1LDMA

Refined crystal structure of dogfish m4 apo-lactate dehydrogenase
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
329
Chain Sequence
ATLKDKLIGHLATSQEPRSYNKITVVGVGAVGMACAISILMKDLADEVALVDVMEDKLKGEMMDLQHGSLFLHTAKIVSGKDYSVSAGSKLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKHSPDCIILVVSNPVDVLTYVAWKLSGLPMHRIIGSGCNLDSARFRYLMGERLGVHSCSCHGWVIGEHGDSVPSVWSGMNVASIKLHPLDGTNKDKQDWKKLHKDVVDSAYEVIKLKGYTSWAIGLSVADLAETIMKNLCRVHPVSTMVKDFYGIKDNVFLSLPCVLNDHGISNIVKMKLKPNEEQQLQKSATTLWDIQKDLKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined crystal structure of dogfish M4 apo-lactate dehydrogenase.
pubmed doi rcsb
molecule keywords M4 LACTATE DEHYDROGENASE
molecule tags Oxidoreductase
source organism Squalus acanthias
total genus 105
structure length 329
sequence length 329
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1987-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ldmA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1ldmA02
4A2CA 3PHHA 3R6DA 3WQQA 3PHGA 4ZVVA 2OMEA 3TFQA 4F6LA 3ZU2A 4U0JA 3PJFA 3H9UA 1ISHA 2ZJ0A 4RPLA 4CM5A 3F4BA 3S55A 3FCOA 4DYVA 6ADHA 1J49A 2E82A 4R68A 3DAGA 3SJUA 1AGNA 3RUIA 1ADFA 2WDZA 1B16A 4N18A 1HT0A 4XIJA 3WX0A 1NYTA 5JMPA 4AJIA 4BNXA 4F46A 5CEFA 2C2YA 3F6YA 3RASA 5EESA 3WYEA 4QXMA 1A27A 3PWKA 1GUZA 1M6WA 1HTBA 3PJDA 1PJCA 5A03A 4L8VA 4O6VA 3NTRA 5L7TA 2HK9A 1ZEMA 4TROA 3RSHA 2HMWA 3WJ7A 1Z75A 1VJ1A 5IDYA 2DVMA 2VN8A 3LF1A 2J5RA 4IMPA 5KIAA 1A71A 3KBOA 2NVBA 4UUOA 1PEDA 4FFLA 3TRIA 1YL5A 4IDGA 1ZZEA 1Z7EA 3GEMA 3Q1LA 4K6CA 3B1JA 2JFHA 1PS9A 1XELA 4RF4A 3R0IA 4YJFB 1CEQA 1FXSA 1R66A 1GYRA 4EUEA 1T1RA 1KVRA 3HHPA 4KUEA 4MP6A 1LXCA 4E2XA 1XU7A 3GMSA 5EN4A 1I2BA 5DCWA 5C7LO 4M87A 4R4JA 1UP7A 1YL7A 4MVJF 3GDOA 5DOZA 4KTVE 1H0KA 3AY3A 4XDYA 4CLDA 1PZFA 4XYGA 3AU8A 1O94A 2E48A 4R1UA 2VHWA 4DWVA 4TRRA 3UCXA 5L7WA 3TZQA 5CEEA 5JLAA 4YJFA 3HDJA 4YVFA 5L45A 4GGOA 2I3GA 2EP7A 3BMOB 3NT5A 5DCUA 5KWEA 3O03A 4QQRA 5HBRA 2GZ1A 1H6DA 3W8FA 2PK3A 4EBFA 3NAQA 2E37A 1ZEJA 3ZWCA 2AW5A 5GZ1A 3DZHA 2CZCA 4BNMA 2CVQA 4CUKA 1KEWA 3LSYA 4WNIA 3I3OA 1YVEI 1QYXA 4I5FA 4TSKA 3D4PA 3IJRA 1ZNQO 3HQ4O 2I76A 1AHHA 1AXGA 1D4FA 4M8SA 4Q3BA 4U6SA 1WDLA 3RUEA 2AXQA 3H8VA 2AE1A 3VAZA 3K8ZA 2DPGA 2W98A 4DBVO 4K26A 4QECA 5KCZA 4CUJA 5T67A 4Y6RA 3OIGA 3NV9A 5FYDA 1DHRA 3B1KA 3PPIA 3G49A 3VPXA 1P44A 5HRUA 4ZHSA 2Q49A 5JAMA 3OMLA 3QP9A 3RQSA 4J90A 1PS0A 2AMFA 5TLSA 1IL0A 4NBUA 4O5OA 1CF2O 1DC3A 4ZN6A 3FWZA 4IDCA 2EKQA 1B8VA 1UXJA 5JE8A 3KSUA 5THQA 3R3JA 1EMDA 4BOYA 3LU1A 5JAQA 2FY8A 1ZSVA 3IAHA 3L6OO 4GVXA 4L75A 4ILKA 1IULA 4DMMA 4BMVA 2CF6A 3OIDA 4BNIA 1R6DA 1I2ZA 2O7SA 3F1LA 3VKUA 3ASUA 1MP0A 2AQHA 3GDFA 3VPHA 2D4AA 2RH4A 3OFSA 3GVIA 3PHIA 5COAA 1KERA 1NPTO 3L9WA 4J2HA 5DBGA 2VTEA 3U49A 2AA3A 5A06A 2Y0CA 4G65A 2C82A 4WEOA 4GPD1 4DGSA 2CMDA 3VPFA 1QV7A 2TMDA 3L9XA 2OO5A 1GR0A 2YQ5A 1K6JA 4ALNA 3LF2A 4XDZA 9LDTA 5K6AC 1YOVB 3DHNA 3KVOA 2VUUA 1GYPA 2QYSA 4MKRA 3UUWA 4CR6A 1S6YA 4RZHA 2BMAA 3DFZA 3EC7A 4QTZA 4YQZA 2IEDA 1D7OA 2X5JO 3D3WA 3I1JA 5IF3A 5K0ZA 3NGXA 3GOHA 5ENDA 1OC4A 2IODA 3WJAA 5JXWA 1YOVA 1SMKA 2PGJA 4OXKA 1DFGA 2ZTMA 4DLLA 3DMTC 4CQLA 1CETA 4FJ0A 4DC0A 1VKNA 3AOGA 1WPQA 3H65A 3K9QO 3KEOA 5KJCA 5U9CA 5J23A 2CVOA 3DZIA 3L6DA 3RJ9A 4JJFA 4MOWA 3EYWA 3IKVA 1LLQA 3FPLA 5AVOA 4YR9A 3VZRA 3UW3A 4OSOA 2VOJA 3WTCA 3RI3A 1GPDG 3LC7O 5DCYA 1GTMA 1O8CA 3VPSA 1GADO 2VHVA 4BKUA 4D0SA 4IDFA 5JAIA 5ILGA 1X13A 2B69A 2GRAA 4XJTA 5DNAA 3VPGA 4XYBA 1LDYA 4J9VA 1U9JA 3JQGA 4YPOA 1F8FA 4BO1A 1ORRA 3GPIA 3H3JA 4YA6A 2PZKA 3KXDA 1JVSA 2DTXA 3MEQA 4G5HA 1ONNA 3U4HA 1WMBA 2EGGA 4D41A 4WPGA 1ZK4A 4NU5A 5F21A 4FB5A 1ENPA 4NMHA 4CMAA 1VJTA 1OZAA 1XSEA 2XXBA 3FNHA 3PGJA 3L07A 2I65A 4XD2A 1GQ2A 1F0YA 5JY6A 1MG5A 3V5NA 5ADHA 4A5OA 3JD4A 1EE2A 3KHUA 2IYOA 4NU6A 4NK5A 1A7KA 1XA0A 5ILOA 1H6CA 3KV3O 4YACA 3ADPA 3WGGA 1ZMTA 3ROQA 3S2FA 5B4TA 1ENZA 4CQMD 2LDBA 2Q2WA 4CM8B 2Q45A 4YWJA 1GFSA 1GQYA 2ZYDA 5DULA 4PVDA 4Z3KA 1QG6A 2RH8A 4DMLA 3O26A 5AQ1A 3QY9A 4PLPA 1E3LA 4NDNE 4D44A 1HWYA 3ITKA 3DOCA 4QUKA 4R3WA 4HKTA 3ZHYA 1EVJA 2X9NA 4GGPA 5F5LA 4BO8A 5IN5A 4BNUA 1DSSG 1HYGA 3KLMX 5DP2A 4CM8A 3MTJA 5BQFA 1ZK3A 2NU9A 5U1PA 3WMWA 1X15A 3CMMA 2ZTUA 1SBYA 3E5MA 4LVUA 2FZWA 5TJHA 5FWNA 3IQDB 3WR5A 5EIOA 2Y0EA 1AXEA 3DFUA 2EXXA 1UDBA 3DO5A 3JYNA 1YBVA 4WE3A 2C5AA 4DQVA 1XEAA 4P4GA 4Y98A 2G1UA 1I5RA 3OF2A 1C14A 4PN3A 1EQ2A 3QJ5A 4EUHA 1EVZA 3ETGA 3HN2A 4YRAA 2PZLA 2JKVA 3PJGA 4U8GA 3QVWA 4OH1A 1SAYA 4Y9DA 1SOWA 3UICA 3OJLA 2GD1O 3RC9A 1C3VA 1IZ9A 1YE3A 4RQTA 3VVCA 3I9KA 4BGEA 1BXGA 4Q39A 3RVDA 3HSKA 1GUYA 1HZJA 2J3HA 3JQ6A 3VDRA 2ILTA 3SEFA 4B79A 5ENVA 1G0NA 4PIVA 2IYPA 1GUFA 1TA4A 5JCJA 3ZH2A 1PJQA 1ZVMA 3V1YA 1DDOA 4IS3A 4FFMA 4NBTA 3DZJA 4ALJA 3GC6A 1BGVA 4ND4A 1XQ6A 5I7EA 1PJLA 3K6JA 1NVTA 3IC5A 2QG4A 3TZKA 1X7DA 2YY7A 4DYDA 2CUKA 3UHAA 3JYOA 3IL2A 3E5RA 4NJOA 3C3XA 1PR9A 1PZHA 2GUGA 5THKA 1I01A 4XGNA 1E0DA 2X9GA 3ZV5A 3EW7A 4J4TA 5AYVA 1KC3A 1PJ4A 1BVRA 5G0SA 3VDQA 4IS2A 4FCCA 4HP8A 4NFHA 4B3HA 1EUZA 1J4AA 2ZJ1A 3F3SA 3INTA 2AG5A 5A5EA 2HMUA 4FW8A 4E2ZA 3E82A 4IXTA 3PP8A 3ETEA 3NT2A 4TRJA 1I3KA 4BGIA 1I3MA 4A03A 4RL6A 1BSVA 4ZRNA 4JN6B 4FQ8A 4YJHB 1P3DA 3AOEA 2ZB3A 2F00A 3SVTA 3A14A 1LC0A 3GGGA 2F1KA 3PTZA 4XYLA 2Q1TA 3ROMA 2DUUA 2GGSA 3A28A 4H7PA 1QKIA 2X1HA 4JX8A 1KBZA 1PGJA 3P7MA 4IDBA 3VTFA 3NTOA 2VQ3A 2IE0A 3G3EA 4HFMA 3ZV3A 1Y9AA 1K3TA 2GERA 4YT5A 2P9EA 2VYVA 2DTDA 1H9BA 2NM0A 4YJHA 1LSOA 3QWIA 4OMUA 4RLSA 5JDIA 2NWQA 4K28A 4B3JA 2RIRA 2IZ0A 2HRBA 3PWSA 5EPOA 2WD7B 1A7AA 1YL6A 2VCYA 3KOUA 1H5QA 4N5LA 2X6TA 2PFGA 3TJRA 2R6JA 3EMKA 5A1TA 4Z0PA 1HE5A 4FS3A 4J16A 2GZ3A 2DBVO 3JYLA 4Q3NA 3T7CA 1TEHA 3LT1A 1EQUA 3ROPA 4ALMA 5JO0A 4QSMA 4I9UA 2EV9A 1P9LA 5ES3A 4A27A 2EP5A 1JTVA 3H9QA 2X8LA 4M1QA 3DONA 1J5PA 3OM9A 3Q2IA 4PG7A 3E9NA 1MX3A 2WD7A 4W9NA 1TXGA 1PGPA 1J0XO 5B12A 4LSWA 3WBBA 3H9EO 3EK2A 1TT5B 1JWBB 3QWBA 3RUCA 3K5PA 4FFRA 5TIIA 3EDMA 5IN4A 4KUGA 1LRKA 3TFOA 1P33A 3WSWA 3WNVA 3VZQA 5IDXA 1LRJA 1SO8A 5TX7A 2D8AA 3PYXA 4PLCA 5G0UA 3FTNA 2HAEA 1RYEA 1DOHA 4MVJP 4TMFA 1LDBA 5L51A 3RC2A 3H5RA 2O48X 4L73A 4IDEA 3F5SA 3AY6A 3D7LA 3NKLA 3QLJA 3QWFA 4RLHA 5BT9A 3K2EA 4YYZA 4XEHA 2Q1UA 4HADA 5G4LA 3TQHA 2PH3A 3ONDA 1RPNA 2DPHA 4EZBA 1KVQA 2W2LD 4TWRA 3SBOA 2TMGA 4CMEA 5L4SA 2OBYA 3JQAB 1TLTA 4R3NA 2WYUA 4ZJUA 3TOXA 4GMFA 3LVFO 3LDHA 3H3FA 3OJEA 3ZV6A 4BNJA 1E3EA 2OUIA 1E3WA 3GNTA 1KEUA 2JJYA 4WK6A 2QW8A 4UVEA 3FWNA 2D3TA 5I7VA 3ZHZA 3BHJA 4GBJA 1HLPA 1R4NB 1Z82A 2O3RA 4IQ0A 4TVOA 4IQGA 2DBZA 3FNFA 1SOVA 1P1IA 4FFNA 4B7XA 1CJCA 1SZJG 1SB8A 4TZKA 3JQAA 4BNYA 4ONEA 2NTNA 3LT4A 3L4BC 3E8XA 3WGHA 3QWAA 4FGWA 3DC2A 1B14A 2FWMX 3WXBA 2NU8A 1HYEA 3BYZA 4H3VA 3EVTA 1JDJA 2V65A 4XR9A 1N9GB 3RBXA 1R4NA 3BZUA 4CLEA 3PJEA 1I33A 4N7RA 3CMCO 4ND2A 2PD6A 4PLGA 3F9IA 3ENKA 3SXPA 1QYWA 5I9MA 3DB2A 5BNIA 4M86A 2Q4EA 2HMTA 3HDYA 4W4TA 2B83A 5L3ZA 1UDAA 1HDCA 1N9GA 3BMCB 3WWZA 2AEFA 1PGQA 2GASA 4PLTA 3ST7A 2A94A 5A5FA 3R3SA 2Z5LA 4GQAA 3HNPA 4WLFA 4GKVA 2YUTA 3WICA 3UGKA 1Y81A 3U09A 1T26A 1XR3A 4K1LA 2EF1A 2FR0A 3JV7A 4KP7A 1T1SA 2NU6A 3RUDA 3DZFA 3RC1A 4ND1A 3W4JA 1M6HA 1VM6A 4J3FA 4NIMA 3ZU4A 4D7AA 2O50A 4YDRA 2QRLA 3BMCA 3OBBA 1VPDA 1H2HA 2Y67A 5IZ4A 3SLKA 4IXWA 4DLBA 4JK3A 5TQVA 3OECA 3FTPA 1I3NA 1YXMA 3GH3A 4IINA 2RHCA 1E1LA 5A9SB 4PLFA 1NWCA 4E33A 2PA3A 3TZ6A 3ZWBA 1LDMA 1ZJZA 2PH5A 4EI2A 1LA2A 3JD0A 5KJFA 5T8KA 3B1FA 3PXXA 1SNYA 2EWMA 2HSDA 3QV1A 1VSUA 5L9AA 4O59O 4FGSA 5DBFA 4A10A 2DAPA 3P2YA 4PLYA 1KC1A 1R12A 3OH8A 4DPKA 3OQ6A 2B5VA 5JW6A 1YKFA 2GYYA 2QHXA 4M89A 1PR3A 1VJ0A 3SX2A 4BO9A 3SLGA 3WLEA 4ZD6A 5A9SA 1EUCA 3M1LA 1T2CA 2I3AA 2D5AA 4J1NA 3LLVA 4L4RA 5H83A 4CM6A 3U0BA 3ZWXA 3GHYA 3Q6IA 2YV1A 3OP4A 4AL4A 4XRGA 1UH5A 3PDJA 3R1IA 4ALLA 4ALIA 2YFQA 3QVTA 4WUVA 5A05A 4IDDA 2VHXA 3WGOA 1IHXA 1A9ZA 4Z9FA 1JAXA 2QZZA 3AFMA 1K2WA 2P9GA 3GNSA 4TKMA 5A9TA 4FOOA 3AJRA 4BNFA 3GN1A 2ZQZA 4QFDA 5C3MA 5HS6A 4Z9YA 3TZCA 5BR7A 2NSDA 1NPYA 1U8XX 3B20A 4W99A 1HDZA 4MIOA 3HDHA 1W0CA 4OJNA 1WZEA 3EVNA 1ISIA 2WYVA 3LC2O 1YDWA 1J6UA 3MWDB 4HBGA 3UKOA 1LLUA 2HDHA 2GLXA 4RPJA 4M54A 4AJOA 1T2FA 2D2IA 4E12A 1UXHA 4YT4A 2VZ0A 1RKXA 4NFYA 3JQ9A 4NBRA 4R51A 1IUKA 4GSLA 3S1LA 1KVSA 4I5EA 4NFSA 1ML3A 4G2NA 2OBNA 1HE3A 3KUXA 2JCVA 4R54A 4IPTA 1H6AA 4IMRA 4MVJH 1L7DA 4E30A 3W6ZA 5CDUA 4GKBA 5JDCA 4I9HA 1DLJA 3NTQA 4PG6A 3G1UA 4GLLA 4HFRA 4RQUA 3VZSA 5IJZA 4NK4A 2HJRA 1Y5RA 3DBRB 3JYQA 1FDTA 3ICPA 4XWYA 4Q9NA 5LC1A 3ZW9A 1NAHA 4D42A 1YB5A 3BXXA 3O4RA 1LJ8A 4EW6A 1P45A 3C7CB 1YONA 5IFLA 1XCBA 3JCZA 4QEDA 5JPIA 4FR5A 3B70A 4CUZA 4CPDA 4J4HA 5I8WA 1G1AA 3LQFA 3HG7A 3DBRA 3JQBA 3A06A 3FN4A 4AJEA 4U5QA 3RD5A 3KM0A 1C1XB 4XB1A 1E1KA 3QSGA 1VSVA 4XA8A 1LDNA 4AJKA 3FBTA 1LSUA 3WLFA 2W8ZA 4DREA 1JW9B 3K73O 4FFOA 4GAEA 4RGBA 4AJNA 4E21A 2OFPA 4WLVA 1I0ZA 2YZ7A 2ZB4A 3STHA 1K6XA 1IY8A 2CDBA 3MOGA 4L4XA 5KVQA 4S1VA 1UZLA 1HSZA 1HSOA 3ZWMA 2YYYA 3VH3A 5L40A 3DZBA 4B7UA 4R1SA 1C1XA 1EK5A 4GL4A 5FEUA 4JXKA 4II3A 1ZBQA 4LGVA 1V8BA 2PNFA 5IXYA 3KYDB 2YV3A 1D1TA 4YAIA 1W4ZA 1LQTA 2BI8A 1MLDA 2ZIZA 2HKIA 1EDZA 3D4NA 3NJ8A 5KTKA 4PLVA 5JYEA 4ZRMA 4MPDA 4DIBA 4YT8A 4D43A 1HYHA 3UF0A 4CM3A 2PGDA 1C0PA 3IOYA 2FZEA 2JFFA 3V8BA 3L0DA 2P5UA 4BNLA 2Q99A 2AEMA 2DC1A 2Z95A 3KYDA 4I5GA 3BMQB 3OIFA 4RVFA 1LEHA 2GSDA 1HDXA 1NHGA 1ZFNA 1RM4A 1QR6A 1Y5MA 1CQIA 3ANMA 5HTOA 4MVJM 1ISFA 4PLHA 1NFRA 1IHYA 3JQFC 3Q9NA 1YB1A 1ULSA 4PCVA 4XYMA 1JKFA 4B4VA 4RDIA 1YS4A 1ZW1A 3AUUA 4NQZA 2JD0A 1E5QA 3GVHA 2XOXA 4WJZA 3PEFA 2H63A 3BMQA 5COBA 3RROA 4DXHA 3D4OA 4OAQA 3N74A 2O4UX 4YRBA 2NTVA 5HM8A 1KIFA 3JQDA 2FSVA 2JFGA 1HDRA 1YBMA 3DR3A 5JFOA 4CL3A 4XKJA 4GLOA 2Y68A 3UAGA 4NG5A 4YXFA 1GY8A 3PHJA 3RAJA 5TT0A 4KOAA 4OO3A 3D3WB 5TGDA 4CQMB 3KYCA 4EGFA 1MC5A 5KVSA 2Y1GA 3CZMA 4JNKA 2UDPA 1TVEA 2DU8A 5CDYA 1U7HA 3DMTA 5F5NA 3V2HA 4BL5A 4DIOA 1ZCJA 5H82A 3ANNA 1LX6A 3DBLB 4CMBA 2OP0A 4CQLB 2E4AA 2QX7A 2CDCA 1WLYA 3NGLA 1ZH8A 4DA9A 1F06A 3CIFA 4HY3A 3U9LA 2UV8A 5U4QA 2AEJA 4CQMA 3SC4A 3KEQA 2JAHA 5TF4A 1S7CA 2V6BA 1T25A 3AI1A 2NQ8A 1P1KA 2C07A 4WECA 1XQ1A 3RKRA 3GA0A 3OSUA 2AQIA 5L95A 2BKAA 1GV0A 3PLRA 1Y7TA 4WLNA 2IEBA 3DBLA 1XYGA 2H5LA 3ZNQA 3QWHA 4PLZA 5FFFA 1IOLA 1LSJA 1NWHA 1YRLA 1BXKA 1CWUA 2QZ9A 2X23A 5KOIA 3CUKA 4FN4A 2WM3A 2J5KA 3JQGB 3PVZA 4E5YA 4UREA 2RAFA 2CNBA 5EL0A 1QLHA 1KVTA 2EJVA 1D3AA 4BO0A 1EEHA 4H16A 4RVUA 4AVYA 1YWGO 1R0SA 4YJGB 4AJPA 4EJ6A 1WWKA 5MGBA 1UUFA 2YDXA 5I7FA 5G0VA 5BSFA 3OHSX 1KEPA 1K5HA 1R4MB 1DAOA 1HF3A 3DAPA 3ETDA 4F45A 4IGEA 3CZRA 5C5IA 3S2IA 4JBHA 3K2BA 4ZGWA 3UFXA 1I24A 3TN7A 2ZATA 1E92A 2VRCA 3WFJA 1ENYA 3RUHA 2P91A 4KDEA 5JCXA 3WGYA 4YJGA 4DQXA 1I10A 3GLQA 3E6AA 5FI3A 2AQKA 4JLWA 3Q9UA 1A5ZA 4GWGA 1R4MA 4PZEA 1ARZA 4CM4A 3BAZA 1HETA 3BTSA 4BQPA 5CDTA 4LCEA 3GZNB 4MP8A 4XQ9A 3WFIA 1GU7A 3VZPA 2WD8A 2OP1A 3WYBA 1DRVA 2XF8A 3TOZA 1DHTA 3DZKA 1BG6A 1DIBA 4PGFA 4UUNA 2G0TA 1HKUA 2PLAA 3V1TC 5ICMA 1QV6A 2DTEA 1UXGA 5GZ6A 3D1LA 1A72A 3P2OA 2SCUA 4J1QA 2GO1A 3JD3A 4OXYA 1YJQA 4XJSA 4CV2A 1WW8A 5KKCA 5H81A 4MP3A 4UULA 3AM3A 3AUSA 1LLCA 9LDBA 3GZNA 5KKAA 4FFPA 1D1SA 2Q4BA 4OQZA 1X0VA 1MG0A 1I2CA 3PGXA 1E5LA 1MB4A 3ZWNA 4XX0A 5ITWA 1UJMA 3VVBA 4ROSA 4PVCA 4IY1A 1JVBA 1PQUA 4IDAA 1AUPA 5A3JA 3UH1A 3BTOA 1U1IA 5FI5A 1XHLA 2O7QA 4U6QA 3RIHA 4GX0A 3GZ4A 1EZ4A 2HUNA 1O95A 4LK3A 2O2SA 1U7TA 4A73A 4HNGA 1QSGA 4KWHA 3ZN2A 4DIFA 5B1YA 4B7CA 1BDBA 1YJ8A 3ROKA 1PIWA 4C7JA 2G82A 2YW9A 4NR0A 4R16A 1C0LA 1ONOA 1P1RA 3N58A 4KUHA 3W4KA 3ZWYA 2DQ4A 1BXGB 1AHIA 3PDUA 2VUSA 4CM9A 1RM0A 2VRCD 1ZJYA 5G4KB 3KETA 4A26A 4J91A 2HLPA 1LRLA 4R5MA 5KJ6A 4RDHA 4RZIA 4INAA 2OZPA 5IDWA 5TS3A 2O3SA 4DTIA 2EG9A 1BW9B 3TWOA 4BKPA 5DOVA 1JKJA 3QIVA 3S2GA 5KNLA 3MJTA 4HUJA 3OA2A 1L1FA 2IXBA 2BFMA 1V35A 2HO5A 5G4KA 4E3ZA 1FDSA 3F5QA 3ZWAA 3I9JA 1GCUA 2JAPA 2W90A 4LN1A 1VLLA 4E5MA 1ULUA 3VC7A 3DDNA 2EW2A 1BW9A 4UVGA 1F17A 5G0WA 4FC6A 4WASA 4MKXA 2OL4A 3CH6A 1GL3A 3KZVA 3T4XA 3C1AA 3FNEA 3IUSA 4D0RA 1DC6A 1P1JA 1PGOA 3OQBA 3SC6A 1DBVO 3INGA 4MKZA 2GN4A 2VRBA 2DBRA 2YFHA 3JD1A 3KB6A 1P0CA 3GUYA 5CHEA 3QHAA 4YAEA 3JTMA 3RBVA 1HDGO 3A9WA 3ZWPA 5C37A 2C5EA 2EGHA 2ZCUA 3GFBA 1UAYA 4B8ZA 5CG2A 5BSEA 4R9SA 1B26A 4OSPA 2OGUA 2J3IA 4UEOA 3PIIA 2Y0DA 1UXIA 4BNKA 4CM1A 4YT2A 4FC7A 3NT4A 1U4OA 1NVGA 3I9LA 3A1NA 4OXNA 1WDMA 3H5NA 4PG4A 4P4NA 3V2UA 4M55A 2DUWA 4JBIA 1GZ4A 4CMIA 1V3UA 2NNLD 3CPSA 4WGGA 4CM9D 4JIGA 4JROA 3BHIA 2ZYGA 4UEKA 2W2LA 3HB4X 5LCXA 1WAMA 1VRWA 3GF4A 7ADHA 1LBEA 2X22A 3ZV4A 3FR8A 4E2WA 4LVCA 1MUUA 1UXKA 2Y1EA 2O3UA 4WKGA 1H2BA 4JBGA 4ZQHA 2J5QA 1X7GA 1SC6A 3TL2A 2J8ZA 3OA0A 1QLJA 2AG8A 4B8WA 2VWPA 1Z45A 5CAEA 2B4TO 3COSA 1GZ3A 1NQOA 1U5CA 4F6CA 3U5TA 2NTJA 3GAZA 3GFGA 3I6QA 4ITUA 4W7HA 1NFQA 5ITVA 3G17A 4HXYA 4Y8VA 3LZ6A 5AXBA 3UCEA 1AE1A 3K31A 1H93A 3QE3A 3H2ZA 2VYNA 5MDHA 2GR9A 4BO3A 1BTOA 4OOFA 4OQYA 5A3VA 4CLRA 4B3IA 1VI2A 2YHUA 3K96A 3UCFA 2BGMA 4MO2A 1U3UA 2I99A 2NADA 3GVCA 3D5QA 4UVHA 1XGKA 1MA0A 3I9NA 4BV8A 2VZ9A 4R9RA 1JAYA 4CMKA 2UVDA 3NEPX 1FDUA 5GMOA 3JSAA 1W6UA 1EVIA 3ZI0A 2EKLA 4I08A 2PWZA 5F3RA 5ER9A 4E5NA 2QRKA 3WBFA 3O8QA 1B8UA 2FOIA 5JDIC 1MXFA 4Q3CA 4E5PA 5L53A 1E3WB 3RCBA 2C20A 1IZ0A 1U3TA 2C7GA 1OOEA 3Q0EA 3LYLA 1SEPA 4OGWA 2C29D 3L4BA 3IKTA 3I5MA 1O0SA 2UUOA 3DAFA 2VHZA 1C0IA 2X0NA 3VH1A 2HMVA 1N7HA 4WCDA 3V1UA 2B36A 1WVGA 3WQRA 4XQCA 1A4UA 4ESOA 2NLOA 3UOGA 1E7SA 3DTYA 1I8TA 4EUFA 2FN7A 4DPMA 2HJSA 2WMDA 1K6IA 3RWBA 5BSHA 2ZTVA 2I6TA 4QO8A 2OOSA 4E13A 4ZQBA 1Q0LA 4WEQA 1Q0QA 4ZA2A 4O1MA 4AICA 1GZ6A 4BNGA 3TPCA 2VYND 3VHRA 2Q50A 4J6FA 3FPCA 3I52A 2OHXA 4L74A 4BO5A 4BMNA 2QRJA 3H6KA 4M49A 1F8GA 3W6UA 5IZCC 4BNTA 3G0OA 4JP2A 4BVAA 5HA5A 4WLOA 2WE8A 4GVLA 4XQEA 1GDHA 2O3TA 3HJAA 4JP3A 3DXFA 3EZYA 1E1MA 1QXSA 1VL0A 1DEHA 1YH3A 2WTBA 3ONFA 3AK4A 3MJEA 4FIZA 1NHWA 2Y93A 3MTGA 1YB4A 1PWZA 2E49A 4EDFA 5G2OA 2ZYAA 4Q3AA 3WMXA 5B4UA 2EEZA 1EE9A 3M1AA 1E7WA 2FMUA 2BLLA 4BNWA 2WJPA 2FR8A 4FBGA 4NBWA 1B3BA 3NDRA 4XQGA 4L9RA 4CODB 1QYDA 2BD0A 3RKUA 3RFTA 4J7XA 4BKOA 2NVUA 3MJCA 4MVJG 4NJMB 1UDCA 4XCVA 4BMSA 1ZK1A 2I66A 4JGBA 3WG9A 1AN9A 3EY4A 4RVDA 5CP8A 5JBIA 1RM5A 1T2AA 3D5TA 3ICCA 3PZBA 4BGVA 5CDSA 1DIGA 4RV9A 3CINA 2BGKA 1R0LA 3AM4A 2DFVA 2CFCA 3ZZNA 4QX6A 1SEVA 2XPCA 4MVJI 4BKQA 1BXZA 1NFFA 5AXCA 4IIVA 4BNVA 2UYYA 8LDHA 1UZMA 2JHFA 2G5CA 5DBIA 1F14A 1E3IA 4NI5A 3FD8A 1N7GA 3PYMA 4NJMA 1RYDA 1VC2A 3F1KA 3QVXA 1E7YA 3BIOA 1X0XA 2RHRA 1N8KA 3G1TA 1KOLA 3HDQA 4J4BA 5EJ2A 2R00C 1K0UA 1O6ZA 4XGIA 2A4KA 3IP1A 2CDAA 4BUCA 1M2WA 4E0BA 3NUGA 4EEZA 2D1YA 2V6MA 3GGOA 4HX5A 3HN7A 3WWYA 4CLHA 1YQGA 2GN9A 4AFNA 4B4UA 4XYEA 5TJ9A 4KQXA 2WSBA 2W2KA 3IP3A 2PZJA 5ER6A 1O5IA 4FPXA 1I30A 4XRRA 4J7UA 3GHHA 3W1VA 3ULKA 1VL6A 3PZRA 4IQ8A 3ADOA 4UEJA 2EW8A 2VHYA 2DFDA 1OC2A 3M2TA 4KWIA 1NQ5A 3GAFA 1BMDA 2PGLA 4CLOA 2BGLA 3MJVA 1H6BA 2P4QA 1U28A 3BTVA 2PV7A 4P8RA 4P22A 4R5HA 4PRKA 3ZCXA 2I5PO 3DQPA 4NH4A 4BIIA 3ABIA 1Y1PA 2YQ4A 3GRKA 3Q11A 2E6UX 4GX2A 4IZHA 4FD3A 1PJ2A 5HS4A 5KJ1A 1PGNA 2VWHA 4DQUA 5JC1A 1W73A 3L4SO 5L4NA 3I4CA 5DZSA 5T8KC 3TZHA 2ZK7A 2WEKA 3IJPA 4P38A 4W6ZA 1IB6A 4ZU3A 3RC7A 3F47A 1PZGA 4RVHA 2QIOA 4NHEA 1DIAA 2J6IA 4WCFC 4KTTE 1U2DA 5JNLA 2GCGA 2I9PA 4HFNA 4MVJD 4XZ3A 5DDIP 3ZU5A 1CERA 4GI2A 2POQX 3AW9A 5DF1A 3C1OA 5A9RA 3ZNNA 4BNNA 4LRTB 5IDQA 1KYQA 1SCUA 1V3TA 3OETA 2B35A 2Q3EA 3Q2KA 4LISA 2ZCVA 1VL8A 1P1FA 2Y1DA 3S8MA 1RM3A 3PFWO 4WLEA 4QFCA 4I9NA 2W4QA 5JMWA 2EKPA 2BF7A 2X58A 3VH4A 2GNAA 4YRDA 3AY7A 4RO0A 1KY4A 2UAGA 4OKNA 3ZWVA 1Y8RB 1R37A 2JD2A 3GEDA 4U0KA 3TDKA 3P5SA 3ZW8A 3HFSA 3PQDA 4EJMA 3ZU3A 1PTJA 3GDGA 1EFLA 4URFA 3T7EA 3X2EA 1DFHA 4CMGA 1CQJA 5A04A 1TT7A 2Z1MA 5F1KA 2DBQA 1NAIA 5LDHA 3DBHB 3JQ9C 3ITDA 5TC4A 4AJ2A 3QRWA 1HDYA 1NQTA 4PFJA 4B4OA 5IG2A 5KVCA 1Y8RA 1YBAA 1JA9A 3AFNA 1HE2A 3ASVA 5JDCC 4RJTA 3V2GA 1SB9A 1K89A 3HUDA 1EK6A 4CMCA 4C7KA 5L4LA 4N54A 4QO7A 2X9VA 3VTZA 4DL9A 1NTOA 1LQUA 3PRJA 3DBHA 1VKOA 1T2DA 3FRJA 3JQFA 1NM5A 4MVJE 2HCTA 1ZIDA 2PKQO 1A9YA 2FHSA 3KSZO 1GCOA 2JCXA 3PHLA 4NNJA 3H4VA 1CIVA 2HK8A 3E9QA 4BKRA 1XIVA 3EGOA 5TT1A 3UVEA 3C8MA 4NBVA 3ZHXA 1LLDA 1EFKA 1PJBA 1Z74A 3NRCA 1MV8A 4A0SA 4BS9A 4E31A 4PZDA 4E32A 4P4LA 4AJJA 1V3VA 5JAZA 1V6AA 1WXDA 2BI7A 5EINA 3LC1O 2FPIA 2X86A 3JQBC 1HZZA 1T4DA 1H9AA 2YV2A 1LC3A 1PX0A 4TQGA 4XGKA 2V7PA 4LMRA 1Z7BA 2VTDA 4RCVA 1L7EA 5EMHA 2CY0A 2VNSA 4Z9XA 1BWSA 5B4VA 5G0TA 1E7QA 1QRRA 2VT3A 1LI4A 1NBOA 4IGFA 1VE9A 5EQDA 3I9MA 4OIMA 1B0AA 3BMOA 2A92A 1Z6ZA 3IMFA 4D3DA 1PL7A 3HB5X 5COQA 3KYCB 1PU2A 4C4OA 5K6AA 1O9BA 1EBUA 4OM8A 1DXYA 1XG5A 3D64A 3MJ4A 2QYTA 1YGYA 3U4IA 4KZPA 5TSDA 3W8EA 3I9OA 1LNQA 2X0IA 4PLWA 1XKQA 3H2SA 1UAGA 4GSKA 5FF9A 4EJ0A 3ENNA 2I67A 1E3JA 1XDWA 4YBZA 3EZLA 4JQCA 3M2PA 4H15A 1DJQA 3UN1A 4UVIA 1ISGA 2X7HA 3BA1A 2Q2VA 2EHDA 2J3JA 1EVYA 3WDSA 2R2GA 1ID1A 1N2SA 2QQ5A 3WYCA 1R15A 4CL8A 4AJHA 4PZCA 4MJLA 3KSDO 5TNXA 1ISJA 2GF2A 3GN2A 4ND5A 1V0JA 4Y6PA 2Y99A 4OOEA 3GUCA 5BNFA 1G0OA 4OKIA 1YQXA 1X1EA 2G76A 3TL3A 4PRLA 3C7AA 4N5MA 3M6IA 3GR6A 3ONEA 4NZ9A 4J0FA 3FF4A 4CV1A 2DT5A 2IRWA 1SPXA 2LDXA 3PWZA 1BVUA 1F12A 1OMOA 4MIEA 2H9IA 4I8XA 4D46A 4J7CA 3U4CA 1CYDA 1DRWA 4BB5A 4HWKA 4J0EA 1ZK0A 2NACA 2WWRA 1GYQA 3L77A 2WE7A 2JD1A 4FSHA 4OL9A 4Q3DA 3KYBA 2PD4A 1EBFA 1T24A 5JYDA 3AUTA 1X14A 4I1IA 4E6PA 1U3WA 3DZGA 5T5QA 1ZK2A 3GG2A 2P68A 2P5YA 2RCYA 2B37A 2Y1FA 1X1TA 1RWBA 3TSCA 3WGZA 4W82A 3PK0A 4LSMA 1EUDA 1EDOA 4YB8A 1FK8A 4CV3A 4MIYA 4DRYA 3FNGA 4CM4B 1P31A 3B6ZA 3SJ7A 2HMSA 4PG8A 3H7AA 2BHLA 2FPPA 1FDVA 3RBZA 3WTBA 4LMPA 4O0LA 4CR8A 1E3SA 1UP6A 3WIDA 4FJ1A 2WYWA 1QYVA 3S2EA 1PZEA 1M76A 4YJDA 7MDHA 3GNQA 4L4SA 1E6UA 3DHEA 4RVSA 1U4SA 4KMSA 3EUWA 2Q46A 4D45A 2C2XA 3AWDA 1NPDA 4CLXA 2EIHA 2IXAA 1PL6A 2Q2QA 4IJWA 5AXDA 5F1OA 3U4DA 8ADHA 5DN9A 4DC1A 5IXSA 1MGOA 4AJLA 3WB9A 2C59A 4YAKA 4AJ1A 3W4IA 3OEWA 4RF5A 3VKVA 1MXHA 3U62A 4FDAA 4WOKA 2ZB7A 3D3EA 3PFFA 4JJIA 4BO7A 2XAAA 1MC4A 2NV6A 3OJFA 4YAJA 3WGQA 4R41A 1MFZA 1WZIA 3CE6A 4J1SA 2AE2A 3WGIA 3HE3A 1NNUA 1IYZA 1DLIA 4ZICA 1C0KA 2BELA 1ENOA 3LK7A 1PJTA 1DJNA 4UUMA 4WLUA 4N5NA 4ZQFA 1ZO8A 4JCOA 3C7DB 3I83A 5JC8A 5CFZA 3E03A 2DKNA 3EHEA 3OEYA 4ALKA 2HU2A 1ADGA 3VOSA 4J2OA 3AI3A 2V6FA 1JLLA 3HWRA 1KETA 1OAAA 1PQPA 2B4RO 1Z73A 2O23A 2ZQYA 4Z0HO 2O3QA 3A4VA 2CVZA 3C24A 4L0QA 1PS8A 2H1SA 3INRA 1U3VA 4RPHA 1P0FA 2GPTA 3BHMA 1DO8A 4UAGA 1B2LA 1ONPA 2VWQA 3HFGA 1PJSA 1BDMA 1M67A 1HLDA 1WNTA 1E6WA 3MOIA 5A4DA 2D5CA 1Q7CA 1N1EA 2C0CA 1FF9A 3C85A 4XB2A 3GVPA 3OJOA 4IJUA 3FSRA 3WGTA 1HDOA 4AJ4A 2JHGA 3D0OA 1Q2XA 4BB6A 4WOJA 1XWFA 3RJ5A 1JWAB 5DP1A 5L7YA 1DC4A 4BHTA 3E9MA 3HADA 4ZQEA 2FSSA 3KLPX 4U7WA 4L76A 1UR5A 5I8ZA 4RORA 3I6IA 1NQAO 1PL8A 4J49A 2IZ1A 5ICSA 1QP8A 3TF5A 4BNZA 3HZZA 5GZ3A 1GV1A 1ADBA 1Q7BA 2Y05A 4GH5A 1HRDA 4XR4A 3DHYA 4NPCA 1Y8QB 1TB4A 2NU7A 2BH9A 2HK7A 2PR2A 3RFVA 4BO6A 1DFIA 2VNAA 4R69A 4CMIB 1ZSNA 1Y6JA 1KS9A 1E77A 4MDHA 1U2GA 3ZGYA 4Z0TA 1DIRA 1XLTA 1LUAA 2VOEA 5EERA 3WOHA 4BNHA 3H9GA 4IZIA 3H5AA 4LW8A 1C1DB 3N7UA 4RF3A 4CR7A 2FP4A 2VZ8A 1E7RA 4DPLA 1N1GA 3ZNOA 1T4BA 1Y8QA 4RVGA 2D59A 2ZB8A 4X54A 4GWKA 3MZ0A 4E5KA 1PSDA 1B15A 1H94A 1I36A 1BRMA 2VUTA 5A02A 3PIDA 2YDYA 3BMNB 1P74A 1DIHA 5KVVA 3O9ZA 5T6BA 1C1DA 1RJWA 3GQVA 1YQDA 4K9DA 3WS7A 3PQFA 3QW2A 4BV9A 4MINA 1JKIA 2O3JA 2B5WA 1P1HA 3VH2A 2PKQP 4Z6KA 4CLRB 3FR7A 3EAGA 3JYPA 3E18A 1R0KA 1LDGA 2BFAA 2XXJA 1MFPA 1QMGA 2G17A 4Y67A 3ZWWA 4BO4A 3I4FA 5CEJA 1FMCA 3BMNA 1NX6A 2D0IA 3RFXA 3CXRA 3QVOA 4BO2A 4DLAA 3JQ8B 3ANLA 5JO9A 3GPDG 5K9ZA 6LDHA 1NVMB 4GX5A 2IZZA 3O38A 4OYRA 4YEDA 1Q0HA 1QYCA 2BRUA 3RUFA 3X2FA 1OI7A 3MCVA 1DAPA 4II2A 1WMAA 3F46A 2X5OA 2P9CA 3DL2A 4QT0A 4YTEA 5JY1A 2H6EA 1LDEA 4TVBA 2Y66A 3DEYX 3K30A 4HFJA 3RU9A 4HNHA 3AOEC 3DBVO 3O8QB 1XU9A 1PJ3A 1GD1O 4A7PA 4B4WA 1ZKMA 5JCJD 3AU9A 4J1TA 3JQ8A 4CV0A 2UUPA 1IPFA 1U5AA 2Z1NA 4ND3A 1M66A 5F1PA 3NYWA 1E6EA 5KJEA 1N92A 4J9UE 2Q1SA 2EERA 2OORA 2VT2A 5B37A 3BTUA 1KEVA 4RPKA 3C1TA 3GY0A 3OICA 1A4IA 1HEUA 3CEAA 3JQCA 3ORFA 3F4LA 2GN6A 3DWFA 2NQTA 1YDEA 1ZXLA 3WNQA 1TI7A 3KTDA 5CPBA 5I9NA 2X4GA 3JQ7B 5DT9A 2X0RA 2Y1OA 3DOJA 3MJSA 1Q1NA 3T4EA 2OXIA 3G79A 4FOSA 3DOOA 5AOVA 2GDZA 1Y9EA 3P19A 4CMHA 3E1KA 5C7OO 1WP4A 2YHIB 5IZCA 1FDWA 1ISMA 4ZQGA 2B0JA 1BHSA 2B4QA 3FBGA 4I5DA 1IPEA 4BGUA 3GT0A 5CDGA 4BQRA 2Y1CA 3JQ7A 3U3XA 4W9NC 1ADCA 1TT5A 1X7HA 3DMYA 4EITA 2FR1A 1Q7GA 2CF5A 3AM5A 2ZTLA 1DB3A 4YCAA 4EEXA 1B7GO 4K6FA 1NASA 3WIEA 2P2SA 2CD9A 1KY5A 1HXHA 4FJ2A 3W8DA 4Z3DA 3RUAA 3AI2A 4IJVA 2YHIA 5CG1A 5I9LA 3GRPA 3DTTA 3OJ0A 4GMGA 2VYVD 2ET6A 1JN0A 1NR7A 2HQ1A 3ZNPA 1U8FO 3LT0A 2DM6A 3CKYA 2O2YA 2IDZA 4LCJA 1B8PA 4CMJA 2C54A 2DLDA 2NVUB 1JU9A 1ZXBA 4XIYA 3E48A 4G81A 3NX4A 4E2YA 3PI7A 4S3MA 4D79A 2AQ8A 4CMEC 5JSFA 5C7IO 2BFPA 4PG5A 3TNLA 4CM7A 4E4YA 2PD3A 2J3KA 1DRUA 2FRDA 3PYLA 1P77A 1KVUA 2AHRA 2HRZA 3KRTA 4UUPA 3ZWOA 4DBZA 5T57A 5CPFA 4EYEA 3JQEA 2A35A 3H9JA 3RU7A 5AXAA 3CSDA 3FI9A 1OBFO 2CSUA 2PZMA 1R16A 3JD2A 1UP4A 2JCYA 2R00A 3OQ1A 1W8DA 4ID9A 3GEGA 3AUAA 2FPGA 3GMDA 3LLSA 5I7SA 1T2EA 2EJWA 1FJHA 1GEEA 4IUYA 1OFGA 5LDGA 4W7IA 1PWXA 1G6KA 4RF2A 4CJXA 4TRMA 4RPGA 4R01A 1GPJA 4Q3EA 3FHLA 1HL3A 1I3LA 3K92A 3NJ4A 4OHUA 1I32A 1NXQA 1LU9A 1IE3A 4YAGA 5BSGA 4IM7A 4MVJA 4R1NA 3CTMA 1B3RA 3GK3A 2PKRA 2X0JA 2PY6A 2W2KB 2NVWA 4KDFA 3IDSA 4DUPA 3IS3A 3NDJA 3MWEB 1HE4A 1E7MA 1E1NA 2RBEA 1NP3A 3LT2A 1DPGA 3L6EA 3GGPA 1ZMOA 4WNCA 1DC5A 3ON5A 3PQEA 2C7VA 2BFOA 2ZKLA 3QQPA 3UXYA 4TRNA 2JL1A 5TRTA 2V6GA 4CLOB 4DVJA 4J43A 2P4HX 1ZUD1 2O4CA 1V9LA 4LRSB 5GY7A 2X5KO 4WCFB 5IAAA 5BNTA 4HV4A 4D3FA 3GVXA 1GQQA 4IJKA 1M75A 3KO8A 3WQSB 1UZNA 4D3SA 2Q1WA 4IIUA 2GN8A 2PTGA 4Y6SA 3JQAD 5JS6A 3I23A 4TKLA 1GEGA 3Q3CA 1D8AA 1ZSYA 1YO6A 3ZDFA 3NDIA 5HWSA 3QVSA 4WCFA 2VWGA 1CRWG 3QA9A 2YJZA 4R1TA 1NR1A 4KQWA 3PLNA 5EQFA 1WDKA 4IBOA 4JJGA 3IIEA 4O63O 1GAEO 3WSVA 1PQWA 3IUPA 4GX1A 4F3YA 2A9FA 2NUAA 2GZ2A 5T64A 1JQBA 1QORA 1LTHR 1N5DA 3GG9A 1LSSA 4UVDA 4AG3A 4TZTA 3ZHBA 1O89A 4YQYA 1CDOA
chains in the Genus database with same CATH superfamily
3WO0A 3VZBA 3PHHA 4QNNA 4L5CA 1A5SB 1T8UA 2B30A 1MPTA 2ZYTX 1IEVA 2I54A 4DDVA 1YRYE 4ZVVA 5EUMA 5F4ZA 4DLWA 3E84A 3LKDA 4TT8A 4C0BA 4G0PA 3IQWA 3PJFA 4P7BA 4YYEA 4C4ZA 2XYGA 4EO7A 2RE8A 4HLUC 1DE0A 1Z4NA 3S55A 5DX1A 3T7IA 4DHWA 2K6GA 1RPAA 3ND8A 3O3CA 1C0EA 4GG1A 6ADHA 2IWRA 5J5CA 3VC3A 1S2DA 3NPAA 3UBMA 3MK31 2V3WA 3BXPA 5A6SB 4FONA 3AYZB 3STVA 4QM7A 1HOXA 3EGDA 1ADFA 1T1EA 4J0QA 2PKXA 3OCXA 4N18A 1GPUA 3S0JA 2CXXA 4BZQA 2OBBA 3H1GA 4F46A 4HRXA 2OD9A 1JUDA 4QJ5A 2SICE 4YRCA 2C2YA 3F6YA 3LVRE 3JWGA 5EESA 3SZRA 4HB3A 1AGYA 1XZDA 3AV0B 1R6UA 1GUZA 5BV0A 1B6SA 1LPAB 2ABWA 1A5TA 3ORQA 1K7SN 4FM9A 1DAFA 1OTYA 3IPXA 3NTRA 2PU5A 4BBJA 4MDEA 2C8KA 1AG9A 1YRAA 4XWKA 5A6SA 1VB3A 3TAHA 1ZD9A 2XRZA 1Z75A 3G8AA 2A9VA 3LUAA 5IDYA 2IYQA 3X1MA 2AVDA 1Y6GA 5JZSA 3KBOA 4FQ5A 1ZD3A 2Q6KA 4G8JA 4RTLA 2DR0A 2PBFA 1KYVA 1PLKA 1ZZEA 3Q1LA 4K6CA 3B1JA 4P0PB 1QGED 2ZT5A 1XN4A 1QHEA 1KORA 4KXWA 4N7MA 4H1WA 1M7HA 1GNLA 3W7VA 3VO2A 3GRRA 2RB5A 2VC2B 4UFOA 1FXSA 1R66A 1TLLA 1L7PA 3E9RA 1RSZA 1IY2A 2WJVA 4YRRA 3UJHA 4EO9A 2QKYA 2W37A 4BEBA 5H16A 3HGQA 3GMSA 1PJZA 2NV2B 2ON6A 4GICA 5DCWA 4M87A 2RONA 1ZISA 1KIMA 1JHMA 2X77A 3IA7A 4R4JA 3BE4A 1ZOLA 3K05A 1TZJA 4MVJF 1V9CA 5HJEA 5IWAB 3MGKA 2QTHA 3WLPA 1GN8A 1JDNA 4S35A 1BN7A 1V5IA 5L7WA 1IN7A 2V7QA 4OHYA 3OE1A 3ROXA 1P4AA 3HDJA 4M76B 4OGLA 4YVFA 5KDDA 5L45A 2JJ1D 2ZBPA 2QE6A 4GGOA 5JBQA 2XOKD 3I34X 2RGNC 4J3JA 2IBSA 1UIMA 4FYVA 3BMOB 1PBTA 3NT5A 1RJDA 3ND6A 3L79A 4P4TA 2XWPA 3JVDA 1PE0A 5HBRA 3MMXA 3W8FA 3LTNC 1LD3A 1LI5A 1WPXA 1EIZA 2PUHA 3KU1A 4UMFA 4ZVUA 1KR5A 1ZH0A 2ZIEA 5E3IA 4DARA 2E37A 4JLVA 4B3MB 1YKGA 3ZWCA 1FIUA 2QIPA 1L5RA 1ZPDA 1HG1A 3DZHA 1Y6ZA 2CVQA 2EBHX 4P83A 2IU0A 5GZ1A 5J58A 4WKOA 1B41A 2F1OA 1QYXA 2GVNA 3IMGA 3RANA 2R1VB 3AHIA 1PFGA 3NWBA 4V02A 3HQ4O 2DMRA 1AXGA 1D4FA 3QX7A 1MJ5A 2GM5A 4Q3BA 4U9IS 4XASA 2E1RA 4U6SA 3G2NA 3X1YA 5BUZA 4MEJA 3C74A 5B3AA 1PUJA 1EHIA 3KXLA 3MGGA 4P3KA 5U4XA 5AI0A 4K26A 3ORHA 3IURA 5KCZA 2R5FA 4C4AA 4S05A 1W581 4H60A 1IDN1 5D87A 4UXJA 2OC4A 3B1KA 5D6OA 1GCGA 4EENA 3WWPA 2Q49A 2XSZD 4IHJB 4Q7LA 1RJ9B 1L5QA 1TF2A 1OVGA 1U9IC 2Q5JA 2R1VA 3RQSA 1IL0A 1QHGA 4BP9A 1DC3A 3FWZA 2YCLA 4PZ9A 1JZSA 4UUBA 1B8VA 5JE8A 3ZU6A 3VYSB 1T4MA 2ZUVA 4KQHA 4BOYA 1CDDA 1EH5A 421PA 1UADA 2X6QA 4WL0A 3AUXA 3J7AC 1ZJ5A 2UYQA 4C3OB 3IAHA 4F4JA 4N4AA 2P9JA 1V8DA 1J00A 3TKAA 2PJUA 4ILKA 3U3DA 3L49A 1RWNA 4DMMA 4D57A 2EFHB 1RWWA 4IHJA 1RJ9A 5K0EA 2OC9A 5LZ9A 3OIDA 4BNIA 3VKGA 1HZZC 3Q7EA 1IBSA 1R3UA 3ASUA 1YDGA 4PNZA 3I62A 1PNTA 3HCDA 4RVCA 3GVIA 4Z86A 3S7ZA 2XWSA 4D9NA 5DBGA 1ABBA 3VYRB 1AS3A 3O84A 4H3KB 3V1KA 2CXNA 4NNOA 4GPD1 4GZMA 1JHXA 3VOAA 1XMQB 1F8YA 2QTMA 3DLIA 2MYTA 4L8FA 2D0DA 2WF8A 4M0UA 5DM4A 3RC3A 2IYXA 1HQCA 2ECKA 3L9XA 4DNOA 2YQ5A 3A3OA 4EWLA 1K6JA 3E7WA 4ALNA 5J9FA 4EARA 4XDZA 1QRDA 4ZVKA 3TMAA 1S7GA 4O25A 1RHKA 4NV0A 2QYSA 3EH2A 1YZYA 4CR6A 1M33A 1U80A 4B5KA 3CRNA 2GXQA 4LI0A 3ZLVA 2GHQA 1MORA 3DFZA 4M1EA 1CC1S 5B2FA 1ECCA 1XMPA 1R0XA 1BGWA 3RSZA 2DE0X 2X5JO 2G80A 3D3WA 5FTNA 4XLTA 3QEMB 4Q48A 5JROA 4TLLB 3QX3A 3UFBA 5K0ZA 3PU6A 5ENDA 1KBQA 2FWJA 2XGSA 4LVOA 5JXWA 3TBKA 1NT4A 1PJAA 2O5VA 1Y5NA 2V54A 3P0RA 4LGCA 5CFNA 3DFFA 1QR2A 2PGJA 3EG9B 1WTAA 4K03A 3IEMA 4G0QA 3FDZB 2ZTMA 3LGAA 4B81A 3C97A 2QXUA 2PZ8A 3DMTC 3C3PA 1QFZA 3VAAA 4U9UA 1CETA 4DLLA 5K8UA 5BRJA 4IMJB 1KJZA 1OPXA 3VR6A 4S2EA 1VE5A 3WWOA 5KJCA 5U9CA 5J23A 2CVOA 3L6DA 1Z5UA 2WU0A 4LWQA 3S5UA 1QX3A 3QEMA 3OFJA 2VK4A 5KEIA 1CK4A 3A3NA 4MOWA 3VKWA 1J7KA 1EHYA 4BZPA 1LLQA 4MS4B 5AVOA 4Q7QA 4YR9A 1HYQA 2ST1A 3ABZA 5EZSA 5KOYA 2CKDA 2ZJBA 3VOTA 3S81A 4TTTS 4F85A 4D0SA 2LV8A 1GTMA 1P1CA 1TMGE 3EG9A 2DWCA 3OMWA 1C3LA 1WR8A 3FDZA 3T7AA 4N5IX 5JTUA 5BN3B 1H2RS 1E6LA 3VPGA 1MRNA 2QJOA 4Q05A 2ZUUA 2OHGA 1VBNA 3M0EA 4J9VA 1KYXA 2JG3A 5L3VA 4H0CA 3JQGA 1F8FA 2XA1A 2XB6A 4PO1A 3H04A 3WRXC 3V33A 1IMOA 2GBCA 3IPCA 4YA6A 1ZI8A 2OFXA 2QZJA 4HWOA 3HNRA 1D0SA 1F9AA 3R4CA 3H4MA 4DKXA 4BLVA 5AVZA 1ZK4A 4NU5A 4MYCA 4UD6A 1JLSA 2YJ3A 1MVNA 4N0DA 4NYIQ 3SBDA 1I1OA 3HJGA 2FN8A 5DGTA 1W5TA 2DWOA 4CMAA 1LLFA 2ANCA 3FNHA 1T0JB 5GTDA 3AIOA 1XZHA 1K8YB 1CRLA 5CA0B 2AI1A 1KH3A 2Y1KA 1MG5A 3CUWA 5HKLA 2H4JA 1L5LA 3V5NA 2JGNA 1POWA 3JD4A 3M1IA 4BWVA 2CUZA 2J48A 4HAOA 4JUDX 4OU4A 3KKKA 2ZRJA 3I01M 4AF8A 4JXJA 1PFKA 2CXTA 2WABA 3CRVA 5KC9A 1NLUA 1FTQA 4ZEVA 4LWOA 4YACA 4JOBA 1OWMA 1ZMTA 3UK1A 1FYDA 3VPDA 1CY8A 2C83A 2PU7A 4H77A 2Q6VA 1FRQA 3CX7A 3GO4A 4CM8B 3B36A 2PM8A 1GQYA 2R6GA 2HPHA 3RWOA 2B61A 3WYDA 2QM0A 2NU9B 4RL4A 3D9QX 3SFVA 5BMVA 4QZVA 1GU1A 2BGUA 5CA0A 1IZ8A 1MT0A 5C34B 2VPQA 3UHOA 3DWGA 3MB8A 5AQ1A 3O21A 1PT6A 3HRIA 3HKBA 1UBSB 1BJRE 3I2JA 4J3NA 2A9QA 5HUQA 1PT8A 4MR9B 4NICA 4QUKA 4OUKX 1AB5A 4CN9A 2F2TA 3BD9A 2DZDA 3R6WA 1WIWA 4GGPA 4NMWA 3HBAA 4OJKA 1Q6YA 3TW4A 4KREA 4BNUA 1GZHB 2WZCA 4WKPA 3KELA 4K88A 4BTLA 3KLMX 3JVIA 1RQXA 2GYWA 4CM8A 3REGA 4YCLA 5BQFA 2I4TA 4KO8A 2E85A 4P31A 1JIIA 1ZK3A 2NU9A 3IDQA 3VGJA 5EIXA 1BE0A 1QJCA 1MT3A 1PHRA 3PHCA 2ZTUA 3RS2A 3A6LA 3TIFA 2FZWA 1USVA 5LUBA 5FWNA 1CUEA 1H69A 1WY7A 1FNSA 1Z7GA 3IQDB 4MR9A 2OGWA 2L19A 5EIOA 4U7TB 3DFUA 3DO5A 1G19A 1UDBA 3TQSA 5C5CA 1YBVA 1NW3A 2ZM6B 1XEAA 3GCGA 3RVMA 3T0GA 2IVZA 2DOKA 4Y98A 3AHEA 3DEIA 2D7DA 5JSKA 2BMWA 1ZM3A 5ENZA 1XMOB 2ZKIA 2XUZA 5AJXA 5ERGB 3HN2A 1TTPB 1GAQA 1U0JA 4HQKA 4QOFA 2CV2A 1MW9X 3D6JA 4Y9DA 1O95C 2WAYA 2H92A 3L7NA 5ADVA 5KWJA 1C3VA 1GGMA 4CU2A 2V5UA 4RQTA 4UTOA 3A4LA 3VVCA 4J6EA 4RYDA 2O8DB 3HCNA 4NG4A 3RVDA 3FPKA 1M5TA 3MLBA 1HZJA 5AVYA 3VDRA 1W96A 7AT1A 3T3IA 1QGAA 4JLNA 2RK3A 5ENVA 3COWA 3GNLA 1GUFA 1TA4A 1Z0KA 3HUUA 5EHIA 5JCJA 1IY9A 4ZI7B 1F1JA 5KYGA 3FMFA 1QAQA 2EVWX 2Z4TA 4PSVA 3TIIA 2P2ZA 2BN4A 4DVGA 1SWVA 1X1AA 4FFMA 1DEAA 4IS3A 3HB0A 4NBTA 3DZJA 2QSYA 4ALJA 1XTZA 1UK7A 4ZFNA 1XQ6A 4KFCA 5I7EA 3E3MA 2W4MA 1GZ5A 3K6JA 3LW7A 1M7GA 4UMVA 3TZKA 4DYDA 2LCFA 1ZU4A 1YQWA 4MWZA 5ALMA 1MBZA 1P81A 1VCHA 1AQ6A 2E4XA 3UHAA 4NJOA 2YWCA 1PR9A 2GUGA 1UBCA 3V6LA 1OYWA 2IK8A 3BWYA 3CLTD 3EDOA 1E6CA 4RVOA 4ZI7A 2WF6A 2FEXA 1RP1A 4HO1X 1E4VA 1KC3A 1O4VA 1PJ4A 2A9JA 4W8HA 5G0SA 2FWPA 4PHCA 4NFHA 1CNFA 4BB0A 1W5FA 3GD7A 2O1XA 2NSLA 2ZJ1A 3F3SA 3IV9A 4HQOA 4K6HA 5TPWA 1O95D 3EW9A 3I42A 4FW8A 2JVIA 4FYWA 4HQRA 4LUCA 3CF4G 5EP3A 2AFVA 1LK0A 1DDGA 5EHZA 1E9RA 3NT2A 4AULA 1WQ4A 2A7XA 2BFCB 2FQYA 2H1WA 1T6XA 3P9NA 4A03A 1BSVA 3S6JA 4AUMA 8GPBA 4MUFA 4PTYA 5J40A 1SUWA 1E2QA 1SIUA 3D02A 2Q3HA 4WX2B 4DDHA 1USUA 4JUIA 5FA8A 4F9GA 1QGOA 4W5JA 5I01A 1SCQA 2I2AA 5G1PA 3SVTA 3A14A 1E1CB 3EZ9A 4K6GA 3NIDB 4DRZA 2Q1TA 3QVVA 3E70C 1SQFA 4IDBA 1F38A 2XUGA 2ONZA 5K8CA 2JATA 1C9DB 1OFVA 4HFMA 4FWIB 1C41A 1U2GC 2CEAA 4MCJA 4OMDA 2BFCA 2WF5A 2JH9A 3DT6A 1K3TA 2ENUA 4IDOA 1NE7A 4PZYA 4Q24A 3S44A 1UJ4A 1T4CB 1O8BA 2CXQA 5K7SA 1H9BA 1TKAA 3IE2A 4RPCA 5JALA 4FVTA 4OMUA 4JJKA 4X85A 6YASA 2HNAA 1QU3A 1E1CA 3PNBA 3T06B 4ZHQF 4RLQA 2QI9F 3LXMA 2VK8A 1DKRA 2AYXA 4EF6A 3GP8A 3U60B 1YL6A 2VCYA 2YJ4A 3ABQB 4G5YA 2FRXA 4LNUA 3R5FA 1HEYA 4PM4A 2G36A 2PFGA 1LPNA 3T5CA 3QBEA 4Z0PA 1OJ7A 4FS3A 2GZ3A 3ZDZB 1T4CA 1TEHA 4DRXA 1EQUA 5GINE 2DR3A 1FFCA 4YQFA 3NHAA 1ZG3A 4I9UA 5AM0A 3KKOA 1P9LA 5BSUA 3U7JA 4C5AA 4EFNA 1EXVA 1P18A 4M1QA 3EJWA 1J5PA 2ZIAA 2H2DA 3OM9A 5THXA 1QV9A 3EIXA 3M89A 1MX3A 1UJBA 1QCYA 2E4YA 1E2UA 3BB4A 3OO1A 6CHYA 4LJ6A 1PT9A 4CCWA 1ACLA 5B12A 1U6KA 3AF3A 4LSWA 2R6R1 3ODGA 5F76A 1Y98A 1NBAA 5J2TA 3NZEA 3PTLA 3RFUA 4I6EA 2I2DA 1L5VA 5D00A 1JP7A 2LIVA 3EGEA 4B2PA 1WUTA 2ZAYA 3KR0A 1LRKA 5JAOA 3VZQA 4OHWA 4YCBA 5A62A 4LRQA 3N7AA 3OSZA 5CNIA 1T8TA 3PPXA 1IN8A 1RYEA 4Q9KA 1U9YA 2R8ZA 4WJLA 4MVJP 4YR7A 1QE5A 3TNFA 1LDBA 2OG1A 2RHHA 2Z3VA 3A10A 3LCUA 4YK7A 4Y2UA 1FL9A 2CB9A 3GEPA 3K2QA 3M5PA 3ORYA 4L73A 4TTSA 5ESXA 4QOHA 3UKDA 3ZDAA 3F6SA 3NKLA 2CWDA 4RLHA 4BU1A 3V8EA 1CG6A 2G1JA 3BQ9A 1KKLA 3JQPA 4HADA 3TQHA 2PH3A 1Q50A 3ONDA 1SUPA 1NONA 4EZBA 1N6HA 1NULA 3HXTA 1FU4A 1SHZA 1C4OA 2COEA 2TMGA 1Y33E 4OJQA 2PKEA 4AX8A 1G38A 2Q3MA 3QVMA 3QYFA 4R3NA 4D97A 1KPHA 2VPWA 2ZI7A 4FMCF 3LDHA 3H3FA 1TD9A 3KOMA 2XUJA 2ISCA 1XPUA 3RHTA 1P5ZB 1W49A 2Q27A 3T1VA 4TSFD 4HPXB 4OAOA 4UVEA 3FWNA 2G88A 3M5CA 5G1NA 4B6PA 3ZHZA 3BHJA 3CNLA 4EGJA 4Z1MD 5I7VA 1DTSA 1M0EA 1UBUS 3K8YA 1UF9A 3FNFA 4O33A 1P1IA 3SIWA 4EYSA 1SZJG 1SB8A 1UWCA 2C5FA 5JNUA 1IQUA 3LT4A 2PQ6A 4QDXA 4PSUA 3EMBA 1MTZA 3R23A 3CJTA 2FWMX 4PX3A 1VA5A 5LQMA 1HYEA 1N3BA 3I2HA 4REOA 4CFZA 5KSOA 3EVTA 5CB0A 4A0QA 2ZRIA 1EZZA 3JWJA 2YXDA 3KT0A 3RBXA 2H65A 2JFZA 4DDKA 3BZUA 3INYA 3VSAA 3WDLA 3NKVA 3PG5A 1AF4A 4LJRA 1I33A 2IP1A 4J0IA 3A4MA 4ND2A 4HX2A 3IILA 1PFYA 3PX2A 1QYWA 2EJCA 4U7GA 1KDRA 2QQGA 3NWOA 2NU6B 1S9HA 2ZSEA 1VL1A 1F6DA 1XWWA 2JI8A 2Z08A 1JKMA 2HMTA 3RVBA 1X7XB 2JGJA 3FB4A 2CFIA 4NHOA 2C92A 1UDAA 4LNHA 5GV8A 4KO3S 3DM5A 3QEAZ 1HDCA 1K75A 5J4YA 1PGQA 2GASA 2R8BA 4J0GA 4HLDA 2BIFA 2BTOA 3R3SA 3VNVA 1N8TA 3Q8LA 1NL3A 3RG8A 3WICA 4ZZ0A 1GNRA 2JH8A 3U09A 5CFLA 1VPVA 1Q84A 4ZWNA 4ZCQA 3JAMA 4HVLA 1PV4A 3IVAA 1DTEA 3NBQA 4O4JA 2NU6A 1G64A 1K7FB 4URYR 5LKRA 1KJQA 4EOGA 3D0RA 3W4JA 5D8DA 1M6HA 5H4HA 1X7XA 5JLJA 1E5XA 2UZ0A 3B1WA 3KKQA 2R7AA 4G1UC 4NBLA 5E2IA 2IH2A 2AJLI 1DX6A 4X44A 4YLYA 2C9MA 3OBBA 1VPDA 5EIEA 4MWTA 1DXOA 3B1XA 5JVDB 3AZQA 5E9AA 4DLBA 2I4IA 2VDJA 1CS4C 3STTA 4R2XA 4WXHA 3OZDA 2XCQA 1IBLB 3OCZA 4IHAA 3UM9A 5CGZA 4IWNA 2P6OA 4PRYA 3WYFA 1QC5B 1Z2CA 1XTPA 1YQ9A 3EULA 1E1LA 1QH8A 4RKWA 3TSYA 2F1JA 1NWCA 3ZWBA 2XRFA 2Q5QA 1ZJZA 2Q1YA 3JD0A 1GZ7A 4DCSA 2YXPX 5T8KA 1IC6A 2TSYB 4P4SB 5EE5B 5B2ZA 4O59O 4BQOA 2WFMA 3ITNA 1AN0A 2QLBA 3EC2A 3H2BA 5DW3A 3SSAA 3HK2A 2D1TA 1E2LA 2D8MA 2OR3A 3E1GA 4RD3A 1UFQA 2GYYA 3GX1A 4MH0R 1PR3A 3O9MA 1VJ0A 1I0LA 1RJFA 5CUQA 4AWXA 1V6CA 4OUDB 4ZO8A 1YC2A 1XJWA 3SLGA 2OV3A 4ZD6A 4G2TA 3WLEA 4Q1CA 1JMKC 3M1LA 2AXEA 2OGTA 1UPXA 5BYKA 1GCIA 1XJCA 2D5AA 1A98A 3DCIA 4L4RA 1C7FA 4CM6A 4BFVA 3AFOA 2V58A 3ZWXA 5EZYB 1L8AA 2GK7A 4P4SA 2X0FA 3UTCA 2YV1A 5BXQC 4PHHA 5LZ7A 1UH5A 2F48A 3LHIA 1Q57A 3DTVD 4TQAA 4ALLA 2QWXA 4W5RA 1MH9A 4L2IB 1IMJA 1NU8A 2VHXA 4FW9A 3WGOA 3RS7A 5DGDA 2PS9A 1B43A 2QW1A 3AFMA 3GNSA 2PJDA 2IYYA 4O1HA 3R3HA 4OUDA 3OUUA 4TSRA 3GJ8A 3ZY2A 1WZUA 3B89A 3U4GA 1G8SA 1T5LA 3ZBUA 5C3MA 1K86A 2YXNA 4MI9A 1S4MA 2PX6A 3DV0B 3TZCA 5BR7A 2XOKA 3CUEF 4DY4A 1U8XX 2C57A 2GZRA 2PMDA 3IHWA 2R97A 3OFNA 2GETA 3PE6A 1Q19A 3SMVA 1WZEA 3EVNA 1OLOA 1GTJ1 1HT1E 1H65A 3CRQA 4JMLA 1U0BB 1YDWA 5FL7D 1JDUA 1SXIA 2AJDA 2AD1A 3KPJA 4BVGA 1SQ0A 4L2IA 1VCOA 2GLXA 4ERNA 4E12A 4TTJA 2J09A 4YT4A 5JSZA 4J75A 1G98A 1UOOA 2PX8A 3AY0A 3JQ9A 4HB0A 3G8DA 2ZJAA 4NBRA 1U28C 3NC1C 3DV0A 1IUKA 2REQB 4G4IA 2OBFA 3OU6A 2CL7X 3BWBA 4GSLA 4I5EA 4NFSA 1HE3A 4XUGB 2JCVA 4FE3A 4IMRA 1OPRA 1NY5A 4C08A 3PFCA 4CIAA 5CDUA 3BXFA 1EEXB 1CW2B 2IOQA 3C3KA 4EZIA 5G3YA 5BQ5A 4I9HA 5JDCA 2EQBA 4A0GA 4HDAA 1IBCA 2HWUA 4M7WA 5GOTA 4NK4A 5EMNA 1DAHA 2IE8A 3VZDA 3DBRB 4BVBA 3JYQA 1UM8A 4FOPA 1FDTA 2XSZA 4UE6A 3ZUGA 3DW3X 4GSYA 1EVKA 4EJSA 1NAHA 3OX3A 2REQA 4FZ3A 2Q29A 3K32A 5AVTA 3CO0S 4GRDA 4QYXA 5CFOA 1SVOA 1LJ8A 1P19A 4EW6A 4EA7A 1YONA 4RTQA 1MAVA 3HFJA 5IFLA 2RGNA 1G4UR 2FETA 4C4XA 1WQ3A 2ZYVX 2G8NA 1MKYA 4FR5A 4LBWA 2P2NA 3VHLB 4AZVA 4C3UA 4F3CA 3TUZC 1IK6A 3GLHE 1E59A 3LQFA 4KYUA 1YE5A 1IXKA 3DBRA 3EC1A 4HGOA 2HW8A 1PNVA 1T9CA 2OM2A 4Q6BA 1QPZA 3FN4A 1I1QB 3TXAA 3PEWA 1DGQA 3N2YA 3VISA 4UTRA 4ZEMA 5AUNB 2R7NA 2QN6A 5FPTA 5JTTA 1MC1A 1RTKA 4U02A 2QRGA 3O8OB 2YICA 4KQJA 2NO6A 2W8ZA 3LK6A 3WLFA 3QG5A 5FORA 4U7DA 3NALA 3K73O 4YO7A 4RGBA 4GAEA 3K1JA 3KALA 3TRKA 4AJNA 4BZZA 4DLNA 4EAQA 4KV9A 2H1OA 4XUCA 1IZYA 1RIFA 2YZ7A 3C4QA 2XMRA 2XMZA 4FCTA 4L51A 3STHA 4MEBA 4GRAA 2GEFA 4KIWA 4JKIA 4S1VA 4A5SA 4XVCA 4HN9A 1IVSA 1WDWB 4IG4A 3VH3A 4B7UA 4Y2RA 5KVAA 4WXPA 5T4FA 2FG7C 3KUUA 4FCVA 1PLLA 1MU0A 2PT5A 1U9IA 2QENA 4WNYA 3DLPX 1M1YE 5KPDA 1E3QA 4U7JA 3MOSA 1UKEA 3KYDB 3LJKA 5IXYA 1U6JA 4B32A 4QHTA 4A2QA 4DT1B 2VA8A 3PR3A 1HL7A 2CLHB 3DE5X 4DR3B 4B35A 1IN6A 4EB3A 4WIAA 5M29A 4PLVA 4WZAE 4EMSA 3ISTA 1U7PA 3HJNA 2F4VB 4ZRMA 2FJPA 4MPDA 2IIPA 2ZSAA 2ZT8A 2Q07A 4MRRA 5BW6B 1C0PA 2AF4C 3IOYA 2FZEA 2JFFA 2VAPA 4CKYA 1YZHA 2P5UA 2II6A 1RKVA 3DVLA 3IBGA 4D0NA 3HCBA 2DC1A 5A0TA 2Z95A 3KYDA 4AYXA 4I5GA 4DCNA 5J3JA 4DT1A 1Y3DE 1HDXA 3EZ7A 3QSYA 1NHGA 4L7QA 4U2DA 5JXJA 2OAQ1 1D1PA 2GBIA 2AFHE 2I2XB 4MVJM 4BRZA 5BVGA 4PLHA 3SBEA 1NFRA 3SMQA 3Q9NA 4B3DA 4D9KA 3IT0A 1YFJA 4DV3B 2GCOA 1ANKA 3WGLA 3AUUA 1N6RA 5CLHA 3THWB 4I50B 4Y1FA 5DTEA 4DMHA 1JSZA 2HCRA 2LW7A 3BA6A 3K1AB 1KMCA 5EFOA 3RROA 1XFDA 2JARA 4CG1A 2NTVA 3PVCA 4MXDA 1IM2A 4DQKA 4ZCRA 3AETA 4KAFA 3T3HA 4V0SA 3FYSA 1C29B 3NOVA 4HH1A 2HJ9A 3USES 3RSFA 3RS9A 4DJAA 3B3QA 3F9RA 1L4EA 4URHA 3R7BA 1XMVA 4H6XA 1LB1B 4MDYA 4YXFA 2CUNA 5AVXA 5ITZB 1QZTA 3RAJA 3F6CA 3THWA 3ZJ4A 1C9MA 3IAS1 1NSTA 1GL9B 3SSMA 3ZDCA 1MC5A 3DE1X 3RYHB 4C3ZA 5KVSA 3K1AA 3C0KA 2X19A 2GMWA 3GAMA 3I0ZA 1GPWB 3BDIA 4IIYA 3TCNA 2HMAA 1MQSA 2UDPA 5CDYA 1MX5A 3A0UA 3DMTA 5F2KA 4YLEA 4QQFA 4EGQA 3V2HA 4H7JA 4QG7A 1T5TA 2AUNA 2NAFA 4YN3A 1LX6A 5TPZA 4UTPA 2BCEA 1LNZA 2P1ZA 2O5EA 3UJ6A 5ITZA 3EEBA 4C6SA 3C3CA 3NGLA 4DA9A 3CIFA 2F9LA 4GP7A 2UV8A 3U9LA 3FTEA 1RRFA 2L18A 2PMBA 3G0GA 3KEQA 2JAHA 2EFGA 4YRQA 5TF4A 3RYHA 2IPLA 1YMUA 1GTRA 4TV9B 5I7WA 1ESCA 3GQBB 2C07A 4HAIA 2XTZA 1FVXA 2QUHA 4WECA 3RTBA 4M36A 1XQ1A 1GTL1 2W2OA 2FZLA 4FLMA 3TSWA 1IG0A 3I5XA 2BKAA 3RARA 1HRKA 1JA0A 2QLLA 3GRFA 2O2EA 4WLNA 2IEBA 3QWHA 1Q0PA 2VP3A 5FFFA 3GLRA 3SQDA 1LSJA 1NWHA 7MHTA 3OKCA 1CWUA 1UIRA 2QZ9A 3KIPA 3PFHA 4FN4A 2WM3A 3H13A 2JFNA 4AMGA 3I2YX 5K09A 5KWIA 1XDGA 4ZTZB 3GPCA 2EJVA 2BBWA 4MYSA 4TV9A 1EEHA 4XCXA 4XJVA 1UPTA 3H5WA 4LSGA 1YWGO 2QV0A 3GQBA 4BFLA 4D4HA 4DMGA 1WMSA 1TD1A 2R25B 2B5OA 2JAXA 3MQFA 1CJVC 4R7ZA 4D74A 2HSWA 1RXYA 4PGMA 2FQXA 2DWUA 2HHJA 2VF4X 4ZOLB 1DAOA 6AT1A 3DAPA 1B8OA 1YZFA 1ZGJA 1QQAA 1FQOA 4HCJA 2VBCA 2NOAA 4FGKA 4KYIB 1PW5A 1NKTA 4BMPB 4Z53A 1CUAA 1MAAA 5SY6A 3AUJB 3FNIA 4C14A 1FUEA 4KACA 2EZ9A 5A7HA 2G25A 3TNJA 2A5LA 1CB0A 1SFRA 2O2IA 2V7XA 4UJ5A 4EVIA 4JLMA 3WFJA 2P91A 4B84A 5JD5A 3A1EA 3AR6A 3WGYA 4DQXA 4WOBA 4L5AA 5FI3A 4YCCA 2YTZA 3Q9UA 4ZOLA 3NDBB 1CEYA 2MR6A 1FFGA 3M5DA 3WLTA 4PZEA 4KK4A 1P9NA 2OSBA 1R5BA 3AF5A 1G5PA 4A0FA 3R6GA 1U4NA 4NDAA 3IPRA 4GBMA 2AHOA 4MRAA 5CDTA 1HETA 2R62A 5FOQA 4MP8A 2FGJA 1FXWF 2F8MA 4HB4A 1K98A 2WFLA 3ME5A 3UXHA 2O8EB 1BG6A 3F5FA 3DGFC 1X2EA 3PD7A 4JI0B 2PLAA 5FOSA 1W76A 4WD3A 2DTEA 1UXGA 5GZ6A 1QPBA 3P2OA 4K7JA 1WEHA 4CKEA 2GO1A 1FSFA 3EF1A 1CUCA 1WW8A 3EAFA 3A6PC 4MP3A 5KQMA 1NC3A 3DEJA 3LY9A 1M3SA 2I1WA 1A9OA 4IILA 4X20B 2QR3A 5FTWA 3AONB 4RTNA 9LDBA 5KKAA 4O8ZA 2FZVA 4OFXA 1XRJA 3ZLJA 2Z3ZA 3EVEA 5ALLA 1Q15A 5EVCA 4TS4A 5DHFA 1F2DA 2O2CA 3OUTA 3VVBA 2XEXA 1BCRB 5LDDC 2EC5A 1NRXA 3E61A 4N65A 2BEKA 3MMSA 4ROSA 5SV2A 1PQUA 5EJMA 3TBFA 2ERYA 5A3JA 1U6IA 1H4TA 3PUXA 5FI5A 4Z4EA 1NY6A 2O7QA 4E1AA 3L7OA 4U6QA 3NVAA 5F98A 4X20A 2HA2A 4GOND 1YQEA 4CETA 5JY6A 1O95A 1Z8HA 4MI3A 4A73A 5A71A 5DV9A 1JV2B 1NATA 3U5TA 3WP1B 3IEXA 1MEEA 2AF3C 3HWSA 5M7EA 1BDBA 1YJ8A 2YZNA 3I30X 3Q3EA 3ROKA 4AZTA 3KJXA 5BOSB 4NR0A 1BCRA 3VR6H 1BCSB 1NXWA 4KUHA 1ONOA 1JMVA 1Y3BE 2YY6A 1H66A 4R16A 1VE3A 2DQ4A 2RG1A 1IXSB 3RVOA 3ZWYA 4EQZA 2P0EA 4UE3S 4DV1B 1OXMA 3EDQA 3WLNA 4HMQA 2J9RA 2GS9A 1KEZA 2ZRKA 5G4KB 4LF8B 3EIOA 4AAYA 3MTIA 4AY3A 3KETA 4A26A 1EVEA 3L0BA 3ZHRA 1LRLA 1SC3A 4FSDA 1Z39A 2AX3A 2BI4A 2B9VA 2LD4A 3EH1A 2M32A 5ETJA 5GJVC 5TS3A 3SQXA 4DTIA 2EG9A 3JATB 4XQ0A 2A1TS 5AI9A 3ML1A 4JH0A 2M6SA 2Y1LA 5B53A 1R8QA 5BOSA 2RGUA 3CNNA 1JEOA 3MAAC 3C2QA 1J2EA 2QI9C 1UPFA 1BCSA 3ZJ5A 5KNLA 1N5JA 4ZVRA 3ZXIA 1IBKB 4KN5A 3OA2A 1ISRA 2ZTHA 2IXBA 2BFMA 3EIQA 1YIDA 3DMFA 2O2ZA 3OMXA 4WKBA 5DM70 4Y2JA 5G4KA 3ZWAA 3I9JA 3RQIA 4KPEC 1GCUA 1XRPA 2JAPA 2PHZA 3HCAA 1J0CA 1I6WA 1I13A 2J0SA 1A2OA 2YWXA 3KB2A 4EB8A 1V2GA 5F3DA 4B71A 4ZYZA 3CTPA 3TS1A 3JATA 4RHFA 2ISQA 4XWAA 4FC6A 5G0WA 1OA1A 2GKOA 2YUIA 4MKXA 1BKSB 5CT9A 5CIYA 2PGNA 4LY6A 4JVOA 3HYCA 3ODPA 2X3FA 2A2ZA 3GV0A 4G8BA 3C1AA 1NC1A 2RGDA 3IUSA 4GP9A 2MWMA 5BUQA 3NQ41 3SC6A 2BW0A 4MKZA 4UKDA 1TL7C 4RXMA 5H8WA 1A8HA 3KB6A 3SEZA 1Z35A 3TAXA 4KFUA 4A23A 5DM1A 2H1VA 3T38A 3VNUA 2OWDA 3QYJA 5HZGA 2F4NA 1VGQA 2FX3A 3D0KA 4PYOA 3RBVA 2JJ2D 2VYQA 1RPTA 5F77A 2ZULA 4PX9A 4QGAA 5B58C 3T9FA 3ZD9A 3GRAA 1VHQA 5BSEA 3CRRA 4FE7A 4B2LA 4ARCA 2J3IA 1SVUA 3P9XA 4BNKA 4FZVA 4QGFA 1DO0A 2W11A 1RTTA 2X8WA 4EYGA 3I9LA 3A1NA 2H57A 2O7NA 1WDMA 3IEIA 3H5NA 4OEHA 3T7DA 3L04A 4P4NA 2G77B 1HLGA 4DIDA 2O8CB 1GZ4A 2OLKA 1ODLA 4H6PA 4I46A 1AZSC 4X6LA 1UK8A 1DKUA 5J1SB 1R0YA 1V7QA 1ITZA 2AG6A 2ZYGA 4Q4AB 2F3TA 3EXHC 3KHKA 2PAFA 1EX7A 1RBZA 1IJBA 2PGIA 3GF4A 3KVVA 4QDOA 3FR8A 1OWLA 4X8LA 2CCGA 4AKGA 1MUUA 2Y1EA 1U3DA 1JZTA 1W34A 2HPZA 1DG9A 4TTIA 4WKGA 4ZVTA 2DERA 1OXVA 1U9ZA 2QR2A 3QPBA 1T2NA 3LQRA 1X7GA 2VJPA 3R5TA 3BCRA 5LUAA 3L7CA 4D99A 2O8CA 4B8WA 2ZSDA 1JQEA 2REXB 5IDWA 1U9CA 1MN6A 3PFBA 4QTTB 5ILQA 4TSFA 3J81k 3M9XA 2HYDA 4PQGA 3GAZA 2A1IA 1TVKB 4W7HA 2BKLA 3FPFA 1PUIA 1TIBA 3K0EA 5BV1A 4ECAA 1CFZA 2HIMA 3DMDA 5AVUA 3LZ6A 4NL4H 4AP9A 3F74A 3ZE7A 4Q18A 1H93A 2BMDA 2VDWB 5EJ6A 1SOMA 3A04A 3H1PA 4PO8A 2OCGA 2VYNA 1RQ2A 2ZJ4A 4A6EA 4C0KA 2GR9A 2G8LA 4GOJA 4BO3A 4F71A 1BTOA 2EATA 3OX2A 3N2IA 1W19A 3G0IA 5ESDA 5A3VA 4YV1A 4HEJA 3ORRA 4BLUA 1VI2A 3NC0C 3QEKA 1T1GA 3AHHA 5DTJA 2R8YA 3QUBA 1JJAA 4HL6A 3CRZA 4Q3KA 2BMFA 3AERB 3OCVA 5JHHB 2OV2A 4AXXA 4FNMA 1DELA 2CW5A 4QATA 2HCFA 1MA0A 2OHHA 2VKTA 4F2WA 1Q0RA 2VDWA 3IP8A 4P98A 3VOBA 4HYEA 4WFQA 1QNFA 3E23A 3WK4A 1V4NA 1Z2NX 4RV4A 1FDUA 5GMOA 4CQLA 3JSAA 5AVQA 4Y7CA 1ZOOA 5FLEX 4EY7A 2J0QA 5F3RA 1VYTA 5ER9A 3SE7A 2QRKA 3GLUA 3V3KA 4E5NA 2J85A 4IJQA 4HT3B 2FCAA 3C39A 1KE1A 1GL7A 2DX7A 2OKGA 3AERA 4AKTA 3BGIA 3R40A 1MXFA 4E5PA 1R88A 3KWFA 3QKUA 1ST2A 5EXDA 1IZ0A 3P2KA 1SUDA 1QONA 3TM4A 4K9KA 1CUWA 2ZRQA 4PC7A 4PINA 2VP6A 4GW3A 4BYGA 1XP5A 3BXEA 3DYBA 4OGWA 4IO0A 3QBVA 5DIFA 4GLBA 3DAFA 3I76A 1C0IA 1T5IA 3IP6A 4WBSA 3NNDA 1WXFA 2HFKA 2KBFA 5JZBA 3DW1X 1N7HA 4M38A 1FX0B 2B8WA 4WCDA 3V1UA 5LQKA 2AV6A 5CXXA 2RH5A 1T5BA 1YZVA 2NLOA 2OPBA 3UH0A 3UOGA 1E7SA 3V42A 5FR1A 3AEKB 4GLJA 5SICE 2R11A 3KDSE 3KJFA 2QMOA 2I6TA 2MU1A 2LWIA 1EWVA 2JIZA 2WJIA 4NTZA 2XMDA 2NZWA 4RSHA 3WFZA 4C7MA 2XUOA 2XZPA 3DG9A 3EPKA 2HZBA 4PZLA 2FE1A 1GZ6A 5AM2A 3G2LA 4GI5A 3TJMA 4DABA 4I8DA 1YDHA 3TG8A 3DTVB 5HTKA 1JEQA 3Q87B 4BNGA 1BEUB 1FX0A 5CT5A 3I8XA 1TVCA 4GMHA 4ZALA 3GLHB 1TRKA 4LJ4A 3TAUA 4L6AA 4F5DA 4BMNA 5CX4A 3AEKA 1K3FA 2V9PA 4FMBB 4N7BA 4F9EA 1IK4A 4WLOA 2WE8A 3V4ZA 3THRA 1XZGA 4JMPA 5G40A 2OB2A 3N76A 2O3TA 3GYGA 3HJAA 3IEKA 3DP9A 3TW6A 2MT9A 2VPPA 4GXTA 1RHMA 4HQ6A 2ZEJA 1E1MA 1OZ0A 3ONFA 1DEHA 1WU8A 1KZ7B 2J4DA 3AK4A 3CJRA 3FB1A 4D26A 4FIZA 4C9BA 4EDFA 1C30A 3K70D 1KMMA 4IXDA 2QP4A 3E81A 3B12A 3KFXA 1W30A 3BF8A 4N9WA 3K0KA 4RW0A 2JHPA 4EM6A 3OJCA 1EE9A 1V8FA 2FMUA 3ETCA 3OPMA 1VPWA 3BZWA 1VBFA 3IOEA 1W2HA 4DAOA 2WJPA 3UMJA 2IYRA 5CM9C 4QFBA 4KQEA 3HJBA 2JFVA 2YHAA 2AOUB 1JVNA 1B3BA 4Q5IA 3RRBA 4XQGA 1NNEA 4L9RA 3RBAA 3UJ9A 3HXOA 3BCHA 5BR1A 3RKUA 1T8RA 3DF7A 4BKOA 1HLFA 1M1YB 3MJCA 4NJMB 1SKUA 4AP5A 2ZJ8A 4XCVA 4EK9A 2I66A 1WQ1R 3WG9A 1FLDA 1I4OA 1EFTA 3EY4A 5FL7A 5CP8A 4YO8A 4LAFA 4UBMA 2EKBA 5LIRA 5EZ5A 2OKCA 3VC2A 5IX8A 3CINA 1SCBA 4WZAB 3HXQA 3AM4A 5CXSA 1FVFA 3ZZNA 1SEVA 2XPCA 1C3OB 1WW3A 3QTTA 4AURA 1NFFA 3KYIB 3SJCA 4X3CA 4CFSA 1MQ9A 2A1TR