1LDMA

Refined crystal structure of dogfish m4 apo-lactate dehydrogenase
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
329
Chain Sequence
ATLKDKLIGHLATSQEPRSYNKITVVGVGAVGMACAISILMKDLADEVALVDVMEDKLKGEMMDLQHGSLFLHTAKIVSGKDYSVSAGSKLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKHSPDCIILVVSNPVDVLTYVAWKLSGLPMHRIIGSGCNLDSARFRYLMGERLGVHSCSCHGWVIGEHGDSVPSVWSGMNVASIKLHPLDGTNKDKQDWKKLHKDVVDSAYEVIKLKGYTSWAIGLSVADLAETIMKNLCRVHPVSTMVKDFYGIKDNVFLSLPCVLNDHGISNIVKMKLKPNEEQQLQKSATTLWDIQKDLKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined crystal structure of dogfish M4 apo-lactate dehydrogenase.
pubmed doi rcsb
source organism Squalus acanthias
molecule tags Oxidoreductase
molecule keywords M4 LACTATE DEHYDROGENASE
total genus 105
structure length 329
sequence length 329
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1987-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ldmA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1ldmA02
4NK5A 3VKVA 4FFPA 1DC4A 4AJIA 4KZPA 4GX5A 5DULA 4BNXA 3WBBA 5GZ3A 4ITUA 4YT4A 2FY8A 2QG4A 4BKQA 4P4GA 1GYQA 5DOZA 4YBZA 3I3OA 1E3WB 1SBYA 4OGWA 1T2EA 5DCYA 5ILOA 5JC1A 2OGUA 3WFJA 3NT2A 3PHHA 3PK0A 3EAGA 3UN1A 4MVJM 3MEQA 1LXCA 4MVJI 4ALKA 1LRJA 3KSUA 4NMHA 7ADHA 1PQWA 5C37A 2I99A 2O3QA 5TS3A 4XYLA 2WYVA 3RSHA 4IJUA 3NDRA 1H2HA 1GQ2A 2GUGA 1KC3A 3WIDA 1QLJA 2YY7A 4PG4A 1X1TA 3IJPA 3DBLB 4E2ZA 3FNHA 3IC5A 3Q1LA 5I7EA 4BNHA 3GMDA 2BFAA 5KJFA 1VJ1A 1K2WA 3G0OA 1PS8A 5DCWA 4J43A 4NBRA 3O4RA 1B15A 1R15A 1PZFA 1DRWA 3FPCA 3WGOA 1TVEA 3JQGA 1ORRA 3F46A 1R16A 1YQXA 1RYEA 3GH3A 2ET6A 2G5CA 3ZWNA 2AE1A 1HLDA 2D5AA 3NT5A 5JO9A 1QXSA 1ZEJA 3WMWA 3FNFA 1J6UA 2E48A 1LLQA 2ZYGA 5G4KB 4AFNA 1PS0A 3H6KA 1XEAA 4J4HA 5G0VA 3S55A 3IL2A 2DT5A 2C5EA 1KY4A 1DC3A 3NKLA 2O2YA 3Q2KA 4FQ8A 4RVUA 4JBIA 3W8FA 2B69A 3SEFA 3H4VA 1HLPA 2DBZA 4D79A 3I83A 3WWZA 2BI7A 1UP7A 3W4KA 2VYND 3GUCA 3ONEA 1Y6JA 4CR6A 1GZ3A 4ALMA 1WDMA 5JBIA 5KJ1A 4XR4A 2RAFA 1A7KA 4U8GA 2P9EA 3PFWO 1LA2A 4CM9D 3HQ4O 2PZKA 1NQOA 3AJRA 3O38A 4MIOA 2OP0A 4I5GA 3R3SA 3HB4X 4Q3DA 4ROSA 1PS9A 3A4VA 3C1TA 1EMDA 4JN6B 3MTGA 1E7MA 1T24A 3FSRA 3RJ9A 4IDBA 3UCFA 4NBVA 3E03A 2YV2A 3EW7A 2G1UA 1GPDG 4J4BA 2ZTUA 5TQVA 1GUZA 3RC1A 3LLSA 3OM9A 2XF8A 3L9XA 4O59O 5HA5A 2JAPA 4IGEA 4MKXA 1ULSA 3U09A 5JYEA 2VWHA 4GKBA 5G0UA 2EG9A 3PI7A 4RLHA 3JD3A 1YBMA 3PHGA 4I9HA 4BO8A 3IKVA 3P2OA 1XG5A 1V3VA 4GX2A 2JD2A 4INAA 3O03A 5TJHA 1T1RA 3WSVA 1T2FA 1DBVO 3IUSA 3RFTA 3AOEC 3F5SA 4K1LA 3QVOA 2AQKA 5HM8A 4E32A 2DTDA 4N18A 2H6EA 5TNXA 3DZGA 3ONDA 2OFPA 4XYBA 5IDQA 5JCJD 4HV4A 4EUFA 5KJCA 3FPLA 1EVIA 2PGLA 2WJPA 1Y8QA 3VZQA 1X13A 8LDHA 1P9LA 4RVFA 3BMQB 1BXKA 5AXDA 6ADHA 1B8VA 1BVRA 4U6QA 5AXBA 1BDMA 4HXYA 3DZFA 3GN1A 5T64A 4MIEA 4BNUA 4GX1A 3KEQA 1YBVA 3PDUA 5B4VA 1VSUA 4R1UA 4ND5A 1O0SA 3ASUA 2B0JA 3QE3A 4R1SA 4FC7A 3OEWA 2ZATA 1YB5A 3ZU4A 1Y9AA 5H81A 3TZQA 2BELA 5KKAA 1T25A 3DZJA 1P1IA 3MJTA 4YB8A 3H5NA 1C1XA 1BG6A 3CZMA 3L4SO 4WLUA 2PKQO 3L6OO 4OO3A 1B8UA 4I1IA 1D1TA 4R9RA 4DGSA 1XHLA 3G79A 1YONA 4JIGA 5L40A 4YTEA 3FRJA 4IJWA 4E33A 3A06A 1P1RA 4C4OA 4QFCA 4NFYA 3ZV4A 3G3EA 3L07A 4I9NA 4YWJA 3STHA 1K6JA 2Q49A 1M66A 3L4BC 1LLUA 4EJ6A 2Q4BA 3DMYA 4BGVA 3E18A 2EW8A 4N54A 1O94A 2JCXA 3PZBA 1CEQA 2HMTA 1W6UA 3UUWA 4R68A 2JCVA 4BMVA 4CM6A 4FPXA 3TNLA 1X0XA 4YQZA 4MVJP 1PX0A 1GCOA 1PJQA 3W6ZA 1PGOA 2BGMA 2Q2VA 3H9GA 1Q0QA 2FZEA 1PWZA 5IZCA 4BKOA 4OIMA 4ND4A 4M1QA 2O4CA 1Q2XA 5I8WA 3WG9A 4QUKA 3DBHA 4B7CA 1MXHA 4OSPA 4OYRA 1LDYA 3AM4A 3X2FA 3D0OA 4B7XA 4XIYA 3GVPA 2RH4A 1LC3A 4W6ZA 3QVSA 1SZJG 1HE2A 3OQ1A 4L4XA 2VHYA 3D3WA 2HO5A 1RM4A 1ZSNA 2CMDA 1DSSG 3EMKA 5AYVA 2QX7A 2GYYA 3DO5A 3H9QA 4G81A 4ALLA 4HFJA 3TFQA 5JYDA 1QYCA 2ZJ0A 1RM5A 2CF6A 1P1KA 4IXTA 1JN0A 3KSZO 4WKGA 4YRBA 3GDOA 4UEJA 4GX0A 1U3UA 3K30A 2JHGA 2YUTA 1NPTO 1PL8A 4R41A 4EEZA 2AA3A 1MFPA 3HDJA 4CMEC 3I4CA 4BNGA 1QP8A 1UDCA 2RCYA 1PJBA 2C07A 4JJIA 4K9DA 4OKNA 3QSGA 5AXAA 3RU7A 1GUYA 3JQ7A 4TROA 1XELA 3IS3A 5BQFA 4WLEA 1E6EA 5I7FA 4XKJA 3B1KA 1ISJA 1QYWA 3GLQA 4IJKA 5EERA 4BQRA 3HWRA 3IP1A 4CM5A 2LDBA 3DC2A 4YT8A 4AJPA 4GGPA 5T6BA 5L51A 3WQQA 3C7CB 1WAMA 4YCAA 2UYYA 5ICMA 1BMDA 2ZJ1A 3SXPA 1X1EA 1QV7A 4NFHA 4CV1A 1A9ZA 5FI3A 3MOIA 4Q3NA 3RUCA 1X7HA 1Y7TA 3V2GA 5JCXA 2NTJA 1DFGA 2BGLA 1X7GA 1E7QA 3TQHA 1LNQA 4JGBA 2BD0A 3KM0A 3GNQA 5IDXA 3JQ8A 3INRA 3PJGA 4RF5A 3I52A 5JDIC 2VHZA 3GQVA 4UVGA 1MA0A 5KVSA 3LT0A 5HBRA 4PLCA 1YWGO 2E6UX 2CY0A 1HSZA 2ZTVA 1E7YA 4UVDA 1HE5A 2EKPA 3MCVA 3OJOA 5U1PA 2X23A 1VE9A 3BMQA 3K73O 3EK2A 3ONFA 1DDOA 3KYCA 3ANMA 3D4NA 2A94A 2AG5A 1L1FA 1DC6A 5A5FA 4ILKA 1KVQA 4ONEA 5A02A 4DMMA 3LC2O 3LDHA 1E3JA 1WDLA 3JQ9A 1RPNA 3NTOA 4BKUA 4Q9NA 4IJVA 2NM0A 4PLZA 4KDFA 3I9NA 3V5NA 4NJMA 3UKOA 1E5QA 3FNEA 1U3VA 2Q4EA 2JFGA 4MOWA 4L74A 4EGFA 4XGKA 1CDOA 3EZYA 1FDWA 1UXHA 2QYSA 3FF4A 4CLHA 4LVUA 3R3JA 4CM1A 3G1UA 1QORA 4PVDA 2A9FA 3WICA 3WQRA 3NTRA 2WYUA 3FWNA 2B5VA 1EFKA 1HETA 3UW3A 1I0ZA 1CRWG 2FRDA 1J49A 2J6IA 1M6WA 2Q1TA 1UZLA 4AJ4A 1Q0HA 1PJCA 1M6HA 2Q1UA 1F0YA 2GGSA 4OQZA 4I5EA 4AJ1A 3NTQA 1U4SA 2OORA 5L4NA 5DBGA 3ABIA 4FFRA 3ZI0A 1RKXA 3GPDG 3C85A 3E9QA 4RGBA 2C59A 3C24A 1KC1A 4BNWA 3Q3CA 1ZKMA 3GGPA 3OBBA 2J3HA 4RF2A 1ADFA 3WR5A 5L4LA 1KEVA 3OA0A 3DOOA 1LTHR 3Q6IA 3GF4A 4CMEA 4E5NA 3OICA 1EEHA 3GT0A 4WCFB 3V1TC 3PRJA 3O8QA 3U62A 3ZWPA 4FJ2A 3ROMA 4BO2A 3ITDA 5THKA 5IZCC 3U9LA 4R1NA 3DZKA 3DONA 3PHLA 3LF2A 1R4NB 1HT0A 4CMJA 3Q9NA 3EGOA 3VH2A 1QG6A 3RBXA 5DP2A 3JSAA 3L77A 3F3SA 3VTFA 2NU8A 4DC0A 3KO8A 1BHSA 3TPCA 4J4TA 2ZB4A 1HDCA 1KBZA 4AVYA 2PV7A 2X6TA 1P1FA 2J5KA 1WW8A 2HJRA 4FCCA 1UUFA 4CM3A 1K0UA 4ZN6A 2OP1A 1GTMA 3LC7O 3QWHA 6LDHA 2Y1CA 3ENNA 3ZHXA 4Q3BA 5I9LA 3I4FA 1N2SA 4I8XA 1XU9A 3H3JA 1ISGA 4B3IA 4BNJA 1QSGA 2YDXA 4Q3CA 1YKFA 1C1DB 3AI2A 2I3AA 2YDYA 2CDAA 3ANLA 4YJDA 3GVIA 1DJQA 3LT4A 1A9YA 4BNZA 3PP8A 4GI2A 4IDEA 2VN8A 4LSMA 4QQRA 3M6IA 4AJKA 4HKTA 3JQFC 4MP6A 3MOGA 3F47A 1LDBA 2GERA 3GNSA 4H15A 4WNIA 4QSMA 4AJLA 4Y6PA 4GWKA 1B26A 3PDJA 3ADPA 1LSSA 2D2IA 2I9PA 3EC7A 4RPLA 2J8ZA 1R0SA 4LSWA 2DUUA 1RM3A 1PGNA 4UUPA 5JCJA 3KV3O 4IDGA 4AJNA 4W4TA 2DAPA 2O3JA 3HJAA 4ZJUA 4L76A 4CR7A 1E0DA 5DOVA 4N7RA 3GVHA 3I23A 2BFMA 3P7MA 3L4BA 4NDNE 1RM0A 5A1TA 4C7JA 3V8BA 1FJHA 1E1LA 4L8VA 2EGGA 1EVZA 1MG0A 4AJOA 3CZRA 3AY3A 1GU7A 5CEFA 2UUPA 4IDCA 4R4JA 5JY1A 3PZRA 1Y5RA 4MDHA 5JMPA 4O0LA 1XQ1A 1G0NA 1V0JA 3AOEA 4IIVA 4IMPA 1YVEI 3RU9A 3WGZA 3ZU3A 5L7TA 3BXXA 2WD7A 4BGIA 1CIVA 4JROA 3RKUA 3QV1A 3GK3A 4BO4A 1YRLA 4TSKA 3FWZA 4KOAA 4ZD6A 2GD1O 4J3FA 5KVCA 1AXEA 3V2HA 1UAGA 1N7GA 2W8ZA 4RVDA 4BO7A 1ZZEA 2FR1A 4RLSA 3GEMA 3KEOA 2VQ3A 4UEOA 1IE3A 3WGQA 3M2TA 2X5KO 5T67A 1JU9A 4Z3KA 4BQPA 5CEJA 4II2A 4H3VA 5JSFA 3LYLA 4W99A 1ENOA 2ZB7A 3ULKA 1BXGB 2A35A 3QRWA 4Q39A 3ROKA 1YL7A 3D4PA 5IDYA 4NHEA 1T4BA 1UZNA 4H7PA 5CP8A 1NAIA 3DBRB 4J2HA 1NXQA 4ESOA 1BW9A 4YEDA 4DIBA 5T8KA 2V6FA 4E5YA 1YE3A 1BDBA 3L6DA 4BV8A 1IY8A 3NRCA 1VJ0A 2NVUA 2O2SA 2LDXA 2Q45A 2VRCA 3BHJA 1P44A 4XQEA 4YACA 1ZW1A 4KWHA 1IL0A 4DUPA 4RV9A 3HFSA 2WEKA 1B8PA 4Q3EA 3A9WA 4UVHA 1PQPA 2Y99A 5G4LA 1O5IA 2EEZA 5JMWA 3GVXA 4W7IA 4DVJA 2YHUA 5GMOA 1PWXA 1ADCA 1HF3A 3U0BA 1E3EA 3ZNQA 1ADBA 5CDSA 2BGKA 1MUUA 3FR8A 3S2GA 2CZCA 3DHYA 1QYXA 5JAQA 2QRLA 1UXGA 1L7EA 4BO6A 2IYOA 1N9GA 4G2NA 4L0QA 3KXDA 1U7HA 1H6BA 4IMRA 4BO3A 5CFZA 3COSA 2PH3A 1U28A 4EBFA 3FTPA 4WOKA 3GRPA 3DMTA 1I36A 2EF1A 4ZHSA 2WTBA 5KJEA 1HKUA 2IEDA 5TLSA 3VHRA 2EHDA 3KSDO 1LDMA 1GV1A 2NLOA 1DIBA 2YYYA 3U4CA 3F1KA 1GY8A 1YDEA 4URFA 1HDGO 2HJSA 2WMDA 1ZFNA 3KZVA 5ITWA 2HQ1A 4LCEA 2GF2A 1S6YA 5G0SA 3U4DA 4ALJA 3AFMA 4RJTA 3DBRA 2R00C 1UXKA 4YPOA 4R9SA 3CTMA 3MJ4A 3C1AA 1BW9B 5BR7A 1VI2A 2ZCVA 1DJNA 1XQ6A 2ZB8A 2X4GA 3BA1A 3DOJA 3H5RA 2VT2A 3RFVA 4B4WA 4TVBA 1E6WA 2VWGA 3RUEA 1ZIDA 3JD4A 4J90A 2OL4A 4EJMA 1XDWA 3QY9A 2C5AA 3OEYA 2PWZA 2RH8A 4UEKA 5ENVA 4CUZA 3V2UA 4BIIA 3AM5A 3E5MA 1EK6A 1UJMA 3DZHA 3JQAD 3QVXA 3RROA 4RZIA 4QXMA 1LRKA 3GMSA 4XZ3A 5BSEA 2GRAA 5A9RA 4XCVA 1GFSA 1GZ4A 4B8WA 5HRUA 3BTUA 2D8AA 3G1TA 4BKRA 4EI2A 2CVZA 1AHHA 1XSEA 2EXXA 1F14A 3IDSA 1UP6A 4X54A 3V1UA 3N7UA 1I3KA 5L95A 3E9NA 3UH1A 4PCVA 5EQDA 4BO1A 1Z75A 2J5RA 2VOEA 5L4SA 4DPLA 3JYPA 4F45A 1IHYA 3WIEA 4U5QA 2Y68A 3GGOA 5EL0A 4YRAA 2HK7A 3C3XA 1YJ8A 3KYBA 4B79A 2Y1OA 4Z0HO 2XOXA 3K2EA 1KVRA 2R00A 1B2LA 4DL9A 2PD4A 4PG7A 2HRBA 2YFHA 1WZIA 4PRLA 3PWZA 1P74A 1WMBA 4U0JA 2W2KB 2Q46A 3PHIA 5TT1A 3ROQA 3ZWYA 2Q3EA 2E49A 3JYQA 3JQAB 3KYDA 1JLLA 4A10A 5K6AA 4F3YA 2V6GA 1I5RA 2FMUA 1YGYA 3JQEA 2AQ8A 1NBOA 2QW8A 3H3FA 3PXXA 5G4KA 3VPSA 1D3AA 3RFXA 2NACA 4DYVA 5MDHA 3ZWBA 4D3SA 3IP3A 4WLOA 1Z45A 4HWKA 9LDBA 1SO8A 2P9CA 1ZBQA 1PJTA 4YJHA 1ONPA 3BHIA 2I65A 2JHFA 2DTEA 3LC1O 3LQFA 1LU9A 4J1NA 4RVGA 2EIHA 1FDTA 1GV0A 2GZ2A 4DTIA 3RD5A 1ZK4A 3ZWCA 4HX5A 3DR3A 5EN4A 5TGDA 3VPHA 4MVJF 3QIVA 1B7GO 3WYEA 5H82A 3WLFA 4CLEA 4JX8A 1MLDA 1NQTA 1CQJA 3WGIA 2AMFA 1CJCA 1R66A 4B3JA 2I76A 4E3ZA 1D7OA 3HG7A 4GKVA 4MP3A 4P22A 1Q7BA 4D41A 5TIIA 3L0DA 1H0KA 4YJFA 1O95A 5A9SB 4PVCA 2FR8A 3E82A 4KMSA 3RASA 3AU9A 1WWKA 1TXGA 4IDDA 3TSCA 1GYPA 3WJAA 1KYQA 1G1AA 4GWGA 4XR9A 3VPFA 4I9UA 1NYTA 1P0CA 1P77A 1HYGA 2EW2A 5ER6A 1W4ZA 1TT5A 4E2XA 5THQA 2C82A 4YAGA 1ZMTA 3RUFA 3DTYA 4FN4A 3UCEA 5L45A 1Q7CA 1EDZA 3VZRA 5IFLA 2X8LA 3DHEA 3V1YA 5IJZA 1M75A 1DHTA 5DCUA 2BLLA 2GNAA 3Q9UA 1DRVA 3BHMA 3UAGA 3UGKA 5IG2A 2FSSA 4NPCA 3OA2A 4E2WA 1JTVA 1E3IA 1C0LA 3EZLA 3RUDA 4QO7A 2J3JA 1AE1A 4YJGB 2I66A 4NU5A 1I30A 3I6QA 4R3WA 3HZZA 4NJOA 2HK8A 4R01A 4LN1A 2JFFA 4E30A 4KQXA 2X0RA 4NJMB 4IS2A 4FOSA 1DFHA 4DLBA 1UH5A 4A5OA 3I9KA 1NQ5A 4WLFA 4CV2A 2Y1GA 3ORFA 3UXYA 4QT0A 2CVOA 3GFBA 4W82A 1E3LA 5ES3A 1JKIA 1NX6A 3C7AA 5BNFA 1LDEA 4NH4A 1EK5A 3PGXA 3U3XA 2ZTLA 3ZN2A 2C7VA 3QW2A 2NU7A 4RZHA 2CSUA 2NV6A 3RCBA 1W8DA 4XJSA 5DF1A 2FPPA 1E1NA 3I9LA 4XDYA 5ADHA 3ZNNA 3Q0EA 1S7CA 1NVMB 1GAEO 3E1KA 4OAQA 3HN2A 3TWOA 3GR6A 4J0FA 4D3FA 1V35A 3ST7A 1DIRA 3D5TA 2BHLA 2I3GA 5T57A 2FR0A 1RJWA 5IAAA 3GN2A 3GOHA 4P4NA 5I9NA 1A71A 5ITVA 1GZ6A 4JXKA 3DB2A 1LEHA 2OUIA 5FFFA 1P3DA 4RPJA 2UDPA 2Q2WA 4FFNA 5B37A 2ILTA 1KOLA 2YW9A 1NASA 3TZCA 3WOHA 2HMSA 3H2SA 2DTXA 2BRUA 4XB2A 1DIHA 3DWFA 3E5RA 4RQUA 4ALNA 3GG9A 3NGXA 4DQVA 3PJDA 5JAZA 4F6CA 3DMTC 4BO5A 1YOVA 4Z9XA 1D8AA 4GLLA 3GG2A 1PGQA 4YRDA 3QQPA 1FK8A 1Y1PA 3HN7A 3PWKA 3HE3A 3BMOB 4LRSB 3WGTA 1YQDA 4XJTA 4CLOB 1XIVA 5JNLA 2PGDA 4JQCA 4HP8A 3CIFA 5L7YA 1U3TA 2JL1A 1LBEA 5F3RA 1MGOA 3ZU5A 3ZHBA 4CMAA 2IZ1A 1TLTA 4RQTA 2C0CA 5KCZA 1JKJA 4MVJG 3I9JA 4PLWA 2OHXA 4UAGA 3P2YA 1PGJA 5G2OA 2TMDA 4D7AA 4LK3A 4N5LA 3ZNOA 2OOSA 3BTOA 1B0AA 4HUJA 5EJ2A 4CMHA 2VUTA 4RL6A 4GGOA 1KVUA 2W90A 3ZNPA 4JP2A 1N8KA 3UHAA 1SNYA 2J3KA 1NWHA 2O3SA 4K28A 2HUNA 1ZXLA 1U8XX 3OQ6A 3OIFA 5GY7A 1NTOA 3S2FA 2AE2A 2B37A 1CYDA 2PZMA 2Q99A 2NVUB 1Q1NA 1WNTA 2NSDA 1E3WA 1JWBB 3FNGA 4A0SA 4XGNA 1GUFA 4EITA 5LCXA 5H83A 4D3DA 2O7QA 4P38A 1T26A 3FR7A 4JJFA 3WDSA 3GPIA 1HE4A 4Y67A 4Z6KA 3R0IA 4WLVA 4KQWA 1MC4A 3LVFO 4Z9YA 1PL7A 1EVJA 3W8DA 1I3MA 2GN4A 1KS9A 2V65A 3NV9A 3ZV3A 1QYVA 2FPIA 4CM8A 3WMXA 2Q1SA 3AU8A 3DBLA 3QA9A 4OOEA 4GQAA 2EV9A 1I10A 4XD2A 4E5KA 1YOVB 5EMHA 4N5NA 2YJZA 3AY7A 1EE9A 5DT9A 2Y1EA 1OBFO 1ZVMA 5COAA 3CE6A 1YXMA 2WD8A 1EFLA 4HFMA 1EQ2A 2G17A 1IPFA 4J0EA 1V9LA 2PZLA 3KB6A 2I5PO 2NVWA 2ZK7A 5I8ZA 5TT0A 5GZ6A 3QWFA 3CPSA 1DOHA 4DLLA 3C8MA 4XGIA 2H5LA 4IIUA 3DHNA 1DRUA 1J5PA 3WTBA 3S8MA 3NX4A 4BGEA 1FF9A 1QYDA 4R16A 3ZZNA 4BL5A 3NGLA 3VAZA 1E6UA 4ZQFA 4J49A 1OMOA 1B3RA 4ZGWA 4ALIA 3TL2A 4BUCA 5I7SA 3TZKA 1PL6A 4NU6A 1IB6A 2EJWA 1U4OA 2Y0DA 4Z0PA 1NM5A 1DLJA 3GRKA 1ZEMA 2DU8A 3OP4A 2I6TA 4TRNA 4WK6A 3OSUA 3E48A 1Q7GA 3JYOA 4CMKA 1I32A 2JAHA 2YFQA 2NQTA 1VKNA 3FBTA 4MKZA 1HDOA 1E77A 3FTNA 1TA4A 2Q1WA 3INGA 2UVDA 2OO5A 2ZQZA 1SOWA 5K6AC 1T4DA 2NVBA 1SCUA 2P4HX 3WGHA 1I3LA 4FSHA 2CFCA 4KWIA 3WBFA 3CXRA 2Y1DA 2DVMA 1R4MB 3WFIA 4C7KA 1JDJA 4KUHA 1UZMA 2HMUA 4CL8A 2Q50A 2IRWA 4Y98A 2P5UA 1DO8A 1WXDA 2FSVA 4HADA 4NNJA 5IZ4A 3NT4A 4BNLA 3ICPA 1H9AA 4AICA 1KERA 3L9WA 3GEDA 2A92A 4BHTA 4LGVA 5IN4A 2P4QA 3ETDA 2GCGA 3DAGA 4TMFA 4M87A 3ASVA 3BAZA 5K0ZA 1TB4A 3PQEA 3ZWMA 3EHEA 3K31A 1NHWA 4PLGA 5IF3A 1E3SA 3DDNA 4PLTA 1H2BA 3GHYA 3SJ7A 4DREA 1HSOA 4FBGA 1DEHA 5KTKA 5IN5A 1LDGA 3G49A 1ZSYA 4J1TA 1NWCA 1FMCA 3P5SA 4M86A 4PRKA 3LT1A 1DB3A 3SX2A 4N5MA 3DZBA 3W4JA 1HDYA 1LDNA 1LJ8A 2WWRA 4FW8A 3LSYA 3B1JA 3JQCA 1X15A 1I01A 4LMRA 2Y93A 4CMCA 4XB1A 2Y0EA 3GC6A 2DBQA 1F06A 2VNAA 3PYLA 4JLWA 4LRTB 1SEVA 2RHRA 3CUKA 5A05A 5F21A 3ZH2A 4RPGA 3B20A 4NBWA 2PK3A 4KDEA 3GAZA 5A3JA 5DZSA 1KVTA 4EUEA 3BMCB 1K89A 3B70A 2QRKA 1NR1A 3MZ0A 1ENPA 2Z5LA 5A4DA 2HAEA 2PD6A 2VTDA 1FDSA 2QQ5A 1T2CA 4WCDA 3RVDA 4OSOA 2PH5A 1LQTA 4BNKA 1I2ZA 2NTVA 4RO0A 2P5YA 2Y0CA 2ZTMA 5F5LA 4PG8A 3GGGA 4FR5A 1ONNA 1JW9B 4WNCA 3QJ5A 1LRLA 2DUWA 4BOYA 3T4EA 3DAFA 4JK3A 4J7UA 4Q3AA 1C14A 2VRCD 4A27A 2HK9A 4FDAA 3DOCA 3OETA 1N92A 2AQIA 4NK4A 4ZICA 3IAHA 5ICSA 1ISHA 1IHXA 3DFZA 2ZCUA 2DFDA 4OXKA 2AXQA 2J3IA 4DC1A 4CM9A 2UUOA 3WXBA 3DBVO 1UDBA 5KNLA 1J4AA 1W73A 2VHWA 1NVGA 3ROPA 4GVXA 2PLAA 4GH5A 4D42A 3P19A 3PVZA 3RUIA 4AJHA 1U2GA 3TRIA 1H94A 1UR5A 4U0KA 3OFSA 2D3TA 3OJFA 5JY6A 3NEPX 1OFGA 2BKAA 1NQAO 3BMOA 3TDKA 3ZV5A 4CLOA 1MFZA 5ENDA 4NQZA 2X86A 1N7HA 2V6BA 2IYPA 3Q11A 4EW6A 1U5AA 5IDWA 1A72A 2Q2QA 3CEAA 1ENZA 5KOIA 5TX7A 3ZCXA 5CAEA 4ZQHA 4IZHA 3KHUA 3QLJA 2HRZA 3D1LA 3K9QO 2J5QA 3KRTA 3UF0A 4B4VA 4XYMA 4FOOA 3VVBA 1Y5MA 3MJEA 1MG5A 2PGJA 2FHSA 2X5JO 4ZQGA 2H1SA 2VTEA 3M1AA 1N5DA 4XYEA 4KTTE 3R6DA 3K5PA 1Y81A 4XQGA 1WP4A 1XKQA 1XU7A 1OZAA 4PLVA 4OL9A 4M55A 4NR0A 4JBHA 3RIHA 5KVVA 3CSDA 3O26A 4ZVVA 4L4RA 3JD2A 1VL6A 4UVEA 1DAPA 2AQHA 4QO8A 2E82A 4IQGA 4BNVA 1V3UA 2RHCA 3KETA 1WVGA 3BMNA 4PLFA 2YZ7A 4UUMA 4YJHB 5JC8A 3ZWVA 4D45A 3ITKA 2D5CA 1U9JA 2F00A 1R4MA 2XAAA 3NAQA 3K92A 4OMUA 3JQ9C 3PFFA 2VUUA 1C3VA 2XXJA 3U4IA 4PZEA 2PZJA 3UVEA 4CLDA 4E2YA 3VPGA 3AFNA 5CDGA 3VH4A 3CINA 3WGGA 2AEJA 3PQDA 5LDHA 2GN8A 1GR0A 1K5HA 5F5NA 1LLCA 5DNAA 4EUHA 4IS3A 3LK7A 4CLRB 4P8RA 4J7CA 3ADOA 1LSUA 3VC7A 2O3UA 1DIGA 4MIYA 2EKQA 4Y8VA 2NUAA 4OJNA 3PJFA 2RIRA 4JJGA 4E5MA 1MC5A 3KLMX 3RUAA 4FB5A 5U9CA 2JD0A 3PQFA 3RBVA 3D3EA 1YS4A 3OHSX 1UP4A 1VPDA 1XCBA 3ETEA 4XDZA 2V6MA 4KUEA 2CF5A 3GY0A 1E7SA 4O1MA 1I2CA 3JQFA 3T7CA 4RCVA 4P4LA 1I2BA 2WSBA 2X0IA 1AHIA 5B4UA 2W4QA 1PGPA 5CG1A 5KJ6A 2WE8A 2BFPA 5C7IO 3DL2A 4Z3DA 2PA3A 3KTDA 4I5DA 4BMNA 3PLRA 4UUNA 4R54A 4DQXA 4XIJA 1Q0LA 3KLPX 5CHEA 4WCFA 5F1KA 2O50A 1ISFA 4TRJA 1GCUA 3T4XA 5FI5A 4WOJA 4OXNA 3WTCA 5CDTA 4GPD1 1PQUA 5MGBA 3OJ0A 3DBHB 1YB4A 1R4NA 4JCOA 4MVJH 4E4YA 4YR9A 2AG8A 2GDZA 4M49A 2BH9A 4HFNA 1XGKA 2AW5A 1DFIA 4HBGA 3TOZA 1VKOA 3KBOA 4GSKA 2YHIB 3GZNA 1CETA 1OC4A 2OXIA 4CQLB 1FXSA 1NFRA 2W2LD 4OXYA 3GUYA 4Z0TA 5G0TA 4IBOA 2QHXA 3U5TA 4B3HA 5JE8A 2GSDA 1O89A 3AK4A 1JKFA 3RC7A 3SVTA 1A7AA 4WEQA 4OH1A 2IXAA 4EZBA 2ZIZA 4WJZA 5B4TA 1YL6A 5A5EA 4PLYA 3F5QA 4YA6A 3NJ4A 2VHXA 2GN6A 4L9RA 4E21A 2X9VA 5JDCC 1EBUA 1MB4A 2WYWA 4UULA 4KUGA 4A7PA 1UXIA 4BNNA 5BNIA 1DLIA 3F4BA 7MDHA 3B1FA 2O4UX 1ZJZA 3ICCA 5C3MA 2D1YA 3JV7A 4K6CA 2C2YA 4YDRA 1LI4A 2NWQA 2JFHA 4UREA 4E5PA 1HZJA 1Z6ZA 2NU9A 1GDHA 5JW6A 1LSOA 3VH3A 4AJ2A 4PLPA 4CLXA 3D5QA 1PZHA 3OIGA 1B16A 1NP3A 1WZEA 3HDHA 4BB6A 1AN9A 1KVSA 4D46A 4IUYA 3JQBC 4YVFA 1B14A 2P2SA 2DQ4A 2G76A 2D59A 1T1SA 2O3TA 3PIIA 4EDFA 4BO9A 3BZUA 4B8ZA 1ISMA 1YL5A 1SOVA 2JJYA 5JAIA 3JQ8B 4XEHA 1PU2A 1IYZA 3ZGYA 1ID1A 4GVLA 5B12A 4HFRA 4IZIA 3H2ZA 4DLAA 4R51A 1C1DA 1IULA 3JQ6A 4IQ0A 4TRMA 2QRJA 1U7TA 3WGYA 3WYCA 5JXWA 3S1LA 3VPXA 2EKLA 3VZPA 1YO6A 2IZ0A 2VCYA 3JQ7B 4JBGA 1H93A 2PKQP 4YAJA 2IODA 4BS9A 3H65A 1HTBA 4OOFA 5TJ9A 3OQBA 1HWYA 4O6VA 3ZW9A 3ZHZA 3GDGA 3D64A 1P1HA 1BTOA 1KEUA 1U1IA 3RUHA 3HUDA 1SB8A 1Y8RB 4S3MA 4IXWA 1MV8A 2VHVA 5K9ZA 1Z73A 3NJ8A 3H5AA 3PWSA 1E92A 2G0TA 1UXJA 4DIFA 3DAPA 2X58A 5JS6A 1BWSA 4FGSA 4ND2A 3A14A 3PYXA 1EE2A 3VKUA 4AJJA 4ZA2A 2UAGA 4TVOA 1U8FO 4MKRA 1QR6A 4TQGA 4RORA 2DPHA 2PFGA 3OJLA 4CLRA 1BXGA 1YBAA 3I6IA 4FJ1A 3GAFA 2PTGA 4WGGA 5LC1A 4BO0A 1IUKA 1EBFA 1N1GA 3E6AA 5F1OA 1B3BA 3WNQA 3WQSB 4WCFC 2BF7A 1VLLA 3WWYA 1HYHA 4WLNA 3LU1A 4NIMA 3S2EA 1ZK3A 3GEGA 1A27A 4MVJE 1XWFA 3ZDFA 1A4IA 1ENYA 4CL3A 3MWDB 5T8KC 4R5HA 3KYCB 1PJSA 4B4OA 5CEEA 1DAOA 1ZK0A 1D4FA 2AEFA 1XLTA 2AHRA 3KVOA 5FEUA 3FHLA 4A2CA 3E8XA 4EJ0A 3OF2A 1NVTA 2NU6A 4K6FA 2VYVD 1ZSVA 3IOYA 3UICA 1SC6A 3TJRA 4D0SA 4DBVO 3MWEB 4CM4B 1U5CA 5BT9A 3K8ZA 3DEYX 4BNFA 3WX0A 4BMSA 3W1VA 3AUSA 1Z7EA 3O8QB 3RC9A 1HL3A 1KEWA 4O5OA 3ENKA 2WDZA 4YJGA 2YV1A 3ZWAA 1XYGA 4YXFA 1JAYA 5A04A 4DMLA 3PHJA 4O63O 4WEOA 2HCTA 3BMNB 3AOGA 2YHIA 1VC2A 4MPDA 5BSFA 1VL8A 1V8BA 1LQUA 4MVJA 1GQQA 3D4OA 3PPIA 2Z1MA 1C1XB 1PEDA 3UFXA 1I24A 4FJ0A 3HDQA 4CPDA 2VYVA 4PG5A 3JD0A 3QWBA 1HYEA 2I67A 4R3NA 3BTSA 3X2EA 1SMKA 4KP7A 2VRBA 2C29D 2POQX 2GLXA 1I8TA 2O23A 4CV3A 2Y05A 3H9JA 4ZRMA 5I7VA 1Z82A 2WE7A 5JFOA 1GPJA 1ZCJA 4MJLA 1SAYA 3VDQA 1NAHA 4Y9DA 1ZMOA 2E37A 3AWDA 2FN7A 4WUVA 4PIVA 4TZKA 4E6PA 2HU2A 3GDFA 4PG6A 3JYLA 3OECA 4LW8A 2DFVA 4NG5A 4J1SA 5BSGA 1F12A 2FP4A 3F9IA 3UCXA 5BSHA 3SJUA 3RJ5A 1ZK1A 3RBZA 5DBFA 5HTOA 3JQBA 2BFOA 1WLYA 5FYDA 4QFDA 4JP3A 1GYRA 2D4AA 3PTZA 1C0KA 3I9MA 4Z9FA 2X9NA 3VZSA 1BGVA 1L7DA 3OMLA 4FS3A 3PJEA 3AI3A 5EINA 1QRRA 2B83A 3W8EA 4BGUA 2QZ9A 1PR9A 3IUPA 5COBA 4IY1A 1KEPA 5HS4A 3WS7A 5A03A 1K3TA 3JYNA 5J23A 1IPEA 4Y6SA 2XXBA 1ULUA 1JVBA 1EVYA 3T7EA 1YQGA 2IXBA 1QMGA 4IGFA 2GN9A 1NPYA 3ZV6A 2Z1NA 3DQPA 1I3NA 2WD7B 1R12A 4GAEA 1PZGA 4JNKA 5COQA 4YAEA 4B4UA 4IDFA 2YV3A 3EUWA 1OAAA 1D1SA 3ZU2A 5KWEA 4DBZA 3IQDB 5EESA 2IEBA 2BMAA 4IDAA 1PJ4A 3BYZA 3CMMA 2JKVA 2OBNA 1JVSA 2VWQA 5C7LO 1XR3A 2NTNA 3BIOA 3NDIA 3RWBA 5KVQA 1OOEA 1EQUA 1A4UA 2C2XA 4TKLA 1X0VA 2VWPA 2IE0A 2ZYDA 5KKCA 2X5OA 3JCZA 1C0PA 2Y67A 2C7GA 3GA0A 5F1PA 1HEUA 2DPGA 4PGFA 1P31A 5A3VA 2PR2A 2ZQYA 1GADO 3WB9A 4OQYA 2YQ4A 2CVQA 3C7DB 1H6AA 1EDOA 2EWMA 2DLDA 2X7HA 1G0OA 5C5IA 4ID9A 4OM8A 9LDTA 1XA0A 2CDBA 1H6CA 5ER9A 2VOJA 2BI8A 1R6DA 3S2IA 4DA9A 5AQ1A 1H9BA 3WJ7A 3FI9A 1GD1O 4YQYA 4AG3A 2H9IA 3VOSA 2FOIA 4L73A 2P9GA 1DC5A 1LLDA 3NDJA 1NHGA 4BKPA 4WPGA 2X0JA 3LZ6A 3GFGA 5JPIA 1CWUA 1MX3A 2ZYAA 4YJFB 3SLKA 5A9SA 3JQAA 1AUPA 3EY4A 2HMWA 1PZEA 3PIDA 4DWVA 4BNMA 3QP9A 2NNLD 4RF3A 3AW9A 4CMIA 2HDHA 1PSDA 3M1LA 5U4QA 5JDIA 4NBUA 1P33A 2Y1FA 4MO2A 1EUCA 2B4QA 1LUAA 2GZ1A 5JLAA 1U3WA 4HY3A 1FDVA 4BNIA 3CH6A 1QKIA 4FFMA 3RKRA 1DXYA 1TEHA 1O6ZA 4B7UA 2XPCA 3C1OA 5ILGA 1DIAA 1AXGA 4GMGA 5LDGA 1E1KA 1HZZA 2C20A 4CQMA 3IMFA 5FWNA 2E4AA 3AI1A 4QTZA 1HXHA 3VH1A 4LVCA 2JCYA 1VM6A 2VT3A 5AXCA 4L75A 4L4SA 2GR9A 3RC2A 3HNPA 5DDIP 2QYTA 3ETGA 3EVNA 5EQFA 1RYDA 3TZ6A 4DIOA 1P45A 3ZW8A 3D7LA 5BNTA 1V6AA 1F8FA 1H5QA 5AVOA 5TRTA 3HFGA 1GEEA 1I33A 3BTVA 4W9NA 3ON5A 4OHUA 3H8VA 2RBEA 4HNGA 4A03A 3HSKA 5DP1A 5EIOA 2DKNA 2QZZA 3I9OA 1TT5B 4NI5A 1NPDA 4F6LA 1O8CA 2NADA 3M2PA 4ZU3A 1IZ9A 4LCJA 1TT7A 2DBVO 4BNYA 4AL4A 4E31A 1W0CA 3VVCA 5JAMA 3AY6A 4XQ9A 4BVAA 3EYWA 1N1EA 1PJ3A 1P1JA 1HRDA 4LMPA 2CNBA 2VUSA 4R1TA 3U49A 4J9UE 4U7WA 4GMFA 3AM3A 4EYEA 2OMEA 4ND3A 3U4HA 2PKRA 2X0NA 1FDUA 2DC1A 2OBYA 3I5MA 4R5MA 3WLEA 4CM4A 3HHPA 3IIEA 1MP0A 4NZ9A 3N74A 1M67A 2IZZA 2IDZA 2WM3A 2EJVA 1QLHA 3DTTA 4QEDA 2B35A 5HS6A 3MJSA 1PR3A 4CQMD 1BVUA 4XRGA 3OJEA 1R37A 4GL4A 1H6DA 3UOGA 4DPKA 1YB1A 3D3WB 3PYMA 3SC6A 5A06A 1YH3A 2VZ0A 1VRWA 5JDCA 3SC4A 1WDKA 1NNUA 1PJLA 5TF4A 3RQSA 3F6YA 4J7XA 3MJCA 2PY6A 3NUGA 1EZ4A 1SEPA 4CQMB 1BXZA 3IJRA 1Y8RA 2GO1A 1M76A 3NYWA 3TZHA 2NQ8A 4NBTA 5DN9A 3JTMA 1KY5A 5IXYA 1OC2A 1U2DA 3CKYA 4CV0A 2O3RA 4II3A 5TSDA 3OH8A 1CF2O 1R0LA 2HKIA 2W2KA 3PGJA 5JO0A 2VYNA 1AGNA 1G6KA 8ADHA 5AOVA 1IOLA 4ZQBA 5A9TA 3QVWA 3SLGA 4E13A 3ANNA 4IPTA 4RPKA 3GZ4A 4J91A 5CPBA 1Z7BA 1NFQA 4GBJA 2EERA 2B4RO 3RAJA 4MINA 4M54A 1UAYA 1X14A 4RVHA 4E0BA 4QECA 3TF5A 1OI7A 4IM7A 3MTJA 4J2OA 4RVSA 4ZQEA 4XWYA 4UUOA 4RDIA 3HB5X 1Y9EA 4D44A 3VDRA 3K2BA 3A1NA 1JWAB 4J6FA 2PNFA 4IQ8A 4DQUA 2DBRA 2HSDA 3AUAA 1EUZA 4RF4A 3FD8A 3LT2A 1J0XO 3INTA 4J1QA 3F1LA 4XA8A 1E7RA 4RPHA 4G65A 1HE3A 2D0IA 4J9VA 1K6XA 4XX0A 4TWRA 2ZKLA 4G5HA 5CDUA 2EGHA 2GASA 5IXSA 4LISA 2HMVA 4YT5A 5EPOA 2C54A 4EEXA 4CUKA 4DPMA 4D0RA 4D43A 2P68A 4CMIB 2V7PA 4DXHA 3KYDB 3OIDA 3Q2IA 4R69A 4BV9A 5L7WA 4KTVE 3L6EA 1PIWA 4YT2A 4OKIA 1ZH8A 4CJXA 3IKTA 3B6ZA 1KIFA 4U6SA 4PLHA 5G0WA 3GNTA 3DZIA 4PZDA 3R1IA 4S1VA 1VSVA 2O48X 1ADGA 1ZJYA 3E9MA 3QHAA 2W98A 4YYZA 1VL0A 1Z74A 2DM6A 5HWSA 1ZUD1 4M8SA 1DHRA 1LSJA 4GLOA 1BRMA 3FN4A 1F17A 3KUXA 3VTZA 3PEFA 2FWMX 3DFUA 4BNTA 4FGWA 4YAIA 2X1HA 3TL3A 3I1JA 1E7WA 2O7SA 1ZK2A 3FBGA 2B5WA 1E5LA 3RI3A 3TOXA 4QX6A 3ZHYA 5CPFA 1X7DA 1CERA 2X9GA 1A5ZA 1V3TA 2VNSA 1LC0A 1UDAA 3W6UA 3GVCA 3K6JA 4CODB 5GZ1A 4FIZA 3QWAA 1GL3A 3EDMA 4CM8B 3CMCO 4WECA 2A4KA 2FZWA 1O9BA 3WNVA 3FCOA 1VJTA 4J16A 3EVTA 4YAKA 2GZ3A 2F1KA 3LLVA 4XRRA 5L9AA 2QIOA 4TZTA 1HDRA 2TMGA 2R6JA 3JD1A 1BSVA 1DPGA 1TI7A 3O9ZA 3H9EO 4TKMA 3GHHA 1KETA 5DBIA 4CMBA 2PD3A 4DRYA 1E1MA 2B4TO 5B1YA 1RWBA 4RDHA 3H9UA 3W4IA 1CQIA 4TRRA 4XQCA 1T2AA 4DYDA 4MVJD 1PJ2A 3K96A 2X22A 4GSLA 1SPXA 5CDYA 1M2WA 4AJEA 4A73A 5T5QA 1ISIA 5TC4A 2ZB3A 5KIAA 3PLNA 2CDCA 3G17A 4W7HA 2CD9A 5L3ZA 2SCUA 3MJVA 1LX6A 4BB5A 1JQBA 2Y66A 1QV6A 1ZO8A 3HADA 4PZCA 4CMGA 3WSWA 2VZ9A 3SBOA 4MP8A 3WYBA 5I9MA 1ARZA 2W2LA 1N9GB 3TFOA 3JQDA 4ND1A 4ZRNA 1NFFA 4CM7A 4CUJA 1ZXBA 4I08A 2EP7A 1F8GA 1T2DA 4WE3A 2EP5A 4PN3A 1EUDA 5L53A 2VZ8A 4WASA 1YDWA 4A26A 5CG2A 1Y8QB 2H63A 4K26A 1MXFA 2AEMA 3AUUA 4Y6RA 4E12A 5C7OO 4M89A 1HDXA 3ZWWA 2CUKA 2P91A 2R2GA 3JQGB 2Z95A 3F4LA 4FFLA 1JAXA 1WPQA 4CR8A 3HDYA 3GZNB 4FFOA 1P0FA 1K6IA 3DXFA 1JA9A 3H7AA 4IINA 4CQLA 4NFSA 1WMAA 1GEGA 1SB9A 4H16A 2JD1A 4W9NC 1ONOA 3ZWXA 1GQYA 4FD3A 4HNHA 1ZNQO 2YQ5A 3TN7A 4FC6A 5FF9A 3ZWOA 3AUTA 3QWIA 1NR7A 2GPTA 3QVTA 3A28A 1ML3A 2HLPA 2FPGA 1R0KA 1IZ0A 1HDZA 3BMCA 2OZPA 3LF1A 4UVIA 1PTJA 4F46A 1YJQA 2G82A 4I5FA 4PFJA 2B36A 3N58A 2UV8A 3KOUA 1C0IA 4XYGA
chains in the Genus database with same CATH superfamily
1NI5A 1T8PA 3TTSA 3JZFA 4F1JA 3PNMA 4R1OA 2WF7A 2H4ZA 3ZDDA 5DULA 3WBBA 2D54A 4BO0A 3NALA 4ITUA 6ABPA 2FY8A 2QROA 3GBVA 2G80A 3OF5A 3KQTA 5DOZA 1SK8A 1SVLA 1ZITA 1SBYA 4QJ4A 4K40A 1T2EA 2NXWA 2R79A 3LQ1A 5C0OE 4CIAA 5ILOA 1ZYUA 2OGUA 4JB8A 5FLKA 3TFWA 1DQPA 1MNAA 3NT2A 5IM4A 1XAGA 2WIGA 3PHHA 3PK0A 4D9HA 5EJ4A 1J2EA 1YR8A 2ETXA 4HH4A 4MVJI 4ALKA 3MWYW 3QITA 4LYFA 3K8QA 2IZ7A 2A59A 4RY8A 4DS3A 4UPDA 1U63A 2WYVA 3DHVA 1E61A 3ER8A 4PSVA 1GL9B 2QUJA 2VYFA 2GUGA 2ZE8A 4TWIA 5DM1A 5FWDA 4C6HA 4HYYA 2ORED 1X1TA 4D0NA 3IJPA 1KXJA 3DBLB 2XTZA 3I01A 1XQXA 2YWJA 5AI5A 1C3LA 3FNHA 1K0FA 1PW7A 2D2FA 4K6MA 1UBHS 5CCBA 4MQUA 2ID8A 1VJ1A 1WPRA 2AD1A 1K2WA 3TXAA 3MTQA 3G0OA 5DCWA 2P0AA 1YDHA 5CA0A 5JWOA 4PO3X 3RJMA 1KP3A 3BORA 5E3JA 2I6SA 1DP4A 2ZREA 1T34A 2J7KA 4QDXA 3FPCA 4KV9A 1SKUA 2Q41A 3OX1A 1ORRA 4LZAA 3UOAB 4DMKA 1YQXA 1RYEA 2IVFA 4DMGA 2ASEA 3IAS6 2P11A 2G04A 4MV3A 1EZ1A 2D5AA 1LVUA 4OQFA 4G25A 3GJZA 1QXSA 2W6ZA 1V26A 2ERXA 3FNFA 3OO0A 3RS2A 1LLQA 4IUDS 2XTMA 1ORWA 4Q01A 3H6KA 3HM2A 1L2TA 3KQWA 4FCWA 4J4HA 3STWA 2B7CA 4OHYA 4GMHA 2XYHA 1AK2A 4AKTA 2DH6A 2W6ID 5KWVA 1H1TA 3I37X 2DQKA 3SKYA 2B69A 2HWKA 4ZT2A 5GPBA 3C3JA 5FJJA 3I83A 2Z98A 4O1IA 1NJFA 4R2KA 3KKZA 2VYND 3GUCA 3HC7A 3MAJA 5FV4A 5DN6D 5KJ1A 1COWD 4KFRA 2RAFA 1XCPA 2IUEA 4LJAA 3PFWO 5SZHB 1TYAE 4L4YA 4CM9D 4MLDA 3O1LA 1NQOA 1EGAA 1LWOA 2FG6C 1IRIA 5A4JA 3SC2A 5EJIA 4BZWA 3IXQA 3HB4X 4Q3DA 4UTVA 4D9IA 1PS9A 3A4VA 3R77A 4MHOA 3AM1A 1J8QA 1L5WA 1T24A 4L9WA 1J8FA 2AFHA 2NUPB 3TCKA 3UCFA 4NBVA 1U81A 4ZV9A 3HYSA 3NBAA 4JMPA 4J4BA 1SXHA 5D6OA 2ZIFA 5K3BA 4LC9A 3GLRA 4D80A 4LBYA 3MB8A 3K2IA 1MOSA 2FWIA 5ALFA 4RVNA 5ELLA 4MKXA 2ZIXB 5LU8A 3AZPA 2YX1A 5C4MA 2CLHB 5JYEA 3E0XA 1PUXA 4GKBA 4ZAYA 1GNLA 2EG9A 4YGYA 3ZDZB 3PHGA 1G5FA 1OTYA 5KQSA 1C8BA 2GBCA 5I3ZA 3EIOA 1Y4ZA 3HDVA 4HGZA 1XG5A 2CUZA 2FQYA 4GX2A 4INAA 3O03A 4QUGA 5LZ7A 2YW2A 4KPFC 3R8FA 3GP8A 3IUSA 1TK3A 2I54A 1U9CA 1DG3A 1M74A 3F5SA 3QVOA 5H80A 2AQKA 2ZI3A 4AKEA 1VG9B 1F38A 3W3ZB 4E32A 5CJPA 3H04A 1LPOA 3CRW1 1XMJA 5JZSA 1CYEA 4XYBA 2EIXA 5JCJD 3PE4A 4A6XA 4YRLA 5J4VA 5BRNA 4MGKR 2WJPA 4RKEA 2A0UA 1X8KA 3MRSA 5C8DA 1X13A 8LDHA 4FX5A 3S81A 3A6HA 1BVRA 5AXBA 4HXYA 3DZFA 2X8BA 3QJYA 1WMDA 2NU8B 1EGQA 5TV2A 2OVBA 4JC4A 4LI3X 4ND5A 3ZIDA 3ASUA 2B0JA 4WW0A 3AILA 1JPUA 5LB2A 3U37A 3FTFA 3IUMA 4REQB 1F9EA 2ZATA 3OEWA 1RACA 1XAJA 1JB9A 2AOTB 3A9SA 3AO0B 1QHSA 4E08A 3T94A 2BGTA 2AS0A 4XVQA 4K1XA 4TWJA 1EA5A 1VLZA 1J70A 3GJQA 5FUBA 3MMPA 4YB8A 3D2CA 2BZGA 4KE6A 2GESA 1URPA 4WLUA 2PKQO 3N2KA 4OO3A 3AF6A 3IDOA 4LA4A 3VHXB 5TVKA 1K7SN 4I55B 4PGHA 4R9RA 4DGSA 4KXWA 2HHJA 2V7WA 4X45A 1XHLA 1E3MA 3K9NA 1YONA 1F51E 1TZMA 5GJCA 2JH3A 3JWJA 2NAFA 1Q17A 5TR9A 2FJPA 2HBYA 3UJNA 5KWJA 3A05A 1DINA 3FRJA 4IJWA 1SVSA 1P1RA 3CJTA 4G1FA 2WF8A 3NVAA 4UZEA 1V11B 2XUFA 1BROA 2QJWA 3I6BA 3CVUA 2Q49A 3L4BC 1C4OA 1O6GA 3DMGA 3MGBA 2XKBA 1H9CA 2G07A 2H57A 1A2OA 1DKMA 3DMYA 4IDNA 5JCOA 4BGVA 2EW8A 5F9FA 1VIDA 4G67A 2NO0A 4AZVA 4EHBA 5AVTA 1BYUA 2PG3A 3TLGB 3HCDA 4DRXB 3AT1A 5KHOC 3UAVA 1T2VA 4Q21A 1TRHA 4CTKA 2B3DA 3Q4GA 4E07A 5JAUA 1JB1A 1NVWQ 4MJ3A 4CM6A 4BMVA 4DLPA 7YASA 3K9WA 3IP6A 4YQZA 2K7ZA 1WU8A 1O2DA 3QOXA 4A82A 2F2TA 1P0IA 1T9GS 1BNCA 3U3OA 5JAPA 3AF3A 1X7YB 5IZCA 1E1YA 2QQ0A 3NHSA 4PYLA 1J33A 4OIMA 4M1QA 2NQ2C 3CF4A 4YJ3F 4EYKA 5I8WA 1UOPA 2OO5C 2VSXA 2FW9A 4L85A 5D2CA 3ZXIA 4ZI7B 1HNWB 3SBEA 1MXHA 1RMTA 2G40A 3HRHA 4OU5A 4OYRA 5AESA 3JWIA 3LX5A 5EJAA 3AM4A 2AYZA 3E53A 5E6RA 1ONBA 3GVPA 2RH4A 1LC3A 3QG1A 2Q3MA 3RFFA 4AUNA 3QVSA 2B7BA 5DNEA 3RRBA 3S1AB 4ZI2A 1RCFA 3DPSA 3K05A 1KTVA 2G9QA 3HBMA 4WFQA 1E89A 4C2BA 1QFYA 1W9HA 1L5GB 2HQRA 3TRHA 1PHRA 3EZ9A 1K4KA 4Q00A 3QPCA 1OWOA 3R24A 1DSSG 4A91A 2GJKA 1W1WA 3H9QA 2ODWA 5E1DA 4ALLA 1ZMRA 4HFJA 3GL9A 3R74A 3TFQA 3Q3VA 1EWVA 1P1KA 1M34A 3ET4A 1M7HA 3PUWA 4U63A 3AB3A 4WCVA 2PQMA 4ZDKA 4GBMA 4YIHA 4RFVA 1U3UA 2VP4A 2A1TS 3SVZA 1RXVA 2YUTA 5CNIA 2YMMA 1SQ0A 4AN0A 4EEZA 2ABWA 2JGEA 3FOBA 3GMIA 3I4CA 3TKYA 3W2GA 4FKBA 2RKBA 2H1VA 4WVLA 2XUKA 2ZANA 2QN1A 3QSGA 5AXAA 4D8WA 1B42A 1B0UA 3AUKA 2ZWVA 1UQTA 1GUYA 2GN0A 2OBLA 4OUDB 4QTTB 3N8DA 1Z0UA 1Y4AE 4L8GA 4TXLA 5K0LA 2EC5A 5FUXA 1YZHA 4KQEA 4NLLA 1E6EA 5DRYA 3B1KA 4FHFA 1T15A 3GLQA 5EERA 3TEMA 4BQRA 5AKIA 5JAOA 3HWRA 3T9BA 4W8HA 1O6CA 2WV9A 2QB5A 4QOIA 2A30A 3WQQA 3C7CB 5EJFA 1WEHA 3U3DA 2E2WA 5KTNA 4KR9A 1F3LA 4PIMA 2UYYA 1H1LB 3TNJA 4UCFA 1EJ2A 1M0WA 5ICMA 1PF7E 2ZJ1A 4AYXA 3SXPA 4CIXA 1BIFA 4FGZA 3GRZA 2CCJA 1BOOA 2HDNB 5HTKA 3EDQA 1VE1A 4RH3A 1CUAA 3UGJA 1CNEA 4Q7QA 1IAQA 4F2WA 2IHTA 3ZCUA 4GI3A 4PC1A 2YC2C 2WIBA 5EXDA 5H68A 5JJ5A 3TQHA 1VPVA 3O5AA 1LNQA 4ZAZA 3SSMA 1KYTA 1PLKA 3GNQA 2G63A 2C3UA 3LQ2A 3WKCA 2JG3A 4RF5A 1U11A 3BJIC 3OWHA 1JEYB 2VHZA 3GQVA 1R8QA 4ZJZA 5KVSA 5HBRA 2Y6VA 4OVKA 4LYGA 3EVZA 1EKXA 1R9GA 4GYYA 2OORC 4EMSA 2E6UX 1AQ6A 1HSZA 1Q0PA 3OLVA 1KSGA 1GKKA 1QC5B 5AOBA 1ULAA 2ZTVA 3FLEA 4UVDA 1HE5A 3NKVA 3U9SA 4QLBA 2X9LA 2EKPA 2R4UA 3BC1A 3D4BA 1OBHA 3MCVA 1YJBA 3LFTA 5FT9A 5KSPA 5U1PA 1R88A 5EUMA 5AWFC 1G42A 4BO3A 4YO7A 5B2FA 2HO4A 2HBZA 4HBZA 2VPPA 4WBXC 1DC6A 5A3RA 4ONEA 1KVQA 3I1FA 3T1NA 2C42A 1CZHA 2NU6B 1LS1A 2FPLA 3EPRA 3LDHA 1WDLA 4ZDWA 1RPNA 2PDAA 2G9UA 3HB0A 4IJVA 5JAHA 3QX7A 4OA8A 3UKOA 1M8GA 4XPIB 4YV2A 1DU4A 1WL8A 2JFGA 5ICCA 2P62A 4EGFA 4XGKA 1CDOA 3KXLA 3SM3A 4DDUA 4Z54A 2WTUA 2PUDA 3FROA 3PF8A 2IYZA 1FDWA 1QHHA 2QYSA 4IIDA 4RSHA 3X44A 5KYWA 2WKPA 1AQNA 1ZRHA 4CM1A 1Z33A 1QORA 3HUFA 4BJ1A 1MBZA 2A9FA 3O4GA 3UB3A 2A5YB 1GAWA 3PX3A 1XKLA 4QREA 4U6NA 3WICA 3F97A 4ZVSA 4AWXA 1EFKA 5A3SA 4S1TA 4ZEWA 3LA8A 4TYNA 2L19A 3UW3A 1I0ZA 2FSPA 5LYJB 1CRWG 1AH2A 1M0SA 3B9BA 4AUMA 3PFGA 2Q1TA 1R8YA 4QU0A 1UZLA 2PFSA 1QFZA 2Q1UA 4PR0A 4YHBA 1UKCA 1V8OA 2AMVA 2HY7A 2IC5A 1EX1A 1BX3A 1YAJA 1ZINA 3ZXXA 4US2R 2PWPA 4I5EA 2XA2A 2ZVQX 3LXRA 5EZYB 2YR0A 4AK9A 1P0QA 5DBGA 5KOJA 2NOAA 1Z5GA 3ABIA 2VYQA 4JI3B 2OZKA 1CY2A 3GD5A 3FRIA 4RGBA 5CRIA 3C4JA 4KJZA 3Q3CA 4U9IS 1ZKMA 3DCYA 2QAJA 3IBGA 4ZKDA 3M8KA 1BDIA 3DEJA 3T06B 5J4HA 1RLUA 1P3Y1 1T8YA 2YL2A 5JECA 1AK1A 3ZJUA 1E6KA 2GEFA 3KFXA 4X5OA 4CMEA 3O8BA 1NW8A 4MRPA 3O74A 4MPPA 4X1YB 3V1TC 3O8QA 3ES9A 3W5BA 1SQ6A 3ITDA 4HDCA 5JROA 4ZOAA 3DONA 5D3KA 3SY8A 5BMVA 3B2EA 2JIMA 4ESHA 1RRVA 3VH2A 3OU6A 2OC4A 2ZJ4A 3QKSB 1U2QA 3F3SA 1M8FA 2FP4B 3HLYA 3R3VA 2CT8A 3DOEA 1YVPA 2J67A 2AGVA 2MJLA 1VHWA 3HKBA 1IZYA 1ZNXA 3ESBA 4JWTA 3U13A 1G17A 2B9VA 5JS8A 2P9TA 2ZB4A 1HDCA 1X2BA 3WA7A 2LKDA 4P0QB 1RAIA 3EGDA 5E0OA 4EAQA 5ALSA 1FQKA 3LRTA 2QMYA 3ZJYA 1E9CA 1WW8A 1Z2EA 1UUFA 3AHDA 5JWRA 3OE4A 1DQNA 1GTMA 5TY0A 4ZAFA 1XK6A 3QWHA 1OGYA 3ZHXA 3I4FA 4AS2A 1RE0A 4I8XA 1GM5A 1G8FA 3LDAA 4YQFA 1OH7A 4OM7A 2D1RA 4BNJA 4D5EA 1YQUA 2MIIA 4DG8A 1NW6A 3N28A 3JQPA 4JLSA 5G53C 4A8HA 4JLMA 1YKFA 4L5JA 5BVHA 1TK2A 1KFKB 1T0UA 2CFRA 2OHFA 1S02A 5LYJF 2I3AA 1SVOA 2YDYA 2C9BA 4QYIB 3KTAA 3NBQA 4U3JB 4EY8A 1EWQA 2IZOA 3CW9A 1FP1D 2FZLA 3LT4A 4ZZ1A 5K0GA 2CMHA 3T5AA 4ZTZB 1NBEA 4IDEA 4ER7A 5KYXB 1QPZA 5EIEA 2C98A 3B1ZA 2RHLA 3IOCA 4B47A 1YZNA 3JQFC 4BUZA 2OHHA 1XMVA 3CUSA 1IY9A 1LDBA 1O57A 4P5PA 2ONJA 2I7TA 5BUSA 2CC2A 4GWKA 2VSQA 4ZC1A 4E1AA 4DADA 3DCIA 2KHZA 3TLGA 3HI4A 2PKYX 1BWRA 1JXOA 3B8HA 3HMQA 2J8ZA 3UJCA 1NMXA 2ADMA 2WD9A 2JJ2A 2DUUA 5AW3A 1KO4A 2C84A 1PGNA 2QG6A 4JR2A 2GCEA 4IDGA 1REQB 3FM9A 4HLNA 2OAP1 1Z4JA 2YIMA 3LKBA 3LYHA 5AVJA 4Z3OA 4X8MA 4YRKA 4BLTA 2HA6A 4L76A 2Z2XA 1F6BA 3R5XA 3WHKA 3CLRC 3KYJB 2QTTA 4G01B 3K1ZA 2EX0A 3GVHA 5DOVA 1TCVA 2J0EA 4YDSA 4JP5A 3P7MA 4MTCA 1CUZA 5A1TA 4QYSA 5BR8B 1FJGB 3V8BA 1E1LA 3TLYA 3FWPA 3C3DA 4EG6A 1OFIA 2F7SA 3GJXC 2QT0A 4UKDA 4R4JA 5JY1A 3F2IA 1Z5ZA 3PZRA 1WKCA 1U8ZA 2J0UA 1OIWA 3X3HA 1QFJA 1TZCA 4A2PA 1XDUA 1G0NA 1V0JA 2Q6VA 1JA0A 1YVEI 1DKQA 2QRZA 2QZSA 1FFWA 2WFLB 2WJJA 3ORRA 4Q37A 3RU9A 5L7TA 1DMSA 2WD7A 2Y6UA 1CIVA 2EFHB 1YR7A 1CY7A 1ZC3A 3IHLA 3QV1A 1FC0A 5AW0A 2IYQA 2PL9A 1YRLA 5CD1A 1E3QA 1U8EA 1SUAA 1YDFA 4UFNA 4MR9A 2BHTA 2YRWA 3U3JA 3V2HA 2UVPB 2YHAA 3DL7A 4OK3A 5DNWA 1P2SA 2I87A 2XD4A 3NAGA 4FFVA 3VYSB 4BAZA 4DWJA 1N7GA 2W8ZA 2GM9A 3OQIB 5CNMA 1CP2A 4FLEA 5ESXA 2FR1A 3GEMA 1GA4A 2ZI6A 4W1QA 2ZTSA 5T67A 1JU9A 3KXIA 3JU3A 1Z6PA 3ZEIA 3ZD6A 4UATA 1DXHA 2GOYA 2O8CA 2ZB7A 1JQLB 1USWA 3R5TA 5A3QA 3R7AA 1LPBB 1KH2A 2IITA 1PFGA 1XA3A 3LUAA 3ULKA 1C81A 4MV7A 5K05A 3A1WA 2QRGA 1WXGA 3D4PA 3Q5GA 1OZHA 2HBRA 4K8OA 1T4BA 3QEAZ 4M83A 5CP8A 4K0RA 4ENTA 2F1IA 1B6SA 3O7MA 2IV2X 1M2VB 1FP6A 4DIBA 3C6KA 3I5AA 4PBRA 3U3MA 1F4LA 2PFKA 1C7JA 5EJ7A 5DTEA 3W6NA 2NTEA 4EFDA 4HLDA 1QGED 2CXQA 4KV7A 2R6FA 3NRCA 2MHCA 2XUHA 1RHMA 1YA8A 3HJGA 4KE9A 4ZPJA 5E4JA 4C0SA 2DR2A 2OHOA 1T3GA 1KFJB 2Q45A 2VDNB 3RQIA 2FN9A 5AW7A 3FGNA 1P44A 1DQYA 3E1GA 1JVNA 4L7VA 2F6RA 2J3EA 1JEDA 4O4LA 4AURA 1TTTA 1B8PA 4FHCA 3N59A 1FYDA 1N2ZA 3LPMA 1MV5A 1QGDA 3R5FA 1JIVA 1G4AE 4NPHA 4Q6WA 3ZDEA 3UMMA 2Y99A 4U02A 1IK6A 2EL7A 1IN7A 3GVXA 4W7IA 5BPHA 1XRRA 4LBWA 3KXPA 3H18A 1ADCA 1HF3A 3U0BA 2R8XA 4MS4B 4DMUB 3ZNQA 3Q15C 3DMRA 4YJ3B 1RADA 3K4PA 3EWSA 3OSZA 4QBKA 1WUKS 1XTJA 4X20A 1OH6A 4OIFA 1Z0DA 4I4IA 4B3CA 2Z3WA 2PPVA 5JAQA 4C0WA 4DJJA 2XHZA 2QRLA 2XYPA 4NCNA 5C2JB 2COEA 1RRPA 3TX2A 3U16A 4G2NA 1GQFA 1OZFA 1U7HA 5JQGA 1NVVR 1E8DA 1H6BA 4IMRA 4X6XA 4NHOA 3SEAA 3U26A 3WYFA 1P7WA 2Q7XA 3HO8A 5DHPA 2EQAA 5CFZA 1NBAA 2F4VB 5AHOA 1XALA 4BU1A 3FTPA 4OFXA 4WOKA 4EBFA 1DPFA 2VDWA 3A58B 3GRPA 3H1GA 1SQGA 3G5UA 1GR1A 1M34B 3PGVA 3DDZX 4RAQA 4XPZA 3DJYA 2HTEA 5T41A 4ZO7A 3LECA 4C29A 3EXAA 1T1JA 2P40A 1OQAA 2Q0QA 3KSDO 1P60A 2DGDA 2XWQA 4I7EA 3EWIA 2BMFA 2JI6A 1JBKA 4WADA 3IXMA 3ZJ4A 4HLUA 3KJQA 3ZY3A 3OTQA 1UMBB 3F1KA 3IEUA 3IUYA 2VC2B 4KB5A 5HDBB 4AYTA 1OU4A 4YV1A 2HQ1A 3TD6A 2GSWA 4H31A 3FFWA 4HZGA 1FS4A 2GDJA 4QOJA 1TF2A 4QBGB 3MMSA 3U4DA 2PQ2A 3RYFA 3ZDQA 1PD0A 4Z1MD 1FQOA 1P9RA 2LR0A 2WP0A 4C5BA 5KYXA 5C5EA 5L6LB 1TJPB 1X1QA 3C1AA 5IAEA 2KBEA 3NUZA 1DJNA 4RD1A 3SEZA 1VGQA 3RFVA 2X2OA 2VT2A 3KUKA 1E6WA 2VH1A 3FZYA 3NJRA 2HJHA 2VWGA 3E15A 2R8ZA 1CP3A 3JD4A 1OJLA 3WWEA 2QR2A 2CLKB 5CM9C 1EZZA 4CW7A 1S3FA 1XDWA 5BW8A 1UKBA 4WK0B 2FAXA 1TPZA 1YRBA 1YACA 1EJBA 3P2MA 4RETA 5E3IA 3RK1A 1OFUA 1QCZA 4K9MA 5EVCA 3AM5A 2FWPA 3E5HA 1SULA 3DV0A 3VNVA 2I71A 3JQAD 1V5EA 4DDKA 1ELOA 1OXTA 2WJ3A 4PZPA 2INGX 5KNDD 1AF7A 3BHNA 5BSEA 2J0SA 5BWMA 5A9RA 2YJ4A 4FCVA 4XCVA 1KDVA 1CE8B 2G7ZA 4NYJQ 4UU8A 2J59A 2OAQ1 3LUFA 1C1HA 3AUFA 1WBBA 1X74A 1ECJA 2ODAA 3MHPA 3MMNA 4BKRA 3TLMA 3C6XA 3JWGA 5FWXB 3Q2OA 1DC7A 1MT3A 2CVZA 3DE7X 1U02A 1ZVJA 1F14A 4NRDA 2IDMA 1VBMA 4NBNA 4UASA 1CZRA 4BJ3A 1ORHA 5E4TA 1P6UA 2QJTA 1SWWA 2RK3A 3QF4B 4X8HA 3UH1A 4EKDA 4JI6B 2PKEA 5L4SA 4F45A 3VU0A 3MCWA 1FFCA 1H4TA 1U1FA 2Y68A 4BFCA 2HK7A 3C3XA 3C74A 3NIFB 2C88A 4GUAA 5CAEB 1NMSA 1YJ8A 3KYBA 1KJ8A 2Y1OA 3SQXA 3N1UA 2QTWB 4YRIA 3W7VA 2XOXA 3WLKX 3CRVA 4EY3A 1Z2PX 1B2LA 4FUTA 1N5IA 3EPKA 3JVUA 3ZY6A 2VJYA 4K3VA 4XWWA 1KFEB 2WWWA 3MIIA 3O47A 2GZAA 1CW2B 2QRHA 2VEOA 3FJYA 4U0JA 2K5UA 4UFOA 1VL5A 3EPPA 3JYQA 3X1JA 3AERB 4IO0A 1Y4DE 4AT1A 4JQYA 1N4DA 3KYDA 3W5AA 4M1OA 5K6AA 3K94A 1RRCA 4UOZA 4KXYA 3PXXA 3VPSA 1K9VF 2B61A 3HN6A 4UDOA 3WLPA 5MDHA 3ZWBA 3GUUA 3IP3A 4WLOA 3V46A 2WHXA 2XQJA 1F1JA 2GKOA 4D3SA 9LDBA 1BGWA 1PJTA 2PX8A 4YJHA 2I65A 4RMNA 3WVNA 5GONB 1YIAA 2DJ5A 5HGXA 2P9JA 3HVRA 2GPBA 2IPMA 2PBRA 1OSNA 3ZGVA 5BT8A 1FRFS 5IVPA 3LPDA 2ZAGA 1FDTA 2OV3A 1GV0A 2VDQB 2XCSB 4QAQA 4D02A 1FBTA 5BN5B 4HX5A 3DCJA 3EVGA 4EM6A 3THYA 4MVJF 4BTVA 3EEIA 3QIVA 2DUMA 3D6TB 3JATA 1K8XB 2VI5A 4AMZA 4ARAA 4CLEA 1YTUA 4RD3A 4JX8A 1AUOA 2Q5EA 1EPUA 4D1YA 3OZWA 4LRWA 5IUNC 1M33A 4JP8A 4B3JA 4BFLA 2BV3A 1Z0IA 1Z2AA 1GTZA 3B2NA 3EODA 4UBJA 4YMSA 3QM1A 4HVAA 1DWQA 3QFSA 3G2HA 2XEXA 1NYRA 5EYPB 5ALIA 1X2EA 1EH5A 3UWMA 2XW6A 2MSKA 1G2OA 1WWKA 2QVLA 4IDDA 4CIVA 3AKYA 4YJ3A 5BV8A 1GYPA 2H4WA 2PRKA 4WKBA 3V9PA 3WJAA 4GWGA 4R7GA 3VPFA 1GKUB 4B3GA 4BVEA 2ZOSA 3LDUA 4JLDA 2IOFK 4HYTA 4F5YA 1HNXB 4GHWA 1R50A 4O2BA 2ZE7A 5KO2A 2LGJA 4JAVC 2X7JA 1QQ5A 3R6TA 1VRVA 3DE6X 4D9FA 5FADA 2RGUA 521PA 1X86B 2V74B 3FPEA 3DTYA 4MB2A 4R9NA 5L45A 2WLSA 1Q7CA 2YHBA 3E81A 5DGTA 3VZRA 5IFLA 3CNBA 2AOUA 5LZ9A 3OM8A 3G89A 3V1YA 1TF7A 3W77A 1M75A 1DHTA 2QM0A 3EA4A 1LW6E 3FHTA 2ZI7A 3CBGA 2JLRA 3BHMA 1T5SA 4M8IA 4NPCA 4F1WA 5IVDA 3OA2A 3Q10A 1OJ7A 5CLLA 2I0FA 4ZC8A 4U2KA 5E3HA 1E3IA 2QMUA 5EUCA 3SI7A 4I8IA 1RTTA 3L40A 3RUDA 4QO7A 2A9KA 1AU9A 2J3JA 4LE2A 2ZRLA 4YJGB 1JHQA 3I6QA 3HO1A 2A8YA 1MIOA 3LW8A 3EDOA 4LUCA 1U0EA 3NC0C 4LN1A 3S4YA 2VHEA 2X0RA 4HOYA 2FMHA 3CW2A 3G1WA 1UH5A 2F3SA 2ZYVX 3AUXA 4WLFA 4GC5A 1HA3A 4CV2A 3ORFA 4QT0A 2CVOA 1Z8HA 4EG7A 5DIFA 4I55F 2WUFA 3NS7A 4RQAA 4TV9A 3LCVB 4GPBA 3U3XA 2DFNA 2IXTA 4AECA 4XD7A 3QW2A 3QYAA 2NV6A 4D82A 1W8DA 3BA6A 1PFYA 2VTBB 2P90A 4DSUA 4MSUA 1U1GA 2F1JA 1TMOA 4ZAGA 3VTKA 1L5VA 4L2IB 4GC9A 1S7CA 1NVMB 5HJ2A 1B00A 5KI6A 1YVRA 1SCIA 2WQ6A 2QUZA 1GP2A 2ZS9A 1WCV1 3E1KA 3EXG2 3HN2A 2ZBFA 3OLYA 1SCUB 3TWOA 4D3FA 4RWEA 1ACMA 1DIRA 1XJ5A 1YKGA 2XADA 3A9TA 4OI2A 1ABBA 4TUYA 1SOAA 1TTQB 4RCZA 2WIFA 5T57A 2IHNA 3O3MB 1J39A 4P4NA 3JYHA 2ZBDA 5A4KA 4X62B 5ITVA 2BF4A 5CNKA 2DE0X 4F38A 3ZKAA 1YZFA 4H1UA 4HDSB 3UC9A 3TVYA 2OUIA 1WXFA 2P9ZA 5AW5A 2HQSA 1XBTA 4QELA 5HQTA 5ISMA 2Q2WA 2QX4A 3QF4A 4K7JA 3IEKA 4RMGA 5B37A 4DF3A 2ILTA 1CR1A 3I5YA 1MHPA 3OI7A 3R0JA 2I9KA 3AGPA 4XVRA 1DRJA 1NBME 2IGTA 4ZMSA 1Y80A 2QLBA 1TQDA 3A1DA 3G0BA 2HHCA 3HR7A 3AEQB 1ZOSA 1X39A 3WGJA 5CFOA 3L6BA 3GG9A 3NGXA 1JIQA 4CT5A 2GYWA 4BPRA 5JAZA 4KPYA 5ITZB 1YOVA 2ECQA 2BVNA 3L8ZA 3EC2A 4OYYA 1N6RA 4ZAVA 2WWHA 3WL6A 2WJWA 4WOPA 2WZBA 1L5KA 5FRDA 5A0VA 1JEAA 3TNFA 5I7SA 3HE3A 3BMOB 4FW9A 1QJ4A 2XMBA 4XJTA 3ZHOA 4CLOB 4C7XA 5FHRA 2R1VB 1R6BX 2B4YA 5JNLA 3K9HA 5LQNA 1CJSA 1YT5A 3GLHB 1S2NA 2ERYA 2JL1A 1MT0A 1LBEA 3ZDXB 1MGOA 3ZHBA 3KR1A 4CMAA 3KQKA 2XYVA 3BFVA 1TLTA 2Q9UA 2V9CA 1JHYA 5DMHA 2EBHX 3I9JA 1SHTX 4C0QC 4KFUA 5KNCD 3UUFA 4PLWA 3ROEA 3QOWA 3P2JA 1W46A 2TMDA 4ARVA 4P7FA 3ZNOA 1JLKA 3GCZA 5J58A 3EIEA 1CHNA 2B6NA 1VG1A 2OQRA 3IELA 4IIGA 4ZQCB 1JBEA 1E9RA 4MUKA 3KG2A 4JEHA 1XZHA 2X5NA 2W90A 2GN1A 4JP2A 4M98A 4CL2A 3WIUA 1NWHA 3NHRA 4L6CA 4P80A 2O3SA 5DWVA 4U3JA 5IBRA 2R1ZA 4GZ6A 2BEUB 3OQ6A 3KHTA 1NTOA 2C4TA 4V39A 3AHCA 2PZMA 5TQ2B 1WNTA 3GAAA 3TIFA 1FEZA 3NHUA 3OWOA 3P4UA 4ZYUA 1GUFA 3F90A 2A0YA 1VCIA 3M82A 4D3DA 1W581 3U3ZA 1NU6A 1PDOA 2E5LB 1XZNA 2C4UA 4QYTA 3H42B 1JR4A 3MYRA 2YC4C 3FR7A 1SCJA 4PPFA 1HE4A 1UM9A 1T9AA 2RH9B 4QC2A 5GIOE 4KQWA 1MC4A 3LVFO 1Y63A 1SBZA 1IQPA 3TVTA 3LD9A 1STOA 3ER6A 3KP1A 3W8DA 3ED5A 1IXZA 3E3LA 1I3MA 5HIAA 2C00A 3VOAA 1F8UA 1KS9A 1P2DA 4KSYA 3H75A 2FPIA 3PITA 2I4RA 3AU8A 1G21A 4DAOA 3CKLA 1TEXA 3DBLA 1X9HA 3MLEA 2CHQA 2W2PA 3N70A 3QKRA 4GQAA 2CL0X 3VNUA 5IDVA 1W29A 3FLBA 5AKZA 5TEWA 3SN6A 3I2JA 3NVDA 1BE0A 5EMHA 2Q21A 1XYVA 3M6AA 4N5NA 2H54A 3RSGA 3ZJ5A 1OBFO 4L72A 1A8PA 1RLTA 1E2FA 1VHLA 4LXHA 1EQ2A 4YP1A 1Q44A 4NZMA 3L8FA 1N1DA 2D8MA 4QG7A 1CUJA 2DWPA 2C4KA 3RT7A 3PUYA 4MITA 3P9RA 3TE6A 4DQLA 3UT5A 1AS0A 2XF2A 4E6EA 3S8EA 2Z3ZA 3CWZA 2CFSA 3AR2A 2IPXA 5JXJA 3AERA 4MHTA 5AM3A 2RGGA 1UK7A 1DRUA 3LVQE 4HNAB 2OHJA 3S8MA 5F76A 3M49A 1QH8A 3IEMA 2XUIA 4ZQFA 3LOQA 1B3RA 3KPJA 2ZW9A 1IBLB 2FFHA 5AK4A 3VI4B 1NRIA 4ZVLA 5LJIA 4RV5A 2O8VA 3C48A 4M9SA 1EM6A 3LX4A 4JLKA 3R09A 4ZOLA 1XZ8A 3WB0A 3C6MA 5J4LA 1T6ZA 2QRUA 4N1AA 2C58A 2RGAA 3OURA 3LCCA 4QHSA 1FUUA 3GI1A 3LQRA 1NN3A 4HAVA 5HUJA 2DU8A 3IR5A 3OP4A 5M34A 4C7OB 3OSUA 1J1UA 2NZYA 1SRQA 3JYOA 2I29A 2FK8A 1I32A 5T4HA 1N9KA 3HLKA 1Z2NX 2XA1A 3OIWA 4EFLA 4ZJYA 5EAIA 2A7QA 1QX4A 3SQNA 4P36A 2V59A 3WDLA 2B1RA 1TVCA 3N8IA 2DERA 4MA5A 3L49A 4ID3A 4WNIA 1RTKA 2OO5A 2ZQZA 1SOWA 2RD2A 2IL1A 4MCJA 1JDZA 3ISVA 3WGHA 1I3LA 2CFCA 4BZPA 2CZQA 5E8RA 1UFRA 2IDJA 4CXMA 1I6LA 2FA9A 1MOPA 4MMZB 3VMMA 3QVLA 1IWPB 1E2KA 5LL6P 1TYBE 1WHSA 2A7XA 3PD0A 2HMUA 4KIJA 2XYGA 4DW8A 4U7JA 5AKYA 4AUEA 5DO9A 4CL8A 1CT9A 2IRWA 1O96B 4ZEMA 1KAMA 2ZJBA 3K71B 2P5UA 1DO8A 2I8LA 4EHAA 2FSVA 3IOEA 3KOOA 3VJLA 1JEOA 5DH9A 3NT4A 4O4HA 3U4QA 3MQ4A 5CTJA 5HQ3A 4JUBA 4AICA 1U7UA 4KBFA 3RSOA 1M5RA 2YBDA 1E63A 3I04A 3LP6A 3VOTA 1NBHA 5F7XA 4NCXA 4NE2A 3DYIA 4CF6A 1WCYA 1Z4IA 4EW2A 1O9HA 1TB4A 3PQEA 4BZZA 5K0ZA 3P4XA 4ME6A 1J09A 3UNXA 3VYWA 4BFWA 4PLGA 4PZ9A 4B74A 5JTTA 4Y2JA 4A4DA 4Y0NA 4DREA 1KJYA 1DEHA 4FBGA 1C8VB 3TPFA 5KTKA 4E11A 1VA4A 3HBNA 4X44A 1DS6A 1B6TA 1YK1A 4J1TA 2CXXA 1FMCA 3EUAA 1BZYA 4Z4QA 3D3NA 5DTQA 1VJDA 1DB3A 1XZFA 3RPEA 3DZBA 4AO7A 2V3VA 2H2AA 1FQJA 4FEGA 1HDYA 3AKZA 1LJ8A 3L7DA 5CT5A 4FW8A 5T4FA 1SKAA 3H4MA 3LSYA 1FTYA 2WT4A 5CR9A 5I4BA 2BGNA 3JQCA 1X15A 3ILSA 3URMA 2Y93A 3DEIA 3DXXA 3P9IA 4CMCA 3VR4H 5HIIA 3NQ41 2Y0EA 1ZRSA 3GC6A 4A8TA 2PSSA 1N25A 3VHXA 5FFNA 4F4HA 1N6OA 3BRCA 5LUBA 4ODIA 1BU8A 2BEWA 3O3NB 4FR0A 3ZH2A 4KEAA 4OFZA 4KDEA 4ZGBA 3ESQA 4WDQA 1GDTA 4FHZA 4RIFA 1K89A 1QGOA 1MNQA 4X93A 5IC4A 4YCNA 2HB6A 1O6BA 3FFBA 4WCDA 5D5HA 1WSDA 3C8HA 4R0NA 2P5YA 3S68A 3F2VA 2UZ1A 3GGGA 4P82A 3QTTA 3NYIA 3O82A 3PEUA 3WLMA 1MHTA 1KI3A 1JW9B 4DLXA 2WFMA 3TIXB 2O05A 1DELA 3MK31 1AB5A 4D9JA 1SUDA 4M1EA 2IIQA 4EMBA 1N0WA 2PX0A 3ONNA 1CR4A 4HRVA 1V96A 4QQFA 4J7UA 4IJQA 4ZVQA 3S2YA 4DBLC 4Q1CA 3LJKA 5FBKA 2GPWA 3DOCA 3OETA 1XF9A 1AA6A 5ICSA 3DFZA 3R23A 2ZCUA 4QM7A 3T5TA 3T3PB 4YRRA 4HK4A 2F9FA 5HQJA 1P2FA 1VKJA 4F4JA 2O2GA 1XCLA 2QD3A 1G7CA 2FI1A 1UDBA 1VMEA 2G72A 1WPXA 2W2MA 1R0WA 2VHUA 3ISTA 5KNLA 3LUBA 4NMWA 4Q47A 3TEFA 1XROA 1U2ZA 4D42A 2BGWA 4PX2A 4CEJB 3L04A 4IRXA 4Y0VA 2VF5X 3NC1C 3O4FA 3BF8A 4N8DA 4BTEA 1U2GA 2YMLA 3VSEA 1FW6A 2C1EA 2XEDA 5IM4F 2FSFA 2O06A 3EBLA 2CHVA 3BWMA 3L41A 5FWXA 5EZYF 4DV5B 4D98A 1E9DA 1P1CA 3IOBA 4AAYA 5JY6A 3FYUC 1OFGA 4EJ2A 4CRWB 2GVDC 4HDMA 4RSMA 4QOFA 5PNTA 3ZV5A 2QPLA 3TW4A 3WRYA 3FBWA 1QS0B 1WB5A 4M1TA 2D1TA 3L8EA 1ZH4A 1COWA 1X94A 4NQZA 5KDLA 4B87A 2X86A 3HWX1 3A3YA 4BMCA 2ID7A 4EW6A 1U5AA 5IDWA 2C2MA 2GXAA 1ZRNA 2XNJA 1ENZA 5E9JA 4P3YA 2ZVDA 3ABQB 4HEA1 1J20A 4D4MA 5BSTA 4B6SA 4E5DA 5J2TB 1U1CA 3C98A 2J5QA 3H1PA 3KRTA 3VVBA 4FOOA 1P81A 2WP8J 3FYSA 1Y5MA 1SOMA 2HNKA 3BREA 3HWWA 1SKYB 3MJEA 3QMVA 2PGJA 2X5JO 4RL4A 1N0HA 1Q1AA 1Y3FE 3OESA 1Y3DE 3PUXA 3IVMA 5IH7A 3WGVA 4V1CB 1F5NA 1XMPA 1WQ3A 3WE7A 3R6DA 4DNPA 4XQGA 4TTAA 4FBLA 1OZAA 1RAGA 2F3QA 4JBHA 3RIHA 3D8NA 4ZVPA 3GPLA 4L5IA 4PIPA 2P4UA 3VPBA 2ETVA 5A7FA 1VL6A 3SQLA 4GZLA 4XFKA 5JJIA 4QO8A 3BJZA 2HDOA 3MTBA 4ML3A 2IYWA 4LC1A 4RGYA 2RHCA 4JIMA 1P8JA 2AVNA 2PVPA 2C9CA 4CEIA 3MT7A 1Y3CE 3GUHA 1NW3A 2W70A 4YXWA 4NXMB 2QXYA 3O8RA 3SF8B 2GPJA 1QRSA 1JJ7A 5EQTA 4EKIA 2OHVA 1VXOA 3GFQA 4QEZA 3QOYA 4Z7OB 1E0SA 1ZONA 4HX2A 3U4IA 1CJMA 3UK0A 1E5DA 3DEKA 2PZJA 1O96A 2UVQA 4KVFA 4PZEA 2Q07A 5ERXA 3REQB 1H8EA 4DR1B 4UBIA 4QJIA 1ZCAA 4GECA 1NLMA 4MUYA 1E0KA 3VH4A 5CDGA 1M1UA 1PBNA 4XVUA 5LDHA 3UQZA 1Q83A 1JPJA 3EPLA 1K5HA 2BEVB 1LLCA 5DNAA 4EUHA 4IS3A 1W94A 2XNDD 3QBDA 4QATA 4EJSA 5IW8A 4EZIA 3C3WA 2JGIA 2PT9A 3KVVA 1YS7A 3MW8A 2JKZA 4G2TA 4IIJF 5E0KB 3T1OA 1AG9A 1DIGA 2LVBA 4K2HA 4MIYA 5BQXA 2CXHA 2BPOA 3LO8A 2RIRA 5G1PA 4BKMA 4JV5B 4DUZB 1E5XA 1N6HA 5KTRA 1FOEB 4V38A 3PTAA 3PHBE 2JD0A 3QKIA 3NGMA 4NOJA 1PG5A 5IJ9A 5F7JA 3VO8A 1JXQA 1Y3HA 3WHLA 5LNK1 3OHSX 2TMYA 3ETEA 3BCSA 1DAGA 4JL6A 3BBPA 4UJ3A 3UHJA 1PEYA 4DQKA 4NESA 4IXNA 1FP7A 3L4EA 3R0QA 4JOBA 3NEAA 4IP0A 2GPYA 5BY2A 1I2MA 1T1IA 1PQ4A 3ESAA 3JQFA 5KSWB 3BEDA 1NXPA 3AIOA 5LZ5A 1MAHA 2MTBA