1LDMA

Refined crystal structure of dogfish m4 apo-lactate dehydrogenase
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
329
Chain Sequence
b'ATLKDKLIGHLATSQEPRSYNKITVVGVGAVGMACAISILMKDLADEVALVDVMEDKLKGEMMDLQHGSLFLHTAKIVSGKDYSVSAGSKLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKHSPDCIILVVSNPVDVLTYVAWKLSGLPMHRIIGSGCNLDSARFRYLMGERLGVHSCSCHGWVIGEHGDSVPSVWSGMNVASIKLHPLDGTNKDKQDWKKLHKDVVDSAYEVIKLKGYTSWAIGLSVADLAETIMKNLCRVHPVSTMVKDFYGIKDNVFLSLPCVLNDHGISNIVKMKLKPNEEQQLQKSATTLWDIQKDLKF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M4 LACTATE DEHYDROGENASE
publication title Refined crystal structure of dogfish M4 apo-lactate dehydrogenase.
pubmed doi rcsb
source organism Squalus acanthias
molecule tags Oxidoreductase
total genus 105
structure length 329
sequence length 329
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1987-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ldmA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1ldmA02
4RVHA 1DRVA 5L3ZA 2EWMA 2X9VA 1BMDA 2O2YA 2Q46A 2YW9A 3VTFA 1L7DA 4FB5A 1DAOA 3INGA 3PFFA 3O03A 1P0CA 2RHRA 3GAZA 4LCEA 3MJVA 3WGHA 2EW2A 4EJMA 5I7EA 1QP8A 3G0OA 4ILKA 3OSUA 4NNJA 5ENDA 5F1OA 2P5UA 1CERA 1E6WA 1K0UA 2GGSA 3CSDA 3ST7A 4JP3A 1YE3A 4R1TA 2F00A 1KC1A 3DMTA 4TRJA 4ALNA 5IFLA 5G4KA 5JAZA 4YJFB 3AM3A 2OBYA 1KETA 1RPNA 1YDEA 4I1IA 5JLAA 3QW2A 3PXXA 4FR5A 4FGWA 3HADA 3D4NA 1U8XX 4XYGA 3JQBC 2A9FA 3PI7A 4ONEA 4JJFA 1VPDA 2X7HA 1XG5A 4BB5A 1WPQA 1HXHA 2PZKA 3QWHA 5GMOA 2ZTMA 2BF7A 2O23A 5JS6A 1Q7CA 2P4HX 5KJ6A 2EV9A 3LT4A 1YJ8A 3QWBA 3DZBA 1ENOA 4HKTA 1KEUA 3OH8A 3LQFA 3SC6A 4NFSA 3WBBA 1EUDA 1FDTA 3WG9A 1HSOA 2RAFA 5FF9A 3ZWBA 1ONNA 2AQHA 2PH3A 3JQCA 3WGGA 4BMVA 3ENNA 2GN4A 1I3KA 3ZWVA 4IQGA 4PG4A 1GUZA 3B1FA 1PJ3A 5TX7A 3TDKA 3GRPA 1ZKMA 4BGIA 3I4CA 1SO8A 2QX7A 1E6UA 2PFGA 4E5NA 2DBRA 4N5MA 3HE3A 1XU9A 2D1YA 1DRUA 1DHTA 2WD8A 3H5AA 3WLEA 3PHGA 1ARZA 5A3JA 2W2KB 3I83A 3Q11A 1UJMA 1QORA 3ZN2A 3AUAA 3HDJA 3IKTA 2YHIA 4XYLA 4JXKA 1D4FA 2B5WA 2O2SA 3H65A 3BMQA 3RBXA 2RHCA 4CQLB 3BA1A 1PL8A 1H6AA 3E03A 3U4HA 4CM5A 1HT0A 4PFJA 3PIIA 1Y5RA 4FJ0A 4WE3A 4U6QA 4FSHA 3WR5A 4D46A 3VDQA 3DWFA 1LDBA 2UYYA 3GNSA 2HRZA 2PD3A 2WWRA 1XIVA 4NI5A 3ZH2A 1V3VA 4IJUA 1LLUA 4QXMA 2PLAA 3C3XA 4G81A 2ZQZA 2YDXA 4CLOB 4YAKA 4R51A 3ANMA 4Z3DA 4EI2A 3F46A 3RSHA 1MA0A 3L6OO 4RLHA 4WASA 4BQPA 5ITWA 1AHHA 5KVCA 4NQZA 1D7OA 2PZJA 5T5QA 2EKQA 2ET6A 2QRKA 5KJFA 2DVMA 1NFRA 5JDCC 4MKRA 3L4SO 4J7CA 4FIZA 5IZCC 3NT4A 1ZIDA 2DUWA 3AFNA 1KEVA 4ZN6A 4EDFA 4P22A 2B5VA 3MOGA 3LT1A 2GN6A 2JFHA 2YV1A 2VYVD 5DDIP 1E7SA 2AXQA 5KNLA 4ZQBA 3GG2A 5EINA 2IEBA 2AMFA 5U1PA 3HG7A 4A7PA 5JW6A 4NZ9A 2A94A 2JKVA 3BTOA 4B3JA 2LDBA 3DBRA 3ZU5A 1Y6JA 1ZK2A 3C7CB 2UVDA 5IG2A 3EDMA 1OC4A 1QYWA 2GERA 1HDGO 2IODA 1HE5A 1VKOA 5CPFA 5K6AC 4BMNA 5JCJD 4DBZA 3JD0A 1YO6A 2YUTA 4J1TA 4OMUA 3WQRA 3PQFA 3BZUA 1PZEA 4CMBA 1JWBB 1QYXA 5JNLA 3A9WA 4MVJE 2Q2QA 5G4LA 2R2GA 3LC2O 3ZI0A 4KWIA 5JO0A 3JQAB 4HADA 3WGZA 4BNVA 4YXFA 3H7AA 1KEWA 1HYHA 3QY9A 1EEHA 1HDCA 1ONPA 4H7PA 3FRJA 4R3WA 3VKUA 1NPDA 3PPIA 4RO0A 1XSEA 3ZHZA 2BRUA 2V6BA 5KJCA 3ZCXA 4OO3A 1K6XA 1WNTA 3I4FA 3S2FA 4CQMD 3W1VA 2Z95A 2XXBA 1NWHA 3OETA 1E7RA 4D0RA 1H94A 3FTNA 5TLSA 1LSOA 2WJPA 2Y0CA 4UUPA 4LMPA 2J5QA 3ZU3A 1T4DA 3OIFA 3X2EA 1B2LA 3GQVA 4XQ9A 4DQUA 4UVGA 1V3UA 3Q3CA 2DBVO 4BGEA 2WEKA 3PZBA 4BKOA 1X0XA 4O63O 1LDMA 1FXSA 4YJGA 5JY6A 2Q1WA 3RASA 4S1VA 2AG8A 1D8AA 1O95A 2B0JA 3BAZA 3GH3A 4LSMA 4CMIA 5L40A 5BSEA 2FZEA 3E9NA 1MX3A 1YDWA 4CMCA 3A14A 4XA8A 1H9AA 3OJFA 4J2HA 4NDNE 4OXYA 1EVYA 4PG6A 5ICMA 1P0FA 2H6EA 3A28A 2O7SA 2CUKA 1ENZA 1I0ZA 4CMEC 1R4MA 5GZ3A 4E5MA 2X22A 3LSYA 3ZNNA 3IOYA 2CF6A 2HMSA 2VTEA 1CQJA 1P1KA 3JQFC 1NVMB 3DAFA 3DEYX 5HA5A 4W6ZA 3WICA 3BTUA 3CEAA 3GPDG 2W8ZA 1NFQA 3EK2A 1N7HA 4M49A 5A02A 5FFFA 1N1GA 3F1KA 2BI8A 4RVSA 1GQQA 4IPTA 2YHIB 2GDZA 5F1KA 3GLQA 3UCFA 4E30A 2Y1DA 3NT2A 4JJIA 3BMQB 1ISIA 8LDHA 4QQRA 3UICA 3U09A 4FFOA 5JC8A 4ZA2A 3RQSA 1U2DA 4BNNA 4TMFA 4HNGA 1E7WA 3LLSA 4QUKA 3WGYA 1UH5A 1Y8QA 5HWSA 2Q99A 3QLJA 1GFSA 3DBLA 4RCVA 1O0SA 2E4AA 4D3DA 2NTJA 3DTYA 1I36A 4DREA 2GZ3A 1C1DA 3GEMA 4YEDA 4L4XA 4MVJI 5I7FA 4J0EA 1V9LA 2P9EA 3WSVA 3FPCA 3GPIA 2NVWA 4BUCA 1R0KA 3ORFA 2W90A 5DULA 3OP4A 3TL2A 3TSCA 1GZ4A 3GOHA 1TA4A 4PZEA 4CM6A 4FCCA 1RM5A 1QR6A 1XCBA 1U3TA 4PLHA 3U49A 1HTBA 2VHXA 3K2BA 3BMCA 3GUYA 1PR3A 5T67A 3VPSA 3D64A 4IJKA 2VQ3A 1ISFA 1LQUA 1U2GA 4J4TA 3TPCA 5KKAA 4YA6A 1DB3A 2PD4A 1EUZA 1AE1A 4CJXA 3B6ZA 2X5KO 1DRWA 3UF0A 3I5MA 2JD1A 4FC7A 4Q3BA 4XJTA 3IS3A 3TJRA 1QYVA 4A10A 3PDUA 2NU6A 4KDFA 4K6CA 1FDWA 1KIFA 3BYZA 2VYNA 3DBRB 3JYPA 4O6VA 3QE3A 1BVUA 3WTCA 1B14A 2FN7A 3GFBA 1PR9A 2FWMX 3R3JA 2UUOA 4PGFA 3UGKA 2P68A 3D0OA 3SLGA 2XF8A 5A9SA 3WGTA 4Q3NA 3ZWAA 3D5QA 3PYXA 4WLUA 3L07A 5TC4A 3O38A 2PY6A 3H3FA 4Q9NA 1BW9A 4IGEA 3M1LA 1NPYA 4WUVA 3TN7A 4F46A 3CZMA 1E7QA 2FPGA 4IQ8A 5J23A 1VM6A 3S55A 2B83A 2DUUA 2I5PO 1NR1A 2FZWA 3G3EA 3EYWA 3T7CA 4HFMA 2NLOA 3UW3A 2HJRA 3KUXA 3OEYA 3QP9A 4AJPA 2EGHA 1NQTA 4CLEA 1GCOA 1GQ2A 4BNUA 1AHIA 3GG9A 4BO1A 1NVTA 4UAGA 3DZGA 4BGUA 1V6AA 3D7LA 5I9LA 2GPTA 1YB1A 1PQPA 3EZLA 2D5CA 4FFLA 4YB8A 1TEHA 3DOJA 3ANNA 1JLLA 1EQUA 4RLSA 1O89A 1BVRA 3JQ7A 4NJMB 1C0KA 3O9ZA 4ZJUA 3T7EA 1QLHA 4A26A 1DFHA 2BI7A 4NBTA 1IHYA 3O8QA 3TZQA 3OIDA 3RIHA 4YJGB 5LDGA 4IJVA 3V2UA 2JAHA 4CMIB 1X7GA 2GR9A 4J43A 3NDIA 4ND4A 4E6PA 5KWEA 1NQ5A 1U9JA 4AICA 1CDOA 4BKQA 3Q2IA 3RUCA 5ILOA 2NU8A 1SEPA 3KBOA 2WDZA 2I3GA 1WZIA 4GBJA 2I66A 4R5MA 2BFMA 1R4MB 5B4VA 3OQ6A 2J3JA 3GGPA 2HAEA 3QVTA 1PQWA 5I7SA 2CFCA 4ZVVA 1VE9A 2W98A 1Z7BA 3ETGA 4QT0A 3IUPA 1DEHA 1WXDA 3LVFO 4W99A 3KXDA 3K2EA 2AA3A 1O94A 4E13A 1IULA 4IMRA 4DVJA 2XXJA 3RFTA 4K9DA 4B3IA 4M8SA 2WD7A 4WLOA 2BGKA 1GR0A 1LQTA 4E21A 4EZBA 5ITVA 2X23A 3PHHA 4WLEA 2PGDA 4NIMA 3KLPX 1PZHA 1VRWA 2Q1TA 1JWAB 1Y8QB 3FWNA 4CR7A 1EMDA 2BGMA 3ITKA 2H63A 3DBLB 1JTVA 3FR7A 3GDGA 3R3SA 1W0CA 4FS3A 1A4IA 4NHEA 2Y68A 3KEQA 5DP2A 4CM3A 4J9UE 4P38A 4BKPA 1N8KA 1YQDA 4AFNA 1C1DB 3C1TA 4DIOA 4ALJA 2FRDA 4AJKA 2X5JO 3WJ7A 3KRTA 4DYDA 4KZPA 3OHSX 3CKYA 3N58A 2NU9A 3QQPA 2JHFA 4D42A 2D2IA 4E32A 1GV1A 4INAA 4GI2A 3ZWMA 5MGBA 1K89A 1YBVA 3IL2A 3QHAA 3DHEA 5TF4A 3RVDA 3ADOA 1Q2XA 4R54A 3BMCB 4PLCA 1JU9A 1RM3A 5AVOA 3O4RA 3JCZA 4W9NC 2FSSA 4L9RA 2X0IA 4UREA 1XYGA 5ICSA 1PWZA 4U5QA 4AJ1A 1A71A 4NK5A 4E33A 4IZIA 3QSGA 4GVXA 4RF5A 1YRLA 5FI3A 4DQVA 1FDUA 4W4TA 2QHXA 3NDRA 1I2ZA 3VH2A 1G6KA 4L73A 4CLXA 5KVVA 5LDHA 4JN6B 4NU6A 3RC7A 4TZTA 4PLYA 5L4LA 2AEJA 4LN1A 1M67A 4NJOA 3AUUA 4LVCA 2IZZA 3QRWA 4OYRA 1AGNA 4BKUA 3PHLA 3VPFA 4E2YA 3SVTA 5A4DA 1E3SA 4OKNA 4U0JA 1Y1PA 4CM9D 3GEGA 3SJUA 3PK0A 5CG1A 1C0PA 3D4PA 1DIGA 3OJEA 1WP4A 2HLPA 1BW9B 4R5HA 4BNLA 4R68A 1H6CA 3HNPA 3QVSA 2BHLA 1YL6A 2Q50A 5CHEA 4BNZA 3EVTA 2VYVA 4CM8A 4Z3KA 1I2BA 3JYNA 4NBVA 4OQYA 1K6JA 4DRYA 1VL0A 3F1LA 2Y1FA 4N7RA 5HRUA 3H9JA 3Q1LA 2B4TO 3PP8A 1A5ZA 1X7DA 2D3TA 5CDTA 1QV7A 2ZYAA 4IDCA 1BXKA 1ZEMA 5TQVA 1DOHA 3WMWA 1X7HA 3FBTA 3CXRA 2Q1SA 3NEPX 3T4XA 3WMXA 1EE2A 1A7KA 2QZ9A 4LW8A 2ZTUA 2VUSA 3OECA 4F6CA 2AHRA 3HUDA 4O59O 3WTBA 4A0SA 4CLDA 3NTQA 2FMUA 1TLTA 4UEKA 3SXPA 4KMSA 3O8QB 4DPLA 1UZNA 5DBFA 1ZBQA 1CIVA 4ND1A 3ICPA 3UXYA 2CF5A 2GF2A 1GEGA 3HDQA 4Z0PA 3U3XA 3COSA 4YJDA 1NNUA 3JQ9C 2ZJ1A 4KUHA 1P1HA 4OM8A 2A35A 4OIMA 1YL5A 1VJ1A 2UV8A 3P2OA 4CQMA 1AUPA 3H9EO 3OEWA 4UUMA 1Q0LA 5F5LA 1PZGA 5KCZA 1GL3A 1U3WA 3QWFA 4RF4A 2P9CA 1YOVA 3F9IA 2YQ4A 4YACA 2Y93A 3OFSA 2J3IA 5EQFA 2ZIZA 1B0AA 3K9QO 3V1YA 1VJ0A 2VZ9A 4URFA 4XQGA 1D1SA 3DZHA 3AI3A 1PQUA 4NFYA 4IQ0A 1P31A 3AK4A 3K73O 3OM9A 6LDHA 1SCUA 2FPIA 3STHA 4E4YA 3RKUA 4BV8A 3DB2A 3L77A 3ONEA 4JQCA 1DC4A 4Z9XA 1PIWA 2VT2A 3ZWXA 4YRAA 4GL4A 4M54A 5DZSA 3DQPA 4IY1A 3RFVA 4RPLA 1KOLA 3OQ1A 3PZRA 1LSJA 4GGOA 4ZRNA 2VHYA 2IZ0A 1P45A 2O3TA 3FD8A 2YZ7A 2WE7A 2OP0A 1FMCA 1XR3A 1H2BA 4YRDA 5JYEA 4NBRA 3KYDA 1KY4A 1N9GA 4F3YA 2RH4A 1ADBA 2PK3A 4BGVA 4M87A 3TQHA 3PFWO 5DBIA 1MV8A 3RUEA 2JAPA 4I5GA 4R1UA 2NNLD 3W4KA 2NQTA 1DSSG 1XEAA 1H9BA 3I9JA 1SBYA 3ZWPA 1ZCJA 5DCYA 5L51A 3DMTC 3WGOA 4YTEA 2VOEA 4BIIA 4R9SA 3GGGA 1Z45A 1LLDA 1NR7A 1WZEA 3G1TA 1HDXA 4CV3A 2QRLA 1UP4A 4R4JA 3TZ6A 3WYEA 1XQ1A 2WYVA 2VN8A 1T2DA 3D3EA 2E37A 1KBZA 3KM0A 2GUGA 4BNMA 4MKXA 3HSKA 3LK7A 2ILTA 2X0JA 5GY7A 2D0IA 4NBWA 1G1AA 1I5RA 1ISHA 2G17A 4M86A 1EQ2A 5IZ4A 3ZV6A 3ZDFA 1ADCA 3FCOA 4E3ZA 1EDZA 1T2FA 4TVBA 9LDBA 4IZHA 5DOVA 2WYWA 2OHXA 1EUCA 4KUGA 2YV3A 3K96A 3KYBA 1JW9B 2NM0A 4TVOA 2QG4A 3DHNA 1SMKA 5A5EA 1K3TA 3Q0EA 4MIEA 3MTJA 1E5LA 1YQGA 4A5OA 4CM8B 1EVIA 2FP4A 3C24A 4YJHA 5CDGA 2JFFA 3OBBA 1Y8RA 3U0BA 3K6JA 3I52A 4UVHA 3WFJA 3CUKA 5IDWA 3LDHA 1ULSA 1EFLA 4WNIA 4ZU3A 3AUSA 4AJ4A 2XOXA 1M75A 3F3SA 4PLGA 4C4OA 3AOEA 2EERA 4RPKA 4OXKA 3VOSA 2VRBA 5AOVA 3GMSA 3ULKA 5A03A 4H16A 2H9IA 3R1IA 3M2PA 4MVJF 4Y6RA 4I9NA 4HUJA 2AE2A 4YRBA 1TT5A 1YB5A 3P5SA 1IE3A 2JCVA 4XB1A 2CY0A 3NT5A 3SEFA 5T8KA 3ZV4A 3JQEA 3Q9UA 1MP0A 1HKUA 2PGLA 4U8GA 2OORA 3V2HA 1EK5A 5TRTA 4TQGA 2EKPA 1O6ZA 2HMUA 2IE0A 4CM1A 1NTOA 3P7MA 2PH5A 3GDFA 4D3FA 4CQMB 1IB6A 2SCUA 3ROPA 1FDSA 4YWJA 3PJGA 5A9TA 1I24A 3MCVA 3RAJA 3UAGA 3BHIA 2C7GA 1ZSVA 4PRKA 2VNSA 1SZJG 1MG0A 1VL6A 1T26A 1VL8A 1YOVB 1JAYA 1VSVA 2OO5A 4ND2A 1O9BA 3B1JA 1MB4A 3D5TA 1J5PA 3EVNA 3UHAA 1P1JA 2J5RA 4KP7A 3UCEA 3HN2A 2ZYGA 4FFMA 1DJQA 4FFRA 3ZV5A 4RPGA 4DC1A 2VWGA 1LI4A 2NU7A 4B7XA 2ZYDA 4TSKA 3W6ZA 4JBHA 3KLMX 1VKNA 1RYEA 2BMAA 1UXKA 1TI7A 4RZHA 2GN8A 4MVJM 2HUNA 1UR5A 2Y1OA 3JSAA 4RL6A 1Q0QA 1P9LA 4JLWA 2CDCA 1DO8A 1RKXA 2HK9A 3GT0A 4GKBA 1AXGA 3GUCA 3U62A 4R9RA 1IOLA 3PYLA 3TZHA 3GRKA 3U5TA 3KO8A 1RM4A 1MLDA 1EDOA 1YBMA 3BMNA 1PJQA 3CH6A 1WW8A 4FQ8A 2VNAA 4FOOA 3AWDA 2BH9A 2EP5A 3I9NA 2JD2A 1PJCA 5BNFA 2D8AA 4CPDA 3LF1A 2HMTA 5G2OA 4R16A 2DC1A 2IDZA 3ABIA 3KYDB 1NQOA 5TGDA 1E1NA 2JL1A 5BNIA 3JYLA 1ZMTA 4AJLA 2D4AA 2JD0A 2DPHA 3WIDA 4HXYA 1WMBA 1AN9A 2VUTA 1LXCA 4BNXA 5A04A 3QWIA 1N1EA 3C1AA 1EVZA 1BHSA 1F8FA 4N5NA 3R6DA 3H9GA 1DC3A 4E2XA 5ER9A 2CDAA 1A4UA 5EQDA 1Q1NA 2CNBA 1NAIA 4WKGA 4WCFA 4YPOA 2J6IA 4II2A 1U4OA 2BGLA 5G4KB 1NYTA 1U3VA 4BL5A 2IRWA 4LISA 4BS9A 5CAEA 2P4QA 4B4UA 4G5HA 4DL9A 3D1LA 1ISMA 4XYMA 4HFJA 2BLLA 4IS2A 3DL2A 5COQA 4CLRB 5EL0A 1E3LA 3FN4A 4Y9DA 2YFQA 2X0RA 4OAQA 1NASA 2P5YA 1Y81A 4BNHA 3RBZA 3RU9A 4EUHA 1HETA 2QYSA 3RCBA 1GD1O 5LCXA 1LJ8A 1Y5MA 3F6YA 1JAXA 1GYQA 5C7IO 4FD3A 4ZICA 2EKLA 1LLQA 3TNLA 4OOFA 3OA0A 1UZMA 1J0XO 2AQ8A 4ZQEA 4NH4A 5JYDA 1NFFA 2O3RA 3D3WA 4Y6PA 4YJHB 1HF3A 3WSWA 4NK4A 4GQAA 1LRJA 1NWCA 4UUOA 3GVPA 3L4BA 4Z9FA 1Y8RB 5I8ZA 1MXHA 2G0TA 3K31A 3PLRA 2OGUA 4LCJA 3LC1O 2VUUA 1NHWA 2UDPA 1WLYA 2DM6A 1XLTA 4CM9A 3H5RA 4IS3A 1DAPA 4UULA 4QSMA 1UXIA 1X1TA 2CVQA 4RORA 4XZ3A 3RUDA 1LC0A 2ZTLA 4XGNA 2VWQA 3JD3A 2DU8A 4GAEA 3RI3A 1MGOA 1M6WA 4MINA 2BD0A 2OP1A 3S2EA 4J0FA 1GDHA 3AI2A 3DZKA 2GN9A 4XYEA 4Y98A 3PIDA 4BQRA 4Q39A 4DUPA 4ZHSA 2GYYA 2ZCUA 2Q2VA 2BFPA 5HM8A 4DA9A 1E92A 2D59A 1B26A 2ZB7A 4W82A 1X1EA 2I65A 3JTMA 3MOIA 1SOVA 4BOYA 4PLPA 3NYWA 2CSUA 3EHEA 3DAPA 3SX2A 1ISJA 4GGPA 4J6FA 1Z73A 2VZ0A 4UEJA 5JMWA 6ADHA 1HWYA 2ZTVA 2D5AA 4NR0A 1Y9EA 3FNEA 1W8DA 2B4QA 3PEFA 4AJEA 1W73A 1NM5A 2NWQA 3MJEA 4WLVA 1ZW1A 5KOIA 2GD1O 4U7WA 4DBVO 2GSDA 3HDYA 2J5KA 2OBNA 4RJTA 2NADA 3VH4A 4J7UA 1A7AA 3JQAD 2CD9A 3TWOA 1YQXA 4L4RA 3JQ8A 3MJSA 5L95A 3K30A 3BHMA 1K6IA 4AJHA 4GX2A 2EP7A 4CV0A 5JCXA 4BNKA 2TMDA 3GEDA 2I9PA 5I9MA 5FEUA 2QIOA 4N5LA 4GKVA 4EYEA 3MWEB 1LRKA 1Z74A 3AUTA 5ER6A 3WGQA 4CUJA 1A9ZA 3BMNB 3U4CA 1HZJA 3NJ8A 3OJOA 3PWSA 1BGVA 2IZ1A 3AU9A 4BO6A 1GCUA 1OI7A 2ZATA 4HNHA 3PTZA 1YKFA 1ORRA 4WLNA 2ZB4A 2R6JA 1FJHA 4XRGA 1JQBA 3TFOA 1Z6ZA 4EBFA 2DLDA 2DQ4A 3WGIA 1I33A 5BSHA 4ESOA 4XQCA 1PL7A 3KZVA 2O3SA 3FR8A 1I2CA 3PGJA 1LSUA 3ASUA 3ZWNA 1ZK0A 3RUFA 4E2ZA 5B4TA 5TJ9A 3W4IA 2O3JA 3MWDB 5C7OO 1R0SA 2RH8A 3AY3A 5A1TA 4KQXA 5ENVA 3LC7O 4GH5A 5G0UA 1BWSA 1PS8A 2Y0EA 4FJ1A 4QTZA 1LDYA 4JX8A 2DTEA 1I01A 3NRCA 4WCFB 3VH1A 4J1SA 4E2WA 5G0VA 4Y8VA 2XAAA 1NX6A 4TZKA 1ISGA 5COAA 3RC9A 4BVAA 4XQEA 2W4QA 3EC7A 1H5QA 1GPJA 4IIVA 4BO2A 4MJLA 1R16A 1XGKA 1B3RA 4R41A 4DWVA 3GHYA 4J1QA 1DXYA 3O26A 5KJ1A 2B37A 4PIVA 3H5NA 1GTMA 4IXTA 3FPLA 4R69A 4I08A 3VPHA 1FK8A 2DBQA 2C29D 1CQIA 1U1IA 3GVIA 4BB6A 5FYDA 3L9XA 1UDCA 2RIRA 3KEOA 1ZSYA 1IHXA 2WTBA 3I9LA 2ZB3A 1ZJZA 4NU5A 4QECA 4TKMA 1Q7GA 1UDBA 3EAGA 3SJ7A 3PQDA 1UDAA 4FPXA 2J3HA 3GA0A 3IJRA 3NJ4A 1ZNQO 2HDHA 2YY7A 5AXCA 2EGGA 4LMRA 3VVBA 2R00A 4PLTA 4Z0HO 1KVRA 2I67A 1P3DA 3GMDA 3EGOA 3GVXA 4YDRA 4YVFA 1LDNA 3ZU4A 2Z1NA 4IDFA 1BXZA 2QYTA 5FWNA 2GZ1A 3HQ4O 5DN9A 4XGKA 5COBA 3PJEA 1M66A 4OJNA 5G0SA 4OGWA 1P44A 3JQGA 3PHIA 3I9KA 2CZCA 5B1YA 4EGFA 5A9RA 3BMOA 1I30A 1LBEA 1ENYA 1IZ9A 5KIAA 3RKRA 1N5DA 3U4IA 1BSVA 4BNYA 5IXYA 1CRWG 2DPGA 4YQZA 1X0VA 1R66A 3DXFA 3IP3A 1T25A 3DC2A 4GPD1 4PLVA 3I3OA 1SEVA 2WE8A 3K8ZA 1Q0HA 4J3FA 2Y67A 5G0TA 3I23A 2O3QA 3QJ5A 5BSFA 3B70A 2VRCD 2X5OA 1C14A 2QW8A 5TNXA 5DOZA 2XPCA 3OJ0A 1ADFA 1NVGA 1HLDA 1H0KA 4QEDA 4XJSA 1QYDA 1HL3A 1P77A 3P2YA 1U4SA 3A06A 3ROKA 4EEXA 3NUGA 3PJDA 3FSRA 1E7YA 1JKFA 1RYDA 1E0DA 1EFKA 3RUIA 1L7EA 1LUAA 2YQ5A 3ZV3A 1T1RA 4AVYA 4RZIA 1JVBA 2C5EA 3E1KA 2V65A 4N18A 5THQA 3JQ8B 2PV7A 3HB4X 1GZ3A 1R12A 4L4SA 5EESA 4CUZA 2OL4A 1J4AA 1GQYA 3ETEA 4K1LA 4O0LA 2PKRA 3FNHA 3CZRA 5IDYA 3UFXA 1PZFA 1GUYA 1ADGA 2YYYA 2IXAA 1VLLA 4D45A 1NP3A 4ALIA 4TWRA 4Q3DA 1L1FA 3WQQA 1B7GO 1ULUA 2POQX 3KV3O 3ONFA 3FNFA 5IF3A 1OMOA 3ZW9A 1PSDA 2IYPA 1KVUA 3FNGA 3C1OA 2FR0A 5A9SB 3ZWOA 4IDDA 1GU7A 1ZZEA 5H82A 1S6YA 3AY7A 2EW8A 4K6FA 2A4KA 5T57A 2X0NA 5HTOA 1UP6A 1P1RA 3N7UA 4I9UA 4B4VA 1T4BA 4CM7A 4J90A 4MPDA 3VAZA 3HWRA 4RDHA 1P1IA 2AQIA 4ZD6A 4BO4A 4RVUA 2WMDA 4CL3A 2G76A 4TKLA 1DLJA 1XKQA 2O48X 3DBVO 3VKVA 1IY8A 1EZ4A 4JBIA 4MP3A 3KTDA 4H3VA 2BFOA 1W4ZA 4OSPA 3CMMA 1DC5A 5CDYA 2EHDA 1NBOA 1X13A 1V8BA 5JCJA 4E5PA 2YJZA 4L8VA 4PLWA 4GWKA 3OMLA 4HWKA 3JQ7B 1F14A 5JPIA 4YCAA 3OA2A 4GX5A 1IPFA 3ADPA 3PVZA 4MVJG 3D4OA 1E6EA 2BELA 4FFPA 4IDGA 3PJFA 3RC1A 4A73A 1PGOA 3W8EA 4FDAA 5CDUA 1U7TA 4PLFA 1LDGA 1X15A 3GGOA 2C20A 4F6LA 1EVJA 5C3MA 5IXSA 2IYOA 2VWHA 3LYLA 3VZRA 3RUHA 1HDYA 4I9HA 3PWKA 2AE1A 1MC5A 2C2YA 1YGYA 1OC2A 3BTVA 4RDIA 5EPOA 1C0IA 1ZK4A 4E31A 2VHVA 1JN0A 1UUFA 4YAIA 4OOEA 4CL8A 1LDEA 4BNFA 2VOJA 1ZVMA 3JQGB 4MIYA 4K28A 4YQYA 3CINA 4B79A 5U9CA 1SNYA 2WD7B 3AOGA 4FBGA 5JMPA 3BMOB 2GLXA 2Q3EA 3NAQA 3KB6A 4CLHA 2C54A 1P74A 5L7TA 3AY6A 4XCVA 4MVJP 3V1TC 5KJEA 2OUIA 2V6FA 3H9UA 3HFGA 4IXWA 1YL7A 4O1MA 1U5AA 5IDXA 3E82A 2C2XA 1LNQA 2TMGA 2PA3A 1PS0A 4IDEA 5IN4A 1GEEA 1Z75A 3I6IA 1YONA 4TRRA 4FC6A 3NV9A 2O3UA 3OIGA 1UAYA 4HFRA 4IBOA 4R1SA 1LA2A 4XKJA 3HJAA 3UVEA 1OZAA 2JFGA 4BO0A 4OH1A 4FW8A 1LRLA 2BFAA 1O5IA 3DO5A 3GAFA 4RVDA 4CMKA 4RVGA 2JHGA 3GN2A 3DFZA 1VJTA 1ZJYA 2HMVA 2HSDA 2J8ZA 3LT2A 1EBFA 4UVDA 4XD2A 3WQSB 2W2LD 4BMSA 1N2SA 2EJVA 4L0QA 2I6TA 3UUWA 3WOHA 3E8XA 5JDIA 1OOEA 3FWZA 2FSVA 4DGSA 4EUEA 4ZQHA 5DBGA 3T4EA 3KVOA 5JO9A 1Y9AA 2ZK7A 4YT4A 3ZGYA 1E1MA 4MOWA 4H15A 3C85A 3TOXA 1MUUA 1PJSA 1YVEI 4XWYA 1YS4A 3DR3A 4KUEA 2C0CA 4GLLA 5HS6A 4U0KA 3L6EA 1MFPA 2O7QA 4UEOA 4NBUA 2P2SA 1B16A 2EF1A 4QFDA 1DFIA 4FFNA 1HZZA 4JROA 4XX0A 1BXGA 3E48A 1XELA 3JQAA 4IUYA 5JFOA 2C7VA 4CV2A 4GVLA 4XGIA 3MJCA 2HJSA 1DDOA 3TFQA 1ZH8A 1LTHR 1T24A 1YBAA 1X14A 5A05A 3W8DA 4P4LA 5B12A 4YT8A 4ZQFA 2O4UX 4M1QA 2FOIA 1O8CA 3LF2A 4XEHA 1U5CA 2OZPA 2IEDA 3PLNA 4BO5A 4E12A 1XWFA 3WLFA 4KTTE 2FHSA 1UXHA 2CVOA 1H93A 2RCYA 4ZRMA 3VPXA 5JXWA 3JQBA 1GAEO 4Q3EA 5GZ6A 3AOEC 4Q3CA 3HDHA 4IGFA 4AJOA 5L9AA 2O50A 4HV4A 3IDSA 1DC6A 2OOSA 4JP2A 3PQEA 1HDRA 1QYCA 3BIOA 1M6HA 2ZKLA 5T8KC 1CJCA 1HLPA 2PTGA 3JQDA 3I9MA 4WK6A 2WYUA 2JCXA 2B69A 4M89A 3WIEA 3EW7A 2PNFA 1S7CA 2EIHA 2A92A 1PTJA 4Y6SA 2NTNA 3QA9A 1D3AA 1YH3A 3WJAA 1DHRA 4Z0TA 2P91A 4KDEA 2VTDA 4J9VA 1YB4A 5CPBA 2OMEA 3GN1A 4UVIA 5HS4A 3GY0A 1B8UA 2PWZA 3LLVA 5KTKA 3C7DB 2PD6A 1E3WA 4B4WA 4TRNA 3GR6A 1DFGA 1DJNA 1N7GA 4L74A 4DPKA 1J6UA 3GVCA 5AXBA 3GK3A 4G65A 3G17A 4HFNA 3V2GA 2PGJA 3W8FA 4AG3A 5TS3A 1QKIA 4MDHA 3GFGA 1LU9A 4GX0A 4B4OA 5GZ1A 4WEOA 3G1UA 3VTZA 5JAMA 3KSZO 4L75A 5BNTA 2Y1CA 3ZW8A 3V5NA 2VZ8A 1KVQA 1JA9A 3OICA 4W7HA 4WEQA 4DIBA 2HQ1A 4XDZA 4RGBA 4OHUA 5CG2A 1OAAA 5A3VA 4WJZA 4ND5A 1PS9A 4CR6A 1LX6A 1ZMOA 4CMAA 2LDXA 3MTGA 1EK6A 3IUSA 1PGPA 1WAMA 4QX6A 3X2FA 4MP8A 1R15A 1ML3A 3L9WA 2Q1UA 2YDYA 5CEEA 4WOKA 3TZKA 1EBUA 4XIYA 4WGGA 3HZZA 1H6BA 5K9ZA 5ES3A 1P33A 3GC6A 5DCUA 1TVEA 1ZEJA 1NPTO 5JDCA 1U7HA 1ZFNA 4MVJD 2ZQYA 4CODB 5IZCA 3IMFA 4IINA 1IYZA 1R0LA 3M1AA 4J4BA 1N9GB 4ZGWA 2YFHA 4BHTA 4CMJA 5A5FA 2VT3A 1SB8A 4J49A 4B8ZA 1QLJA 1CF2O 4U6SA 4XDYA 3ONDA 2HU2A 4WPGA 1ZSNA 3RJ5A 3VH3A 3TF5A 4II3A 3I9OA 3WYCA 5EMHA 2UAGA 5IJZA 1KY5A 2DBZA 2E48A 2NSDA 5L4NA 1QG6A 4EUFA 2Y0DA 4WCFC 5BSGA 2X4GA 1IPEA 1K2WA 5ADHA 1E3IA 4GSKA 1W6UA 4I5EA 1UP7A 3N74A 1IZ0A 2VRCA 2WM3A 5DT9A 1KYQA 1E7MA 4GLOA 3ZHBA 4ALKA 1YJQA 4GMGA 4OSOA 4D0SA 4RQTA 2G1UA 3ICCA 2UUPA 4D7AA 1IL0A 5AQ1A 5K6AA 4PLZA 2C59A 3AW9A 3QIVA 4DLLA 2AEFA 4PG5A 2VCYA 4AJ2A 3CE6A 1HDZA 3ENKA 5DF1A 3HHPA 4BNJA 4J4HA 3F47A 3S2IA 1UAGA 1N92A 1XQ6A 2J3KA 2VHWA 1GUFA 1BXGB 4PVCA 3HFSA 3WXBA 3W6UA 4B7CA 3DMYA 4IM7A 4ID9A 1I3LA 2C82A 1E3JA 2Q4EA 2V6GA 3IP1A 3A1NA 2B4RO 4WNCA 5DCWA 3ZNPA 4E5YA 5KVSA 3LT0A 3VDRA 5EN4A 5HBRA 4KWHA 1E5QA 1IUKA 4IIUA 5IAAA 3H6KA 3PRJA 3MZ0A 3RROA 3Q6IA 5I7VA 4RF2A 5JBIA 3L4BC 4RPJA 1HYGA 3M2TA 5T64A 3PWZA 4CUKA 4JK3A 4O5OA 2GASA 3LZ6A 1H6DA 3F5SA 3FBGA 4Z6KA 1NHGA 5T6BA 1NXQA 4IDBA 4DXHA 3RWBA 4NJMA 4F45A 2PZLA 3PDJA 3KETA 3GZ4A 3KSDO 1C0LA 3ZWWA 5A06A 3WWYA 1ZO8A 3NDJA 3WWZA 5L45A 1QV6A 3C8MA 5TSDA 4EJ0A 1C1XA 1HRDA 4XIJA 2Q4BA 4RPHA 1A72A 3ITDA 2Z1MA 4J16A 3WNVA 3EUWA 3RU7A 4X54A 4A03A 1TT5B 2V7PA 3WB9A 5F5NA 4C7JA 3DZIA 2H1SA 1DIBA 3ZWYA 4DYVA 2NVBA 1HYEA 3TRIA 2EG9A 3JQ6A 4RV9A 3PYMA 4PRLA 4E5KA 3QV1A 1PGNA 1J49A 2GZ2A 1R6DA 2NACA 5H81A 3ZHXA 2G5CA 5AXDA 4CMEA 1Y7TA 1E3WB 1M76A 3BHJA 3S1LA 3WFIA 1ID1A 3DAGA 1ENPA 3TL3A 3FHLA 4DLAA 5JC1A 9LDTA 3JQFA 1HEUA 1SPXA 4XRRA 1BG6A 3SLKA 4CM4A 3IIEA 1CWUA 1DIRA 5JSFA 1F0YA 1R37A 1TXGA 4EJ6A 4EEZA 4GWGA 4A2CA 2V6MA 2HK7A 2PZMA 4NFHA 2CDBA 2DKNA 3E5RA 3WX0A 3GNQA 3JD4A 3L0DA 3F4BA 2I76A 1AXEA 1ZXLA 2E49A 4KQWA 2PR2A 4IDAA 1PGJA 2EEZA 1QRRA 3IC5A 2QRJA 2NQ8A 4BNGA 4OL9A 4D43A 4YT2A 3GNTA 3AJRA 4P4GA 3GDOA 2BKAA 1LLCA 4EW6A 5KVQA 4J1NA 1TB4A 3QVWA 3RUAA 2JJYA 1KC3A 1T2AA 1WVGA 7ADHA 4OKIA 1PJBA 5BT9A 4BNTA 3DONA 3MEQA 4LGVA 3FTPA 4OQZA 2Q49A 5H83A 3KSUA 4R1NA 1DIAA 1GV0A 3INRA 3OQBA 2B36A 2QZZA 3IQDB 4JJGA 2VHZA 2JCYA 2DFVA 3DZFA 2HRBA 3SBOA 1PGQA 3ZWCA 3U9LA 5FI5A 1JKJA 1DBVO 1R4NA 1WDMA 1U28A 3DFUA 3GHHA 3JD1A 1B8VA 5EJ2A 3KHUA 4AJIA 2GO1A 3ZNOA 5L4SA 3HB5X 2FY8A 3RJ9A 3H2ZA 3I6QA 4S3MA 3DZJA 1GADO 4NG5A 2Y1GA 2HMWA 3V8BA 2VWPA 1XHLA 5F21A 3TZCA 3KYCA 5JAQA 5DNAA 1D1TA 4OXNA 2DT5A 4UUNA 3VC7A 4NPCA 4BO9A 1A9YA 2E82A 1F8GA 8ADHA 4LRTB 4QO7A 1MFZA 1FDVA 2NVUA 4ALLA 1G0OA 3JV7A 5K0ZA 5CEJA 1BTOA 2W2LA 1I10A 2NV6A 4A27A 3GF4A 4J2OA 4PN3A 3SC4A 3IJPA 3GZNA 3CTMA 4AJNA 5IDQA 4YR9A 1T2CA 5L7YA 4QFCA 4ITUA 1LC3A 3DOCA 2R00C 3D3WB 4PVDA 1H2HA 4Q3AA 4Y67A 3UCXA 3HN7A 1F17A 1PX0A 3UH1A 2F1KA 4HP8A 1ONOA 1PJTA 1E3EA 4KOAA 3E6AA 4BNIA 4TROA 3VZQA 4B3HA 3K92A 1ZK3A 3VZPA 1I32A 4MP6A 1C1XB 4Z9YA 4GMFA 3QVOA 2RBEA 3AU8A 4C7KA 5U4QA 2AQKA 2EJWA 4BO3A 3JYQA 1I8TA 2AW5A 4BO7A 4I5DA 4IMPA 3FF4A 2GRAA 1SC6A 2X9NA 3S8MA 1V3TA 4DQXA 4KTVE 3DBHA 5BR7A 3R0IA 3UOGA 4D3SA 2I99A 3CPSA 1BRMA 4XB2A 2ZB8A 4ROSA 4P4NA 3ASVA 3DDNA 3WNQA 4M55A 5L7WA 4CMHA 3G79A 1HE2A 3JYOA 5LC1A 1XA0A 4MO2A 4MVJH 4CM4B 2ZJ0A 4WCDA 3NTRA 3LU1A 1WWKA 3INTA 5CDSA 1KERA 5AXAA 3VVCA 2O4CA 5EIOA 1ZUD1 4P8RA 1PL6A 5ILGA 3OJLA 5B4UA 2FR1A 1KS9A 1E1KA 2DAPA 4W7IA 2E6UX 1GZ6A 3Q9NA 4JCOA 4ALMA 5F1PA 1MXFA 1YWGO 3F4LA 5THKA 1DIHA 2HK8A 1T2EA 3B20A 5EERA 3ROMA 2G82A 3RBVA 4LSWA 4G2NA 4YAJA 5G0WA 2HO5A 3ZNQA 1XDWA 1YXMA 2C5AA 3G49A 4PZCA 1GYPA 4E0BA 2Y66A 4DMMA 3QVXA 3ON5A 2X6TA 4BV9A 3FI9A 4D44A 1K5HA 3OF2A 2YV2A 1JKIA 4CMGA 1HSZA 3RD5A 2HKIA 1OBFO 1F12A 4EITA 5MDHA 4CLRA 3P19A 2OFPA 1Z7EA 4WECA 1QMGA 1ZK1A 3ZZNA 2CMDA 3ZU2A 4I5FA 4PG7A 4J91A 3H9QA 1DPGA 4HY3A 1P1FA 4D41A 4R01A 2X9GA 3MJTA 2DTXA 4ZQGA 2AEMA 1NQAO 2X58A 2P9GA 1V0JA 4QO8A 2GCGA 4YT5A 4PZDA 4W9NA 1PJ2A 3PHJA 4AL4A 1U8FO 2C07A 3CIFA 1SOWA 4IJWA 4DTIA 4B8WA 1F06A 3ANLA 1RM0A 1Z82A 2FPPA 3NX4A 4LK3A 4YJFA 4YBZA 1VC2A 3WS7A 4DLBA 2Q2WA 1R4NB 5KKCA 3BTSA 2WSBA 3WYBA 1TT7A 4N54A 2Y05A 3ETDA 3AFMA 1B3BA 2X86A 1VSUA 3AM5A 1I3MA 4CR8A 4FOSA 1WMAA 3RC2A 1PU2A 2QQ5A 2ZCVA 3ROQA 1HDOA 3WBFA 1RWBA 4XR9A 1M2WA 2NUAA 3KYCB 2H5LA 1U3UA 3I1JA 2NTVA 3E5MA 4MVJA 1Q7BA 4DMLA 1BDMA 3EY4A 4JBGA 2AG5A 4HX5A 1KVTA 2X8LA 1JDJA 3F5QA 4K26A 4FJ2A 1KEPA 2NVUB 5F3RA 1DLIA 3GVHA 4DIFA 4MIOA 2YHUA 4JNKA 1KVSA 4UVEA 3RFXA 3W4JA 1C3VA 4L76A 4GX1A 2CVZA 1PJ4A 4DPMA 3KOUA 3A4VA 3GZNB 3DOOA 4ND3A 4YAEA 1CYDA 2Q45A 1RJWA 3K5PA 5B37A 1SAYA 3B1KA 4BNWA 3C7AA 4FN4A 4YAGA 5CEFA 1MC4A 3NGLA 3DTTA 4RQUA 3ZHYA 5JE8A 3VHRA 4CV1A 5TIIA 5I8WA 3M6IA 3E9QA 2Z5LA 1EE9A 1UZLA 3NGXA 4TRMA 4XYBA 4JGBA 4J7XA 2B35A 2W2KA 3VZSA 1PJLA 1MG5A 1T1SA 1UXGA 3NTOA 3UKOA 3WDSA 3H4VA 1ZXBA 3H8VA 4DC0A 1I3NA 5DP1A 4B7UA 4I8XA 5TT0A 4CQLA 3IKVA 1CETA 1PEDA 3AM4A 1B15A 4R3NA 1NAHA 1CEQA 1HE4A 1JVSA 1WDKA 5L53A 4GSLA 5JY1A 3H3JA 3VPGA 1E1LA 1QSGA 3JQ9A 1G0NA 4XR4A 2IXBA 2PKQP 4NMHA 3H2SA 4BO8A 3AI1A 4WOJA 3DBHB 5C7LO 1HE3A 4CLOA 1PWXA 1B8PA 2HCTA 4BKRA 3DHYA 2Y99A 3Q2KA 5I9NA 1GPDG 2GNAA 1XU7A 2VYND 4PG8A 4HBGA 4PCVA 2FR8A 1QXSA 5CP8A 3L6DA 1UXJA 7MDHA 1BDBA 4YYZA 5C5IA 3BXXA 2I3AA 3NKLA 1FF9A 3U4DA 5C37A 2PKQO 5JAIA 2DFDA 1SB9A 5TJHA 2EXXA 4D79A 1E77A 3MJ4A 5JDIC 3IAHA 3EZYA 2OXIA 1V35A 1GYRA 2X1HA 4WLFA 1OFGA 3EMKA 4MKZA 1LSSA 4FGSA 5TT1A 3S2GA 5BQFA 3UN1A 5IN5A 1GY8A 2DTDA 1LEHA 1A27A 4LRSB 1WDLA 4JIGA 4AJJA 3V1UA 3JD2A 4LVUA 3E18A 3PGXA 5AYVA 3CMCO 3QWAA 3TOZA 1VI2A 4RVFA 4RF3A 5CFZA 3E9MA 2Y1EA
chains in the Genus database with same CATH superfamily
5CTJA 2XBLA 2BMDA 2O0KA 2BFEB 2PBLA 3VI3B 1SCAA 3KOZA 2F1OA 4DSZA 4EA9A 3ECSA 2AFRA 4NU8X 5SYAA 3PXGA 1A9XA 1HFEL 1N2CE 1QFMA 1YR7A 1D2EA 3O03A 4RXUA 4TM8A 2YWEA 4TTQA 5IFKA 1V37A 1J00A 5I7EA 1QP8A 2R11A 3G0OA 3RJMA 4D9JA 5IK2D 5I45A 2DBYA 1ZUWA 5F1OA 2EFCB 4DCMA 2W22A 1BMFA 1V1RB 2RGWA 4XD7D 4LZAA 1KC1A 4G01B 4ALNA 4YFVA 3WADA 5JAZA 3EFOA 1X7YA 4P4UA 2OCGA 5B2ZA 4I1IA 3EVBA 2RBGA 5JLAA 4EI9A 2ZJOA 3PXXA 5DRYA 1RWKA 3HADA 4L07A 3D4NA 1H05A 3N7TA 1EFAA 1XD2A 5JXGA 3EXIB 3S28A 2ZJZA 3E70C 3PI7A 3AX6A 2EYQA 4ONEA 5DLYA 3SC2B 3THSA 3VNQA 2XHZA 3AL2A 4LOIA 2RG1A 3ESDA 2X7HA 1XG5A 4R2MA 2FNAA 3B48A 4RZ2A 2PZKA 3QWHA 3LV8A 3RTDA 4M37A 3E4DA 4V0RA 2BF7A 4OFBA 4RE6A 2V7GA 2ZIWB 3H17A 1I2MA 4LBZA 4RABA 5CB4A 4E15A 5AJVB 1W1UA 1P9OA 2RJ3A 2SECE 3LT4A 1YDGA 1ESNA 2IS4A 1QE3A 4NFSA 3FFBA 1FDTA 4PZZA 5KB3A 2HLNA 5GOZA 5FF9A 3T1OA 4B7AA 3FCAA 1I0LA 4BMVA 2H1CA 3E05A 2WM9B 2RJOA 3EIQA 3ENNA 3HYLA 4RHEA 3UAYA 4C7MA 1JR2A 4ILEA 1B6SA 4ZP1A 1NW9B 5LU8A 3HI6A 1GFZA 4JT2A 4YJ2A 4QM7A 5G02A 4OB8A 4XASA 1VKRA 1YKGA 3B1FA 1PJ3A 2FSUA 3KKOA 1II8A 5LYJF 5F51A 5K6RA 4BGIA 5SZKB 3NIWA 4BJHB 4ISCA 3I4CA 2QX7A 2DJIA 1USKA 1ZITA 2CNKA 2GO7A 2AB0A 1DRUA 3EPPA 1DX4A 2GHTA 1XL1A 5EJ5A 2WD8A 3BB4A 4CKEA 3WLEA 1UFQA 4NESA 3WGJA 1ZNZA 3E61A 4C01A 3IOCA 3I83A 3ZE0B 2P35A 5EUQB 5CD9A 5JBQA 4D9KA 1RQ2A 4X7BA 2JIQA 2QI9C 3AUAA 3L18A 3MMPA 5K8VA 1RE0A 4JXKA 2VBGA 4F9TA 3BMQA 4U2CA 1QQBA 4HSEA 2R8OA 4LXQA 2PS3A 3H42B 1J8MF 1L7MA 4Q5IA 3RHFA 5AVSA 1H6AA 3E03A 1IN4A 1YGPA 3U4HA 4KI0A 1G9XA 4KR9A 4R1MA 1Y5RA 4MVXA 2RE8A 3FOBA 4YIKA 1JPNA 3WR5A 4E31A 3VDQA 4X64B 3Q5EA 4HEA6 3DLCA 4M53A 4H0NA 3V8EA 3HJNA 4L5IA 2UYYA 2FPXA 3T9EA 5B3KA 4NI5A 4N48A 1XEXA 3ZJ5A 4IJUA 1AKEA 1C7RA 4FHCA 4EF5A 3DV0B 4QXMA 2PLAA 3P9CA 3QPDA 4G81A 3SKXA 4F7DA 3B3FA 3H8WA 3Q8WA 2G70A 2V4ZA 4I4CA 1TE2A 4TKUB 4CLOB 3ANMA 4DB2A 3B8HA 4Z3DA 4C4AA 3P0RA 3KPVA 3LCMA 1Z6PA 3ZQJA 3RSHA 2OHIA 2VXBA 3ZUGA 3EFEA 3WKBA 5AK4A 2WWTA 3SSOA 3BK7A 3B60A 1AMOA 4I46A 1RYNA 1SG9A 2IHNA 3IKMB 2Q0QA 2ZUWA 3E9RA 1A9SA 2ZB2A 4I2VA 2ET6A 2OR3A 5DTIA 3HFRA 1Z7YA 1BYUA 4ZMRA 2ZIAA 1NVFA 2VATA 2YHSA 4QYMA 5CK5A 2FKNA 2O2HA 2DLNA 2W0MA 3AP1A 3ND5A 5IZCC 2Y2VA 1NU6A 4FUTA 2AZXA 3V6LA 2GJAA 3NYQA 5JFGA 3P9IA 1IDN1 1NNLA 4ZN6A 1UXOA 1QGUB 1Q0SA 1YHZA 2Q8NA 3FI0A 5FIUA 4P22A 5K3AA 3WV5A 4M83A 2PZEA 3MOGA 4LSZA 1N2IA 2C4HA 1F2UB 2OLJA 4YGYA 3CRRA 4G1EB 1PJ8A 2GN6A 5ELLA 1E2BA 5K45A 4BATA 1T5DX 1VHDA 4L8YA 1HNNA 4UBJA 3OE4A 2R1TA 1PHRA 2L17A 1GUDA 1G8GA 5DDIP 5DXAA 4URVR 2C9MA 3GG2A 4JYCA 3RC8A 1GTVA 5KYUA 2JKVA 4GPZA 4A4DA 5EGSA 1BN6A 3BSWA 3ZU5A 1W35A 4BV3A 4QAQA 5EJMA 1A77A 2JCGA 2X5NA 4NJEB 3HY3A 2W6JA 2GERA 1TF2A 3EH1A 1R4ZA 1SY7A 2R5WA 4EMSA 1VKOA 1N0VC 2H7XA 2RHOA 3BD7A 4BMNA 4EKNB 3MWKA 4J1TA 2H1OA 1O6GA 3H6GA 5AK5A 1RADA 4PHCA 4OFZA 5BWMA 4NP6A 2GM3A 2BN4A 1JWBB 1QYXA 1N6RA 1T34A 1Y4DE 1MR3F 2WV9A 2WM8A 3E7DA 3IKJA 3IAAA 1KI3A 1MOPA 2J41A 2R2GA 3R44A 1PFQA 5DWVA 5G4LA 3R74A 5DHQA 4A1FA 4FP9A 1NBME 2KLBA 1BOFA 3BILA 4KWIA 1IH8A 4ZT4A 2YOGA 3FFXA 1H4VB 1XZGA 2IF2A 4HADA 2BE9A 5AD1A 3OCZA 3QY9A 3LLMA 1HYHA 3TLBA 1EEHA 1ONPA 4N7MA 3ZHZA 3FDXA 2WTXA 1NVVQ 3T52A 4RO0A 3VYVA 1YCFA 3BE4A 2BKVA 1COWD 4OO3A 1K6XA 2VPYA 4Z3OA 3PI6A 2GJSA 3H1BA 1G8AA 2XXBA 2GZDA 1LKZA 3OOSA 3K0CA 1NWHA 3OETA 5I3CA 5KTSA 2BEVB 1PR5A 3AF5A 3D7KA 3SPXA 2QJWA 4YMLA 3R4VA 4DV3B 2NVOA 3SY8A 2FGKA 2J5QA 4UM9D 3CPEA 4ITRC 4BZQA 3Q6NA 2W2QA 3GQVA 4XQ9A 5TS2A 3TOVA 1VYHA 2JI8A 3Q3CA 3CJTA 1JB1A 4AP5A 1EIWA 1O95C 4ZALA 2YIDA 3WLTA 1X0XA 1W88A 4RTJA 2FV8A 1FJXA 2BFDA 3CNHA 4J16C 5C18A 2IVZA 1OLUB 1P72A 1TM5E 1XMIA 2B0JA 1ONSA 2HIMA 2O14A 4WZBB 2I91A 4LSMA 1JQDA 2I2CA 1M34B 5KDLA 3MA0A 3E9NA 3EUAA 3U7EB 1WHSB 4IO0A 1QZXA 1VDMA 1YE8A 1OQAA 3LJKA 2FFRA 3ZDBA 1ZUHA 1H9AA 2Q3BA 1EVYA 3KVRA 4JSTA 4LRYA 3A28A 2E2WA 3J7TA 4M6WB 3EC1A 1ENZA 1I0ZA 3DAOA 2M1ZA 4ND8A 1TJ3A 4E5MA 3LXMA 3QPVA 3ZNNA 2QJOA 2O1XA 5DX0A 4JI5B 4U2BA 2YWDA 3NVAA 1XNQB 2D4HA 1CQJA 3IAS6 1P1KA 1C8BA 1CRPA 4PTLA 3DFKA 1NVMB 5E7MA 5HA5A 4W6ZA 1Z36A 4HWPA 5AM0A 4MULA 1HI9A 1GL9B 3M6XA 1XXHA 3FKQA 4GPEA 4BRSA 5CVTA 3LO5A 3PS9A 4JWTA 2BI8A 3ETNA 4M38A 4TZ0A 4U7TB 4E30A 2P2YA 2W5UA 3TTXA 3VU0A 5BVGB 2PSEA 1V5WA 3AESB 3MT8A 4QQRA 1T5OA 4FFOA 1DPFA 1PWYE 4ZA2A 2J9YB 3Q4GA 4K9PA 4QC2A 1I6KA 1U2DA 2GPBA 5EKXA 3N2YA 1A2BA 1E7WA 1P4RA 1VGVA 3RYHB 3WGYA 1Z5UA 5EP1A 5HWSA 1MC8A 2O8EA 1XL0A 3DBLA 3NEJA 3A2LA 4M1KA 4A82A 3DD1A 1FTQA 3E35A 3L0BA 3WB2A 1TJ5A 2FSIA 4K1XA 4ZCMA 2AJCA 1ZA2A 1CUBA 1H1TA 2ZVQX 4ZJZA 4CTMA 1XAJA 2RSLA 2ID7A 4MVJI 3H2HA 1MZVA 4KQ9A 1VP3A 2C2ZA 4MR7B 5K7SA 2P9EA 4KAFA 5LA6F 2QRUA 4IHJF 4NAHA 2YY5A 3ZCQA 4OB7A 2XSZD 3WBJA 1KL7A 4E2YA 2VDJA 1GZ4A 1Q84A 3BEDA 3ECCA 1K9SA 4FCCA 4NTZA 5E2BA 3T3IA 1QR6A 4DARA 1XAIA 3KWMA 4HDSB 1XXLA 2QI9F 3L49A 2GM4A 3IR7A 3R0XA 1PFUA 3K2BA 3GUYA 1PR3A 1PV1A 2C0QA 2H4XA 2FLVA 3D64A 2XOKD 2QVBA 2XVZA 5BSMA 1ISFA 4HVLA 1T4CB 2XZDA 3OOEA 2AOUB 2EFHB 3QU4A 4LMAA 4LWZA 5IM5A 1E2PA 3OZIA 4YA6A 4RY9A 2I34A 3MUOA 4BLPA 4LF4B 3IUEA 3CCCA 3LPLA 2CT8A 4U02A 2OUKA 4NBKA 3B6ZA 2X5KO 3O0TA 1DRWA 1U28C 4HRXA 1U1CA 3NIGB 3WE7A 1GA4A 4XJTA 2JFYA 3G2OA 3THOA 4IUBS 1NUSA 1S01A 2PAAA 2IYSA 1NQUA 1KIFA 4QTTB 3BFPA 2VYNA 5D3MA 5HQ3A 3RNLA 5C35A 4HX2A 3WTCA 1LWOA 1NIJA 2FFQA 3NP9A 3ZYZA 2FWMX 3ZY4A 3EUFA 3JASB 3DPSA 4PGFA 4A91A 2YJGA 4AXBA 4JENA 1OT5A 3C6XA 3X43A 3AUJB 1UAAA 3SLGA 3D0OA 3K7EA 4N3CA 1KJWA 2OB1A 1S3GA 2RGUA 4QGGA 3W90A 4URUR 4PONA 4AG6A 4M7OA 2OB2A 2KBEA 2PY6A 4RSHA 1A8IA 3GWZA 3TIFA 4Q9NA 3NFYA 3FAKA 4JC0A 1PD1A 4GI7A 4GOKA 3TN7A 8ATCA 4IQ8A 1E7QA 3T3OA 1IXZA 3I72A 3MT0A 4CVNA 3T1YB 1PT7A 2Q4OA 2V03A 3T7CA 1TRKA 5DYIA 4Q37A 1HMPA 5B3JA 2HDWA 2J30A 4IKOA 2OD2A 1V7CA 3DEIA 4RCZA 4AJPA 3QP9A 3W3AH 3E1GA 2EGHA 4CLEA 2PX5A 5C46F 1GCOA 4BNUA 1XCOA 3CQ9A 3OEHD 3K72B 1YCHA 2QBYA 1CUVA 2R79A 3FSGD 2VDWA 3GG9A 4BO1A 1NG1A 1S4QA 1Z5NA 4IG4A 1FFCA 4BGUA 4N9WA 5BW4A 4KQMA 4IMJB 1XLUA 2OEPA 3MMZA 4BXOA 2QQGA 2D5CA 3HA7A 2IY7A 3I6BA 1XMSA 1T35A 3O93A 4HDMB 1JLLA 1FP4A 1MOSA 4NYIR 3NOQA 3ZQ6A 5JV5A 5JS7A 3ZHQA 3ROEA 4UDNA 2PX2A 2CNNA 4G5OA 3U3ZA 4QLAA 5K3DA 3KQYA 3VHXA 3EWAA 1F51E 4DA8A 1ZHOA 3D1VA 4LOHA 3J7AC 1QLHA 2FQ1A 1CRZA 4A26A 4EABA 4KB5A 2BI7A 3O8QA 1ZZGA 1VJRA 3GRUA 3BWYA 3D8BA 3OIDA 4OATA 5KO2A 1RXVA 5A6SA 3BZWA 1YVRA 3H5VA 2WWXA 3M49A 2C83A 4K9SA 4LJ6A 3FPAA 4QYWA 1WW2A 1HEYA 1ZM2A 3SNHA 2GR9A 4QE3A 3VGPA 4CMIB 4YY3B 4DF3A 3NDIA 4ND4A 4E6PA 5KWEA 1MTOA 2FPRA 1CDOA 4PBTA 4CL0A 2FI1A 2ZIXB 1DJPA 2VP5A 4HNRA 3LA6A 1I9CA 5H80A 5ILOA 2HXGA 2WUEA 4JU9A 1SEPA 3BSFA 4H1UA 3GV0A 2Q4DA 1TCBA 4X1IA 2W6NA 1WZIA 4R71A 3TM4A 1ZN9A 3I2GA 4KE7A 1G20A 3OQ6A 5DW3A 3GGPA 5DX1A 3QVTA 1PQWA 2CMGA 4NF2A 4OAPA 3GA7A 1OYYA 1R8YA 2FX5A 4F6RB 1QIIA 3GELA 1RFLA 5IABA 5CLGA 5JNUA 5D2CA 5BV2P 1Z6XA 3KXDA 1QX3A 3T7SA 5JR3A 1JDSA 1O94A 2WOJA 3R75A 3V6MA 4E13A 3VKWA 1FUIA 4OFXA 2FLWA 2WW8A 2CKDA 3H16A 4XE5A 1KKMA 3R0VA 4LXHA 2CLKB 4B3IA 4K9DA 2R2AA 4WLOA 5LFAA 3C87A 4TT3D 1BU5A 2CE7A 4OV6B 5L3VA 2CHEA 2O2IA 3C8HA 4NLLA 1XVLA 4PY2A 5ITVA 1QQ7A 4WLEA 3RANA 3KLPX 4CU2A 1OU0A 2QX4A 5DTEA 2QN2A 1JWAB 3BH6A 1ID8A 1A95A 5CFOA 4Q9JA 2Q7DA 4CG2A 4CR7A 5D8DA 3CO5A 4NXMB 4NHEA 3KK0A 3R3SA 3KEQA 4CM3A 4DY6A 2BM0A 1AS2A 2IZOA 4P38A 1N8KA 4XH9B 1C1DB 2W83A 2FRDA 1ZD2P 1E2QA 3RRBA 2X5JO 4MQUA 1CR2A 4BE9A 2ZSHA 1GLGA 2VJCA 3KRTA 3CX4A 4X90A 3C4JA 2QDKA 1WETA 2J6HA 2XDQA 3HXMA 1OUMA 3CKYA 2RGNA 4GZ6A 1E2IA 1GT6A 3LI2A 4H6VA 4JI3B 4D42A 1CB0A 1A5SB 3MJHA 1PW5A 4INAA 4LX8A 1MU0A 4NULA 2BYTA 4GI2A 1ZD4A 3JAWB 2IEZA 3TUJC 1XJ0A 3NV7A 3RRFA 1YBVA 1Y6RA 3Q8XB 3M33A 1M0EA 4B2PA 2HHJA 3QHAA 4GXTA 3KB2A 3DHEA 1YK0A 2HBRA 3ADOA 1H0RA 4G8BA 1KY3A 3E22A 4DG8A 4RKRA 4D9FA 1KF0A 2PE5A 3JCZA 4W9NC 4L9RA 3S70A 2X0IA 3QOWA 4UREA 2AUTA 2R6FA 4U5QA 1LTQA 1Y4UA 1A71A 1SM4A 3C3JA 3HJUA 4IZIA 3QSGA 4R2KA 4RF5A 4WT7A 1NY6A 1ODIA 4O8ZA 2JVKA 4W4TA 4XM1A 3VH2A 2WHEA 4R98A 1XJWA 3V7FA 4AO8A 4CLXA 1GGVA 1K7YA 3UJCA 4D74A 4JN6B 5INTA 4MV4A 2OCKA 2R5NA 3NTVA 2C88A 1PNTA 4BP9A 1OLXA 2GDJA 3PQ7A 3WLKX 2E0IA 1E2KA 1L5WA 2NU6B 3P8ZA 4F3RA 5B58C 2IZZA 1BEEA 4YXWA 1IB0A 3BRQA 1NUUA 3V7YA 3O3CA 4MJ7A 5A4IS 1AKNA 4GZMA 5ALUA 3T15A 1KA9H 2AYZA 2ZR0A 3HYNA 2J0UB 3NHLA 4K7JA 4MYRA 5A4DA 4Y9SA 3LM8A 3O5AA 1E9EA 4BDTA 1Y1PA 2OFOA 4O2RA 3K0KA 3BDAA 2Q6LA 3HP7A 3NHMA 4GF5A 5LQNA 4D92A 4TLLB 1GKKA 2GEDA 4HQNA 2JFQA 2Q5QA 4OMDA 2PIDA 3KAQA 4JSYA 4R5HA 2Z2IA 1N5LA 2I03A 5JI2E 4QBKA 3AVPA 5ECDA 4DV2B 4R68A 4RNCA 5D5HA 3QVSA 3R5KA 2XXAB 1UT8A 1YL6A 1VFPA 1YBHA 5LZ4A 1NW5A 2QR3A 1WW3A 1JIKA 3UZUA 5JVDF 3PGVA 3CX8A 3RV3A 2E7ZA 2A78A 1XDBA 1LPMA 4OQYA 1OYVA 2LWIA 2QAJA 4X41A 1DEXA 2QG6A 2WWIA 2Y1FA 1PZNA 3NNDA 2YWHA 4HUQB 5IJWA 4GRIA 5J2UA 3A6PC 1VIAA 5CDTA 1X7DA 2BFFA 4V0SA 2WF9A 1HM5A 4BMPB 2DHDA 2PUTA 2XT6A 3ME5A 4IDCA 1BXKA 3OESA 1V39A 4P81A 5TQVA 5LQCA 5EWJA 1ZD5A 2HPAA 1AOXA 3MINA 1A2KC 2BGTA 2C0PA 4LW8A 4OJKA 1A8UA 2Q0SA 3KB8A 4F6CA 1E2HA 4O59O 4CEIB 2AYXA 3Q7TA 4IYJA 4LNUB 1E79D 2P2CA 3EVGA 2ZT5A 5F4BA 2ZM6B 1G38A 2YVQA 3IPCA 3LMKA 2AR7A 4PGHA 3IV9A 1ZRNA 3QPUA 4NENA 4RMHA 2WM2A 5DM4A 3UUFA 1OWOA 1ZBQA 1ZGAA 2NP7A 1T2UA 1U6IA 3FLEA 4LOAA 3UXYA 3QSYA 4EOGA 2H5EA 4FHZA 4RTQA 1G63A 1C29B 4M7WA 1G2PA 1T9CA 1YZHA 4Q3LA 2WILA 3JTEA 2ZJ1A 3KTAB 4FYIA 2GI4A 7REQB 3AJDA 4OIMA 2NPFA 1WO8A 1YL5A 2HYDA 1HQKA 1JPUA 1P9WA 1PUIA 1VJ1A 2PZAA 3DNMA 1Z4OA 3GFRA 3P2OA 1Q0LA 3QNMA 1PZGA 4UUMA 5CLHA 5IU6A 1RC1A 4CKWA 4JMLA 4POOA 3VR4H 1WF6A 3QWFA 3ND7A 4JFAA 4RUKA 3OLQA 3IPYA 3NO4A 3L4JA 1SPBS 2PSFA 3OFSA 5K8TA 4RLFA 2CLIB 5EQFA 5K0JA 4EI8A 4C78A 3P0HA 1Y5NA 3GCGA 1NZDA 3MWYW 5E38A 1C7FA 2D6FA 3MERA 5NLLA 1QR2A 4KK4A 3OCYA 2VRNA 3K9QO 5FAKA 1BRTA 2C2HA 3W2GA 1C9YA 3KJHA 1D1SA 4HD8A 4XQGA 2H57A 3HSYA 3RLFA 4COKA 1LPSA 1PK8A 3FGPA 3SZUA 2D74A 1APBA 2OXTA 3QZUA 3HCNA 1HR0B 2X8BA 1B2RA 2XZPA 4MMZB 4UC0A 2P8SA 4IXMA 4UW9A 1QF7A 4WVFA 5E7IA 5AIBA 4FT4A 2FPIA 1A96A 2H2AA 3GEHA 3VR5D 2NV0A 1DC4A 1QNLA 3TDNA 1T0PA 3ZWXA 4GL4A 1Z35A 2LD4A 1EVKA 2WFMA 4M54A 5DZSA 5I3ZA 1JMKC 3DQPA 4AT1A 2QN1A 4GW3A 4HK4A 5JLJA 5IT0A 1LV7A 4FEGA 4YAFA 2ZETA 3VJMA 4WBNF 4FEYA 2ORVA 1GPMA 2WR8A 4YP5A 1EP9A 1UOEA 4CBVA 2YZ7A 1IBCA 5CUQA 4P2BA 2NU9B 2J6CA 4ZDKA 2OP0A 1FMCA 2BEUB 3BA6A 1XR3A 4I36A 1V4NA 1IZ7A 4L78A 4BCCA 4OYLA 1PR2A 3KYDA 4PSAA 4XARA 1LX7A 3FPGA 1YJXA 2XUZA 1R0XA 3NP7A 4YRJA 4B75A 4K5QA 4BGVA 2TMKA 1JSXA 2R68A 3SJBA 1Z8NA 3RUEA 3HKEB 4I5GA 4R1UA 3UTDA 3AVQA 4IJ6A 1DSSG 3TX2A 1Q1QA 1TKCA 5KQMA 3I9JA 3V4VB 3EVFA 5DCYA 1BFKA 1K6EA 4FWIB 4Y2QA 5DW0A 3DMTC 1JBQA 4I50A 3DGFC 3RABA 5DYTA 3IB3A 1AGPA 3G2IA 3LH5A 1GG8A 3UJHA 1EM6A 1ZMBA 4EG5A 4EW1A 1QO0A 1R6XA 1XTZA 1Z47A 5C81A 5J58A 2MYNA 1JIUA 4DZTA 4ETNA 1NR7A 1WZEA 5F35A 2GRJA 2QRLA 3TZ6A 1VE3A 3Q8LA 4ENQA 1T2DA 1JIXA 1QHSA 3D3EA 3AQ4A 3HN6A 4BNMA 2Q8PA 3HSKA 3LK7A 2ILTA 1DQYA 5FOVA 2X0JA 1RI2A 3BE8A 3P2KA 3ZXSA 1VL2A 4EF6A 3BULA 3RYTC 4PCAA 5EEGA 3GRFA 4TSFD 4D8WA 1ODSA 3LD9A 2G1JA 3C39A 5A3QA 5DX8A 3DEAA 2B6NA 2YX1A 2PMKA 3KT3A 3SYTA 5KX5A 2R0QC 4M86A 4AF7A 1X8JA 1XTJA 1XNRB 1HKHA 1Z25A 3GXOA 2H7CA 2GTHA 2M1XA 3QTTA 4UTXA 4X8HA 3CKKA 1XZBA 4OJQA 1RHKA 4TVBA 2FZ5A 4F3TA 5DOVA 3CZ9A 1OBHA 1J25A 2WYWA 3VMMA 4X65B 3CVWA 1KYVA 4KUGA 4N82A 2PAFA 1JR3E 1RAEA 1SHUX 2ORED 1JW9B 3AW8A 4TVOA 4KO8A 4YJKA 1VG8A 1K3TA 4MIEA 1ZS9A 1Q74A 3UB2A 5FUWA 4QNNA 1EVIA 2N46A 4IV8A 2WZQA 3B85A 2FPKA 4U3JB 4Y2VA 1JHAA 3C24A 3H0CA 1NF3A 4AN4A 3I2YX 3LWDA 4KLCA 3HKDB 4PSVA 1C9DB 1MAVA 3ICVA 1MABB 3I52A 2JHAA 3CUKA 2XYGA 3E9ZA 3C97A 3AKDA 4DR5B 2ISCA 3CSUA 4ZU3A 1L9XA 2C8VA 2PMFA 2RHBA 4AJ4A 1G20E 3RRMA 4HXFB 3DLAA 3D02A 5DI9A 4Q7QA 1M75A 3DDUA 4C6HA 3AETA 4F93B 3UT5B 1KK0A 2Q5CA 2LP4Y 1NVAA 2VRBA 3UAWA 4YYEA 2MINB 3GMSA 3P52A 2H9IA 3R1IA 3M2PA 3JATB 4M1YA 5KHAA 1N1MA 1E4OA 2W11A 1B8NA 2AE2A 4HUJA 5LJLA 3EXHB 1RPZA 3LWBA 4ZOEA 1RVV1 1IE3A 4ZPJA 2JCVA 1M8FA 3K35A 3T3MB 4XB1A 3PPXA 1JJIA 2CY0A 3USCS 3ZE8A 4M3NA 2X1VA 2FOXA 3NT5A 5G40A 2WWFA 3PT9A 5C4IA 1XU4A 1QRAA 3ISVA 3DTVB 2IEGA 2O2CA 1HKUA 2PGLA 2ZVPX 1QRUA 1E6CA 3OZTA 2BGRA 2CBGA 2FHPA 2ZWPA 3L8HA 3OD1A 1YD7A 3OWHA 3L04A 5TQJA 3V2HA 4MR8A 3KQHA 2ZVJA 3WJ1A 4NY1A 5BURA 3PNOA 2X9LA 4I6GA 4D3FA 3TR6A 1IB6A 1L4GA 4LYEA 1H2FA 3TK1A 3ZVLA 3SMQA 2G88A 1JX6A 4YWJA 2A5FA 3PJGA 5A9TA 1ONBA 1DWPA 2O9JA 2QTLA 1AF4A 4PRKA 3WDMA 1SZJG 4R1PA 1TK2A 2P6NA 4F1KA 3KQWA 5HYVA 1UZAA 3TLGA 1QCCA 2PS9A 2GBIA 2E3JA 2CK3D 3DEZA 4PQEA 3RU3A 3UNXA 2QP9X 4L0CA 1OLSB 3B1JA 3DLIA 4DT1A 1SXQA 2Z30A 3ENVA 3D5TA 3FOFC 4CKBB 1SXHA 3HN2A 3B3QA 2BZ0A 3B12A 5CIQA 4FFMA 3ZV5A 1IJBA 1A7JA 4FFRA 4TTSA 5DGHA 1ZYUA 1KO5A 1LI4A 2VWGA 1D09A 1OROA 3H04A 2ZYDA 4EQZA 4JDUA 1G8YA 4TSKA 4JBHA 3KLMX 4Q4JB 5EWLA 5JPDA 5L6MB 4N40A 1UBFA 1OH5A 1SCUB 2GBPA 2VXYA 4I55B 1CIJA 1DV2A 2V96A 1N0HA 3R7DA 3U3MA 4M7RA 3JSAA 4RL6A 5BR8B 1Q0QA 1TA9A 5DM2A 2CDCA 4HH4A 2GN0A 2QUJA 3FYUA 3GT0A 3L7CA 2OECA 1U9YA 3GUCA 3MWEA 4GKBA 5DHTA 3STVA 1UWKA 2CE2X 3A32A 1FFDA 3KO8A 1NYRA 1YBMA 4ALKA 4UBLA 3OLYA 5D3ZA 5FHRA 2BH9A 1XEWX 4MV1A 4DCCA 5K05A 1YFJA 2GCOB 2Q9BA 2IU4A 3OM0A 4M1EA 3W5AA 2OV3A 3LF1A 1BCRA 5C34B 2HMTA 2ISQA 2OMKA 3GP5A 1VL1A 4UHJA 5DFAA 3NEYA 4FZJA 1QP7A 4E1BA 2I6QA 4HYYA 2D4AA 2JD0A 3N2IA 3EY9A 3QOYA 3WIDA 4CG1A 3A4IA 1NR5A 2G28A 1FC0A 1IBSA 2Q5HA 3QY0A 4QRIA 5HGJA 1JT9A 5IC6A 1UEJA 3OF3A 2J3DA 3IP7A 3QWIA 1XFDA 1Y9DA 2C3MA 4JKOA 1NVUQ 3MWDA 4XPIA 4CEHB 5TMPA 2WJIA 4UQOA 3U6KA 2BRUC 1DC3A 4C9BA 1S8OA 1A4UA 3HM9A 1R5JA 2B6HA 2CNBA 1RJ9B 1JYSA 2H4JA 2XWBF 3ER6A 2I54A 2VHJA 3JYHA 1DRKA 3H4MA 3HRIA 2MMGA 3C7TA 3NTUA 4GM1A 4II2A 3U13A 3H5WA 1K3FA 4ZU6X 4BL5A 1DMSA 1P91A 3QE4A 1OH8A 2OO3A 1J23A 4FYYA 4BS9A 2ZBEA 4B4UA 3KDSE 4M1TA 5EJAA 4YPVA 4IEFB 3P2MA 5LQAA 3QPCA 1HFKA 5A4KA 3IA7A 4MRMB 1TYCA 1AMNA 3DM5A 3FN4A 2EFJA 3FTCA 5JHHB 2W6ZA 2YFQA 2DFLA 4MUIA 5ADWA 3IA2A 1RMYA 1MAWA 1YQUA 3MFYA 4PX5A 3FKSA 4RJIA 3LUDA 2IHBA 4JGIA 1LJ8A 1OV6A 1Y5MA 3F6YA 2PRKA 2QJTA 3B6KA 4C0KA 1GYQA 1TCUA 3F7MA 3CT6A 3V42A 4DJFC 5C7IO 2WUWE 4DV0B 3WHKA 3FTDA 1JAHA 4OOFA 1IXSB 3OA0A 3QE0A 3T7KA 3MMSA 2ZR7A 1UZMA 1J0XO 2YC2C 2FP4B 4KE8A 1RWXA 4X1YA 5JYDA 4EJFA 3ZGZA 1HF3A 3WSWA 3KAPA 1RQXA 4N3BA 2F64A 1BC5A 5G41A 3L4BA 2GWHA 4KR0A 1MXHA 2G0TA 3LIIA 5DHUA 3DE3X 4EFKA 1ESMA 3OE5A 4R9UC 3L8EA 1F9AA 5IX8A 1QIKA 2ONCA 3R5SA 1B0PA 4BEBA 3K9CA 1S3SA 1XLTA 5FV4A 3H5RA 4IS3A 5SY9A 2WYHA 2C92A 1DARA 3LECA 2RHJA 3IOMA 1O77A 4MJXA 4RORA 1TOAA 1ZJ6A 1U31A 2F3UA 2IUFA 3I8SA 4XZ3A 1ZNYA 4C2TA 5A3RA 4WK4B 4N3AA 1SKYB 4FDMA 3JD3A 3VU8A 3CTPA 3SDZA 5LUAA 3TOCA 2MHCA 4WZAA 5ALPA 3SYKA 1M6WA 2BD0A 2DMRA 3LHKA 3B53X 1O0CA 5TGZA 3CONA 2MYPA 3EQ2A 1KAMA 4QUEA 1X1CA 3B2QA 4FMDB 4UTVA 4IFIA 3BFKA 3DZKA 2XUAA 1GTZA 2ZIEA 3PIDA 4Y98A 4BQRA 3QPBA 1CY0A 1Z83A 4XLLA 4ZHSA 4ODIA 1LF5A 1JG2A 2X8JB 2ZCUA 1NP6A 2XNJA 2O0JA 3UMFA 3V8RA 2QY6A 2ZB7A 3HWWA 3CNEA 3H13A 4WESB 1H0SA 2SCUB 1QKKA 1PG0A 1V1MB 4PLPA 4YO8A 1RZRA 1JMYA 5KOYA 1W87A 1UKCA 2IYTA 3EGXB 3G82C 1PYGA 2FWIA 3I2FA 3O74A 8GPBA 3BCSA 4IUDS 2IW1A 2ZTVA 1M2FA 4IYRA 2ENUA 3LBAA 5FEMA 1X92A 1KSHA 3IIJA 1UMDB 1Y9EA 1ZIPA 2PQ2A 1W8DA 4Q66C 2CL0X 1NM5A 2H1FA 5F3DA 3EA4A 2BGNA 1CVIA 1QONA 1G6HA 1ZW1A 1YU6A 1U2GC 4DBVO 3Q98A 1QDLB 2FUKA 4FFBB 3T3EA 1NJ5A 1PR6A 3ENWA 3TFWA 3VH4A 1A7AA 2JJQA 2GPNA 2NU7B 3JQAD 4UTOA 4XWKA 2BJVA 4KX5A 3NOVA 5HIMA 3GP3A 3CJQA 4O3MA 3RKSA 4ARVA 3MJSA 2H9AA 4ZOQI 2YMMA 2N47A 3H1EA 3HU1A 1U0LA 1EP2B 1CZRA 1BA3A 3EEBA 4AJHA 9ATCA 2Z2KA 5ESRA 1N2BA 2WPDA 2ADOA 4KJZA 4A0RA 3CZAA 2TMDA 3M4XA 4PFQA 3GEDA 2UZ1B 4DB4A 5FEUA 1Y89A 3MAAC 4FXOA 4H7DA 1CNMA 1T43A 2YV4A 1Y3BE 4HMQA 1Z74A 5BWCA 3BDIA 2D2VA 4FR0A 3JVEA 5ER6A 3WGQA 3BMNB 5THXA 3U4CA 1LI7A 2W58A 2AC7A 3AJAA 3OJOA 3PNLA 4OD0A 5AHXA 2IZ1A 1PR4A 1YBFA 1ABFA 1JG6A 1QPZA 5FA5A 3AF4A 4HNHA 1CRQA 1K3UB 1E1CA 3DBOB 3TBHA 3FNRA 1OI2A 3ACDA 1JG3A 4XRGA 1H23A 4IKEA 1T5HX 3IEKA 5KYKA 1OXBB 4EBFA 3UV6A 3WGIA 1WEKA 5BSHA 1TM1E 1C4WA 3DYVA 1PL7A 2AJBA 3HB1A 2Q3JA 3KZVA 1I4EB 1I2CA 3MTAA 2CYAA 3P5BA 3P94A 3CNLA 4JASB 1CZLA 1C50A 3TGPA 3Q9LA 1WD5A 4HDRB 2BHNA 2HA3A 3QH4A 3QI2A 2O3JA 3T5CA 3W4IA 2JZCA 4LQCA 5C7OO 2ZRLA 3MBKA 2P78A 3AY3A 2XRFA 4Z9AA 1LFDB 5ESDA 4ZC8A 5AJXA 2P67A 3LC7O 3U80A 1ODJA 2Y0EA 4FJ1A 1ZUNA 1KDPA 3A2MA 4N0MA 4QTZA 4C2BA 4DLZA 2ZRBA 3H0KA 2DTEA 1I01A 3NRCA 5FNZA 5K0GA 4S05A 1MX9A 2WTNA 4MX8A 4ZIRB 2D0OB 2GOYA 1NX6A 2V74B 4TZKA 3W6PA 5COAA 1J2TA 1ZC4A 4A23A 2WOOA 3TQSA 3EXG2 3H11B 2X0FA 4OLAA 3TCNA 4AULA 1JG4A 2VPXA 3U9SA 3VU9A 3ZTWA 4MVWA 3AKYA 4KXMA 3AB3A 2PTHA 4KBGA 5EHXA 1B3RA 3CYFA 3C2QA 3ZXXA 3R3XA 4TN1A 2QB5A 4F1WA 2KX7A 5HE9A 3GHYA 1DXYA 5CCBA 4B3FX 2WD9A 1GTMA 3FPLA 3I34X 3IQZA 5C1DA 4MTCA 2ZRGA 4NOJA 3AIOA 2ZDGA 4E1VA 3F4KA 2Y1LA 3HV2A 3QOXA 1Z6TA 1W59A 1JEDA 2QRMA 3GUVA 3I2HA 2DB3A 1YB6A 3IVCA 1Y8ZA 1Q11A 3KEOA 1IHXA 2YMQA 1OSNA 1XD9A 2G9RA 3IPLA 2GEFA 3LOPA 2ZB3A 3RYCB 1RYZA 2XVYA 4O4HA 1XF9A 3MCTA 3SSMA 4E6EA 3L7AA 3SJ7A 5LQKA 4K2HA 4FPXA 1L4KA 3GLIB 2HNAA 1ICEA 2Y27A 1RKVA 1TFRA 2ZI7A 2FN8A 2HDHA 2YY7A 3NJ4A 3JSXA 4MUKA 4PR3A 4EFMA 2VO1A 3EZFA 4LMRA 5HGXA 2ZYWX 4WD3A 3N1UA 1U7WA 4PLTA 1KVRA 5IBCA 1P3DA 1Y3CE 1ZVJA 3EGOA 1S9HA 1KMHB 3HPQA 1LDNA 1KH1A 4FZVA 4YDRA 1K92A 4AS3A 5AW4A 3ZU4A 2TSYB 4GI3A 3FTEA 1S2LA 4UPVA 2P7HA 2A5DA 1O4WA 5EE0A 4HDNA 3SOZA 4PC3A 4PGAA 3VVLA 5DN9A 2XUHA 1V2HE 3PJEA 2GZMA 3RSFA 2VDPB 3K0FA 2I6FA 3PHIA 2XDYA 1EA5A 3I9KA 2WIAA 1S5PA 2CZCA 1A50B 1U7DA 2COKA 5B1YA 5CT6A 5B2FA 1G19A 1O9GA 5EZ6B 1ULZA 3EIXA 2IV3A 1ENYA 4LZWA 4MJ3A 1EFTA 5ILQA 2GYUA 1K8YB 1OD6A 4BNYA 1J21A 1SCNE 1ORVA 2DCMA 4LJ9A 2Z1DA 5JCPA 4YQZA 1AH2A 3IP3A 3B1VA 3DM9B 4OGKA 4GPD1 4PHGA 4QXRA 3H2IA 1PKEA 3OKAA 4XGRA 1UC9A 2AVNA 2WE8A 2Y1KA 3G9TA 4H6XA 4CT5A 4DXAA 3TQCA 2JANA 3JZAA 3VX4A 1B00A 3W5VA 1W0JA 4KSCA 2K4MA 3JVVA 4AMGA 3PGA1 5JSQA 3LE8A 2O3QA 3QJ5A 1RI4A 3A4LA 2G1AA 4TLEA 2ZWIA 4U7HA 2VRCD 4D9HA 1D0VA 1SXJD 2GD2A 1C14A 2QW8A 4GYJA 3K9GA 4YRCA 2XPCA 3O94A 1IZYA 1NE2A 1WIWA 3FWPA 4JBWA 1NVGA 4W5WA 1HLDA 2C96A 4QEDA 1SKUA 4XJSA 3RS4A 3W0LB 1HL3A 1P77A 7GPBA 5KPDA 1OZGA 1P6UA 1JKFA 3FDFA 5B1SA 2SHKA 4F21A 1EEXB 3I1IA 3MGCA 3ESBA 3K0AA 2AOTA 1EDEA 1MH9A 3RUIA 4BP1A 1QF9A 3KJFA 4Q03A 5K2OA 3HZOA 4AVYA 3EXFB 1OWNA 1GG5A 5A0TA 4HUTA 3BGWA 5C7YA 1KQ3A 1QS0A 2HLDA 1NLUA 3A9RA 1CU1A 1YE5A 3E1KA 2FUEA 3IMKA 4N18A 4RZXA 4P58A 3O7MA 5FJIA 3PFIA 4I14A 2PV7A 3ETCA 1GZ3A 5EESA 2OL4A 1GQYA 3ETEA 3FYHA 1U0EA 1MF7A 1QZTA 2OAGA 3NONA 2OG1A 2PX8A 3FNHA 5FORA 5HMMA 5D7NA 1L5QA 3K0BA 1AKQA 1NLFA 4JEIA 2JEOA 4IGAA 2QK4A 3HDGA 2ZBFA 3ZGOA 2CJWA 4WW0A 4X94A 1G6Q1 3H2GA 2KMLA 4HPWA 3DOUA 5AR1A 2V4UA 2H29A 4TWRA 1FFAA 4V02A 2K87A 3HO1A 1OMOA 4MB6A 1KPHA 1TQ4A 2NZUG 3HY4A 3N3BC 3O1IC 4QEZA 5IYZA 5IAGA 4OX9B 4MAAA 1YAHA 1EJ6A 2FR0A 3OE7A 1SVOA 1V1RA 4C08A 2HH9A 3K0HA 4EA8A 2AG6A 3MNFA 1TD9A 3A4NA 3AY7A 4GS5A 4B32A 3TKAA 4IMIB 5HOQA 4FMBB 4OJMX 2XNHA 5EVCA 4EB6B 2X0NA 3D8SA 4V2IA 5HTOA 2RGEA 1L4EA 2RK4A 5HE8A 1UP6A 3Q3GE 3HK2A 3N7UA 3CSSA 1OWLA 2VBCA 5HFNA 3C48A 3VAZA 3HWRA 4H17A 1YC5A 2AQIA 3AERA 1YVDA 3DEKA 4GOOD 3M3DA 4BO4A 3I32A 2B5OA 4HAXA 4HG2A 1P2UA 1DLJA 1XKQA 3DLTA 1IY8A 1EZ4A 4JBIA 3T5TA 1XPUA 1ZJ5A 2C4UA 2QPOA 3PUYA 5ALNA 4OSPA 1W4ZA 2HX1A 2GVDC 2VXOA 3F5FA 4H7JA 4CCYB 1FX0A 3A3KA 1B8OA 1V8BA 2OBMA 2UKDA 1B6RA 3M4JA 3EXHC 4ZVQA 4GL2A 5EEHA 1JJAA 5M2QA 1BEUB 1QIDA