 1O6ZA 1AN9A 3ROQA 2NNLD 1P1KA 1T2EA 2FZWA 2WD8A 3JCZA 4I9HA 1N1EA 5KIAA 2B37A 4AJEA 5KWEA 5HS4A 3IIEA 1YBVA 1DRVA 1LDMA 3JQFC 4A10A 3LF1A 4F3YA 3VKVA 5TSDA 1KVTA 3DFUA 5C37A 1LUAA 1R66A 2EW2A 2ET6A 3DEYX 4BS9A 4W4TA 1DLJA 5FEUA 2P4QA 5EQDA 3UICA 1B7GO 1X14A 3AUUA 1EUCA 4E32A 2QIOA 4P38A 2VTEA 3H3FA 3HFSA 3MOIA 4MPDA 3VC7A 3Q2IA 5BSGA 1SB8A 1Q7CA 3GH3A 3UW3A 2UAGA 1NYTA 1BG6A 5DF1A 4NIMA 1LLDA 2FWMX 4XGKA 1A5ZA 5G4LA 2AHRA 3ZNQA 4YYZA 3GNQA 3UF0A 5IFLA 1TEHA 2JD2A 2JHFA 1B8VA 2NADA 1GCOA 1C1DB 1QSGA 4U5QA 5BR7A 2EHDA 4BGEA 2FPIA 1O95A 4CUZA 1T1RA 3GR6A 3I6QA 1T25A 4PVDA 1U7HA 3SEFA 4YT2A 1VC2A 4MIOA 9LDTA 2GNAA 4FFNA 4NU6A 2PZMA 2QQ5A 1RM4A 1CDOA 2QW8A 1ISFA 2JD0A 2O23A 5KJEA 3W4JA 1HYEA 1N9GA 1V35A 1ZSYA 4CMAA 2Q4BA 3A9WA 3WNVA 2HK8A 4NU5A 4RVGA 4BQPA 2CUKA 3BTVA 4P22A 2BMAA 3DDNA 1JVSA 3RJ5A 1R4NB 4N5NA 1W6UA 4GLLA 5A4DA 1H6BA 1W73A 3D7LA 3EYWA 2CVZA 5A9TA 4R3WA 5IDWA 5U9CA 3NGXA 1DC6A 2C0CA 4F45A 3UOGA 4XQ9A 5JC1A 1HT0A 2OORA 3E8XA 4RF5A 3NT5A 1U1IA 2PA3A 1MFZA 3A06A 1LC0A 4AG3A 1T2DA 2BGLA 2G76A 3WWZA 2Y05A 2GCGA 4JBHA 1I5RA 3I4FA 3Q0EA 1FF9A 2HLPA 3FWNA 1PIWA 4QQRA 3BHJA 1FMCA 2ZJ0A 3V1UA 4DQUA 2BKAA 3M6IA 4OIMA 1F14A 4RVDA 1BMDA 4M87A 5ICMA 1DIRA 4R5HA 3L4BC 4XYMA 1GUYA 2OHXA 3RC2A 4Z0PA 3RU7A 1GPDG 2AG8A 3E48A 3L07A 1WPQA 1H6DA 1M75A 4J4TA 2VYNA 1C1XA 3T4EA 3TZKA 4ZICA 1E92A 1HTBA 3FR8A 2OBNA 3ETEA 3LC7O 3LC2O 5JS6A 1B0AA 2A9FA 1Y1PA 4YQYA 1RM0A 4CMIB 5L45A 3B20A 3SC4A 1EVJA 2JHGA 3PFFA 5T57A 3EZLA 2AQ8A 4R9RA 4RPKA 5COBA 3TN7A 3HZZA 3FNFA 4CJXA 5DCYA 4GWKA 1X1EA 3KSUA 4PZDA 2GDZA 1ORRA 1WNTA 2DPHA 1T26A 1I3LA 2AE2A 2WE8A 2B5WA 5JMWA 2IE0A 3QVSA 4WLOA 1N8KA 3E82A 1X7GA 1PS8A 4JLWA 4QT0A 3RU9A 2Q99A 1NR1A 2AG5A 3AM5A 3LU1A 3EVNA 1CETA 1X7HA 1F06A 4A27A 1ENPA 1DFHA 3E18A 5CPFA 5BNTA 5IZCC 4UVIA 1I32A 3C1AA 1LRJA 4E12A 1OC2A 4E5YA 4EUEA 3RC9A 4NBVA 3ONEA 1PJCA 1XU7A 1DOHA 4W99A 1I3NA 3MTJA 2IXBA 4DRYA 1C14A 1EQ2A 4RLSA 1MXFA 3U62A 1EMDA 1JU9A 4GLOA 1ZSVA 5F5LA 4EUHA 5ES3A 1UXIA 4U7WA 4RPJA 2JCVA 4CQLB 2PD4A 5JAIA 2P91A 5IDXA 2I6TA 3AJRA 3KVOA 1H2HA 1N9GB 2X23A 3VZPA 3DBVO 4XJSA 4DMMA 5HA5A 4R16A 4CLOA 2YHUA 2DBVO 3LT4A 4WGGA 2NVWA 2Y1GA 4JP3A 5BNFA 2GERA 1B3RA 3IL2A 2AEFA 4BO1A 3IP1A 3PDJA 3B6ZA 3F46A 2VNAA 4NBTA 1E5QA 2WD7A 4NG5A 4YAGA 2YJZA 3DQPA 1WWKA 3G1TA 4G81A 1VKOA 2ZK7A 1A4UA 4M1QA 4CQMD 4ND4A 4BKOA 3NTOA 3JSAA 5U1PA 1R15A 3BXXA 4ESOA 1I2ZA 2CVOA 2QG4A 2DPGA 1DPGA 2C82A 3KXDA 3AM4A 2X0JA 4BNFA 2VUTA 4UUMA 1XELA 4I8XA 2OFPA 2QYTA 3NTQA 3TFQA 3KO8A 1P45A 5ENVA 3KSZO 4UUNA 3GVHA 1YO6A 1GV1A 1LA2A 4FOSA 3ZWCA 3OM9A 1A71A 4FR5A 1I01A 2X8LA 5I7FA 5H83A 3WTCA 5BNIA 3WSWA 1ZZEA 4IDAA 5DBIA 1HL3A 4YT8A 3S2FA 3H6KA 3UFXA 4PFJA 2YFQA 1I24A 5TJHA 5BQFA 4NDNE 3U4HA 3VPSA 2G82A 1LDBA 4RJTA 4L9RA 2B4RO 3G79A 4QUKA 4WLNA 3MTGA 5B4UA 2XPCA 3HB5X 2HDHA 3ROPA 6ADHA 4TVBA 3DZJA 4KQXA 4NMHA 5IDQA 1SEPA 2HKIA 1HDZA 4NJMA 5TX7A 3NTRA 5FYDA 3GZ4A 3DTYA 2VWGA 3JQCA 1PX0A 4NR0A 4HNGA 4KQWA 3C1TA 3GPIA 4B4OA 3PHLA 4FSHA 4R1UA 2NTVA 2DLDA 3ANLA 3E1KA 2UV8A 1F0YA 4YEDA 5G2OA 4E2ZA 4B8ZA 3H2SA 5JDCA 2C2XA 4NJOA 5KVCA 5B4VA 2PZJA 1HF3A 4E0BA 3PP8A 2YQ5A 3JQBC 4RPLA 4B3JA 2X0IA 1ZCJA 2BH9A 4DWVA 3VH3A 4BO0A 4RDIA 5TLSA 5KVVA 1GYPA 4OXNA 1XLTA 1LLUA 5JCJD 4HUJA 4E5MA 4BGIA 2Q1WA 3PJDA 3ZWVA 1X0XA 1KEVA 3I9LA 3FR7A 1QKIA 3L6EA 1BWSA 4TKLA 4BGVA 4IGFA 2FR1A 4CLDA 2VYND 4XIJA 4GMFA 3K92A 2AA3A 4AJKA 4CM8B 4NH4A 3L4BA 1PU2A 2RAFA 3RCBA 4W6ZA 1PJ4A 3RVDA 1WDKA 5ENDA 1T1SA 4OOFA 4WK6A 1M6WA 1HE2A 1UP7A 1KVUA 2AEMA 1EUDA 3UN1A 3FTPA 5I9LA 1ZBQA 1HETA 5KTKA 2P2SA 5TRTA 3RC7A 4UEKA 4DUPA 4DGSA 1O9BA 2H6EA 1Q0QA 3C7CB 5A9SA 1G6KA 3WDSA 3NV9A 4BNZA 1CRWG 4NJMB 2ZTUA 4WASA 1VL0A 2C20A 1LSJA 5JDIC 4J90A 3OBBA 3QW2A 4NK4A 2HO5A 1RM5A 4XCVA 1HLPA 4GGOA 1SB9A 1FXSA 5JCJA 4DLAA 1JAYA 4EEXA 4BUCA 5I9NA 2AQKA 2IYOA 2X9GA 4XA8A 1S6YA 2YW9A 3FPLA 3NUGA 1GZ3A 3WGZA 3HN7A 1KC3A 4DPLA 1C0LA 4JIGA 1QYDA
chains in the Genus database with same CATH superfamily
2M9MA 2W2NA 4EGSA 1UJMA 5B3JA 1ENYA 4HN9A 1K5PA 1YI1A 1XZEA 4O3FA 1FXWA 3EK2A 2HEIA 4DA8A 5A1TA 4CL3A 3RK1A 4U7TB 1JEJA 3DTVB 1Q15A 1A9PA 2E5WA 2X7XA 3AKEA 1CCWA 1PL7A 1V1MA 2B1RA 3OF5A 4S1NA 5LBUA 2ZDGA 2Y0CA 3GCZA 3R4VA 4AP9A 2ZRHA 3LOUA 2QZ4A 1JLLA 4ZVKA 4B7XA 2EU8A 4BNNA 1OH6A 4CDMA 4K9NA 2QGFA 5CA0A 3HS3A 2C54A 1JNXX 4EYKA 2VG8A 2OK7A 1XPJA 2REXB 2X0DA 4IG4A 3SS7X 3TR5A 1PJ8A 2XSZD 5CHYA 4RV9A 2P9CA 3L6OO 2ZRFA 4KYVA 4PEVA 3VX4A 4JR1A 3AETA 2GX6A 2K4MA 4Z4EA 3A9TA 1Q0PA 1RXUA 3KQVA 1KXJA 1ULBA 3ZNNA 1U5BA 4KRXA 1P73A 1IN5A 1U02A 4JA0A 3QUTA 5JLAA 1HYGA 1LZKA 3DBOB 5BWLA 5L7TA 4NBLA 2VR1A 3QKWA 1DJMA 5EMLA 3GEIA 3LT5A 3D43A 2DR0A 4POAA 4JX8A 2IZ0A 2Z4SA 4L8FA 3WIOA 5H8WA 1QRUA 3SNKA 2FMXA 5HFJA 4CODB 1FVHA 3JAWA 5AKYA 5DLEA 3IPYA 1FP2A 3AEQB 5LUBA 2JJMA 4JBYA 4WLVA 1U3TA 3SLRA 4YT5A 1ID1A 1KTIA 3Q87B 3ZWXA 3VM6A 1AKYA 2RHOA 3M0EA 1D0IA 2Y1FA 3CISA 1OQAA 4O2BA 3CJRA 4RXMA 3SHVA 4BU1A 1KNXA 2Z8ZA 1NP3A 3IT0A 3EGWA 3A2KA 1Z8HA 4TV9A 1J49A 4B47A 4BFCA 3KJFA 4AXXA 4L5BA 2J5KA 2DQSA 1PVVA 1D5WA 1CZHA 3JQDA 2YJNA 1T8WA 1SVIA 1KL7A 3CY6A 1OHHA 2NZYA 4YFVA 2WQ6A 1RCUA 3MT8A 4FGUA 2OUIA 2Z2JA 3AHGA 1JS1X 4GM0A 4M0LA 4KQ9A 5DBOA 1FYXA 4ZVRA 4D3ZA 3G8BA 3ITKA 2I3BA 2O59A 4D0SA 1MO4A 4REQA 3RWBA 5EE1A 3SSMA 1R0SA 2QD2A 3C70A 4L3WA 1XCOA 1VIMA 4R2LA 2Q5CA 5JNWA 2BGUA 2IGTA 2MYPA 3HWX1 5K03A 4AKGA 4QU0A 1CE8B 2XQVA 3UXMA 5KB3A 2X1HA 3IAUA 3KEFA 1MZPA 3D6NB 4RH0A 3OTQA 2O7QA 3R0XA 3CLKA 4ZAZA 1B15A 2C9YA 3KTOA 4HVAA 4X20A 3T4UA 3C97A 1VRCA 5A5FA 4JU8A 4V03A 1QZZA 2SKEA 5H02A 2M2IA 5CEFA 3ELYA 3GMSA 5B6IA 3T1QA 1YWGO 1FPMA 4JIMA 4RACA 3TLEA 3KUXA 3A4VA 3UAZA 1E9EA 1MQAA 1SOWA 2YY7A 2ZYVX 4YACA 3THWA 4AMVA 4DMHA 1ZMRA 2ADOA 2RGNA 3CVJA 5CEJA 4XTCS 2JGFA 1WU8A 2OCKA 2P1DA 2RHHA 2ZXFA 3OJEA 4M9XA 4PLFA 5EG5A 1Y6FA 4UBLA 1K88A 3W7BA 4PG8A 3GRUA 1EFKA 3BFXA 1F0NA 1KJIA 3KQTA 5BVGB 2VHCA 1WMDA 1M5TA 3FDIA 3A1WA 3IIMA 4L4RA 3TMKA 3ORRA 4OHUA 3AKZA 3TEJA 4JFAA 2COEA 4LQLA 1LF5A 5BQOA 1E2PA 4AURA 1V41E 2L17A 3PVZA 1TUBA 1R4MB 1EBFA 3ZGYA 1IULA 3DV0B 2WJWA 3CH5A 3N8NA 4JV5B 1GAXA 5CVDA 3NU1A 1KI9A 4KQCA 3CZ5A 3RT1A 5ES4B 2CD7A 4DHEA 3KELA 4WNAA 4UW9A 1K5GA 1YDGA 3H4TA 1U98A 2WUGA 1D7OA 3E1SA 4IG9A 1AXGA 4IH4A 1PQWA 3GLGE 1Q17A 4Y6SA 1RVV1 2GRUA 3SS8A 5ALPA 1P0CA 3GN1A 5D00A 2WUWE 1HK7A 1ZD3A 5K01A 4CQLA 4OBXA 4YJ3B 4OO3A 4ZZ1A 3BIJA 4DMUB 4MGZR 2XUAA 2GN0A 3QVLA 2J33A 1HSZA 2OK8A 3A14A 3CEJA 3IQXA 3PHHA 4AULA 1B4DA 4DCSA 5HF5A 1TM5E 2HMVA 2JLBA 2JCGA 1N75A 1GA4A 4OF4A 3A10A 4ZHSA 4C2BA 1LH0A 1E2NA 1XAHA 3EXEA 1JG7A 3N86A 5DIZA 3CVOA 5JDCC 1F2TA 2WMDA 2XUIA 3OMWA 4S1OA 3ZCRA 4D9KA 4M6WA 1GRQA 3QLUA 4Y8VA 3SC3A 3E9YA 3KQWA 4LHEA 2BHLA 3GEDA 4B46A 5FUVA 1EFPA 2IZZA 3NBQA 1CQJB 3C3CA 5EINA 5L53A 3CX7A 1QB7A 5IC5A 1SUBA 3DOJA 4Y0VA 4ANFA 1REQB 2BRUA 3OPVA 4CKCA 3IRUA 3ZIDA 3P9IA 3EDMA 3EZNA 3K0AB 2NO7A 2HRZA 2QX7A 1UC9A 3B7GA 3WLMA 4BO2A 2YMLA 5CGQB 4CM6A 1IPHA 1M10A 3DL0A 3I62A 4GPIB 4WNCA 3BWVA 3OMLA 2PX4A 4XPZA 3G2HA 3WJAA 4BLUA 2RARA 4ZVPA 1Q1ZA 3SF0A 1CF9A 4R2WA 3WG9A 5DTEA 3DLBA 1G9TA 3DAHA 5A9RA 1AHIA 4URYR 4MVYA 4PQGA 4OQQA 2XDYA 2XTJA 4NOJA 3QJGA 3VU9B 4TMWA 4UNSA 3CUWA 5H5JA 2V54A 1XZQA 3I9NA 1B1CA 3M8KA 3PWTA 3WZ2A 1TZKA 3P9PA 3L1IA 2WU3A 2JFHA 1Z6XA 2VHJA 2GEUA 3KYDA 3RIYA 3Q88A 2XCOA 2GILA 1D6SA 5ITZA 5FOWA 4N41A 3IIKA 2JVIA 3FDFA 2VHTA 3ADOA 1XP5A 3IO5A 2QAGB 3V4OA 2XWPA 2YJ6A 3EF0A 5F64A 1W1IA 5DGHA 3SJUA 1KYYA 1O87A 1N6KA 3ZHYA 4LAFA 2QQFA 2IV3A 4BX3A 1P74A 4OREX 5HQJA 1E79A 5EVJA 1Z25A 3JYLA 1NW8A 1H9BA 4HS9A 1OZAA 4ML3A 4BBAA 1E5DA 2IEDA 2H2WA 2JRLA 3EASA 3I92A 4B75A 1GN9A 3UK2A 1DG1G 1W94A 2PXHA 3LTEA 5IKXA 1P31A 3B1JA 1YQ9A 2E4XA 2TMDA 3H5AA 1AURA 3KXIA 3LUCA 1QJCA 2ZB3A 3HGMA 3IVRA 2M6SA 3QEAZ 1JEEA 1U65A 2GK6A 2YWHA 4JJ6A 3RO7A 3OFSA 4DYHA 5JVDF 3HVKA 3RT9A 4X3OA 1VE5A 2PE5A 2YMPA 3AFMA 3ET4A 3JXEA 2C3UA 3MUFA 1P44A 3FTEA 4F3TA 1T2UA 1T36A 1XEXA 5DBHX 1UMCB 2ETXA 4K5QA 5A6VA 5MGNA 1OU0A 1M2JA 4CWAA 2Q45A 2YOFA 4I3HA 3UB3A 1MH1A 2EFCB 3SKVA 2OHIA 3CSSA 1H9CA 2JJ1D 3CEMA 1Q0SA 3HCPA 3VMMA 2C83A 3OTWA 3WDKA 1I8TA 3FPSA 1KHHA 1NR5A 4HB2A 3FOCA 4JJEA 4XDZA 1UBLS 4QELA 5DN9A 3T5PA 4HMOA 2V1UA 2X5NA 5E6SB 3GLUA 2O14A 4G5SA 2A1TS 3O4GA 4E7PA 3CZ9A 4YRNA 1Z63A 1B6SA 3U56A 1N0WA 3GY0A 2YYAA 4NABA 2HWXA 4Q01A 3ZQJA 3AEUB 3O8RA 3QSGA 2JANA 1BRMA 2YCBA 4FMCB 4KPGA 4MUMA 5C1IA 4ENSA 1OXUA 3FMFA 5JBNA 2W2LD 3OX3A 1CRPA 2NWQA 3Q40A 1KQ3A 2IYVA 1SKQA 4YROA 1ZK3A 3A1UA 3ISTA 1L1FA 3GP5A 4TL9A 5TB5A 2OGSA 1VG9B 3M89A 1F4PA 1SIUA 3MJRA 3H9GA 3QUQA 2AXEA 2GRAA 1HKUA 4HXGA 1PK7A 4EP1A 5GWXA 1XJQA 1ONBA 4L51A 3AVWA 1JDSA 3BDVA 3JYPA 4GBJA 4CCYB 1H0RA 4FFBB 1JHUA 5AK6A 2VP3A 4YH1A 3QKSA 5DSTA 5K3DA 2D8MA 4NENA 1UPUA 4JEIA 5DXJA 3WHPA 4KQ6A 2OCPA 2G5PA 4ETIA 4X00A 3WAGA 1XTBA 1FYEA 1HLDA 2YX1A 4PZLA 5AHKA 3RWOA 4C2TA 3IVMA 4ICIA 4M1SA 3U3XA 1KO7A 3KQUA 1LTQA 3D3NA 3CO5A 4PYNA 3ELWA 2GZRA 2X3YA 3HZOA 2QRVB 5E7JA 4DMLA 2F8MA 5IYZB 1N3YA 1E3IA 1G8FA 3OUTA 4XTRA 2GA8A 2FW8A 3N9IA 1TYDE 5KTPA 3B53X 1HE5A 2HNKA 4KEAA 5KNBH 5WRFA 2ZZNA 3TTSA 3VRHA 3CR8A 3MWEA 5AHXA 4KUEA 3QBEA 1LXCA 4RVFA 2XNKA 3PUWA 1YS4A 5KNDH 3F3SA 1E2QA 2BFAA 3KEGA 3HRHA 4L4XA 4TMFA 3I05A 5ARCA 5CEEA 5KYKA 4RZQA 3HC7A 2ATEA 4NOMA 3VUEA 2LP4Y 3U7RA 1T4DA 1BXGB 1MOQA 4IJWA 4ZEVA 2AR7A 4Q9NA 4KDCA 1KSHA 4H35A 2FG5A 3HWRA 4LWPA 3I42A 3TVDA 1YBHA 3T61A 2EBHX 4AMYA 4Q3BA 3OTIA 2ZYAA 4Z99A 3OLYA 3QFHA 3BWEA 2VWQA 3RWMB 2LE0A 1DAIA 2H3EA 3AL3A 3STXA 4CZ2A 3CRVA 4LJAA 4TOIA 3Q5EA 5FOVA 3ZG6A 3RVNA 2HV8A 4X94A 3T94A 4PYJA 5FLXA 1BEUB 1E89A 3F5SA 3KU4A 3TAHA 5LLTA 1OXTA 5B53A 4LOIA 1SG6A 3MM4A 3IELA 3V9PA 1VSBA 3OMXA 3ZNPA 1KP2A 1WMAA 2RE8A 1ZCZA 1ETHA 2AN3A 5JADA 3QXCA 1G3MA 3HVUA 2IX9A 3EVFA 1C8BA 5FI5A 3S2YA 1SUSA 4BWGA 1SOVA 3FCYA 3EDCA 4URWR 3WB9A 2EBUA 4YCLA 1JWLA 2GETA 2X9LA 3V1TC 1TUGA 3BICA 4LC1A 3QBTA 1UIRA 3N70A 1TF5A 4LHWA 5F73A 3ICWA 1SXJD 1A7JA 1AGYA 5EXTA 3G7SA 1BA2A 3NTLA 4HLNA 4JXJA 5DWQA 1NBHA 4HXYA 5KQPA 5LYJA 4RF3A 4EWLA 4Y1RB 1BC5A 3UBTA 4M86A 1F4VA 4MIYA 2J3KA 3GEGA 3Q6MA 3PDUA 5EP2A 5JOQA 4BMNA 3HYTA 2GESA 3FIJA 1YHZA 1TVMA 4MARA 4L7QA 4MKIA 2X5JO 4P80A 4PO1A 1QG6A 2B3TA 2FXIA 1WSAA 2IXDA 3CX3A 1SPXA 3IMKA 3TAUA 4DDWA 4CL2A 2NUAB 3GLGA 3QX8A 2FSIA 4JXXA 2XZDA 1V8FA 3LZ6A 1QF9A 3DLIA 3VR6D 7REQA 4QOHA 1JEAA 1YDEA 4N0MA 2VZEA 3OTHA 2R11A 4TM8A 4F4JA 2PTHA 5M7EA 3KOWA 1DE0A 1ST2A 3PLRA 4IFBA 3A7DA 3RUDA 3COWA 4GRAA 4Z9BA 3MJTA 5DTJA 5A3VA 2ZYGA 4PPGA 3COJA 3TJZA 2JCXA 2FNAA 1DX9A 1USWA 2B83A 2X40A 4NONA 4MPTA 3U6BA 2GVDC 2NU9A 3DYBA 4FJ2A 1IE3A 2BWJA 3F9IA 5KWVA 1V8BA 1FDTA 1RP1A 1T1EA 2VP9A 2G9RA 1NR7A 4KE8A 5E4JA 4RTOA 1T2NA 3NBMA 3AGQA 3HDJA 4W5NA 1NIJA 3F6YA 3R5FA 3N2GA 2IW1A 3HVHA 3U39A 3RADC 3KFVA 4G6ZA 2DHQA 1NI4B 4MO2A 4L3VA 2HNAA 5FPHA 4RIGA 4RA9B 2COUA 3WSVA 4AMGA 1QP4A 3IBGA 1UBRS 1NIPA 1AG9A 3U4CA 2JLVA 4WV3A 3B3QA 4YLYA 1THGA 1GGFA 1QH1B 3NT2A 3PLNA 5EZYB 5BN4A 4ITRC 5IJ0B 2Q5IA 3H5TA 1I51A 2PD6A 5T8KC 1I3CA 3VDQA 2H5LA 3KEOA 4N7BA 3HMQA 3IAAA 4J8PA 4D0GA 4B45A 1JA1A 1GPYA 5JSZB 3NP9A 3D6MA 2N75A 1XKLA 3HR7A 3KFXA 4J2HA 1II8A 5FTMA 1PL6A 1X15A 2PYIA 1XD9A 3EGXA 4TKVB 2JLYA 3BJIC 3GJ5A 1X1AA 1WTCA 3BIWA 5E4TA 2A0FA 3ZDRA 1R0XA 2ORVA 3KPUA 1JNYA 2O8VA 3E3OA 2B35A 4OH7A 2DETA 3UC9A 4ZCSA 3LYUA 3ZQKA 1KE2A 4G23A 2BFOA 2O8EB 3B5IA 2ODBA 3GGOA 4RMNA 4RDXA 3HM2A 5F76A 1GGJA 1ULSA 3GRVA 1QB8A 2JAQA 3W04A 3WRYA 1U7DA 1GPLA 2QNRA 3NOVA 3ZS9A 2I1QA 3U5TA 3TSWA 1UXGA 2I2BA 4HQLA 2CMGA 3FWPA 4C6TA 1TD9A 3GXOA 3HU1A 3PNOA 5IPFA 5ITVA 3OUZA 4OGKA 1EGAA 2AN9A 2ZWIA 5LN1A 3G7UA 4NXNB 1TFUA 2YL2A 2QUHA 4R1NA 3O4RA 1OXBB 3OZUA 4UMFA 1JPUA 3R7LA 1XRMA 4Q18A 4BC1A 3JRXA 3N8IA 2FUG6 4GR4A 1J8FA 1CEQA 4RZHA 1A88A 3ER9A 3S2IA 1JRLA 1IY0A 2JHPA 4A9AA 3C16C 4G5QA 1Z56C 4HDSB 1LBQA 2D5AA 4MVXA 3UAYA 4ES6A 1QE3A 1DJOA 1DPFA 2I4RA 4JYMA 1E96A 3OAAD 5FUMA 3HA7A 1AY0A 1ZM4A 1X2BA 2WF6A 4IGEA 3RF7A 3LHFA 4L75A 1R7RA 2OKGA 3MZ0A 4V1CA 1R0ZA 1J0EA 1UKVY 4CMIA 3RUAA 1R8SA 4PHCA 1D3AA 1ZVKA 2PKQP 4W8GA 4MV8A 3CUTA 3K2EA 4AJOA 4F7DA 5I7RA 4QOJA 1SU6A 2OHOA 3C6YA 3H0EA 3W1WA 3SBDA 5JLJA 4UVGA 1PZEA 2BBTA 4YUXA 3WY9A 4B83A 4W9RA 4F46A 4Z9AA 1X70A 1S7CA 5I3CA 5JSFA 1AA9A 1AKEA 2QAGC 4JOSA 4KK4A 4WOPA 4YMUA 4QM7A 4NAHA 2IHUA 3USZA 1ZD1A 5J4LA 1P0IA 3QSYA 5HXAA 5U4QA 3HXQA 3SQOA 3KR2A 1L1RA 1NUUA 2GTPA 4FYVA 3SQWA 2ZUVA 3TO5A 4P34A 4QA9A 1OB2A 1T8PA 1CQPA 2WSLA 4XE5A 1RYMA 2CEAA 1E5XA 1DXHA 4WECA 3WO0A 4IGAA 1XYYA 4CF7A 3W4IA 1ZGGA 5HR5A 3CA8A 1R27A 4QUHA 5DCUA 1GGNA 3AB7A 4G5HA 4D7AA 4S2UA 3QPBA 3FMIA 4N5DA 1FSZA 2B82A 1E6KA 1KAHA 2WIGA 2IY9A 5FI1B 1T10A 5IN4A 1TYZA 1IH8A 4HFJA 4IDFA 4JLBA 1UJ2A 2OD2A 2G83A 4OOEA 5KSOA 1QYVA 2NXJA 2O8BB 3H5OA 4EYSA 1SVSA 1KI1A 4PAQA 1P3DA 2G4LA 3U9LA 3VR4A 2FSFA 1LTHR 1UWVA 5HE8A 2Q1TA 5EP3A 3VSDA 4E2WA 1RBMA 3AKCA 1G9SA 2BW0A 4PPNA 3CNLA 4DLLA 3IUBA 3K70C 2B25A 7MDHA 1K86A 1TVEA 3RHZA 4MB6A 1H3NA 3QXJA 4X7BA 3FOFC 1YVEI 3T4XA 2RCYA 1JJ7A 3C7AA 3H9JA 4BLTA 3M5WA 4EZEA 2BL4A 3DG9A 4FHZA 2PGNA 1GUDA 1W5SA 4Z2AA 4MVJD 5JPDA 4RVHA 1UWCA 4WZBE 1VM6A 2BCJQ 1VJRA 2FWBA 2XGGA 2VHWA 3BB1A 2PL9A 3I9OA 4IRUB 1ZISA 1X80B 1XWFA 1N1DA 2QUJA 4FT2A 3ESZA 5KWJA 3AV3A 2RJ3A 4Q3EA 4ZA2A 5AJWA 3QLVA 5LMNB 4K0RA 1LK0A 2JIBA 1S7GA 4GS5A 1FFXB 3TW6A 1D0SA 1JZQA 1HFKA 1UOEA 1K8QA 2Q8PA 1FPQA 3VTZA 4XI9A 3QU4A 1CRZA 4ZRDA 1JLMA 1TEZA 3UJ8A 3UO8B 1OVMA 3WWEA 1E6CA 2C88A 3QE3A 1K1EA 4DBLC 4UNQA 1KRHA 3IESA 1BOOA 5T5QA 4DC9A 1V5WA 3QUBA 4NCNA 2QVGA 5NLLA 3MCZA 1ONNA 5THQA 3E35A 3AT1A 2J4DA 4FEEA 3F3KA 4HH1A 5GPBA 3REFA 4TYWA 3CU5A 3O90A 4F3RA 3AF0A 1DBWA 2DX7A 3M6AA 2XH8A 4KYUA 3I6IA 4H08A 4TTIA 3EY9A 3H5WA 3BIOA 4J0JA 4B80A 4C08A 4I4LA 5C35A 4R1TA 2SECE 4EW3A 4TMKA 5G4KA 3H5RA 2F3PA 1E1RA 1P4GA 2ZYTX 3ZV3A 4U7HA 1SUIA 3INGA 3LQQA 3LVQE 4A16A 6CHYA 4W1SA 5LD2C 2R2GA 3HGTA 3OLQA 5TPZA 3RUHA 4DQLA 5C4IA 1FUIA 2M6RA 4U6NA 2J59A 4QC2A 4ARUA 1XF1A 4D8WA 1FC0A 3MJFA 3H9QA 5FIUA 3B3FA 4K05A 4KN8A 4Q4LA 4TSFD 3ZVLA 1G7TA 2DF8A 3MWLA 4TT3A 3T1HB 4HLUC 1FLVA 5L7YA 1NT4A 2P3QA 2FETA 3M4YA 3VV2A 4AF7A 4TM7A 3U1VA 4B2LA 1FCJA 4JCOA 2JH9A 1E7SA 4NF2A 5FF9A 3FKSD 3ROEA 4MUHA 4FN4A 4ED9A 1BU8A 3BGDA 3LIPA 1E8DA 2BGMA 1SD2A 2P6NA 3AERA 3R4CA 1CULC 1YQEA 4FEYA 2ZRMA 3L1KA 2JJQA 3OFND 3IBTA 4QJIA 1M74A 4LFCB 2ZP1A 3FNHA 3I0NA 2WJYA 3PSHA 4H6VA 3GRAA 1G2OA 4JUFA 1C2TA 2ID8A 4DCMA 1YCGA 1Z75A 1J8QA 2BE7A 3EISA 4O4HF 3WIBA 3A0UA 5FNVA 2QK4A 4DTIA 1PLKA 3RTEA 2GT1A 3FTNA 4KQEA 1MR3F 3MQ2A 2DFVA 1M2VB 3E22B 3M1IA 4F86A 3QU9A 2A3RA 5GM1A 3D7MA 1QR2A 2VAMA 3LQYA 1HZJA 5IARA 4IJVA 5CCEA 3QWBA 2OYSA 4ZOQI 2O0KA 1D6MA 2WWHA 3VHXB 3ZTWA 3G02A 2WJZB 1ODCA 3K9NA 3E5NA 3MTBA 4HAXA 3KUKA 4NZPA 4G36A 1CUZA 4UVEA 7AT1A 1US8A 3G1WA 4JBXA 1XO1A 5B6JA 1Y7HA 4KLNA 3UQYS 1DDGA 1PHRA 2IDZA 4UUAA 5JT1A 1STOA 3TX6A 1CK4A 3EG5A 1NPDA 1HC7A 2PKYX 2BYTA 2JLWA 1FFAA 1TA4A 5ARBA 1VSQA 5HDBB 1PN3A 3QPUA 4IMIB 1UBFA 4Q00A 1KHTA 1UM9A 5IUJC 3CW8X 1VJDA 2ZT8A 4C20A 1HX7A 2I6QA 4KWCA 3URKA 1SGWA 3H9CA 5C1PA 2BUBA 1JLSA 2DU8A 3Q9NA 3H1BA 4WFKA 3AZPA 3ZH2A 3V97A 4QEKA 3DZHA 4CKXA 1JR3A 1EX6A 1JA9A 5DM60 4JB3A 2GAOA 3HU5A 1LSUA 2FEXA 1WZIA 5IAAA 3JQGA 1U9YA 4YRAA 4DV6B 3E7WA 4HAWA 5JYBA 1XFDA 3MHTA 5ALZA 2PWPA 2J07A 1N36B 3SEQA 3K6JA 4UE6A 1W0KD 4DPKA 1NXTA 2OO3A 3BFJA 4UBMA 4WCFA 4XDHA 1GZ6A 4XR9A 3U26A 5HCUA 1HNNA 3I9V6 4J03A 2HBQA 3H65A 3CZQA 1U3VA 1YL7A 2BLNA 2WOOA 4X45A 1B3BA 4OHXA 2BJWA 5KOJB 2HMUA 2DT5A 2HSEA 3FHJA 1TVKB 2QA5A 2WTXA 1SXJA 4HBGA 2ZVQX 2CBGA 2JLCA 3N2GB 2MSDB 1YQUA 3FOAA 4EB0A 4PYQA 5AOVA 3QWHA 4J7UA 2GB4A 1SNYA 3QUCA 4V0LA 3L0SA 1IU9A 3CLUD 3M2PA 2B36A 1K5HA 3CUSA 3IHKA 1CJCA 1NN5A 4KGVA 4KXVA 4NBNA 2CSXA 1WSWA 2CXQA 4F6CA 3IE0A 1U9CA 2IT1A 1GQRA 2GD1O 5LZ2A 1QTIA 2PSFA 5EWJB 2AHOA 2B8JA 3BMNA 3IVXA 2WICA 1Y8QA 1KFBB 3KLPX 4BASA 4H4CA 3HCRA 4FDVA 1WXFA 5HYVA 4CL0A 1H2WA 1KXZA 3H75A 4P8RA 4O63O 5IAEA 1AD2A 4YRTA 5TV2A 2W8ZA 3EA5A 3C4QA 3RJTA 3GEEA 5JWRA 1N33B 3QI2A 3F6SA 2XRFA 3UCXA 1M1YA 2IUYA 1DKNA 1HMPA 2JFUA 3EHEA 3HNOA 1XRQA 2Y1XA 3FETA 4KXFB 1ISMA 5KSPA 2H2IA 1L5YA 1JSCA 5FTLA 3HFJA 4YJDA 2O8NA 1GSHA 3OIVA 3P9ZA 4IQFA 4PBTA 5AXAA 1N6HA 3NM4A 4CDRA 1IBMB 2ORYA 4ALNA 3H1TA 4ENQA 2DLNA 4V0RA 5IKPA 3DBHB 2XXJA 2PVCA 1EFRD 4V02A 4ND8A 1PGPA 4WGFA 4FNMA 4PO3X 3UJBA 1E1MA 2C4TA 4XX0A 2GBGA 5D3MB 1VQ1A 3VSAA 2GBIA 3W06A 3ZCSA 5CDTA 5IZ4A 1VMAA 3ND9A 1MW8X 3TE7A 3LX4A 5AKHA 2VP0A 2A0UA 2OBLA 3EARA 1UADA 3MGGA 1NQOA 1W30A 2C1XA 2H2GA 3DVAB 1U28A 3L93A 3SHOA 2XRZA 2DT8A 2C42A 1NRIA 5JMTA 4L02A 3AUSA 4KIFA 1A4IA 1CY4A 1DKPA 1LDGA 1ORDA 2VN8A 5CP8A 3LQ4A 4CDNA 4EW2A 2VSXA 4DILA 1KK3A 3ZK9A 3O31A 1H2BA 1MHPA 1PNOA 4G8JA 1LNZA 3CZPA 3GOQA 1LI4A 2QXYA 1CZUA 1ZMXA 3LUBA 3ODPA 3OY7A 4MW2A 3T7RA 2NM0A 3VAAA 1JF8A 3LUJA 2W6JA 1KETA 2QX6A 1EVZA 3BXZA 3H4VA 3BDIA 4MPJA 5BW5A 3E5MA 2FE1A 3NWOA 5P8WA 3RTBA 4ARVA 2DUUA 2WV9A 4Z9FA 4CLOB 2PMDA 4B3CA 1A7AA 1RJFA 1NZFA 4MA0A 2XUGA 5E6SA 4B87A 4IOMA 3RJMA 4B4VA 1MIHA 2A1UA 2G28A 4GKVA 1ND6A 1UMDA 4I9NA 3MAAC 3HCWA 2R5FA 5EXXA 1W2HA 2X42A 4EPXA 3CLTD 3P0RA 1JKIA 4RF4A 1VDMA 4LYYA 2OXCA 4CGZA 1NN1A 1KDZA 1ULHA 2XBMA 1AKNA 1IIRA 4WFIA 3STVA 4F1JA 3ABRB 5LP6C 3OZFA 1GFSA 2VWPA 3D3WA 4NE9A 3C8MA 2HRCA 2JFZA 4YRQA 5T4HA 5J4VA 5KNLA 2D0OB 1G5RA 5CB6A 4AG6A 5IYZA 5BOSB 3VR3D 1RLTA 1KKUA 5E4FA 2P27A 3AYZB 5SZKB 1FW6A 1G63A 5B1IA 3PRHA 5MHTA 1QDUA 2B8TA 3RM3A 1XZIA 4EF6A 2PR7A 1MJGA 3R23A 3O75A 2BE9A 2H29A 4I1SA 1OBCA 5T64A 2VPPA 4JQOA 2DCMA 2BI7A 3AVVA 1OJ7A 2F9MA 4CR6A 1V8DA 3EW9A 1P9OA 3V7FA 3QIAA 1I2MA 4MUFA 4M7OA 1AN0A 4TTSA 4Q1FA 1I9GA 4HR7A 5FUYA 4S2EA 1KDRA 2AZMA 1EK1A 3LKDA 5J59A 4IEFB 4DR4B 3V1MA 5LSAA 3EGCA 1BXRB 1B2LA 4YPOA 1XZPA 4PLWA 1R3DA 1EXNA 2ZEJA 1H66A 1L2TA 3I34X 2CDCA 3KFLA 3E05A 4J0CA 1VLHA 4R54A 4FJ1A 5D1NA 3EGVA 3TSCA 4IVPA 1FBNA 4V0QA 3U3KA 1PUXA 1TYEB 3CB4A 3G5TA 4ZDIA 2GNPA 2HYDA 2IVFA 1P5HA 1K08A 2OCDA 3BE8A 1M9NA 1KQNA 4G67A 4XWAA 2I4IA 5DNDA 1NULA 3OJCA 3WQRA 2PGLA 3PGKA 1HLFA 2E7ZA 3TQIA 1QG4A 3D4BA 1NPTO 1C1XB 1VKNA 2XAUA 3DCNA 4FZ5A 4LXUA 1XXHB 3KKNA 3GGSA 4O4HB 1BX0A 3IPXA 1VCMA 2FZEA 2G6BA 2G9NA 4O8ZA 3M4ZA 1P9LA 3ASZA 3VFDA 2QR5A 2XNCA 3PFHA 3GNTA 4GLJA 2MSEB 2EL7A 4QDUA 1F5SA 1NVKA 4RWEA 3SZOA 1C4WA 2I1WA 1EZ1A 3L06A 3WLJA 1M2WA 3IHTA 3UXYA 4TMVA 3K0AA 4YMGA 1R00A 1NJFA 2P2GA 2BJVA 2Y6UA 3WYBA 4A23A 1ZO8A 2W5UA 2WEKA 2YV2A 5FFNA 5LZ5A 4HWSA 1ZCAA 3QA3E 4MUYA 1P5JA 3T1TA 4NBWA 1U3WA 1WQ3A 1DBPA 2B8WA 4B82A 2M6LA 1R5JA 4HWOA 2X4IA 1KAMA 3DO6A 3R8CA 1GQYA 1QX3A 3DHNA 4JSYA 1Y3DE 3ZWPA 3C6KA 1Q57A 1SK9A 2R8YA 4AS2A 1DG3A 4MVJA 2GUWA 2IFTA 3B6IA 2O3JA 1USUA 4MRAA 4R9UC 1USKA 4YUYA 1R4NA 5ERYA 1GZVA 2PEZA 4QPDA 4CCWA 4LY0A 1T9ZA 5DX1A 5EXDA 3N1UA 2O7SA 4HAOA 4HJXA 1X1BA 4D81A 1E5TA 3D8BA 3KYIB 3RTDA 5L6MB 5IHXA 3U6KA 4IZOA 3EOZA 5H81A 3O8OA 4CTNA 3FOWA 3EXAA 1JSLA 3HCCA 1J9EA 2N9UA 2SKCA 3ECAA 1R16A 5ADWA 3V1YA 4IDBA 3OCJA 2WPDA 1WUHS 1FVFA 2W2XA 4LGMA 4RNCA 3KXKA 3ZWKA 1KORA 3LBHA 2ECKA 5GONF 1FS6A 4NS1A 2HU8A 4NQRA 4HV4A 4PINA 1JFSA 2J30A 3NT4A 3ZW7A 1TUBB 3ABIA 4TRMA 4ZZ3A 1JHAA 1QZUA 3PNBA 4NCHA 4ZEXA 4DA9A 3TS1A 1H93A 2WJ3A 3ZHZA 5DEOA 3SYKA 2C2MA 2H18A 1R8XA 1Z2NX 3W2HA 4Q05A 5AUOB 2GBLC 2DFDA 2PQMA 2VPWA 4NZZA 3CRW1 4Q82A 4B0OA 4MR8B 4I6EA 4IDDA 4JXKA 4Y2GA 2NT3A 3SKXA 2OD9A 4INAA 1N3BA 5AKGA 3FVTA 1IN6A 1JXMA 1T9CA 2OEPA 2ZS8A 1KDPA 1U3GA 3FYSA 4LBZA 4RD1A 3CLSD 4RW0A 4YJGB 5IW8A 4R8SA 2EEZA 4L16A 1REQA 1QFSA 4MV3A 1XK6A 4DCPA 3IURA 2DUWA 2YWEA 4PTYA 1RWXA 2FVXA 4IXMA 4ZOLA 4KXNA 4BWFB 5JXWA 5KX5F 3K0SA 4M46A 1A98A 3MBIA 1Z6QA 4XIYA 2FN8A 2J4CA 1Y4ZA 3OE5A 3QU2A 5FA5A 3TTUA 3VR5D 4CKBA 2Y99A 3EE6A 3ZGVA 1KZ4A 4BVGA 1J0BA 4O5OA 2JA1A 3L7AA 3ORYA 3O94A 4UE2A 3TOVA 1N6OA 3C3XA 3MA0A 3HUUA 5ELLA 3WGYA 4PHGA 3ZVNA 4A5SA 2X86A 3CVUA 2GGSA 1DINA 5FORA 4P0QB 1V5EA 1Z4JA 2WZQA 1E99A 3P9RA 3PUXA 2IH2A 3PCRB 3FMOB 2WRZA 3KSRA 5AXBA 2WI8A 1P0FA 2ODNA 3H3JA 4B43A 2D2EA 3VZSA 1GZSA 5EJ4A 2PKRA 2ZRQA 5DX8A 5FYQA 2X58A 2E9SA 3CGGA 1KZHA 1LLFA 3RRFA 1Z28A 2RI6A 2QN9A 2NAPA 4JMLA 4F0JA 3OOSA 1ZH8A 4MVJM 5E6RB 2EFJA 1ACLA 3MELA 3O8DA 3QP9A 4Q1BA 3SYLA 1CZNA 4AQ7A 4JUDX 5K4GA 1CSEE 3A26A 2OV6A 2BFBB 3LQFA 1RZ3A 2GVNA 2W8BA 4L74A 2NSYA 5DOZA 4ZAFA 1ZHHA 4EI2A 4QTYA 3VOTA 1TM2A 3BMXA 4LK2A 2R6ZA 2OILA 1RIFA 4ZU1X 3GC6A 3QVUA 5DHFA 4MKXA 2CLFB 1X1TA 3BYZA 4IP0A 4LQCA 4C7MA 2HQ1A 2X6TA 2H1SA 1WKVA 1P9RA 1GL3A 5KQGA 1UDBA 4ZU6X 5LA6A 1EDZA 4F5DA 1YU9A 4MI9A 4P4UA 1P61B 1CWUA 1Z06A 2I8LA 3PD1A 2P5TB 1AZSC 1TQDA 4QYSA 4BVEA 3ZNOA 2WKQA 4C14A 2ZJ7A 3JAKA 5EAIA 4MZDA 2OGZA 3MSXA 2PJZA 4JL5A 4GX1A 3RARA 3QPAA 1YDWA 1W9HA 1QH8B 3E0QA 4CM7A 1U5BB 1V25A 4GIBA 1AF4A 1L5QA 1P7YA 1Z7YA 1UKAA 4FP9A 3TIGA 3ER6A 1PZNA 1W19A 3CINA 2HQRA 3DOIA 2VZ8A 2R8BA 4LJLA 3WYDA 1NAHA 4OG2A 4AN1A 3F4KA 5A02A 5KO2A 2R751 3PQFA 2WE7A 3IMEA 3AF1A 1GPJA 2YTZA 4HCJA 2YOHA 4HN4B 2VFAA 4TSKA 2NSDA 4L8LA 2ZRAA 3D4IA 3P9QA 2OXIA 2Q49A 3THXB 4AICA 4BC0A 3T5AA 4RSGA 1W9MA 3ZV5A 2XYVA 3COVA 1P4JA 2FJPA 2RH8A 3EIXA 1WUIS 4Y2VA 1KIAA 5C52B 2GN8A 1U3UA 4DADA 4Q9LA 4DC0A 2XY4A 2QSJA 4WCFB 5H59A 5HVNA 1NBIA 2GCOA 4YFYA 3CSDA 1V6SA 3HUTA 2XHZA 5B1SA 1ZGHA 1LQUA 3EEFA 3LK6A 4LOLA 4E07A 4IOLA 4ARBA 1YZKA 1NASA 2QT0A 1E6UA 1MJGM 2GD2A 2ZIGA 3VH1A 3AILA 1TF2A 3HEMA 3NHUA 1DFGA 3N0TA 3NYQA 3NBUA 4R71A 5BUSA 3UFBA 4RIFA 2H11A 2ZTHA 3C5VA 4IJ6A 4JLKA 3TOXA 1U1EA 3OQBA 1EDBA 5JC8A 4EGFA 1PVDA 4D4HA 4P5EA 2PGXA 3PZRA 1TAUA 5KNCH 2X0RA 2WAMA 3EFOB 1BDIA 1SHUX 2R2AA 2C5GA 3SYRA 1QF6A 3IQGX 1Y9EA 3DTVD 1CF4A 3AR9A 1L5HA 3VR5A 4CEJB 1GQSA 2UZIR 3NUZA 4DR2B 1DU4A 4HAIA 1V11A 2IYWA 2ZTSA 4KXYA 4BLRA 3GP8A 5FHQA 1S8AA 3NEJA 3Q41A 4ZYLA 5JWOA 3GRFA 1LPBB 1T4CA 2BZ1A 2MSNA 3TZ6A 1UP4A 1E1LA 5EZ5A 3IFSA 1GTMA 4BFWA 1OLXB 3FBWA 1Q0ZA 4G0OA 1U9ZA 2PAAA 4KIWA 3KSDO 2I9PA 1TJYA 3B1XA 3BHIA 3GDHA 1BMFA 1C80A 3H1FA 2HA3A 4DLKA 3GVCA 1CEEA 2N1BA 3CZMA 2XTMA 1S4MA 3UMSA 1R6BX 4DCJA 1DV2A 2W4IA 2F67A 4ND6A 4NEGA 1R6TA 4DLVA 1T13A 3SEZA 1PR4A 2HHAA 2GCOB 2OO5C 2P78A 1V3UA 3OT1A 3E03A 4NARA 3WK7A 4F38A 4N0DA 4PZZA 4Z4FA 2R8RA 2QG6A 4IDPA 4EPRA 3L7DA 3L8DA 1KRWA 3O47A 1DJPA 1PTJC 1UODA 3IHLA 4Y2UA 1ZD5A 1CJSA 1VJCA 4N9WA 3RYCB 4MMZB 4OXYA 3OIDA 1CY6A 3OJ0A 3I01M 3P9SA 2D5BA 2Q4TA 4FI3F 3DTVA 4FMPA 2AOVA 5D87A 4B6OA 1BRTA 5J2UF 4HQNA 4R1SA 4TYMA 3WNBA 4CF5A 2XOKD 3RBAA 1FTGA 4C7OA 4GE0A 2ZYUX 5JVDA 2XKBA 3O1LA 3MRXA 1WQ4A 1P7WA 3AZOA 1H5NA 2D4HA 3E5HA 4IEIA 5F1YA 5TNXA 3VYWA 4XCQA 1DTWA 1R9JA 1GPWB 1NNLA 1CUGA 2O1XA 2QD4A 4AN0A 2A94A 1IUKA 2G63A 3FW1A 1E7RA 3OOYA 4YJHA 5COAA 2G1UA 4MYUA 3VR4D 3BMOA 2IF0A 3OC0A 4RTNA 5GONB 1GRCA 5GOZA 3MD0A 1F60A 4CG0A 4RTJA 5IMBA 1CJVC 4C3VA 5C5IA 2J0UB 1Q3HA 3TNLA 4JT8A 2RD2A 3EBOA 5L4NA 1N57A 1LV8A 5I3ZA 1QIEA 3EOBI 2G4VA 2GN9A 1UQRA 5COQA 3G2KA 4OJTA 4X95A 1W5AA 3NHAA 1XTIA 4GMXA 3UAXA 5BURA 2DC1A 2J7KA 1YR8A 4QUBA 2XRMA 3MRSA 4WMLA 3ZH9B 4EZIA 5J58A 2GPJA 5G02A 2WB2A 4AY6A 4UHHA 2UUAB 2FMUA 1EM8B 3DDZX 1G17A 3T5BA 3T7AA 1XQ9A 4FE3A 4RXTA 1EZZA 3IJEB 1VYUA 5FWYA 2I4NA 5GIPE 3U1BA 3OSUA 2RAPA 3IQEA 4FD3A 4BJ3A 1EFVB 4BB5A 4BJHB 5FA8A 3L8GA 3RSHA 4ALIA 2NZUG 3LD9A 3CF2A 4W9NC 3I32A 3ZDEA 1E7QA 4ZZIA 4K6CA 1V4NA 4Q48A 1E2JA 2HA6A 2Y1EA 1R5OA 3O38A 1UBUS 5ILQA 2PWBA 4NCKA 5DHPA 2PRZA 4YRMA 4UREA 3VNVA 1O89A 3LA8A 2AE1A 1DC4A 1SU4A 2ADFA 2D5IA 2ZPAA 3NWJA 4N7RA 1GTJ1 2V7QA 4UJ3A