1LDMA

Refined crystal structure of dogfish m4 apo-lactate dehydrogenase
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
329
Chain Sequence
ATLKDKLIGHLATSQEPRSYNKITVVGVGAVGMACAISILMKDLADEVALVDVMEDKLKGEMMDLQHGSLFLHTAKIVSGKDYSVSAGSKLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKHSPDCIILVVSNPVDVLTYVAWKLSGLPMHRIIGSGCNLDSARFRYLMGERLGVHSCSCHGWVIGEHGDSVPSVWSGMNVASIKLHPLDGTNKDKQDWKKLHKDVVDSAYEVIKLKGYTSWAIGLSVADLAETIMKNLCRVHPVSTMVKDFYGIKDNVFLSLPCVLNDHGISNIVKMKLKPNEEQQLQKSATTLWDIQKDLKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M4 LACTATE DEHYDROGENASE
publication title Refined crystal structure of dogfish M4 apo-lactate dehydrogenase.
pubmed doi rcsb
source organism Squalus acanthias
molecule tags Oxidoreductase
total genus 105
structure length 329
sequence length 329
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1987-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ldmA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1ldmA02
3AW9A 4RO0A 4AJLA 4RPKA 2FR0A 4DQVA 4BKPA 1PJCA 4RJTA 1YVEI 4CM8A 4PLVA 2HMTA 1U5CA 2D8AA 4A26A 4DREA 1CDOA 3NEPX 4ZRNA 4B3HA 1KY5A 4ND5A 3AUTA 3O8QA 5LC1A 2ZATA 4AJ1A 2EJWA 4O0LA 1GCUA 1V6AA 3WGTA 4J4TA 1C1XB 1MFZA 3QE3A 3QA9A 3DFUA 4HY3A 1PSDA 1HE5A 3EC7A 2CUKA 2P4QA 4R3WA 4XR4A 3TL3A 2EXXA 4BMNA 3HFSA 5I9LA 3KYBA 2C07A 3ZWBA 4BNUA 1ISHA 1NYTA 4LVUA 5A3VA 3VH3A 3S8MA 3DBRA 5KWEA 1N1EA 4GWKA 5L7YA 3U3XA 4AJKA 1FMCA 1PL6A 1HDGO 2X9VA 1ZCJA 1EVZA 4LMPA 1G0NA 1G1AA 2DFVA 5TGDA 4FOSA 2PV7A 3OA2A 1AGNA 1PGQA 3EGOA 1PZHA 1UUFA 2DQ4A 3H7AA 3OJEA 1IE3A 3CSDA 4Y6RA 1M75A 5DOZA 2AEFA 4A2CA 3BHJA 3UHAA 3JQ9C 3W4JA 4UUPA 1E1NA 4IDGA 3WMXA 3AJRA 4RPGA 3GPDG 3ZV4A 4R01A 4CODB 1DSSG 1XGKA 1MV8A 5I7VA 5A5FA 5AXAA 4H7PA 3JQAA 1WMAA 4M87A 4WLFA 4UEOA 1H6AA 3OEYA 5L4SA 4BS9A 3V1YA 1LJ8A 4Y6PA 2AXQA 3OEWA 4KUGA 1HDXA 3GGPA 4BV8A 1Y9AA 3KLPX 3H5RA 3AI3A 4Q39A 2H1SA 1TT5A 1BXGA 4XYGA 3MJSA 1I3MA 3ZCXA 4D3FA 3GUCA 3JD1A 1Z73A 3F1LA 4MP3A 1Q0QA 3VZSA 4IBOA 4PLGA 4NBUA 3LSYA 4IMRA 5I7SA 4CM9D 3DBLB 4YYZA 1GEEA 4TQGA 2OO5A 3DOOA 3SBOA 4PLCA 4XJSA 5K6AA 1VSUA 3K73O 3ZWCA 5AXCA 1O95A 3KSZO 1FDVA 2VYND 4BO5A 3JYOA 3U9LA 4ZRMA 1RPNA 1ADCA 3F5SA 5GZ6A 2FZWA 5IG2A 4C7JA 5BNIA 4XGKA 4IQ8A 1WPQA 3ETDA 4D41A 4A27A 1EFKA 1Y7TA 2D5CA 2ZYGA 4NJOA 4RF3A 3JQ7B 4NBTA 4O6VA 1XG5A 1JW9B 3WQRA 4B8ZA 3GDFA 3WYEA 1KVUA 4NPCA 4Q3CA 4ZGWA 3I3OA 4JLWA 4CJXA 5DP2A 1DBVO 1N1GA 4L8VA 2BFOA 2B69A 4OYRA 3ZZNA 3W8FA 4BNGA 3IP1A 4I5FA 4WUVA 1DC5A 2NVUB 3FN4A 2B83A 5L40A 4CMIB 3ICCA 4CLEA 1PQPA 1MX3A 3RUIA 3AUUA 1C1DA 2Y1CA 3HB4X 3CTMA 3GNTA 3UXYA 4WEQA 1K6IA 3B6ZA 1E77A 1S7CA 2OGUA 3DHEA 3NDJA 5EMHA 4D42A 1U2DA 2DTEA 1DHRA 3TOXA 1LQTA 1ZSNA 1E3SA 5TLSA 3C24A 5BR7A 3QW2A 4B79A 4RVDA 1R37A 1ZMOA 4CPDA 2XAAA 3ASUA 2YYYA 2DLDA 3W4IA 1MGOA 3VDRA 3FI9A 1X7GA 4RVUA 1VM6A 2JD0A 3KYDA 1V3VA 4YCAA 4D7AA 1AHHA 3D3EA 3ENKA 1RWBA 4IXWA 1H5QA 1EFLA 4XYMA 1UP6A 5TT1A 2PH5A 5JBIA 4G81A 4IDFA 1PJ3A 3LC2O 1Y9EA 1QSGA 4CM3A 1SCUA 1XELA 4MO2A 3DZKA 3UH1A 1A7AA 2Q46A 1LUAA 3BMNB 4J0EA 1TLTA 4JQCA 4R16A 3AWDA 3L6OO 1NFQA 1IULA 3LF1A 2Q50A 4KDEA 3ANMA 4PG8A 3BHIA 5JS6A 4X54A 1TVEA 4RGBA 2JKVA 3B1KA 3AY3A 4PVCA 3TFQA 4ZN6A 1VJTA 4GPD1 5AOVA 1E3IA 1IZ0A 5AVOA 4LK3A 1HYHA 4TRRA 1ZXBA 3ZWNA 1YGYA 2YV2A 4IS2A 3K31A 3PZBA 1V9LA 2ZQZA 2P9GA 3WSWA 5B12A 1JA9A 1H2HA 3BMOA 3DZFA 3L6EA 3NV9A 4BKQA 4DQUA 2JCVA 4CLDA 2OBNA 3BMCB 5COQA 3C3XA 2PZMA 1L7DA 3TWOA 1TEHA 4DTIA 2I99A 2NQ8A 4AJEA 1U3WA 1N2SA 3GRPA 4ID9A 4FC6A 4PVDA 3JQGB 3IUSA 4BNNA 2WMDA 3TPCA 5CEFA 3RFVA 1F06A 3PPIA 3HNPA 3LVFO 1N7HA 4FC7A 1H0KA 1NR1A 4XQGA 3WDSA 1NWCA 1PQWA 3AY6A 3PJDA 2QG4A 4J1TA 3EUWA 2RHCA 3PJFA 3N7UA 4DQXA 1KBZA 2PD6A 2R00A 4ND4A 1HDCA 1EZ4A 4DA9A 2GLXA 2B5WA 1NVMB 3L4BA 3UGKA 4E5NA 1DFIA 3F6YA 4BHTA 1H6DA 4WLOA 1VRWA 2UDPA 3T4EA 2CFCA 1FDSA 2W2KB 1X13A 2AQHA 3RKUA 1NAHA 1I3NA 4NJMA 2LDXA 3LF2A 4FPXA 4GH5A 1SEPA 1QYWA 5HWSA 2NM0A 4QEDA 2O50A 3U62A 3WGZA 1R16A 4JBGA 5T64A 3ABIA 2NACA 3I9LA 1WW8A 3QRWA 3GMSA 3I9OA 1LQUA 2FN7A 3INGA 1Q1NA 3ANLA 4RLHA 4CM7A 4IY1A 2I76A 2PFGA 5CDTA 3M1LA 3I6QA 3WSVA 3RBZA 5G2OA 2V65A 4Q3NA 1G0OA 2W4QA 1NPYA 1XWFA 4Q3BA 4OMUA 2BGMA 2YFHA 2YQ5A 3BZUA 2DBQA 4WK6A 4EEXA 3TZQA 3GVCA 3E9MA 2BF7A 3H9EO 3KYCB 4WCDA 4R5MA 1V35A 2Q4BA 3KZVA 3VH2A 3IS3A 5CDSA 4PLYA 4BO8A 2UVDA 1DDOA 2X9GA 3ZNQA 1DLJA 4DXHA 4PGFA 5AXDA 3WGQA 3RCBA 4PLWA 3WQQA 5CEEA 4HFNA 4YQYA 2C54A 5GZ3A 1XU9A 3FCOA 1VE9A 4E2WA 1KETA 1HXHA 2VRBA 2J8ZA 4NBRA 4DC0A 4S1VA 1U28A 3K92A 1HYGA 3KTDA 2FHSA 3T7CA 3VOSA 4A10A 5JFOA 2NUAA 3OIGA 1O94A 1F17A 3BXXA 5DF1A 4D46A 3QP9A 3FTPA 1Y8RB 1GYQA 1U4SA 4LVCA 1ML3A 2P5UA 1LXCA 4YWJA 2WD7B 3GA0A 3QSGA 4YACA 1D3AA 2CDAA 1QLJA 3O9ZA 4FW8A 5A9RA 4B7CA 1DLIA 1JN0A 1DRWA 4BIIA 1R4MA 1XQ6A 4TSKA 3GR6A 1KYQA 4WKGA 5GMOA 2JCYA 4B4OA 3TF5A 1WAMA 3JQ8B 1QKIA 3VZQA 4I5EA 2HDHA 1JVSA 3SXPA 3HDYA 2AW5A 4DYDA 3HFGA 3ADPA 3B1FA 4D45A 2DT5A 4DMLA 4ZVVA 3EYWA 3GVPA 3D3WA 1KVQA 2Q49A 1GYRA 4Q3EA 1E7WA 3GF4A 3OBBA 3K96A 4IDDA 1NPDA 1KY4A 1UXGA 5ENVA 1LSSA 1K3TA 2E48A 3O03A 4PLPA 3PYXA 3SX2A 3PJGA 4TVOA 2DBRA 2FR8A 1AN9A 3FPCA 1Q7GA 1VI2A 1DIGA 1LSJA 3D1LA 5KTKA 4R1NA 5A05A 2YV3A 3OIDA 4JP3A 1E6EA 3AOGA 3U09A 4L9RA 3H2ZA 1ADGA 1PWXA 5CFZA 1OFGA 1D7OA 4OOFA 1XKQA 3PQDA 2X5OA 1KEUA 3K30A 1GQ2A 4GMGA 3CXRA 1AE1A 1LC3A 5C7OO 3WTCA 2DTDA 4DPKA 4E2YA 1R12A 2BI7A 4QX6A 5KVSA 4FBGA 1D8AA 4YDRA 1GY8A 1OC2A 2CSUA 3EDMA 4EUEA 4J0FA 1ADFA 3UF0A 3PWZA 3IKVA 2BFMA 1SMKA 2VWPA 2R00C 3IIEA 3WQSB 3DZBA 3L4BC 3PLNA 4XA8A 1QYXA 3EZLA 1UAYA 2Y68A 3Q9UA 1C0PA 3WNVA 4YAGA 2C82A 4QXMA 5ADHA 3QVTA 1V8BA 1H9BA 1PTJA 2Z1NA 2GZ1A 4RF5A 1DJNA 2BHLA 2GYYA 2YY7A 4R1UA 4BKUA 1QR6A 5LDHA 4YJHA 2C20A 4C4OA 4YRBA 1C0KA 2GRAA 3VPHA 2GASA 1O89A 1E1LA 3U4DA 5ES3A 5G0UA 5L45A 1EQUA 1UXIA 2VN8A 2VHVA 1RM5A 1DC3A 2IZ0A 3L9WA 3NTOA 1HLPA 3UFXA 3WB9A 4B4WA 1NM5A 2X9NA 1AUPA 1DJQA 1HE2A 4AJIA 4BNLA 2RCYA 1GYPA 2RIRA 4XB2A 2P9EA 3GUYA 2UAGA 1U3VA 1YB1A 5KVQA 3RIHA 3RC2A 2PY6A 1ZEMA 5F21A 4P4NA 1LLDA 5L4NA 1UZNA 1T2FA 1N7GA 3C85A 3GT0A 4I8XA 3JQ7A 4A73A 1P77A 1RM0A 1NX6A 4Q9NA 2RBEA 2W8ZA 3KHUA 5IZ4A 1IPEA 1GQYA 4EZBA 1E6WA 1GPJA 3GG2A 1YL6A 2O4CA 1KVRA 3S55A 2B5VA 4WOKA 2C0CA 1PS9A 1I8TA 5IZCA 4LRTB 2BLLA 5DZSA 4E4YA 1PEDA 4FN4A 3RUDA 2D2IA 1XU7A 3OQBA 4BNZA 4IQ0A 3ZWOA 2BGKA 4K26A 4JJGA 3ZV5A 1L7EA 5C5IA 3P19A 3RAJA 3WXBA 4J9VA 3ZI0A 4C7KA 5BSEA 4B8WA 2HUNA 1WNTA 2F00A 4J43A 4A03A 3DAGA 5TRTA 1OC4A 3QVWA 3AU8A 3DZIA 2NU8A 1YQDA 4ZQGA 3ZHBA 2ZB8A 4J2OA 3AOEA 1WVGA 1BMDA 4HFRA 1BVRA 4UUOA 4GSLA 2C5AA 2PZJA 1R0KA 3WBBA 3TRIA 5A3JA 1UZLA 3WMWA 5A06A 3F4BA 3QY9A 1FDWA 3H9GA 4XR9A 4YAJA 3GAZA 4KTTE 2DTXA 4NK5A 4P22A 4PLHA 3RUCA 1ISFA 2EGGA 3F3SA 1VKNA 3U4HA 4ZJUA 2AE2A 4PRKA 3AM4A 1P74A 5B1YA 4WCFA 3E5RA 2W2LD 2B36A 2J3KA 4E21A 4XKJA 4FGSA 4JX8A 1U1IA 2B35A 2Q99A 4EJ0A 5IDWA 4IJKA 2X0IA 4RF4A 2Y0EA 1Y8QB 3PVZA 4GX2A 1RYEA 2NTNA 1Z74A 1ZEJA 1SB8A 4E0BA 5TJHA 4MIEA 5KIAA 4Q3DA 2YJZA 2ZJ1A 4RZIA 4UEKA 5EL0A 3V2GA 3IC5A 4LGVA 5JCJA 3H9QA 3JQ6A 4W99A 4L4RA 3ITDA 1I2ZA 4B3IA 9LDBA 4HP8A 1CERA 4KOAA 4R3NA 4FJ1A 4AG3A 2J3IA 1GR0A 3BMCA 1GZ6A 2AMFA 5IDXA 5LCXA 2GN4A 2CD9A 5L51A 5KJ1A 1HSZA 4I5GA 3ASVA 1VC2A 1YJ8A 4OJNA 1JLLA 3T7EA 4FR5A 1M66A 2VUSA 3FNFA 4YJGB 4OHUA 4GI2A 1L1FA 3PGJA 3S2IA 4Z3DA 2CMDA 4E5PA 5CDGA 3PQEA 1P1JA 2IEBA 2VCYA 1W8DA 1QV7A 4QO8A 4XGNA 3EHEA 3NT4A 1PGOA 3FWZA 5GY7A 1I36A 1N92A 3GN2A 3PGXA 1UXHA 1GD1O 4CMBA 5I8WA 4ZICA 1E3EA 4NK4A 5G0TA 4EI2A 3QV1A 4J91A 4DC1A 2Y93A 3H9UA 3RUEA 4CLHA 3ETEA 1QG6A 4Y8VA 4K6CA 1I5RA 2IYOA 3VPGA 4E30A 3RJ5A 5KJFA 4N5NA 3BA1A 3FTNA 4BNKA 5L9AA 2Q1UA 2Q4EA 1XA0A 4OXKA 3DR3A 3G1UA 1R6DA 9LDTA 1OAAA 3WG9A 5H83A 3RU9A 1GV1A 3IQDB 3RFTA 3Q9NA 4IJVA 4GBJA 1I3LA 3QVOA 4CQMD 4R4JA 3EY4A 4CV3A 3ZH2A 4BNWA 2DVMA 4XIYA 4LCJA 4HUJA 1EK5A 1GUFA 1Q7CA 2EKPA 3UUWA 4NDNE 1E7YA 1DO8A 4DBVO 3JQCA 2QRKA 2QW8A 3R6DA 4FGWA 3GDGA 2IXAA 4OSOA 1V3TA 1Z82A 3ZV6A 3BTSA 3V1TC 4YRAA 4ILKA 4MJLA 5G0WA 4JIGA 1B8PA 4HFJA 1PR3A 4I9NA 3QLJA 4CMAA 4OXYA 3TL2A 1HF3A 2OHXA 1O0SA 4BKRA 2ZQYA 1UH5A 1B7GO 1CQJA 1WLYA 3VKVA 1YDEA 1XIVA 4WEOA 1S6YA 1YB4A 3MCVA 3DQPA 2C5EA 3OP4A 3WGOA 4G5HA 2C7GA 4O5OA 4WLEA 4ZA2A 2NQTA 5TC4A 3MJVA 2Y1GA 1Y8RA 4TWRA 2JD1A 2EV9A 4TMFA 3GNQA 4AL4A 4B3JA 2YFQA 4YTEA 3JSAA 2WD7A 3PK0A 3Q3CA 4NR0A 4RPLA 1P1IA 4WCFC 3SJUA 4F45A 2VHXA 2ZKLA 1LDBA 2V6FA 5JY1A 3E9NA 3INTA 1ID1A 1X0VA 2VUUA 1LDYA 5T6BA 2YUTA 1VL0A 3QWBA 4L73A 2JJYA 2IZZA 2WYVA 2Y0DA 1SEVA 2BD0A 3U0BA 8ADHA 2IODA 1M2WA 1TB4A 1XYGA 2YQ4A 1HSOA 1YXMA 5AQ1A 3NDIA 4HBGA 4QQRA 4R51A 4FIZA 4CUKA 5HS6A 2O3QA 2ZCUA 2VTEA 4DIFA 3I9JA 4OQYA 4R69A 2H63A 5F5NA 4D43A 3QJ5A 1BHSA 1MFPA 2EP7A 2VRCA 3G1TA 1E3WB 1EVIA 1PJQA 4U5QA 1R15A 1DB3A 5JXWA 3UVEA 2NU9A 1LTHR 5F1KA 2ZB7A 3PWSA 3WGHA 5IAAA 3S2GA 4J3FA 1U4OA 2GZ2A 1ENPA 3C7DB 1EUCA 5T8KA 1PGNA 4PN3A 4IIUA 1PGPA 2I65A 1NHWA 4CV0A 5THKA 2ZTMA 1NAIA 1ZZEA 4CR8A 1P3DA 2Q1SA 5JDCA 1HKUA 4UREA 4K9DA 4BMSA 3WYBA 4EBFA 4F6CA 3GZNB 5JC8A 1T2EA 2X0NA 4Z9YA 1YQXA 2OOSA 1ORRA 3I4FA 2PR2A 5A9SB 2A35A 1JU9A 1EVJA 2EGHA 2G5CA 4DYVA 3GH3A 2HKIA 3AFMA 5I9MA 4E2XA 5MGBA 4XRRA 2E37A 2FR1A 3GVXA 1WZEA 3B1JA 2D59A 3F5QA 2PH3A 1KVTA 1ZK1A 2X5KO 3NTQA 2GO1A 4GMFA 4PG4A 4RCVA 2G17A 5L3ZA 2GGSA 3BHMA 3MTGA 5FEUA 5JSFA 2YHUA 3IJPA 3NX4A 3KM0A 1NVTA 1R4NB 2AQ8A 2BFAA 3I9KA 4FD3A 4DLLA 3L6DA 3A9WA 1RM3A 1ZJYA 1EE2A 1ULUA 4LISA 2H5LA 1I24A 3PYMA 1YONA 1PU2A 4NHEA 4YB8A 2J3JA 4CMJA 4DPMA 3Q6IA 2WE7A 3O4RA 4WASA 3ZW8A 3DBVO 2D5AA 4IJWA 4MVJG 2QHXA 1E92A 2VTDA 4K6FA 1BXZA 1QMGA 3HZZA 1VL6A 4W7IA 3KB6A 1CWUA 3PHLA 1J0XO 1LNQA 2X22A 4BB5A 4FJ0A 2IDZA 1A27A 4II3A 1YBAA 4OXNA 5JMPA 4CMCA 3HN2A 1YL5A 2Q2VA 4OSPA 3JQBA 3LT0A 4BGVA 2QX7A 1W73A 3DO5A 3SLKA 3W6ZA 3N58A 2PLAA 5KCZA 2BGLA 1Z7EA 4XDYA 1PJTA 1GTMA 2PZLA 3H65A 4GX5A 3OSUA 3R3JA 4M86A 3GLQA 5DT9A 4TROA 3LT2A 5DOVA 1N8KA 2JHFA 1X7DA 1UJMA 2X86A 2C59A 4GVXA 1C14A 3JD4A 3EW7A 5C37A 4JXKA 1E1KA 2FZEA 1MUUA 3OFSA 3PJEA 1A5ZA 4MKZA 5JNLA 1DFHA 3D4PA 1KC3A 1XSEA 4CR6A 3PP8A 2HRBA 1GADO 4GLOA 4MKRA 1I0ZA 2VHYA 1B3BA 2VQ3A 1SOVA 1JAYA 1T2AA 4CQMB 1P0FA 2HMSA 4O59O 3ZWVA 3PRJA 1A9YA 1X0XA 1OMOA 1JKFA 3GGGA 3C1TA 3TDKA 4BO6A 1IB6A 1T25A 3RVDA 2HU2A 3COSA 3WGYA 2Z1MA 4XIJA 4F3YA 3INRA 4QT0A 3RUHA 3ZWWA 4YT2A 2H6EA 1NTOA 4YRDA 2AQIA 2I66A 3AM5A 4UULA 2HJRA 4A7PA 1Y1PA 2QQ5A 1M67A 1VLLA 2O3UA 3S2FA 3UAGA 3FSRA 3ROMA 2VYVD 1BVUA 4MP6A 1NBOA 4MVJF 4OM8A 1BWSA 3A28A 4DGSA 4MVJA 3D5TA 1ZJZA 1IL0A 4YJDA 2V6MA 3D4OA 3A1NA 5JDIA 1BW9A 1BG6A 3K2EA 4E2ZA 3FBTA 1DFGA 1MP0A 2DBVO 5JDCC 1XEAA 4H15A 4QTZA 3DOJA 5K6AC 4WLVA 3CKYA 2E49A 3LC1O 3ZNPA 4ITUA 3CIFA 1BSVA 1HDRA 2O23A 2TMDA 3E1KA 4BO7A 3PIIA 5ITVA 1LSUA 1GL3A 1ZK0A 3O26A 4RL6A 4UAGA 4UVDA 3SJ7A 1V3UA 1GAEO 3ZWPA 3FWNA 4IJUA 4U0JA 4U6QA 4GKBA 4S3MA 3OECA 1SC6A 3AM3A 4Y67A 2I3GA 3GC6A 4NBVA 4HX5A 5DBIA 2FPIA 3UOGA 1BXKA 5THQA 4YQZA 3D7LA 3I1JA 4YJFB 4QSMA 4M54A 2HQ1A 2Q45A 1O6ZA 4BNTA 3BTVA 3DBHA 3MOGA 4PZCA 5ILOA 3QHAA 1J4AA 3H8VA 5B4UA 1SOWA 4JCOA 1P0CA 1ZW1A 3EVTA 4PG7A 2RH8A 2ZTUA 3L9XA 3FBGA 1F14A 2B4QA 4CLRB 2HCTA 2NSDA 2NLOA 1F8FA 1BGVA 2GNAA 4RORA 2A9FA 3KO8A 2YHIA 3F1KA 5A1TA 2JCXA 4BNXA 1X7HA 2ZB4A 3AFNA 4RPHA 2CNBA 3WJ7A 3ZU2A 5BNTA 2AHRA 3DZGA 5CDYA 1XDWA 3CZMA 1T26A 2UUOA 2PKQP 5EINA 4JGBA 3JD0A 3MTJA 5T67A 4BQPA 1BTOA 2CVQA 4CM8B 4NH4A 1I2BA 4MINA 1ARZA 3G0OA 4ND1A 3ZU4A 3WYCA 5H82A 5EPOA 3VKUA 2WTBA 3DHYA 4J16A 3BYZA 4BKOA 4BO9A 2Z5LA 3Q0EA 1DC4A 4EEZA 4QFDA 2HRZA 2HK7A 3CZRA 3DTYA 1RKXA 5KVVA 2TMGA 5TX7A 1ZK2A 3ZU3A 1C1XA 4NI5A 1ONNA 3DBRB 3OMLA 1EDZA 3IP3A 3DONA 5EERA 4L75A 2CZCA 4RVHA 1DEHA 2Z95A 1ZIDA 4IZHA 4CM4B 2NV6A 3A14A 4EJ6A 1K5HA 3JQDA 1LDGA 1MC4A 2HLPA 6ADHA 1HLDA 1XHLA 3GK3A 5ENDA 2EJVA 2VNAA 3ETGA 3GNSA 3HUDA 3QVSA 4NFHA 5HS4A 3IL2A 2O3RA 1XCBA 1HT0A 3WIDA 1LLUA 5CP8A 1I10A 3EVNA 1LA2A 4AICA 2IZ1A 5IDYA 4TZTA 3NJ8A 3VPXA 2X7HA 2JFHA 5JAQA 2HMVA 1VJ1A 3GN1A 4FFRA 4XCVA 4EITA 4M1QA 3T4XA 1CEQA 2FPPA 3JQAB 4G65A 3A06A 1DIAA 2HAEA 4KQXA 2A4KA 5JYEA 1GZ4A 4Z9XA 3C1AA 3DOCA 2O7QA 4RF2A 3H5NA 5IN4A 1EUZA 1BXGB 5JDIC 2SCUA 4UVIA 1C0IA 4MVJE 2EEZA 4H16A 3IMFA 3H4VA 3LZ6A 4I5DA 4WLUA 1Y6JA 3NAQA 4NG5A 5ICSA 1C3VA 3BTOA 1I2CA 1QORA 3GFBA 4IQGA 3DEYX 4Y6SA 1DAPA 4P4LA 3PHIA 4M89A 3QWFA 5FWNA 4KP7A 3ITKA 1Q0LA 1MLDA 2YZ7A 3X2EA 2OZPA 3OF2A 1GUYA 3CMCO 2R2GA 2VOEA 4LSMA 3ZWAA 4CM5A 1ZO8A 1UAGA 1U7HA 3R1IA 3DBLA 4NBWA 4TRMA 1WDKA 1LI4A 4GGOA 1A71A 1Q2XA 4PZEA 3JD2A 1OZAA 5DCYA 5L4LA 4FS3A 1DIBA 2OMEA 2X8LA 3EAGA 3E82A 4KDFA 4BGEA 4OAQA 3OIFA 2ET6A 2OP0A 3DHNA 4J2HA 3U49A 2OORA 1VJ0A 4WGGA 1UXJA 3W8DA 3TZCA 3KV3O 1B8VA 4MPDA 3GZNA 1H9AA 4EGFA 5A9SA 1YB5A 2W2LA 4CLOB 4YT5A 2EERA 2O2YA 2ZCVA 2E82A 1ZH8A 2DAPA 3E9QA 1TXGA 4IMPA 4KZPA 4NFSA 3B70A 4CLOA 4NFYA 4BMVA 1P45A 1I01A 2P91A 1XR3A 4UEJA 4QECA 3OICA 4ND2A 2WM3A 2CVOA 2X23A 2IE0A 3E18A 1MC5A 4IIVA 2VZ0A 3RKRA 1YWGO 2EKQA 3ULKA 5FI3A 4MDHA 3VDQA 1C1DB 1FK8A 2DUUA 1X14A 2NVUA 3NRCA 1ONOA 4DL9A 3FF4A 2Y1FA 4NU6A 2VHZA 4CMIA 2A92A 3ZWMA 5JE8A 5DCUA 1M6WA 2BI8A 1KIFA 1GCOA 4RZHA 4ALLA 2IEDA 1IHYA 3PWKA 4M8SA 1Q0HA 3NGLA 4PG5A 3L07A 1RYDA 5J23A 1Q7BA 4W82A 3QWIA 1EVYA 3GVHA 4MOWA 2IRWA 1WMBA 2ZYDA 1ISGA 4WOJA 3RASA 3V2UA 4PZDA 5DDIP 1K6XA 2B0JA 5COBA 2YDXA 1ZKMA 3GEMA 3W4KA 1JAXA 4JJFA 1EBFA 3X2FA 4OH1A 4GAEA 5EESA 3GZ4A 3TN7A 4CMEA 1NQ5A 3CMMA 3PYLA 4R54A 1GFSA 1EMDA 2O4UX 3OQ1A 4QUKA 4QO7A 4FCCA 4JROA 1NFFA 4J90A 3RC1A 1T1RA 5KKCA 1Z7BA 4NU5A 5BNFA 3VVBA 4XD2A 3PHHA 3RC7A 2HMWA 3FHLA 3LLVA 4E32A 4Z3KA 1MXHA 1JVBA 1CJCA 3EMKA 1U5AA 3GHYA 3GPIA 4E31A 2PD4A 5L53A 5EQDA 5KOIA 4DLAA 3QQPA 4D79A 3RROA 1DPGA 4LCEA 5IFLA 4PCVA 3G49A 3KEQA 1SO8A 2Q3EA 3AI1A 1B0AA 3BMNA 3FNHA 1DRUA 3JQEA 4YR9A 1QRRA 3QWHA 3GHHA 3HADA 2VT3A 4CQMA 4YPOA 2JAHA 2EF1A 3WLFA 1NXQA 2P68A 3ZHYA 2IYPA 3AUAA 1QYDA 3TZ6A 4W4TA 1Y5MA 2QIOA 3BMOB 3HDQA 1A9ZA 2O2SA 3ZU5A 4DBZA 2X1HA 4EJMA 5TIIA 1M76A 3DXFA 3ZNNA 2PGJA 2Y0CA 3JQ9A 1YBVA 1UDAA 1NNUA 4J4BA 2HO5A 4QFCA 4R5HA 4BB6A 4E5MA 2C2XA 3RSHA 3GVIA 4TZKA 4XQEA 1E7SA 1JDJA 2R6JA 4KQWA 3JQFA 4YT4A 3ZWXA 1B15A 1E7QA 1U8XX 4I9UA 4B4UA 5TF4A 1W6UA 3FNGA 4OL9A 5CAEA 1HDZA 3DB2A 3FPLA 3JQGA 4K28A 4URFA 3PZRA 4YAKA 5KNLA 3RQSA 3DAFA 1U2GA 2BH9A 4MVJI 1XLTA 2PKRA 7ADHA 3I5MA 3OJLA 4MKXA 3UCEA 1UP7A 2DBZA 3SLGA 1MXFA 2QYTA 3HHPA 4FFPA 2I5PO 4TRJA 3M6IA 2JD2A 3PLRA 2X0JA 3CEAA 8LDHA 4UVEA 4MP8A 3F9IA 1E7RA 3TNLA 1PZGA 1NPTO 2G0TA 3GEGA 4E3ZA 3EK2A 4J1SA 3BMQB 3FD8A 1PZFA 3OHSX 4IZIA 4JP2A 4NJMB 4BNIA 3LDHA 4GSKA 1ENOA 4FFMA 3VH4A 1ONPA 3PHJA 3KEOA 6LDHA 2FMUA 3GQVA 1GQQA 2UYYA 2QRJA 3GAFA 2W2KA 4INAA 4GGPA 1NWHA 3KSDO 4RQUA 3ONDA 5ICMA 4XDZA 3U4CA 4IS3A 4R68A 3MJEA 3PEFA 3WTBA 1K2WA 4BGIA 2Q1WA 4HNHA 3R3SA 4CM1A 1CYDA 3L0DA 3Q11A 3MJTA 3NUGA 5ITWA 1E0DA 1ENYA 1U3TA 1UDCA 1YOVB 4YJFA 3SC4A 4YT8A 4IGEA 5KJEA 3JYQA 4OOEA 5CG1A 2EW8A 2OL4A 3JYNA 5IXYA 4YVFA 1G6KA 1U3UA 3H3JA 5IZCC 2A94A 3HWRA 3D5QA 4Z0TA 5BSHA 4BO3A 3ORFA 1KEPA 2NTVA 4BVAA 4CLRA 3F46A 5G0SA 3WS7A 5FFFA 4CM9A 4DIOA 3PFFA 5FF9A 4J1QA 2X6TA 3K8ZA 1LSOA 1TA4A 3JV7A 1E3JA 3CUKA 1N9GB 3KYCA 1YBMA 1T2DA 4ESOA 1E5LA 1T1SA 2VYNA 1CETA 3AOEC 2ZTVA 1QXSA 1EEHA 4TKMA 3SC6A 4ZHSA 4CMEC 1O8CA 3IUPA 4UVGA 3WWZA 1EK6A 2W98A 1R0SA 3ST7A 5JCJD 4TRNA 4JN6B 1E1MA 4YAEA 2I6TA 4IUYA 2JHGA 1GUZA 3W1VA 3K5PA 2VWHA 5EN4A 1Z75A 1FXSA 1TI7A 3HQ4O 1NP3A 4BNFA 4RVFA 2FP4A 1PIWA 1DRVA 1E7MA 3U4IA 1OI7A 1R4MB 2O7SA 3RUAA 4BNHA 3BAZA 4ROSA 5F3RA 1EDOA 1FJHA 2EP5A 2J6IA 4DUPA 1JWBB 4IGFA 3WNQA 4GLLA 3UW3A 3PFWO 5ER6A 2X0RA 4PLFA 4Q3AA 2PK3A 4CM4A 3D3WB 3JCZA 5GZ1A 1Z6ZA 3TQHA 3H6KA 3JQ8A 3TOZA 2G1UA 5JLAA 1M6HA 4XWYA 4IDCA 4B4VA 2WE8A 4J49A 4IPTA 4K1LA 3VTZA 2HK9A 1P1HA 3DWFA 1T24A 3WX0A 4RVGA 4OKIA 3UICA 1F12A 3GEDA 1IPFA 2J5KA 1J49A 4D3DA 2BRUA 2QZ9A 2AQKA 1E6UA 1CQIA 2XOXA 4UUNA 5DN9A 3JQFC 4BQRA 1PJ2A 3UCXA 3O38A 4D44A 3BTUA 2FOIA 2NVBA 2WWRA 4LW8A 4B7XA 3NT2A 1HWYA 2PKQO 3HN7A 2C2YA 2EKLA 3ENNA 4XZ3A 4HNGA 1WZIA 1W4ZA 1PS0A 1IZ9A 1YH3A 3PDJA 2O3SA 4OGWA 5DP1A 3H2SA 3H9JA 4CM6A 1B3RA 4AVYA 2VNSA 3MOIA 1V0JA 2JFGA 4WLNA 4Z0PA 2DPGA 5HM8A 1NQAO 3WIEA 2XF8A 3W6UA 4HFMA 3QIVA 3VC7A 3JYLA 4L0QA 4YXFA 1U8FO 1WDMA 4YJHB 5IJZA 3RWBA 1HZZA 1WP4A 4WNIA 4CMKA 1LC0A 3L77A 3PHGA 2C7VA 3LU1A 1GV0A 4W7HA 1J5PA 2VWQA 1DOHA 5ER9A 2J3HA 5CHEA 3Q1LA 1DC6A 1O5IA 4Z9FA 1B16A 4HADA 5L95A 1PJBA 4FOOA 3UKOA 1MG5A 5JO0A 3Q2KA 5JC1A 2PD3A 3PIDA 4M49A 2OBYA 4ZQEA 4OKNA 4MVJH 2PTGA 5JAIA 3FNEA 3HDJA 2WYUA 3ON5A 3ZNOA 2VUTA 2VYVA 2D4AA 1A7KA 5K0ZA 2CDCA 5TQVA 7MDHA 1AHIA 2NADA 3PI7A 4PG6A 4BO1A 3GRKA 3KXDA 3AU9A 4MIYA 4LSWA 3CPSA 1EBUA 2AG8A 2UUPA 5AXBA 2Q2QA 3OJ0A 3VVCA 3FR7A 3S2EA 2B37A 5CPFA 3I9MA 4R1SA 3RC9A 1P1FA 1CIVA 3DTTA 4E6PA 4YEDA 4PIVA 1SAYA 2POQX 2GPTA 5HA5A 2VOJA 5FYDA 3JQAD 4BNVA 3M2PA 3KLMX 5MDHA 2PWZA 1X1EA 1ZK4A 2JL1A 4KMSA 4NZ9A 3WFIA 1TT7A 5IDQA 4CLXA 2XPCA 3E48A 4J7XA 3LLSA 4P8RA 4GWGA 3K6JA 1LDMA 1SNYA 4P38A 4YAIA 5C3MA 1ZVMA 4WNCA 4XB1A 4CQLB 5C7LO 4YBZA 5HTOA 3MJ4A 2XXBA 2VRCD 3DAPA 3E8XA 1PJ4A 4N18A 5DBFA 3ZHZA 4AJHA 5KVCA 5COAA 2I3AA 4ALKA 5KJCA 2Y1EA 3VAZA 4XX0A 2HJSA 4BGUA 5TS3A 1E3LA 5LDGA 1WWKA 2GERA 3C7CB 1B26A 3OQ6A 3W8EA 4A0SA 4EUHA 5JAZA 1H2BA 2DFDA 2V7PA 2DPHA 3C7AA 3DDNA 4WJZA 3ZWYA 1B14A 3VTFA 2X4GA 2PGDA 1MB4A 4PLZA 4AJNA 2EW2A 3HJAA 2QZZA 4BNYA 5B4TA 4ALJA 4L4XA 4WECA 2OXIA 4XYLA 1H94A 1HL3A 2VHWA 4OIMA 4L76A 1LEHA 4WCFB 2NWQA 1SPXA 4M55A 2FSVA 1YDWA 4Z0HO 5TSDA 4UVHA 1YQGA 1LX6A 4DWVA 4E5KA 5CDUA 1HDYA 1YS4A 1IHXA 4EDFA 4N5LA 1R66A 3RD5A 4KWIA 3IJRA 1UXKA 3K2BA 2OFPA 4XJTA 5IXSA 1ISMA 3IOYA 3ROQA 3VPFA 4D3SA 2JAPA 3ICPA 2Y1OA 1ZMTA 4GQAA 4HWKA 1ZSVA 1PL8A 3N74A 1Y8QA 5A03A 1DIHA 5JCXA 1JTVA 5T8KC 5KJ6A 1A4UA 2O48X 4BL5A 3H3FA 1HRDA 1U9JA 1GEGA 4R1TA 5G4KB 3KUXA 2GCGA 1P31A 1PX0A 3PTZA 3HDHA 1CF2O 5T57A 1ZBQA 1DXYA 1UZMA 2CF6A 3LC7O 5DULA 1NVGA 3I9NA 2VWGA 4RQTA 5EQFA 3CINA 5DCWA 3DFZA 3D64A 2DC1A 2Y1DA 3DL2A 1YO6A 4IDBA 1KC1A 3AY7A 1YJQA 4GL4A 3BIOA 4YJGA 4UUMA 3MZ0A 4RVSA 5A5EA 3G79A 1VSVA 1LRLA 2GN6A 2DUWA 4JBIA 3KVOA 2O3JA 4NIMA 4FB5A 1UR5A 1ZSYA 1LDEA 2WYWA 3LT4A 4FJ2A 4P4GA 1JQBA 4LMRA 3WICA 2GZ3A 3KSUA 4TKLA 1KOLA 3BMQA 4J4HA 3C8MA 4HKTA 2HSDA 3G3EA 3E5MA 3VZPA 3I4CA 1ZFNA 4F6LA 2EIHA 2X58A 2EG9A 4KTVE 4BNMA 4PRLA 1WDLA 1LLQA 2ILTA 4CUJA 2D1YA 4GX0A 3L4SO 3P5SA 4II2A 4RDIA 2CY0A 4J6FA 2LDBA 3I52A 4XYEA 3GY0A 3OM9A 3GMDA 3JQBC 2AE1A 1YOVA 3JTMA 1PGJA 2CF5A 3O8QB 4PLTA 2NNLD 2W90A 1MA0A 2VZ8A 3M2TA 2HMUA 4N7RA 1DHTA 1H93A 3DZHA 3WWYA 3E03A 2AEJA 2FWMX 3ROPA 2UV8A 2EHDA 1VPDA 3V5NA 1D1SA 5F5LA 1PQUA 5JW6A 2GUGA 5BSFA 3GOHA 2OP1A 3NGXA 4EW6A 2BKAA 3H5AA 2GSDA 4FSHA 2DKNA 2GF2A 1VKOA 4ZQHA 4WPGA 1N9GA 1U7TA 4MVJD 2CVZA 2D3TA 5JY6A 1B2LA 3GG9A 3P2YA 3VZRA 4DRYA 5HRUA 5A4DA 4R9RA 2P5YA 1B8UA 1HEUA 3FR8A 1QYVA 3B20A 3F47A 3HE3A 1FF9A 2O3TA 2NVWA 2RAFA 4IDEA 5A02A 4KUEA 4NQZA 4U6SA 4WE3A 4TVBA 4LRSB 1GPDG 2P9CA 3HG7A 1P44A 1X15A 3FRJA 2GD1O 4D0RA 5C7IO 1NQTA 2D0IA 4E12A 3V8BA 5I9NA 1ZK3A 1MG0A 3STHA 4D0SA 4HXYA 3EZYA 2WSBA 1UDBA 2XXJA 1RJWA 1IY8A 1NASA 4IM7A 1PJLA 1UP4A 3PQFA 3K9QO 1HYEA 2IXBA 1PR9A 2Y99A 2PNFA 2P2SA 4OO3A 4RDHA 1LU9A 1TT5B 3D0OA 4ZU3A 5B4VA 1JKJA 5K9ZA 2BELA 3OETA 1P9LA 2CDBA 2GR9A 1X1TA 5EIOA 1D4FA 1WXDA 1QP8A 4PFJA 3WGGA 1HDOA 3OA0A 1P1RA 3ONEA 3IDSA 2WD8A 4ONEA 3WR5A 2FRDA 4RPJA 2FY8A 1W0CA 1P33A 1E3WA 2DM6A 2RH4A 3WFJA 1NHGA 2B4RO 2NU7A 4CUZA 4JBHA 1FDTA 4FFNA 2P4HX 5U1PA 4A5OA 1HTBA 4DMMA 1E5QA 4GVLA 1K6JA 4FDAA 3NT5A 3GGOA 4XGIA 3TZKA 1KEVA 4BO2A 3QVXA 3ONFA 5BSGA 1LRJA 1KERA 3TZHA 4G2NA 1SZJG 4E5YA 3IAHA 1AXGA 4RV9A 1BDMA 3CH6A 3KBOA 1BDBA 3OJFA 4GKVA 4CV1A 5JYDA 1T2CA 2WJPA 4W9NA 2GDZA 4I08A 2J5QA 3GFGA 5HBRA 4FQ8A 3A4VA 3NYWA 1I30A 4R41A 3ZW9A 3RFXA 5EJ2A 2OUIA 3ADOA 1IUKA 4J7CA 5CPBA 3KETA 1ZNQO 4U0KA 2HK8A 5DNAA 4AJ4A 1LLCA 2PA3A 3JD3A 3WBFA 2Y67A 1YL7A 4BO4A 3NTRA 4IINA 3ROKA 1OOEA 3OJOA 3LQFA 3S1LA 3DMTA 1J6UA 2ZYAA 1KEWA 1NQOA 1YRLA 4DPLA 2V6GA 1R4NA 1ADBA 2ZJ0A 3LT1A 3WJAA 1JKIA 2ZTLA 1GDHA 3TFOA 1Y81A 2FSSA 1SBYA 3DZJA 2EWMA 4ND3A 4BUCA 3G17A 3TJRA 4BNJA 2PZKA 1F0YA 4MIOA 1A4IA 3RUFA 1ISIA 5BQFA 2AA3A 5TJ9A 5U4QA 4I1IA 2B4TO 3GDOA 5G4LA 3ZDFA 4E13A 5B37A 4B7UA 1FDUA 3AK4A 2AEMA 4Y9DA 2JFFA 4OQZA 3C1OA 2Q1TA 2QYSA 5FI5A 3KYDB 2YDYA 5AYVA 5I7EA 4FFLA 2YW9A 5F1OA 1NFRA 5U9CA 1HE3A 4ZQBA 2G82A 4O1MA 4ALNA 2NTJA 4N54A 2ZIZA 3I23A 3I6IA 4U8GA 1KVSA 4YA6A 5JO9A 3WOHA 5IF3A 1A72A 1N5DA 1K0UA 1LRKA 1GZ3A 3NKLA 4CL3A 2YV1A 4CQLA 4U7WA 2GN9A 1ZUD1 1I33A 3MJCA 2F1KA 3E6AA 1PZEA 3RI3A 5L7TA 1T4DA 5A04A 5BT9A 4GX1A 1PWZA 1QLHA 3RU7A 4DLBA 4I9HA 5TNXA 3WGIA 2BFPA 1IOLA 3HB5X 4AJOA 1KS9A 3ZN2A 2V6BA 1P1KA 3RJ9A 3VH1A 1YE3A 3D4NA 4HV4A 1GU7A 2WDZA 4J1NA 4BOYA 3MWDB 4R9SA 4ZD6A 2Q2WA 4Y98A 2I9PA 3NJ4A 2X5JO 4N5MA 1I32A 1JWAB 2C29D 4AJJA 3P7MA 3ZV3A 5KKAA 4XRGA 5CG2A 2RHRA 3I83A 3HSKA 4XQCA 2PGLA 4F46A 3U5TA 5G0VA 1D1TA 3IKTA 5H81A 4XQ9A 2AG5A 2E4AA 4W6ZA 1AXEA 4J9UE 4JJIA 1Z45A 3DC2A 1XQ1A 2NU6A 1F8GA 1ENZA 1H6BA 5F1PA 4DVJA 4EYEA 4KWHA 2E6UX 3PDUA 1BW9B 4O63O 3ZHXA 4E33A 4L74A 4NMHA 2Y66A 3SEFA 2ZB3A 1DAOA 4CMGA 5JAMA 3JYPA 1QYCA 3RBXA 1PS8A 4MVJM 4J7UA 4BO0A 5JPIA 2VT2A 1HE4A 3LYLA 4EUFA 4FFOA 1CRWG 4IXTA 2GN8A 2WEKA 3KOUA 1H6CA 3MWEB 4MVJP 3P2OA 3ZGYA 4AJPA 1ZXLA 4H3VA 3WLEA 3R0IA 1OBFO 5G4KA 3UN1A 2G76A 2VZ9A 4CMHA 4CV2A 3Q2IA 3AI2A 1EE9A 4Z6KA 3SVTA 2BMAA 3V2HA 1I3KA 1K89A 1PL7A 4ALIA 5CEJA 4W9NC 3DMYA 3AUSA 2J5RA 2I67A 1VL8A 1NR7A 4AFNA 4RLSA 1EUDA 4ALMA 2DU8A 3ANNA 4XYBA 1EQ2A 4IDAA 3VHRA 4KUHA 4DIBA 3QWAA 3TSCA 2H9IA 2QRLA 3UCFA 1HZJA 4XEHA 3LK7A 3NDRA 4BV9A 3PXXA 3DBHB 3VPSA 1HETA 5IN5A 1QV6A 1ISJA 3KRTA 3DMTC 1IYZA 3M1AA 1O9BA 1R0LA 5DBGA 3CE6A 4JK3A 1LBEA 4CR7A 5JMWA 5ILGA 3RBVA 1PJSA 2YHIB 5I8ZA 1SB9A 4LN1A 1RM4A 3V1UA 1C0LA 2ZK7A 1LDNA 5T5QA 1T4BA 4NNJA 4ZQFA 4JNKA 2Y05A 4AJ2A 1DIRA 4L4SA 3MEQA 3F4LA 5L7WA 2FPGA 5I7FA 5TT0A 4CL8A 1ULSA 1Y5RA 1YKFA 5A9TA 1BRMA 3OH8A
chains in the Genus database with same CATH superfamily
1E98A 2Z56A 2CDRA 4N0EA 5K3BA 3IVGA 4AJLA 2H1HA 2YHSA 1PJCA 1P5JA 4N9WA 1VKRA 2I4NA 2HMTA 1U5CA 2D8AA 1SQ0A 4A26A 4DREA 2ST1A 1KTVA 5JECA 1E1CB 4W7SA 3AUTA 3IHKA 2ZATA 2BGNA 4K8OA 1OPRA 4LYAA 4AJ1A 3TD2A 1P4GA 2PFKA 4C3ZA 3K0HA 1COWD 2VT7A 4QBTA 1KDZA 3WGTA 3E61A 3W90A 2VTBB 3X1MA 4RXUA 2JH9A 1JQEA 2J3DA 3DFUA 3EF0A 1PSDA 2I1LA 4R3WA 4LYEA 2G4VA 4YQFA 3C15C 3HFSA 4UPDA 1USUA 4WFIA 1G2PA 2J3MA 3DQZA 2XQIA 1UBRS 4LVUA 4BPBA 5FV7A 4B31A 1T8YA 5A3VA 4LPKA 2D2VA 4OVKA 4QYMA 5K3FB 1PL6A 2YXNA 2KSQA 3DEJA 1ZCJA 2O2ZA 2PMCA 3U4QB 4C3OB 3QE2A 2DFVA 1L1QA 4MS1B 5K3CA 3OM1A 3NAGA 2OFXA 1BN7A 1SQ5A 2NW6A 2ZI3A 2OD2A 3THYA 4LF5B 3CO0S 2AG1A 3KQOA 2UZIR 3MK31 4OI0A 4Y6RA 2VAXA 2BFNA 1M75A 1XQXA 3OKAA 1T43A 4MK4A 3NYRA 5P21A 4KO4S 4QRHA 4XFJA 2PX0A 3UHAA 2ZSIA 2DQSA 1FRFS 1O57A 1O0BA 3DF9A 4RPGA 3NDBB 4DEXA 2P2ZA 3OIVA 2W6MA 3OF5A 3QHPA 2PM8A 4X6LA 1KP9A 3LVBA 3N8DA 4D9CA 4A8JA 4LGMA 4J03A 1JJIA 2WC1A 1BAPA 2L42A 3JQAA 3CLTC 1NVUQ 2A9VA 4M87A 1TF7A 3D8TA 1EZ1A 2RK4A 4EQZA 5L4SA 4BS9A 1LJ8A 1Y4SA 4G09A 4ZVQA 4NPHA 1F7VA 3K0EA 2C3YA 1Y9AA 1YBFA 2R8PA 4UFPA 2JGFA 1U2GC 3V34A 5EZQA 1ABEA 3EQZA 2XRZA 4Q39A 2H1SA 3PB3A 2VJLA 2WWGA 5ADUS 1BXGA 4KMMA 1PT9A 2AVDA 4Q7EA 4P98A 2AN9A 1I3MA 3MJSA 3P9XA 4C4RA 5KTNA 3C8ZA 2RG1A 5A71A 1SGWA 2ATVA 2B0CA 2V5UA 4MP3A 4HZGA 2R9VA 3JXEA 3VZSA 2Y77A 1GNPA 3DPIA 3FTCA 1IHUA 3JPWA 4L0CA 4NY1A 4PLGA 4YCDA 4C7XA 3EEQA 3HU3A 2I78A 1XZFA 2X0DA 3UMBA 1GPLA 1KPHA 4YYZA 4X8OA 1B74A 2D2FA 5I7WA 5SZKB 5I4KA 4PXSA 1O1YA 3RREA 3WRVA 1VSUA 3K73O 4DLYA 1IZYA 1XCMA 2Q0HA 2XUHA 1C80A 1N6RA 3KSZO 4X8MA 5C53B 2ZIFA 3U44A 2ISQA 1AZLA 1ADCA 3F5SA 4KR2A 2FZWA 2JBHA 3DG9A 2FF5A 2UZ1B 3FGPA 5EKUA 5IH3A 4C7JA 5IG2A 2ZE8A 1MAWA 3I34X 4KVGA 4JQSA 2O8BA 4ZOBA 2XXAA 3TNYA 4D41A 1EFKA 2GILA 2AK2A 1KAMA 1KZ4A 1KK2A 1UMBA 2DHQA 2JJ2A 2ZYGA 4NJOA 1IEXA 4FDMA 3ZBTA 3V6MA 4OGLA 1NMSA 1CUIA 1NE2A 3L7BA 1H2FA 1JW9B 2ERYA 2JJ1A 2I2BA 5A6SB 4ZGWA 5JHHB 5YASA 4CKBA 4WH0A 4JL6A 1DBVO 3QBTA 4N03A 5KNBH 3WRXA 2GPSA 4W5HA 1LJUA 3R7NA 4F2HA 2A9OA 5BSRA 2B69A 3SR0A 5J47A 1WDTA 2BEVA 2B5OA 2ZRHA 1K9VF 3IP1A 2NO7A 1KEEA 2WUGA 2QQFA 1ODJA 2QT0A 3JAWB 4KQEA 4CU2A 5DCLA 1V26A 1PQPA 4D56A 2QAIA 5KYXB 4IVNA 5CURA 3AUUA 3SZUA 2C7OA 2Q2OA 3QU2A 3HB4X 4M8IA 1SWVA 3EODA 3U4MA 2YZNA 1WCYA 3F5DA 3F98A 4BDSA 1AXRA 1E77A 1EP1B 1S7CA 1WPXA 3H75A 3NDJA 1L1EA 4J8PA 2PZEA 4UNNA 1U2DA 4YHBA 2DTEA 4O1HA 4D42A 3PQ5A 2HK6A 5B7PA 2ICAA 1VE3A 4IMIB 4AP9A 3ELDA 5TLSA 1JF8A 3K0KA 2NU8B 5EEHA 3LWBA 3JALB 1QAOA 1AF7A 1R0XA 1X77A 3A9CA 5CJ2A 4OYYA 4B44A 2XTNA 2XAAA 3NBUA 3CLSC 1P7YA 2YYYA 3RGWS 3QUQA 1MGOA 3FI9A 1B8OA 1JT2A 4L3OA 2BCEA 4HR7A 3R7LA 2MSNA 4I50A 3OPMA 3JASA 4RCZA 2FPLA 3KYDA 3LMKA 4ZOAA 4BLWA 3FRIA 1ZIOA 4ZDKA 1J0DA 4RAQA 4D7AA 2H54A 1YR8A 3KG2A 4N0MA 2AC7A 5I01A 3D3EA 1UL1X 4DB2A 3SHTA 2WPDA 4RK5A 1Z9BA 4CKEB 4QNNA 3SIWA 1QSGA 1SBQA 1N2CA 1YRQA 1UIMA 3I8XA 3AB7A 2ES4A 4CM3A 1SUWA 3UXEA 4MO2A 4KFRA 1V8ZA 4RIEA 3SDZA 4MNTA 3HGMA 4NX2A 1TLTA 3HI6A 1A8HA 3AWDA 3IUEA 3NYIA 1IULA 4W8GA 3OHMA 4ZOLB 2Q50A 4X41A 2XE7A 2EF0A 4KDEA 1T35A 4RHTA 3ESCA 4DLWA 3LY8A 4HDMB 2J4CA 4IHJA 2YASA 3IPLA 1R8JA 3H4IA 4M6WB 2OT3B 3IAEA 4PVCA 4ZN6A 3V4RA 1YC2A 1Z35A 2FN9A 1GSAA 1ZD3A 2EHJA 3ZWNA 1TK2A 4IS2A 4WHMA 2ZT7A 1B0UA 1QH9A 3THWB 3UHFA 5DXJA 1IRXA 5EP1A 2YNMC 4MQLA 3CZPA 1R0RE 1JA9A 1Q92A 1N34B 3R7DA 4BQNA 3CBQA 2O5VA 1M3SA 1UMKA 4BCCA 4EY6A 2J45A 3D0QA 3D3JA 1RWPA 4HRYA 4C9BA 1TEHA 2QRMA 3ME5A 4MR7B 1GT6A 2NQ8A 3HKBB 1V5WA 1VPTA 5DX0A 1FBTA 3O0DA 2ZULA 3GRPA 1VBMA 1AY0A 4B75A 4O25A 1CE8A 5AJVB 1XRMA 2YL2A 3CQ9A 1UMCA 3VSAA 1J0EA 4JUAA 4RK0A 1GAJA 2UZ3A 3L05A 1J2RA 3LW8A 3V48A 4DMHA 4PSKA 1CHDA 2XWSA 4ENVA 3LVFO 4ZAXA 2RC5A 3IQFA 3BREA 2WNIA 1DUSA 1AQUA 4F12A 1PQWA 4EY4A 3KLNA 5SZHB 1OAKA 1QGAA 3DT8A 4J1TA 3ROXA 1ZLXA 4Q00A 3TOSA 4AK9A 2VPPA 1O95C 2VPXA 2PD6A 2OPBA 3MVEA 1VCHA 3QOYA 4WWHA 5AI6A 3I8OA 4EKDA 4YMLA 2GLXA 2B5WA 1NVMB 3I5UA 3L4BA 4LI0A 5EI5A 3BL6A 1O58A 3OOEA 5FP0A 3UGKA 1DOZA 3OZ7A 2HB6A 3VI4B 4DM3A 1H6DA 4LY9A 4NS4A 4EH1A 1PQYA 1Z4QA 1FDSA 1S4QA 3UUEA 3VFDA 3COJA 3BXZA 1X13A 1RDFA 1XTUA 2PVSA 3W3AH 4EJSC 2AQHA 2F1OA 5B64A 1Z6XA 4AWBA 4MWZA 2GCIA 2W6CX 3OLYA 4L57A 4NJMA 4BFZA 4BFWA 2DKFA 4Z1MA 1SEPA 4S2EA 3A10A 3H05A 3L0CA 3EZXA 4DQLA 1VE6A 2D1TA 2ZWVA 3AFGA 3OE7A 3TQCA 3VGPA 2JBAB 3WGZA 4FB4A 5JNTA 2O7VA 5T64A 4F4CA 3HEAA 1GRNA 4Z4FA 1WW8A 1QIHA 1ZXXA 2Q3CA 1LQUA 3IVAA 3D59A 3KDAA 5EWLB 2O5CA 1T0UA 1TRKA 3Q10A 2CNWA 1SXJB 1MIOB 3CB4A 5HHTA 2Y1KA 1QO0D 2BEWB 1G19A 2ZT5A 3CX7A 4KXWA 5CDTA 3TRDA 4C6SA 2CMFA 3WSVA 2GHRA 1P39A 3CE9A 2AX4A 4I4NA 1GQSA 1NLUA 1ZOIA 2OE2A 2W4QA 3F7NA 3IT3A 1C1YA 4Q3NA 4R7TA 4EQ6B 1XWFA 2HSZA 1SCQA 1ZOSA 4Q21A 1MDBA 2BGJA 1WCIB 4P0QB 1SU6A 4XTRA 1YZNA 3NC4A 2PWBA 2QL6A 1PFVA 3KYCB 3QVLA 4E5UA 3UJCA 1B42A 3LBAA 1N2OA 4X1KA 4YAIA 3A1EA 3L0BA 2WZBA 4RKQA 3IS3A 4TXLA 4IV0A 4PLYA 5DV9A 5AM0A 4YP9A 4CI0B 5KTPA 1DDOA 1R8YA 2ANCA 5KAMA 5DHTA 1TKCA 1WUTA 4PGFA 5AXDA 4DV7B 2SICE 4F6RB 3RSSA 3O3CA 4OU4A 5ALUA 1QKJA 2IP4A 3S0JA 3OCVA 4EMUA 2Q1YA 3FCOA 1ZL0A 3IPAA 4FIDA 4F4HA 4QLOA 1W85A 2VSFA 4JB0A 4R98A 1C9EA 4US0R 5EE9A 3JZAA 4DC0A 1XMIA 4ZARA 2Q3DA 3KTDA 2Y1WA 3L41A 3GLHB 4MUYA 4A10A 2XNDA 4LDQA 5D84A 1O94A 3GYBA 4LF7B 4ARSA 1F17A 3MA0A 1EVLA 2WV7A 5LQMA 1A69A 1GYQA 2YXBA 2C1ZA 3PL5A 4WUTA 5B30A 1NXTA 4XM0A 2P5UA 2FWJA 4TLBA 3QSGA 1NI4A 2PG3A 4JCCA 3RRMA 1LD3A 1ABFA 1H4VB 1OTYA 4FYWA 4F85A 1X1QA 1FPQA 1NJSA 3O0TA 1X8KA 1JN0A 5I48A 1Q6YA 2BY4A 2ZR8A 3R5SA 4TSKA 4U6NA 3GR6A 4WKPA 3CRZA 5DI9A 2JCYA 2HF9A 5LYYA 1ZONA 3JQ8B 2D1SA 2R11A 3D31A 2HA3A 1VA5A 1JVSA 2FKNA 4C2BA 3DLBA 4C87A 4DYDA 5ARCA 2OFOA 3B1FA 4KQHA 4EGSA 4ZVVA 2XMDA 1QGYA 3EYWA 1M1NB 1A1SA 3BFKA 2Q49A 1GYRA 4OF4A 2ZUSA 1UT8A 3KEMA 1UINA 4Q3EA 4HH1A 3AV3A 2F64A 3ZY3A 1IDN1 1IHPA 1NPDA 4ENSA 1QYRA 4FWBA 1LSSA 3OO0A 1BFUA 5DNUA 3A26A 3PYXA 5JG7A 5TV2A 3SX2A 4TLCA 5CA0A 4UDYX 3FPCA 1M0SA 4YO8A 3TW6A 1LSJA 1BCRB 4A2PA 1HH4A 2VXBA 2IIPA 2AI3A 5A05A 3BZWA 3I58A 5FJJA 5LKRA 3DDOA 5LJIA 3U09A 1FSSA 1PRYA 2FEKA 3WLAA 3FHOA 3H2ZA 3LX8A 3M4JA 2CXXA 2OXCA 1VYTA 3OEED 3QFTA 1EXDA 3TIIA 4ZVPA 4EPYA 4Z4HA 2D2XA 5HP4A 3PQDA 2WICA 2QRQA 2CE7A 2TMYA 3E05A 3ZLTA 4GMGA 4JJ4A 1VFPA 2X6QA 5CK4A 1AE1A 3HB1A 3AP1A 4MVXA 1HOXA 4O4JA 5C7OO 2VBCA 5JJBA 1N5LA 3D3QA 1B93A 1D8AA 1SBHA 3EDMA 1M6NA 3FLMA 3GRAA 4US2R 4DR4B 1ADFA 3UF0A 1QO7A 1ZOPA 3VJKA 3T5GA 4A2QA 1BX1A 3PD7A 1JH9A 3HXMA 1V5GA 1JJVA 2YN0A 2VWPA 2R00C 5IH7A 3TRKA 2OBFA 2FQWA 2J7PA 3DZBA 5SZJA 2QTMA 4HZUB 5K8CA 1A2OA 1OA1A 2OBLA 3LD9A 3N5KA 3WLJA 4BPRA 5BWOA 3GT7A 3Q9UA 4Q9HA 1QQ5A 2XGGA 3LM8A 4P2BA 4F4IA 3K32A 1MIHA 5A7FA 4BUJA 1UBKS 4IDHA 5ADHA 1CNMA 1R5OA 2FFRA 2WB4A 1EM8B 2IU3A 1V8BA 1H9BA 1I1NA 2Z1NA 1NA5A 3G9QA 3NVAA 1DJNA 4MGIR 2AEEA 1C5KA 2GYYA 3FW1A 4HDSB 4QYIA 4R1UA 1ODKA 2BFEA 2B8TA 5E3HA 3JWJA 2C20A 5BV0A 1U0BB 1WXHA 2GRAA 3GXOA 3VPHA 4FYIA 3QELB 4LJ9A 4RZ2A 1IOWA 3DE0X 4FD2A 2IU0A 1RM5A 2IZ0A 1VDZA 2F8MA 2PL3A 3L9WA 2FZ4A 4LQCA 3UFXA 1NM5A 1P17A 2OV1A 3JAKB 4GG1A 1ORIA 1FFAA 2GFHA 3G8YA 4H7HA 2W8BA 3QF4B 1SG9A 1W4LA 3BM5A 1GYPA 4UJ3A 2RIRA 1W30A 2ZIUB 5AM3A 4F2PA 1VB5A 1P4JA 2UAGA 1ZH2A 2ID9A 1GAWA 1YB1A 3BH7A 4YRRA 3RIMA 2C78A 3IVCA 4XM2A 3C98A 2FG6C 3RC2A 4OQEA 4P4NA 5CLFA 4JNCA 3NEJA 4BQIA 3ITEA 4IOMA 3GT0A 2TECE 1DJOA 5EPEA 1NX6A 1DTSA 1T9AA 1U0OC 4QREA 4DCVA 2RBEA 4YV0A 4Q24A 3L5KA 4O08A 5JJCA 5CXQA 2DH5A 4JJ7A 3T7TA 3ZKWB 2VP5A 5BOSA 5JI3E 3L0ZA 4HD8A 4IFEA 1L5HB 2WAYA 3GG2A 4UAJA 1JX6A 3DUFB 4JBXA 3EAQA 1LZKA 2VBFA 2C0CA 1QE5A 1VXRA 2O8NA 3PNPA 4G2TA 3P2JA 3A58B 3FFTA 3VZCA 4Y2QA 4E4YA 2CBXA 2HRCA 4BECA 1QF6A 2ACWA 2CLOB 2AKAB 1ZC4A 3BRSA 3OTIA 2NYUA 2SKEA 4GP6A 3RUDA 1U28C 1YJBA 2JKZA 3OPQA 3QU5A 3N6VA 4GPIB 4K26A 4JJGA 1ZX1A 2R1TB 1NBWB 3CF2A 4HMPA 3L8GA 3P19A 4J9VA 1IJKA 3OMXA 2PBRA 2HUNA 5K09A 5EHZA 1WNTA 2F00A 4O33A 2CV0A 5KWVA 5CLHA 2EWWA 3DZIA 3QVWA 4QVGA 4WBNA 1I2MA 4ZQGA 1QIDA 4G5OA 1G20A 3ENQA 1OBVA 5FBZA 3ZHBA 1OWMA 3MWGA 1K98A 1BMDA 4NZOA 5AW9A 3RM3A 1BVRA 1Q2UA 2O8FA 4XUCA 1VFNA 4LXGA 2GAJA 1R0KA 4TSFD 3GAAA 2AZMA 4MEJA 4RWEA 1UZLA 3KHTA 5A3JA 2OSVA 2FKAA 5KO2A 2DHEA 3KU4A 3O8DA 3WHKA 1FDWA 4XR9A 5D1HA 3K8OE 1Z68A 3GAZA 4NK5A 3Q3VA 3RUCA 1XNRB 3LDAA 2I22A 4HNTA 2BFCB 3FDZB 3SJCA 5CCEA 3P96A 4N12A 4TTTS 3VBEA 5SY6A 2Q5FA 1Z5UA 2OQVA 4RNDB 3UOAB 4Y0NA 1XMQB 2MTBA 3HTXA 3AM4A 4C6RA 3KUUA 5B1YA 2JIZA 2WHYA 2ZUDA 3G23A 1GSHA 3E5RA 4IIXA 1DQYA 3L0PA 3MFYA 4E21A 3AQ4A 4Z3KA 1FYWA 2AW3A 4FGSA 1UANA 4GP7A 4JX8A 5IDWA 2QD4A 5LQAA 4KIWA 2H3EA 1T4CA 2GEVA 4IJKA 5DM70 4RF4A 3OPYA 5CNIA 4QELA 4COOA 1XA3A 1CQPA 3LBYA 5KOYA 2NZ8A 5JH7F 1Q0ZA 1XQYA 1ZGBA 1Z74A 1SB8A 2FRDC 1SCNE 3MS4A 4KBGA 3B6IA 3L8DA 2XUFA 5D5PA 1ZI8A 4UEKA 3K0SA 4GOMD 2V98A 1NW4A 2WFLB 4GWLA 4HQ6A 3O1LA 3QXCA 5JCJA 4MQ5A 4NOJA 4W99A 3RS7A 3WAGA 2WHQA 1TO2E 4BDTA 9LDBA 2PYDA 1E4EA 4HBZA 2FW0A 3A1DA 2EZUA 1CERA 2P69A 4R3NA 4Y9UA 3WQBA 4BVHA 4AIIA 1EU1A 4V3BA 4IILA 5KTTA 1FNDA 2QLTA 4ARAA 1YV9A 3VYRB 4MUFA 1GZ6A 2AMFA 2LCFA 5IDXA 5DB4A 5T7BA 3OFNA 1A96A 2CD9A 4F96A 5L51A 1KJ8A 1HSZA 4MDYA 5AM1A 4OX9B 1VC2A 3DFMA 4Y2HA 2JIDA 4DDVA 3TTXA 2XB4A 3CNLA 5H80A 4X90A 2JGLA 2P9BA 4BEVA 5AKEA 1N57A 1WL8A 2WR8A 3ABRB 5J9FA 3PPVA 1HK7A 4QXAA 1VE7A 4E5PA 1KXZA 2WUVA 2VQFB 2HF2A 1P1JA 2Y9PB 4IDNA 1W8DA 2DWPA 5KNBD 2KBEA 1YQEA 3ZLVA 5A6VA 1PGOA 4RSGA 5GY7A 1I36A 5DMHA 1W88B 3PGXA 5M04A 3G8CA 4YH1A 2GEFA 3ABOB 1FTQA 4MQ4A 4C7VA 3SN6A 1E3EA 5G0TA 4X64B 1WZ2A 3QV1A 4J91A 2OHOA 3K5IA 2ODPA 4EG4A 1NUSA 1UDXA 2IYOA 2QX6A 3FJOA 4TMVA 1SR8A 1QRTA 4RELA 3T1YB 3E7FA 3RS9A 1YR3A 2ENUA 3RR2A 3LCRA 2P30A 2FUG1 4EGQA 2Q4EA 4PNZA 1TQ2A 4P5DA 3WBKA 2UYGA 4GLJA 1H22A 3E23A 2BJHA 9LDTA 5TR9A 3PUYA 3DMGA 2G9UA 4NCBA 1T1EA 2ZT6A 2ZJ5A 4G4SO 4ZO8A 3D1VA 1EJ0A 1E79D 1N2HA 2QRGA 2FG7C 4DNXA 4P84A 4IFBA 3V7UA 1GU0A 1VBKA 3FPBA 5DH9A 1H1DA 3WIOA 4BP1A 1O54A 4DMKA 5KYKA 4GZ3A 1JUDA 3IP9A 3JY6A 4IJVA 1I3LA 2JK1A 2YWHA 4CQMD 3CN7A 5E7JA 2JFUA 4KITB 2IP1A 4UBJA 4OFWA 4CG0A 2IUEA 4BNWA 2WIGA 3ESZA 4PPYA 4XIYA 3RSQA 1Y1QA 5HW0A 3N3AC 4UM9D 3TEMA 1Q7CA 4ZKEA 5B2FA 3QTLA 1K86A 5AKKA 5BSKA 5JZSA 2Z4TA 4RTKA 5BN4B 4U9UA 5F7OA 3RT1A 2QRKA 3OZXA 1W0JD 1HDIA 3R6DA 3MLEA 2R4UA 4ZALA 2R5FA 5ALPA 2DFLA 2GAIA 1E3QA 1E9SA 3C6KA 2GCEA 5EMKA 3U7RA 3ZV6A 3BTSA 1Q0SA 5I51A 2P9TA 1GGNA 2X1MA 1W4AA 4YRAA 5CVTA 1PR3A 1UFOA 1Y34E 1RWWA 4OXYA 3OI7A 4AW9A 1O0SA 3EIQA 1ZINA 3ZGXA 5KTMA 1FMLA 4Q4JA 4L5IA 1XIVA 4U39A 4FHGA 3F5MA 1S6YA 2J0VA 3MS7A 5LA6F 1QK3A 4C22A 4YCNA 1M2VB 5ALRA 2I1WA 3SAJA 2C5EA 1CJTC 4G5HA 2JLUA 2FPRA 2C7GA 2YIMA 4O5OA 3PXBA 3HUFA 1USKA 2P7IA 4KQCA 1L5MA 1Z37A 1XZJA 3FVWA 2V8OA 3KZXA 4M9QA 4TMFA 1Y1KE 4B3JA 5KKNB 1RVDA 2MSWA 2YFQA 3VNAA 5KTSA 3PK0A 1GT91 3IDQA 4NR0A 4IIJF 2DUNA 2PVPA 3B7PA 4RPLA 3K4QA 2FPOA 3IVMA 4MCHA 4IXNA 2XKAA 2J0EA 1LDBA 2V6FA 2ZKLA 3TVDA 5JY1A 3INTA 1BMQA 1U0EA 2FZVA 4B87A 2HT6A 3EXG2 1W4BA 4I14A 4JBLA 2QORA 3RV3A 4WQMA 2P8SA 5CIWA 2R7LA 1LCIA 4YK7A 5T6BA 3EGVA 4L5JA 3VQTA 2GKSA 2Z43A 1H2XA 1YB2A 5CD9A 1SUFA 4LC9A 1SEVA 3ZE6A 3U0BA 3F7MA 3MOSA 1AGXA 4Z4IA 2FDCA 4QFBA 1TVKA 2WAMA 5FBQB 4WXYB 1FP4A 2WQ6A 3OU2A 1JP7A 3S70A 2BBWA 3FPSA 4U2GA 1WMSA 5DYNA 5EYPB 5BUZA 4DIFA 2VP6A 2JGDA 3Q5EA 4K6HA 2H63A 2VDKB 3PE3A 4AN4A 1TUBB 1YBHA 3B9RA 4Y9RA 3VX4A 2FMFA 5H70A 5AVRA 2A9JA 5LDHA 3W5IA 2KHZA 5JXWA 3EMVA 4Z9BA 4GXRA 2AFHE 2J48A 3UTCA 2YWGA 2NU9A 1LTHR 3UVEA 4CEHA 1PV4A 1GNRA 1ZUWA 4NNPA 3ETJA 1U4OA 2GZ2A 1ENPA 3C7DB 3L0IB 5T8KA 3X1DA 4PN3A 2PUCA 1PGPA 2BMFA 5H02A 1J8MF 5E1OA 1NAIA 2BFFA 2GNPA 3GJXC 5BMVB 1YR7A 3OFJA 5M3BA 3NQ41 4UREA 2BN4A 4WMLA 1CUSA 2JK0A 1BQEA 4ITRC 3WK6A 5ERYA 3AF6A 4ZU6X 2C8KA 3RQIA 3B51X 4EBFA 2O19A 1XJ0A 5JC8A 1AHNA 1W5SA 1YRWA 2BJWA 4DUGD 3AX6A 2PR2A 1DAHA 4FFDA 2EGHA 4FMCF 4EYQA 4M1YA 5FV4A 1IATA 1BX3A 1U1CA 4ZEVA 1BIFA 2R8OA 3RU3A 2FR1A 4RABA 1XTRA 2CJXA 1OX4A 3WAJA 2ZR0A 2ZGVA 3B1JA 2R1VB 2GPNA 2X5KO 1NBMA 2GO1A 2WU0A 3BE6A 1KMHA 2G17A 3NUZA 3EH2A 3BWXA 4XVRA 1BEEA 2GGSA 1DX9A 5E3IA 5F76A 3IXMA 1CUEA 4BQSA 2PUTA 1NVTA 1R4NB 3T1NA 4P7JA 1SFRA 2QYHA 1CVRA 3KQLA 1CR1A 1I14A 3MAAC 4L8FA 3RVPA 1DKPA 1ZJYA 3N8GA 2HXYA 3OC0A 4O3MA 4G07A 1OFTA 1F2UA 2IDKA 2H5LA 2Y27A 1OW3B 3ETLA 3PYMA 2VEDA 3AHGA 4OHXA 2RK6A 1PU2A 3SJZA 1D1QA 2JKYA 2YV4A 4CMJA 3Q6IA 2W6JD 3LLUA 2ZSKA 3ACDA 3O82A 4LNUA 4YLEA 2CHQA 4WASA 5DGDA 5I9BA 5FA8A 1JG2A 3U7QA 3ZW8A 4MQEA 4AI6A 4X85A 4C0XA 4ZGGA 3N2GB 5KWSA 2RGDA 1ESZA 3SGLA 1TAQA 1Z7WA 2QHXA 3FPJA 4MAFA 4RZQA 2G09A 1G7RA 2IHZA 5BV7A 1U0HC 2FEXA 3HZZA 1NNLA 2AOUB 1GNSA 4UEWA 2E4UA 1U2SA 2HPVA 1CWUA 2XQVA 3KB6A 3O75A 5K4AA 3SZLA 3VSBA 4EHBA 3EIWA 1PD1A 3O83A 4XUGB 2OESA 1EFDN 3T4PA 1OX6A 4OXNA 5JMPA 4CMCA 1YU6A 3RYFA 1NRIA 2Y8EA 3U17A 1KIAA 1YDMA 1MQSA 2QX7A 1HO3A 4IGIA 3USZA 3PUJA 4L07A 3Q98A 4BB0A 2V55B 2XZPA 3N58A 5KCZA 3ZCTA 4KHPB 1Z7EA 1IY1A 4LXHA 4V1CA 2I3BA 2PZLA 4J0HA 1C2YA 3GLQA 4OYLA 5I3CA 5HK9A 3LT2A 1N8KA 1U7XA 1X7DA 4Q4HB 1OROA 1CQWA 1D9XA 2W0SA 1ND6A 3A4NA 2C77A 1YUMA 4L7VA 1VKJA 3VC2A 1HT1E 5AQEA 2PYIA 1E1KA 1MUUA 4QVIA 2Q8QA 4RMHA 1DFHA 4O29A 1MVOA 1GQOA 4XWAA 5ESDA 2LZ0A 1GRQA 4GLOA 2CGEA 2MR5A 3R3HA 1WBDA 1MORA 1C7ZA 3ZYZA 1YZLA 1JAYA 1C29B 2FGJA 4HVTA 4HMQA 3A2NA 1KBQA 2HMSA 4ICIA 4YALA 4AZWA 5FPQA 4O59O 3HCCA 3M4XA 3PFHA 4ZVSA 1A9YA 1RRFA 1X0XA 4B9AA 3B48A 3L93A 3GGGA 4X20A 2VHQA 3C1TA 4MI6A 1IB6A 1Y42X 3B6JA 4O6VA 1ZMXA 4DOMA 5ALDA 4I66A 3L8YA 1GN8A 5HUJA 2QZPA 3LUGA 4UXJA 2HL6A 3C4JA 3INRA 2TSYB 2J32A 3PNSA 4XD7A 3WLKX 5CCXA 2I7TA 2FNAA 3U7HB 4QT0A 3U60B 3IVXA 2GVNA 3E0XA 5J5CA 4FCWA 3ZWWA 1EUQA 2H6EA 2YFYA 3F6CA 3EC2A 2ISSD 1I1QB 1VYUA 2I66A 2Z83A 1ZPDA 3AM5A 4UNSA 2J9RA 5DYGA 2HJRA 1ZGHA 1VTKA 4YPFA 4A7PA 2R47A 5ES4B 4OAOA 2GM3A 4UDXX 1TKAA 3ZVRA 2O3UA 2ZETA 4OXQA 4UHFA 3FSRA 2VDPB 3HP1A 4BLUA 2PGIA 6YASA 1YMUA 5EWJB 1L4NA 3T9EA 2ZIGA 2ZE5A 5IJ0A 5DK6A 1IL0A 2ODAA 4HOYA 5B3JC 2R6ZA 1CJBA 3P32A 3Q8WA 4I7EA 2HGZA 3RE1A 1BG6A 1G55A 4ZEOA 1WB5A 3ZDBA 2BSXA 3FYCA 2Z8YM 3OZVA 1TZJA 3HACA 1MT3A 1XEAA 3W5VA 1PE0A 4CU5A 5C1PA 2AD5A 1PG0A 2QRVA 4LFBB 1KAGA 3DYIA 4AWAA 2QVZX 2E49A 5IM4F 2XA1A 2JGRA 3BGWA 1QWSA 4MA0A 4Q9KA 4Y0VA 1L4LA 3BKXA 4YNBA 2R87A 3CRW1 4DHWA 4OL0A 4DWJA 2P6PA 4YUZA 5JCOC 1Z6QA 4D9FA 2O23A 3E1KA 3O74A 4AX4A 4RTNA 1U9IA 5IW8A 1EUDB 1JQJC 1ZK0A 4O5AA 4UAGA 1VP3A 2OB1A 1SUSA 4QAJA 5IBCA 5IASA 5KQSA 4NYIR 2OTCA 4GKBA 1XC7A 4S3MA 5EJGA 2GXAA 3WO0A 5G40A 5AM5A 5JATA 2I3GA 1KSJA 4RE5A 4EHFA 1A8QA 1KP3A 1XHFA 4JUBA 3AEQB 4P3NA 3CVOA 2HMAA 3N76A 3D7LA 3I1JA 3U26A 4YJFB 3WRXC 4QSMA 4M54A 3TBFA 3O4JA 1U2PA 3QVMA 2Z09A 3NV7A 5CH5A 3S44A 1O6ZA 1Y8ZA 4F2GA 2WWWA 3MOGA 4KXMA 4G67A 4B3FX 1I6KA 2IH5A 3C4VA 3MT8A 4Q4LA 4H9GA 4LJRA 5B4UA 4YRIA 3CS3A 4UHCA 1HNZB 3R3ZA 2PEYA 3EVTA 1ZIXA 2RH8A 3NHMA 4PG7A 5JSKA 2B4QA 1SCIA 4GOKA 4OMCA 4DV1B 2RGAA 1YZHA 2HCTA 3LKBA 2FGKA 1OD6A 1BDIA 4RORA 1ZU5A 2Y2VA 3F1KA 4XQ0A 3CIOA 4CTJA 2FPGB 4U8HA 1X7HA 3R8CA 1RKBA 1A8PA 1SUDA 1OZ0A 4QQFA 2WWXA 3DZGA 5BNTA 3HWSA 2UVPA 1XDWA 2F8SA 5JWHA 1D1PA 6AT1A 4HDOB 1N6PA 1GSIA 1KAQA 3JD0A 3MTJA 4JGBA 3OD1A 5AKJA 4Y1GA 5T67A 1BHO1 2PZFA 3TLEA 1Y89A 3TTTA 4ZT6A 3TSYA 1NJ8A 4MITA 3ZQUA 4C0QC 4PR3A 2FYTA 4BZXA 1VYHA 1MTZA 4FTWA 5K2MA 2C7QA 4GNKA 3I2IA 1KJWA 2WTBA 1SZDA 3VKUA 1UJCA 4JXZA 3BYZA 4BO9A 4FSXA 1DJLA 1FNMA 2JFYA 1ECJA 4PGGA 4HVCA 5EGNA 2Z5LA 3VKHA 2WQZA 4EEZA 2HRZA 2HK7A 2EGUA 1TLLA 2RHMA 4L15A 2AB0A 4OMDA 1T3TA 1NW3A 2BHTA 2G8LA 3PRKE 4KN5A 4QARA 1EFCA 2XF2A 4UE2A 1QMPA 5KVVA 3V9AA 1AH2A 1ACLA 5E2IA 1T4MA 5LZ8A 1ZQ1A 5MGNA 2R48A 4ZREA 2YVAA 3T8YA 2C2OA 3RFFA 3V4OA 1IAVA 3RLIA 2QE7A 3NONA 2A33A 5AVKA 3RV4A 1T15A 1DCTA 3MB8A 1GZUA 3B82A 5K01A 3VNVA 1HFJA 4JBYA 4RVHA 4XGRA 4FDUA 1Z4LA 4PZ0A 3EMBA 1ZIDA 2I0FA 4TWBA 2NV6A 3KSMA 3A14A 5LBIA 2RDMA 2IUUA 3K9WA 3ZD9A 3WLOA 4YP0A 3CRMA 4PQYA 4EJ6A 3QE9Y 2AZXA 1FYFA 2V03A 2WLTA 1R10A 2AZ4A 2G7ZA 3RRYA 3S5JA 5ENDA 1KMQA 2ZR7A 4X93A 1OIVA 4AY3A 5J5AA 6GPBA 1J25A 1Q1BA 1QH8A 3AUFA 4P53A 4DSNA 5HS4A 4WDQA 3UAWA 2HO4A 2WWVD 3GT3A 3LXUX 4KXXA 3PQCA 2EBWA 1LLUA 2Z57A 3LV8A 4JSYA 3PPXA 3EVNA 4RJLA 3BJZA 2A1IA 1VGRA 3O4IA 3A9VA 2QVGA 2OK8A 1Q77A 1N5MA 4RKRA 2VXYA 3SOPA 3T3GA 5A0TA 1QTNA 3V55A 1NBHA 3B3AA 2I80A 2J09A 4HEQA 3HRKA 4A8JB 1QDLB 2JW5A 1JZSA 1VJ1A 2QNIA 4ESHA 2HT1A 1U7WA 1S3GA 3GN1A 4FFRA 4GNRA 3BIFA 5DLQC 1CEQA 2O2HA 3JQAB 4G65A 1OXVA 3T4XA 1TX4B 2X41A 3L6BA 3AFOA 1WQ4A 1DIAA 4AZ0A 5JYEA 5JV5A 3TEJA 1R27A 3C1AA 3DOCA 2Q5QA 3NHBA 1V1RA 3G7NA 4RF2A 4IF6A 5DBHX 3LHSA 5K05A 5IN4A 3I6YA 1EUZA 1BXGB 1H2ZA 2GJKA 2B1RA 1M83A 2SCUA 5JDIC 1I6WA 4TOIA 1GDTA 3LZ6A 4OLJA 1EFRA 1Y6JA 2P35A 1ZKDA 2WU4A 4KZKA 4Q93A 3HH8A 4PM4A 3L40A 4GICA 4ES6A 1U02A 1FW6A 2BTEA 3ASZA 4IHQA 4F3KA 2E4VA 4C01A 1LWNA 4NMXB 4P4LA 2ASEA 1J8VA 4F0JA 3OT1A 4LBYA 1FNSA 3Q9SA 4INOA 4N3AA 4MUEA 1EVQA 1RZRD 3VPAA 1MLDA 1Y3HA 3P9SA 3X2EA 1LVHA 4UHJA 4P3OA 4JFRA 4RGYA 2H07A 2R2GA 3V7WA 2DULA 3MPUA 4IXMA 4CM5A 1EZZA 4AKIA 2ZBGA 1N2GA 3CC8A 1A3CA 1N5KA 1P7PA 3OD5A 3ORSA 3PCTA 4M0EA 1SOUA 4NBWA 4TRMA 5DTJA 3ZCVA 3U44B 1LI4A 4K2AA 1A71A 3AWIA 1GVHA 1TADA 1Q2XA 4R81A 4ZANA 3B12A 2CXNA 3JD2A 2NXNA 2B6NA 4FS3A 2OMEA 3AYZB 1QGZA 2O8BB 1WU8A 2IGTA 2OP0A 1G8HA 3G0GA 1PQ4A 3UAVA 2XXAB 1AS3A 1VJ0A 2ZBRA 5DM1A 4JP5A 4WK2B 1DEXA 4M8NE 4CKYA 4G8BA 4MPDA 1WCWA 1PVOA 1SULA 4C14A 1H9AA 1KYYA 2ZEJA 3G8BA 1CUUA 2GPWA 4W1SA 1AGPA 2W2LA 4IEFB 1O6BA 2EERA 2OFWA 4CKBB 1K3FA 1TGVA 1QVZA 1ZH8A 3QMVA 2MWMA 2VHJA 4CLOA 3HA3A 1ZU4A 2R7AA 1QBGA 4E7PA 5DYWA 2JGNA 4IV5A 3TQTA 2P91A 4HCJA 4EYSA 3UT0A 5IUNC 1KEEB 4QECA 1XTPA 3KVNA 1QU2A 1JS1X 4N82A 2WM3A 2QUZA 4PYIA 2X23A 2IE0A 3E18A 1N0WA 4AAYA 3ER9A 2G1KA 1JPVA 3ZG6A 3DZCA 2WFAA 1E62A 4ZYWA 4TLAA 1FK8A 1Q6ZA 4UFNA 1IG3A 1X14A 3GRUA 5FTJA 3Q8MA 1M73E 2NVUA 5JVDF 2VEOA 3ZE9A 1Z5ZA 2P0AA 1PR2A 3FF4A 3ELUA 2ZYRA 4Y2UA 2FN3A 2RIPA 2VHZA 3A37A 3W3AD 4B6JA 2GRUA 3I9FA 5E4TA 4PYRA 3W5JA 2BI8A 4CIXA 1NBAA 2ZIEA 3BL8A 5LP6C 1CJSA 5F3WB 1KDRA 1LNZA 1NT4A 2IZ6A 3I2YX 4K03A 5EUMA 2DE0X 4MPTA 1SQSA 2DPYA 4OBWA 1WBBA 3SNHA 4PG5A 1GLGA 4OBBA 4DJDC 1O94C 5E8JA 2H2WA 4C78A 1FUYB 3THRA 3ZXIA 3THXA 2ZYDA 2BE7A 3BWEA 3F5FA 3HBJA 4I50B 3VPCA 1XXHB 4YJ3A 1GGHA 2B0JA 1N7JA 3S3TA 1X7WA 4PWYA 1WZCA 2CLCX 4IDQA 1KSFX 4V0KA 5FD8A 5FBRB 3GZ4A 3TN7A 5HZHA 3EGXA 2MYPA 1NQ5A 3UAZA 2R66A 2WSLA 4MPJA 1EMDA 3OQ1A 4R54A 2F55A 3HCDA 4JROA 5KKCA 2MINA 1PLLA 3LY5A 3T5BA 2XCSB 1F8UA 1N2CB 5KB3A 4BX9A 4FFSA 4QOEA 5FOTA 4F06A 2HMWA 3FHLA 1U3CA 5ITZA 5K8TA 5JTUA 3GGDA 2CZQA 4OQQA 5IAEA 1MXHA 1O08A 1JVBA 2PS9A 2P9JA 4HTFA 3HY3A 4XXHA 3EEIA 5EFZA 4TYMA 1VRVA 2XYQA 2PD4A 1OR8A 1RCTE 4IX1A 2RONA 4DLAA 2H57A 3EXG1 4ER5A 2R8XA 4L9SA 4PCVA 3QEKA 2G0NA 4WY8A 2WIFA 5U4XA 3FVTA 1BKDR 1D07A 3TR5A 4BBAA 2KMLA 3DT6A 1JHQA 3JQEA 4ZOLF 4BTVA 3QWHA 3GLSA 3A6PC 2QYOA 1ULAA 4YPOA 4BBZA 3AF3A 4PAWA 5B6JA 3WLFA 4MW7A 1NXQA 3C3EA 3ZHYA 2IYPA 1ST3A 3I04A 2CB9A 3AUAA 4R7ZA 1GPAA 1CUAA 2MHCA 3PFNA 4AY4A 4UXIA 1Y3FE 4XVQA 3RFCA 2ZT8A 4AO6A 1A9ZA 2CUNA 2O2SA 4W5RA 1TAUA 3FLBA 3IEIA 4ZI3A 1NXWA 2X1HA 5TIIA 3DXFA 3L1KA 3SBDA 4KQGA 3A32A 3BH0A 2R6GA 1T2VA 3JQ9A 1YBVA 3G2QA 1UDAA 4KXLA 2AKEA 2R84A 5E6RA 4R5HA 1TU4A 1GRRA 3SJAA 4E5MA 4MB2A 3BB4A 3RSHA 5CFRA 1CE8B 3GVIA 2YOGA 4ZI5A 3ZOZA 2XTZA 5HNKA 1JDJA 2BR4A 1UMCB 5EHIA 2PJRA 2B8EA 4I55A 4KQWA 1X7YA 1OYYA 4L72A 4JI5B 2AJCA