1LDOA

Avidin-norbioitn complex
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
121
structure length
121
Chain Sequence
b'KCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYTTAVTATSNEIKESPLHGTENTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords avidin
publication title Ligand exchange between proteins: exchange of biotin and biotin derivatives between avidin and streptavidin
pubmed doi rcsb
molecule tags Unknown function
total genus 27
structure length 121
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2002-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01382 Avidin Avidin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.30 Mainly Beta Beta Barrel Lipocalin Avidin-like 1ldoA00
2IZHB 2C4IA 3WYPA 1N43A 2OFAA 1SWRA 1SWPA 4GJVA 1LCZA 1STPA 5IRAA 4OKAA 5IRUA 3SZIA 1SWNA 2AVIA 2IZEB 1AVEA 1STSB 3RDMA 4IRWA 1SWGA 1SWDA 1RSTB 1MEPA 1SWBA 2RTOB 4BX6B 2RTFB 1PTSA 4Z6JA 1LCWA 4BX5B 1HXZA 1N9YA 3WZNA 5B5GA 2IZFB 5B5FA 2G5LA 4DNEA 1I9HA 1N7YA 3RY1A 3EW2A 1NDJA 4Z2PA 2C1QA 3VHMA 5JD2A 1KL4A 2C1SA 1VWNB 1RAVA 2RTNB 1LUQA 5CSEA 3WYQA 5K67A 1NQMA 4CPFA 1VWLB 2UZ2A 4CPIA 3RDOA 3WZQA 4CPHB 1VWDB 4YVBA 2FHLA 2IZJA 4BX7B 2RTKA 2RTDB 1KL3A 2RTRB 2WPUA 4GGRA 2IZKA 5L3YA 1Y52X 1IJ8A 2BC3A 2RTJA 1Y55X 4JNJA 1VWGB 2F01A 1VWCB 1Y53X 2RTQB 1MM9A 1DF8A 1SRGA 1WBIA 1SWJA 1SRFA 2FHNX 2IZAA 3MM0A 4Z28A 2OFBA 2UYWA 1SWOA 5F2BA 2RTLA 4BCSA 3RY2A 1VWIB 3FDCA 4Y5DA 3SZJA 1SWQA 3RDUA 2CAMA 3X00A 4GGTA 2RTPB 2RTBB 1MOYA 3T2XA 5K68A 2ZSCA 2IZDB 2QCBA 2RTHB 2A5CA 1LCVA 4BJ8A 3SZHA 1RSUB 1NC9A 1VWRB 2A5BA 5IRWA 1SLDB 4EKVA 1VWFB 2RTMA 4BBOA 2RTGB 2MF6A 2RTAA 1SWKA 3EW1A 1AVDA 1SWHA 5CHKA 1NBXA 1VWOB 4CPEA 3VHIA 1SWTA 1SWAA 1VWAB 3MG5A 3VGWA 1SLEB 1VWJB 4U46A 1N9MA 4GJSA 4GGZA 4GD9A 1SWCA 2IZIA 3T6FA 1RXJA 2RTCB 1KL5A 1SRJA 1RXHA 2A8GA 2IZBA 2RTEB 4BX5A 1VWMB 2Y3FA 1RXKA 4JHQA 1LDOA 1STRB 3RDXA 1SLFB 3RDSA 2Y3EA 1HXLA 1SWEA 1SWLA 3RDQA 1VWEB 1MK5A 3T2WA 1VWBB 2IZLB 3WZOA 1LELA 4Y59A 2RTIB 3WZPA 3PK2A 1SRIA 3RE6A 2OF8A 2GH7A 4CPHA 1SREA 4BX7A 3VHHA 1N4JA 1SLGB 3RE5A 4I60A 1HQQA 1HY2A 1NQNA 1SWFA 1SWSA 2JGSA 2Y32A 4Z27A 1VWQB 4JO6A 1KFFA 2IZGB 4Z2OA 1VWKB 1VWPB 2OF9A 1LDQA 4BX6A 4Z2VA 1SRHA 1SWUA 1VYOA 3T6LA 2IZCB 4GDAA 1VWHB
chains in the Genus database with same CATH superfamily
3RSWA 2IZHB 2RN4A 3RBYA 3SLOA 4MEEA 1JJUA 4GJVA 1OSPO 4AZMA 2QOMA 1FENA 1FELA 4M6SA 1AVEA 3RDMA 2YMSA 4FBVA 1SWGA 1SWDA 1RSTB 2QMIA 1ZRYA 2BLGA 4WFUA 1MEPA 3VG7A 5IO6A 5EDCA 2RTOB 3CBSA 4QYNA 2K62A 3DTQA 4ML7B 5D47A 5HTDA 1PTSA 3PEDA 2MM3A 4U3QA 4Z6JA 1EUOA 1GKAB 1YWCA 1HXZA 2RA6A 3MBTA 3WZNA 3ELZA 4ZJ0A 5B2AO 4CV7A 1I9HA 1N7YA 3HWEA 2KTSA 3EW2A 1WUBA 3FENA 4O4OA 3WVMA 4TQ2A 2PI3O 1SY3A 5C0NA 3U03A 1X8QA 5HZ5A 1I04A 2AKQA 4CK4A 1BBPA 4JGLA 3WBGA 5K67A 1NQMA 4CPFA 5LJBA 4C5PA 1K24A 1QQSA 2FT9A 2X46A 4QYPA 1ZNHA 3ZI8A 4YVBA 1JYJA 2X45A 1KL3A 2RTRB 2WPUA 2HMBA 2MJIA 3F8AA 4GGRA 1IJ8A 2BC3A 2RTJA 1HN2A 2QO4A 3NPOA 3RZYA 4OMXA 1KZWA 4AYHA 1Y53X 1SRGA 1DF8A 2I5VO 3FR2A 4K19A 3B2KA 4N7CA 2AT0X 1A18A 2X8SA 3LHNA 3BS2A 3PH6A 3NQ9A 3NQ3A 5D45A 1DF3A 2OFBA 3FR4A 1LIBA 3ZZVA 1ZNLA 1AQBA 3I17A 3CWKA 4L1NA 1G5WA 1G7NA 2JN3A 2X34A 2OY8A 4I6SA 5F6ZA 4YBPA 4O4XA 1B4MA 4KH8A 4NP1A 5HAEA 3STNA 1R0UA 3AUMO 4GGTA 2RTPB 4KC8A 5EPQA 5HTEA 4ZH9A 3ZW2A 5LJHA 1T68X 4AZPA 3GE2A 4LZVA 2GTLO 5K68A 1LIDA 5K06A 4I3CA 3STKA 2A5CA 4MISA 1ICNA 3WXQA 1DZMA 2ACOA 3CBCA 1VWRB 3FMZA 2Z4HA 2AT5X 3D95A 3P6FA 5IRWA 1FDQA 2X56A 1SXWA 1BLRA 3UEVA 2MF6A 2RTAA 3BX7A 5F6BA 4O4UA 3ZW0B 1SWHA 3D4RA 2GTLN 1Y9LA 3HK1A 3HTYA 3VHIA 2LA7A 1KT3A 3B2IA 1NP4A 1VWJB 2GC9A 4ORXA 4OS0A 3VGWA 1GM6A 1CRBA 4GD9A 5B29A 2IZIA 3C76X 4CDDA 2F09A 1SRJA 2A8GA 4R0BA 4O3ZA 4BX5A 1BWYA 1S2PA 2DJFA 3UAQA 1LDOA 3RDXA 4XMCA 3ZWEA 1SLFB 2Y3EA 1E06A 1E2TA 1S44A 3P6DA 3VG6A 4RUNA 1XCAA 5DG4A 1BJ7A 1I06A 2X55A 5H9LA 4NYQA 3S5VA 1GXAA 4OS3A 5HCEC 2PY1A 1B0OA 1E00A 4NNTA 1HMTA 4O49A 4TKHA 5EEEA 2JU7A 4HPBA 3VG5A 1JMXA 5BVTA 4HPCA 2O62A 4CPHA 4NV8A 4BX7A 1W5RA 4LKPA 4MVKA 3UEUA 3CKGA 3HOLA 1XKIA 4ZHDA 5HWZA 4ALOA 4IABA 1HY2A 1OEKA 1OPBA 2X8FA 3Q34A 1KFFA 2IZGB 3D96A 1OBPA 3FA6A 2A2UA 1W4TA 4IBAA 3S26A 4GDAA 5HZQA 1JYDA 3C78X 1L6MA 1BSQA 3S60A 3BU9A 1H91A 1SWRA 2N93A 1VYGA 3APUA 3FYFA 1STPA 4OKAA 1TOWA 4KT5A 1SWNA 2AVIA 2OZQA 1VPRA 2FRSA 5LJCA 3IA8A 3CQRA 3FIQA 3G7XA 4LKTA 1YWBA 1CBRA 1SWBA 4TLJA 5D8JA 4BX6B 5BYPA 1A57A 1KQWA 2FS6A 2OVAA 2WEXA 3CMPA 1LCWA 2CM4A 5CYBA 4AZNA 2OL6O 1LPJA 5B5GA 5EZ2A 3BSZE 3U0DA 1FE3A 2QOSC 3ELXA 3ZW1A 4CDCA 4I9SA 1MX8A 2NP1A 2BS5A 1NDJA 4TKBA 4U8UM 5JD2A 1KL4A 3APXA 4ORWA 1PMPA 3NQKA 2C1SA 1T0VA 1VWNB 2MHDA 2NNDA 3I0AA 1KOIA 3JS1A 4HPDA 2RTNB 1LUQA 4NNSA 4ZCBA 2HKDA 3HWGA 3WYQA 4LQZA 3AEHA 4B55A 3PDFA 2RCTA 3RDOA 3WZQA 2IZJA 2RTKA 2JU3A 1Y52X 2HNXA 3F9DA 4JNJA 4ON1A 4YFPA 4IB8A 1VWCB 3TZSA 1HMRA 4ORUA 2WR6A 2ZAIA 4ODDA 5HZ8A 1ACDA 4GDZA 1WBIA 2CBSA 1SRFA 4YMYA 1AVGI 1QFVA 2G79A 4HPAA 2IZAA 2W2AA 4YGHA 1QABE 2LKKA 5LKEA 5FAZA 4LZUA 2UYWA 3H3IA 5F2BA 3JQOA 2RTLA 2RD7C 5F1EA 1A3YA 1VWIB 3KZAA 5BVSA 3RY2A 4BCSA 3FDCA 4Y5DA 2BSZA 1Y0GA 1SWQA 1YWAA 4KCAA 3RDUA 3PQUA 1Y9TA 2X4MA 1SXUA 4ORRA 1LIEA 3S5XA 3B2HA 4NLJA 2IZDB 4XMEA 4YGGA 2FS7A 1OBQA 3EYCA 1QY2A 1PEEA 1RSUB 3Q6LA 2FR2A 4WHIA 4Y0SA 5EEDA 3SZHA 2A5BA 1E02A 5B10O 2R73A 4XMDA 3WJBA 2RCQA 4BBOA 1KZXA 2L5PA 5IO5A 1KQXA 1LFOA 2HLVA 4O3YA 3APWA 1SWTA 1SWAA 4A1YA 3KFIA 4MVLA 1SLEB 1LKEA 1EI5A 4GJSA 1UREA 1UYNX 2RQ0A 4GGZA 5HZ6A 5LJKA 4NV7A 1RXJA 1U18A 1CBSA 2P8GA 2RTCB 2YG2A 3P02A 4QNIA 5EDBA 5H9KA 3T1DA 2IZBA 3B2LA 1VWMB 1GKAA 1RXKA 1ZNEA 3MVFA 1D2UA 4JHQA 2VDFA 1STRB 3NP1A 5HCDC 1IFBA 3RDSA 3STMX 1HXLA 1SWEA 4YDAA 3TGBA 4IB9A 3P6HA 1VWEB 1MK5A 1NGLA 4I95A 4MVEA 4YKOA 1VWBB 1EIIA 3EBWA 1GX3A 3LV4A 3VG3A 4YGZA 1LELA 4AZOA 2RTIB 1IW2A 4RUUA 4OMWA 1N0SA 3WOVA 1U0XA 3UEWA 1E5PA 1MX7A 5B27A 3B2JA 3OBLA 5FFHA 2GH7A 4D6AA 4ORSA 1GX8A 1HMSA 4KIIA 4FBOA 2Z4IA 3QQ2A 1SWFA 2JGSA 4Z27A 4N7DA 2QO5A 3EM0A 1VWKB 1YWDA 3BU1A 4ZH6A 1VWPB 2CZUA 2OVSA 2JOZA 3PQSA 4O3XB 4EEJA 4Z2VA 5HCCC 4Y0PA 2AT8X 2C4IA 2OFAA 1TXLA 2OL7A 4BQUA 1P6PA 1LCZA 3HWDA 4BOEA 3BRNA 1IFCA 4O4SA 3VG2A 4GKCA 1JIWI 4BVMA 3VPJE 2KW1A 3P6GA 1ICMA 3KFGA 2KT4B 5HA1A 4ARHA 4QGVA 2JMBA 2I5ZO 5L8OA 1DV9A 2RTFB 3WJCA 1I05A 5HA0A 4TJZA 1X8OA 2A3FX 1N9YA 2IZFB 5B5FA 4OEMA 4GH7A 2LBVA 2OYBO 1SXXA 3ZW0A 3OE3A 3RY1A 1EW3A 1BSYA 3RKGA 3VE2A 1IKEA 4Z2PA 5LJGA 4ZHGA 4GETA 1K3BA 3EC5A 1AELA 5FQ6E 4AZRA 1RAVA 1B56A 3NBXX 4GK9A 4ZR2A 5H9AA 3BX8A 1ZNGA 1D3SA 4EQAC 4DQ4A 1VWLB 3PPTA 2L67A 4CDEA 4CPIA 2OY5O 1ZNKA 4OS8A 2FHLA 2WWPA 2RTDB 1GT5A 3FLLA 2FTBA 1RBPA 2IZKA 4XMGA 2OL8O 1Y55X 2OVDA 1VWGB 2F01A 1X8NA 2M4LA 1RLBE 2Q2MA 2RTQB 4GNWA 1SWJA 3U9PC 4COTA 4NW4A 1SY0A 4WBKA 1KGLA 2X8TA 4GE1A 4NLIA 1JV4A 2AH7X 1UZ2X 5LJEA 4UU3A 5JR8A 1G85A 1NP1A 1LNMA 1KXOA 1SWOA 4OELA 5D4AA 1UYOX 1GT3A 3FIDA 1YIVA 5F58A 5HBSA 3SZJA 1X8PA 2XKLA 5AJBA 2K23A 3FA9A 2JW1A 3D97A 3P6CA 1GT1A 3X00A 5CE4A 1JJXA 2LB6A 2OVEA 1ALBA 1ADLA 1SA8A 5FQ7E 3ZQ3A 4ZHFA 4ZHHA 2AF5A 2ZSCA 4XMFA 1TOUA 1DC9A 2QCBA 4NYRA 3SOTA 5L8NA 1X89A 1DZKA 3BLGA 4CSBA 4YBUA 1NC9A 4MIRA 1HQPA 4EKVA 1IKJA 2LFOA 1G74A 3TGCA 2RTMA 2RTGB 2FLJA 1SWKA 3EW1A 5CHKA 1JJJA 3O22A 1VWOB 1HBQA 2X32A 5IXGA 3SLTA 1EQDA 1VWAB 2R74A 4YH0A 1FTPA 3MG5A 1MVGA 4HFOA 2Q9SA 2F73A 2OY7A 1SWCA 4KC7A 4EXZA 1Z24A 2Q2PA 2DJGA 4I9RA 4TKJA 2WQAE 1QWDA 2A13A 3IFBA 4U8UO 3WJFA 4EDEA 1QY1A 2RTEB 1RXHA 3EMMA 5AJCA 3VG4A 2Y3FA 1GX9A 4IB7A 4U9CA 1YUPA 3TF6A 1KT4A 2ASNX 2QM9A 4IB6A 5IO7A 3GAQA 3T2WA 4I3DA 3FA7A 5AQ6A 2POAA 2IZLB 4U8UN 4YCHA 3WZOA 4WFVA 2Q39A 4QZUA 4Y59A 2MO5A 3L4RA 5H9NA 3VU1A 2ALLX 4ES7A 2BT9A 2CM9A 3PK2A 3AKMA 3KVNA 1QG5A 3CKFA 4PJ2A 2MWHA 2A0AA 4GUZA 3TGAA 2ANSA 1SREA 4AZQA 1DFVA 1N4JA 1BSOA 1SLGB 3RE5A 4L3RA 5F7GA 1SXYA 5HZ9A 1EIOA 1NQNA 4PSQA 1MUPA 3FEKA 4FGIB 4QGXA 1DZJA 1QFTA 2G78A 2BS6A 2WQ9A 1GGLA 2FKGA 3O2YA 4Z2OA 2OF9A 1LDQA 1S7DA 3O19A 2W2BA 3T6LA 1VYOA 1KT7A 1O1VA 4QZTA 3HOEA 1ZNDA 1VWHB 2LBAA 4D6BA 4A60A 3WYPA 3DSZA 1N43A 5B11O 4O9SA 1EPBA 2Q4NA 3ZUIA 1SWPA 3FR5A 5IRAA 4AW8A 5FQ8E 3NX1A 1TW4A 5IRUA 3SZIA 2AL0X 1YP6A 2GTLM 4UU2A 2IZEB 3FW5A 1BM5A 4QRLA 1STSB 4I3BA 4IRWA 4QQ1A 3WJDA 3APVA 4GRJA 1VYFA 4ALBA 3MX7A 1EALA 3D9WA 4Y0RA 1CBIA 3RWXA 4BX5B 5FENA 2R56A 1CJ5A 2L9CA 4EFGA 3NX2A 1AB0A 1LICA 2G5LA 4DNEA 2VFCA 4GZVA 1IIUA 2DM5A 3FA8A 1JMZA 2C1QA 3VHMA 4YFRA 4A1HA 5D48A 3UEXA 3CR6A 5CSEA 4QGWA 2EU7X 2OFRX 4M7MA 3WJGA 2KD2A 2UZ2A 2G8CO 3PECA 3KQ0A 4IMOA 1VWDB 4MVIA 4TNNA 2NNQA 4BX7B 4CPHB 1KT6A 5LJDA 1DZPA 3HWFA 5L3YA 4DCBA 4YCEA 4FBRA 3E3CA 4BGFA 4YDBA 1MM9A 2WSJA 2ACPX 1OEJA 1SMPI 2FHNX 2A2GA 3F6ZB 3FELA 1EXSA 2AT3X 5H8TA 3MM0A 1TVQA 3OJYC 4Z28A 1BEBA 4A8ZA 1FEMA 1W6FA 4IAXA 2FGSA 4CDFA 5BVQA 1JZUA 2VFBA 3EBKA 3QKGA 4XMHA 2NNEA 1FJ1E 1I4UA 2CBRA 1QY0A 2CAMA 4ZGFA 3CQNA 1BRQA 4QAEA 2RTBB 1MOYA 2WUTA 3T2XA 3V8UA 1YP7A 2RTHB 1LCVA 4ZFXA 4BJ8A 2FR3A 4O3WA 1LF7A 1JBHA 4IAWA 1KT5A 5AEOA 3K3LA 1SLDB 5KICA 1VWFB 1X71A 1OPAA 3NADA 3PP6A 1PBOA 2AT6X 3KFFA 2XSTA 1AVDA 3SAOA 2E4JA 3ZW1B 2GJ5A 1NBXA 2W2FA 3NR3A 4CPEA 1B8EA 3JSQA 4HWMA 3SLJA 1OBUA 1OEEA 5B3MO 5KIDA 3OD9A 4GNYA 4ID2A 1N9MA 4U46A 3BY0A 3VE1A 3T6FA 1ML7A 1I78A 3KFHA 4IMNA 2GTFX 3P24A 1O8VA 1LIFA 3N91A 1KL5A 3FEPA 1ERBA 2HZRA 4INNA 1HBPA 1SY2A 4DQ3A 2L68A 1X8UA 1GT4A 2JU8A 3ZUOA 1SWLA 3RDQA 1T8VA 2FKJA 4YFQA 5LKFA 2ZAGA 3FW4A 3HPEA 1EPAA 1PM1X 2WEWA 3BDRA 4FQBB 3WZPA 1JQPA 2FWVA 2G7BA 2IFBA 3WJEA 1ERXA 1SRIA 2HYSA 1O1UA 1PBYA 2KTDA 2OF8A 4Y0QA 3RE6A 4ZGUA 3LTWA 5KHPA 3VHHA 3AKNA 2OY1O 3PH5A 3C77X 2AMMX 4I60A 1HQQA 1U17A 1SWSA 2Y32A 2OFMX 1VWQB 4JO6A 5DPQA 4ORYA 2BHVA 1MDCA 4GU8A 4YKMA 4ZHCA 4BX6A 1SY1A 2CZTA 1SRHA 1SWUA 1CBQA 1A2DA 2QO6A 2IZCB 3P6EA 5L8IA 1BRPA 2HZQA
chains in the Genus database with same CATH topology
2IZHB 2C4IA 3WYPA 1N43A 2OFAA 1SWRA 1SWPA 4GJVA 1LCZA 1STPA 5IRAA 4OKAA 5IRUA 3SZIA 1SWNA 2AVIA 2IZEB 1AVEA 1STSB 3RDMA 4IRWA 1SWGA 1SWDA 1RSTB 1MEPA 1SWBA 2RTOB 4BX6B 2RTFB 1PTSA 4Z6JA 1LCWA 4BX5B 1HXZA 1N9YA 3WZNA 5B5GA 2IZFB 5B5FA 2G5LA 4DNEA 1I9HA 1N7YA 3RY1A 3EW2A 1NDJA 4Z2PA 2C1QA 3VHMA 5JD2A 1KL4A 2C1SA 1VWNB 1RAVA 2RTNB 1LUQA 5CSEA 3WYQA 5K67A 1NQMA 4CPFA 1VWLB 2UZ2A 4CPIA 3RDOA 3WZQA 4CPHB 1VWDB 4YVBA 2FHLA 2IZJA 4BX7B 2RTKA 2RTDB 1KL3A 2RTRB 2WPUA 4GGRA 2IZKA 5L3YA 1Y52X 1IJ8A 2BC3A 2RTJA 1Y55X 4JNJA 1VWGB 2F01A 1VWCB 1Y53X 2RTQB 1MM9A 1DF8A 1SRGA 1WBIA 1SWJA 1SRFA 2FHNX 2IZAA 3MM0A 4Z28A 2OFBA 2UYWA 1SWOA 5F2BA 2RTLA 4BCSA 3RY2A 1VWIB 3FDCA 4Y5DA 3SZJA 1SWQA 3RDUA 2CAMA 3X00A 4GGTA 2RTPB 2RTBB 1MOYA 3T2XA 5K68A 2ZSCA 2IZDB 2QCBA 2RTHB 2A5CA 1LCVA 4BJ8A 3SZHA 1RSUB 1NC9A 1VWRB 2A5BA 5IRWA 1SLDB 4EKVA 1VWFB 2RTMA 4BBOA 2RTGB 2MF6A 2RTAA 1SWKA 3EW1A 1AVDA 1SWHA 5CHKA 1NBXA 1VWOB 4CPEA 3VHIA 1SWTA 1SWAA 1VWAB 3MG5A 3VGWA 1SLEB 1VWJB 4U46A 1N9MA 4GJSA 4GGZA 4GD9A 1SWCA 2IZIA 3T6FA 1RXJA 2RTCB 1KL5A 1SRJA 1RXHA 2A8GA 2IZBA 2RTEB 4BX5A 1VWMB 2Y3FA 1RXKA 4JHQA 1LDOA 1STRB 3RDXA 1SLFB 3RDSA 2Y3EA 1HXLA 1SWEA 1SWLA 3RDQA 1VWEB 1MK5A 3T2WA 1VWBB 2IZLB 3WZOA 1LELA 4Y59A 2RTIB 3WZPA 3PK2A 1SRIA 3RE6A 2OF8A 2GH7A 4CPHA 1SREA 4BX7A 3VHHA 1N4JA 1SLGB 3RE5A 4I60A 1HQQA 1HY2A 1NQNA 1SWFA 1SWSA 2JGSA 2Y32A 4Z27A 1VWQB 4JO6A 1KFFA 2IZGB 4Z2OA 1VWKB 1VWPB 2OF9A 1LDQA 4BX6A 4Z2VA 1SRHA 1SWUA 1VYOA 3T6LA 2IZCB 4GDAA 1VWHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IZH B;  2C4I A;  3WYP A;  1N43 A;  2OFA A;  1SWR A;  1SWP A;  4GJV A;  1LCZ A;  1STP A;  5IRA A;  4OKA A;  5IRU A;  3SZI A;  1SWN A;  2AVI A;  2IZE B;  1AVE A;  1STS B;  3RDM A;  4IRW A;  1SWG A;  1SWD A;  1RST B;  1MEP A;  1SWB A;  2RTO B;  4BX6 B;  2RTF B;  1PTS A;  4Z6J A;  1LCW A;  4BX5 B;  1HXZ A;  1N9Y A;  3WZN A;  5B5G A;  2IZF B;  5B5F A;  2G5L A;  4DNE A;  1I9H A;  1N7Y A;  3RY1 A;  3EW2 A;  1NDJ A;  4Z2P A;  2C1Q A;  3VHM A;  5JD2 A;  1KL4 A;  2C1S A;  1VWN B;  1RAV A;  2RTN B;  1LUQ A;  5CSE A;  3WYQ A;  5K67 A;  1NQM A;  4CPF A;  1VWL B;  2UZ2 A;  4CPI A;  3RDO A;  3WZQ A;  4CPH B;  1VWD B;  4YVB A;  2FHL A;  2IZJ A;  4BX7 B;  2RTK A;  2RTD B;  1KL3 A;  2RTR B;  2WPU A;  4GGR A;  2IZK A;  5L3Y A;  1Y52 X;  1IJ8 A;  2BC3 A;  2RTJ A;  1Y55 X;  4JNJ A;  1VWG B;  2F01 A;  1VWC B;  1Y53 X;  2RTQ B;  1MM9 A;  1DF8 A;  1SRG A;  1WBI A;  1SWJ A;  1SRF A;  2FHN X;  2IZA A;  3MM0 A;  4Z28 A;  2OFB A;  2UYW A;  1SWO A;  5F2B A;  2RTL A;  4BCS A;  3RY2 A;  1VWI B;  3FDC A;  4Y5D A;  3SZJ A;  1SWQ A;  3RDU A;  2CAM A;  3X00 A;  4GGT A;  2RTP B;  2RTB B;  1MOY A;  3T2X A;  5K68 A;  2ZSC A;  2IZD B;  2QCB A;  2RTH B;  2A5C A;  1LCV A;  4BJ8 A;  3SZH A;  1RSU B;  1NC9 A;  1VWR B;  2A5B A;  5IRW A;  1SLD B;  4EKV A;  1VWF B;  2RTM A;  4BBO A;  2RTG B;  2MF6 A;  2RTA A;  1SWK A;  3EW1 A;  1AVD A;  1SWH A;  5CHK A;  1NBX A;  1VWO B;  4CPE A;  3VHI A;  1SWT A;  1SWA A;  1VWA B;  3MG5 A;  3VGW A;  1SLE B;  1VWJ B;  4U46 A;  1N9M A;  4GJS A;  4GGZ A;  4GD9 A;  1SWC A;  2IZI A;  3T6F A;  1RXJ A;  2RTC B;  1KL5 A;  1SRJ A;  1RXH A;  2A8G A;  2IZB A;  2RTE B;  4BX5 A;  1VWM B;  2Y3F A;  1RXK A;  4JHQ A;  1LDO A;  1STR B;  3RDX A;  1SLF B;  3RDS A;  2Y3E A;  1HXL A;  1SWE A;  1SWL A;  3RDQ A;  1VWE B;  1MK5 A;  3T2W A;  1VWB B;  2IZL B;  3WZO A;  1LEL A;  4Y59 A;  2RTI B;  3WZP A;  3PK2 A;  1SRI A;  3RE6 A;  2OF8 A;  2GH7 A;  4CPH A;  1SRE A;  4BX7 A;  3VHH A;  1N4J A;  1SLG B;  3RE5 A;  4I60 A;  1HQQ A;  1HY2 A;  1NQN A;  1SWF A;  1SWS A;  2JGS A;  2Y32 A;  4Z27 A;  1VWQ B;  4JO6 A;  1KFF A;  2IZG B;  4Z2O A;  1VWK B;  1VWP B;  2OF9 A;  1LDQ A;  4BX6 A;  4Z2V A;  1SRH A;  1SWU A;  1VYO A;  3T6L A;  2IZC B;  4GDA A;  1VWH B; 
#chains in the Genus database with same CATH topology
 3RSW A;  2IZH B;  2RN4 A;  3RBY A;  3SLO A;  4MEE A;  1JJU A;  4GJV A;  1OSP O;  4AZM A;  2QOM A;  1FEN A;  1FEL A;  4M6S A;  1AVE A;  3RDM A;  2YMS A;  4FBV A;  1SWG A;  1SWD A;  1RST B;  2QMI A;  1ZRY A;  2BLG A;  4WFU A;  1MEP A;  3VG7 A;  5IO6 A;  5EDC A;  2RTO B;  3CBS A;  4QYN A;  2K62 A;  3DTQ A;  4ML7 B;  5D47 A;  5HTD A;  1PTS A;  3PED A;  2MM3 A;  4U3Q A;  4Z6J A;  1EUO A;  1GKA B;  1YWC A;  1HXZ A;  2RA6 A;  3MBT A;  3WZN A;  3ELZ A;  4ZJ0 A;  5B2A O;  4CV7 A;  1I9H A;  1N7Y A;  3HWE A;  2KTS A;  3EW2 A;  1WUB A;  3FEN A;  4O4O A;  3WVM A;  4TQ2 A;  2PI3 O;  1SY3 A;  5C0N A;  3U03 A;  1X8Q A;  5HZ5 A;  1I04 A;  2AKQ A;  4CK4 A;  1BBP A;  4JGL A;  3WBG A;  5K67 A;  1NQM A;  4CPF A;  5LJB A;  4C5P A;  1K24 A;  1QQS A;  2FT9 A;  2X46 A;  4QYP A;  1ZNH A;  3ZI8 A;  4YVB A;  1JYJ A;  2X45 A;  1KL3 A;  2RTR B;  2WPU A;  2HMB A;  2MJI A;  3F8A A;  4GGR A;  1IJ8 A;  2BC3 A;  2RTJ A;  1HN2 A;  2QO4 A;  3NPO A;  3RZY A;  4OMX A;  1KZW A;  4AYH A;  1Y53 X;  1SRG A;  1DF8 A;  2I5V O;  3FR2 A;  4K19 A;  3B2K A;  4N7C A;  2AT0 X;  1A18 A;  2X8S A;  3LHN A;  3BS2 A;  3PH6 A;  3NQ9 A;  3NQ3 A;  5D45 A;  1DF3 A;  2OFB A;  3FR4 A;  1LIB A;  3ZZV A;  1ZNL A;  1AQB A;  3I17 A;  3CWK A;  4L1N A;  1G5W A;  1G7N A;  2JN3 A;  2X34 A;  2OY8 A;  4I6S A;  5F6Z A;  4YBP A;  4O4X A;  1B4M A;  4KH8 A;  4NP1 A;  5HAE A;  3STN A;  1R0U A;  3AUM O;  4GGT A;  2RTP B;  4KC8 A;  5EPQ A;  5HTE A;  4ZH9 A;  3ZW2 A;  5LJH A;  1T68 X;  4AZP A;  3GE2 A;  4LZV A;  2GTL O;  5K68 A;  1LID A;  5K06 A;  4I3C A;  3STK A;  2A5C A;  4MIS A;  1ICN A;  3WXQ A;  1DZM A;  2ACO A;  3CBC A;  1VWR B;  3FMZ A;  2Z4H A;  2AT5 X;  3D95 A;  3P6F A;  5IRW A;  1FDQ A;  2X56 A;  1SXW A;  1BLR A;  3UEV A;  2MF6 A;  2RTA A;  3BX7 A;  5F6B A;  4O4U A;  3ZW0 B;  1SWH A;  3D4R A;  2GTL N;  1Y9L A;  3HK1 A;  3HTY A;  3VHI A;  2LA7 A;  1KT3 A;  3B2I A;  1NP4 A;  1VWJ B;  2GC9 A;  4ORX A;  4OS0 A;  3VGW A;  1GM6 A;  1CRB A;  4GD9 A;  5B29 A;  2IZI A;  3C76 X;  4CDD A;  2F09 A;  1SRJ A;  2A8G A;  4R0B A;  4O3Z A;  4BX5 A;  1BWY A;  1S2P A;  2DJF A;  3UAQ A;  1LDO A;  3RDX A;  4XMC A;  3ZWE A;  1SLF B;  2Y3E A;  1E06 A;  1E2T A;  1S44 A;  3P6D A;  3VG6 A;  4RUN A;  1XCA A;  5DG4 A;  1BJ7 A;  1I06 A;  2X55 A;  5H9L A;  4NYQ A;  3S5V A;  1GXA A;  4OS3 A;  5HCE C;  2PY1 A;  1B0O A;  1E00 A;  4NNT A;  1HMT A;  4O49 A;  4TKH A;  5EEE A;  2JU7 A;  4HPB A;  3VG5 A;  1JMX A;  5BVT A;  4HPC A;  2O62 A;  4CPH A;  4NV8 A;  4BX7 A;  1W5R A;  4LKP A;  4MVK A;  3UEU A;  3CKG A;  3HOL A;  1XKI A;  4ZHD A;  5HWZ A;  4ALO A;  4IAB A;  1HY2 A;  1OEK A;  1OPB A;  2X8F A;  3Q34 A;  1KFF A;  2IZG B;  3D96 A;  1OBP A;  3FA6 A;  2A2U A;  1W4T A;  4IBA A;  3S26 A;  4GDA A;  5HZQ A;  1JYD A;  3C78 X;  1L6M A;  1BSQ A;  3S60 A;  3BU9 A;  1H91 A;  1SWR A;  2N93 A;  1VYG A;  3APU A;  3FYF A;  1STP A;  4OKA A;  1TOW A;  4KT5 A;  1SWN A;  2AVI A;  2OZQ A;  1VPR A;  2FRS A;  5LJC A;  3IA8 A;  3CQR A;  3FIQ A;  3G7X A;  4LKT A;  1YWB A;  1CBR A;  1SWB A;  4TLJ A;  5D8J A;  4BX6 B;  5BYP A;  1A57 A;  1KQW A;  2FS6 A;  2OVA A;  2WEX A;  3CMP A;  1LCW A;  2CM4 A;  5CYB A;  4AZN A;  2OL6 O;  1LPJ A;  5B5G A;  5EZ2 A;  3BSZ E;  3U0D A;  1FE3 A;  2QOS C;  3ELX A;  3ZW1 A;  4CDC A;  4I9S A;  1MX8 A;  2NP1 A;  2BS5 A;  1NDJ A;  4TKB A;  4U8U M;  5JD2 A;  1KL4 A;  3APX A;  4ORW A;  1PMP A;  3NQK A;  2C1S A;  1T0V A;  1VWN B;  2MHD A;  2NND A;  3I0A A;  1KOI A;  3JS1 A;  4HPD A;  2RTN B;  1LUQ A;  4NNS A;  4ZCB A;  2HKD A;  3HWG A;  3WYQ A;  4LQZ A;  3AEH A;  4B55 A;  3PDF A;  2RCT A;  3RDO A;  3WZQ A;  2IZJ A;  2RTK A;  2JU3 A;  1Y52 X;  2HNX A;  3F9D A;  4JNJ A;  4ON1 A;  4YFP A;  4IB8 A;  1VWC B;  3TZS A;  1HMR A;  4ORU A;  2WR6 A;  2ZAI A;  4ODD A;  5HZ8 A;  1ACD A;  4GDZ A;  1WBI A;  2CBS A;  1SRF A;  4YMY A;  1AVG I;  1QFV A;  2G79 A;  4HPA A;  2IZA A;  2W2A A;  4YGH A;  1QAB E;  2LKK A;  5LKE A;  5FAZ A;  4LZU A;  2UYW A;  3H3I A;  5F2B A;  3JQO A;  2RTL A;  2RD7 C;  5F1E A;  1A3Y A;  1VWI B;  3KZA A;  5BVS A;  3RY2 A;  4BCS A;  3FDC A;  4Y5D A;  2BSZ A;  1Y0G A;  1SWQ A;  1YWA A;  4KCA A;  3RDU A;  3PQU A;  1Y9T A;  2X4M A;  1SXU A;  4ORR A;  1LIE A;  3S5X A;  3B2H A;  4NLJ A;  2IZD B;  4XME A;  4YGG A;  2FS7 A;  1OBQ A;  3EYC A;  1QY2 A;  1PEE A;  1RSU B;  3Q6L A;  2FR2 A;  4WHI A;  4Y0S A;  5EED A;  3SZH A;  2A5B A;  1E02 A;  5B10 O;  2R73 A;  4XMD A;  3WJB A;  2RCQ A;  4BBO A;  1KZX A;  2L5P A;  5IO5 A;  1KQX A;  1LFO A;  2HLV A;  4O3Y A;  3APW A;  1SWT A;  1SWA A;  4A1Y A;  3KFI A;  4MVL A;  1SLE B;  1LKE A;  1EI5 A;  4GJS A;  1URE A;  1UYN X;  2RQ0 A;  4GGZ A;  5HZ6 A;  5LJK A;  4NV7 A;  1RXJ A;  1U18 A;  1CBS A;  2P8G A;  2RTC B;  2YG2 A;  3P02 A;  4QNI A;  5EDB A;  5H9K A;  3T1D A;  2IZB A;  3B2L A;  1VWM B;  1GKA A;  1RXK A;  1ZNE A;  3MVF A;  1D2U A;  4JHQ A;  2VDF A;  1STR B;  3NP1 A;  5HCD C;  1IFB A;  3RDS A;  3STM X;  1HXL A;  1SWE A;  4YDA A;  3TGB A;  4IB9 A;  3P6H A;  1VWE B;  1MK5 A;  1NGL A;  4I95 A;  4MVE A;  4YKO A;  1VWB B;  1EII A;  3EBW A;  1GX3 A;  3LV4 A;  3VG3 A;  4YGZ A;  1LEL A;  4AZO A;  2RTI B;  1IW2 A;  4RUU A;  4OMW A;  1N0S A;  3WOV A;  1U0X A;  3UEW A;  1E5P A;  1MX7 A;  5B27 A;  3B2J A;  3OBL A;  5FFH A;  2GH7 A;  4D6A A;  4ORS A;  1GX8 A;  1HMS A;  4KII A;  4FBO A;  2Z4I A;  3QQ2 A;  1SWF A;  2JGS A;  4Z27 A;  4N7D A;  2QO5 A;  3EM0 A;  1VWK B;  1YWD A;  3BU1 A;  4ZH6 A;  1VWP B;  2CZU A;  2OVS A;  2JOZ A;  3PQS A;  4O3X B;  4EEJ A;  4Z2V A;  5HCC C;  4Y0P A;  2AT8 X;  2C4I A;  2OFA A;  1TXL A;  2OL7 A;  4BQU A;  1P6P A;  1LCZ A;  3HWD A;  4BOE A;  3BRN A;  1IFC A;  4O4S A;  3VG2 A;  4GKC A;  1JIW I;  4BVM A;  3VPJ E;  2KW1 A;  3P6G A;  1ICM A;  3KFG A;  2KT4 B;  5HA1 A;  4ARH A;  4QGV A;  2JMB A;  2I5Z O;  5L8O A;  1DV9 A;  2RTF B;  3WJC A;  1I05 A;  5HA0 A;  4TJZ A;  1X8O A;  2A3F X;  1N9Y A;  2IZF B;  5B5F A;  4OEM A;  4GH7 A;  2LBV A;  2OYB O;  1SXX A;  3ZW0 A;  3OE3 A;  3RY1 A;  1EW3 A;  1BSY A;  3RKG A;  3VE2 A;  1IKE A;  4Z2P A;  5LJG A;  4ZHG A;  4GET A;  1K3B A;  3EC5 A;  1AEL A;  5FQ6 E;  4AZR A;  1RAV A;  1B56 A;  3NBX X;  4GK9 A;  4ZR2 A;  5H9A A;  3BX8 A;  1ZNG A;  1D3S A;  4EQA C;  4DQ4 A;  1VWL B;  3PPT A;  2L67 A;  4CDE A;  4CPI A;  2OY5 O;  1ZNK A;  4OS8 A;  2FHL A;  2WWP A;  2RTD B;  1GT5 A;  3FLL A;  2FTB A;  1RBP A;  2IZK A;  4XMG A;  2OL8 O;  1Y55 X;  2OVD A;  1VWG B;  2F01 A;  1X8N A;  2M4L A;  1RLB E;  2Q2M A;  2RTQ B;  4GNW A;  1SWJ A;  3U9P C;  4COT A;  4NW4 A;  1SY0 A;  4WBK A;  1KGL A;  2X8T A;  4GE1 A;  4NLI A;  1JV4 A;  2AH7 X;  1UZ2 X;  5LJE A;  4UU3 A;  5JR8 A;  1G85 A;  1NP1 A;  1LNM A;  1KXO A;  1SWO A;  4OEL A;  5D4A A;  1UYO X;  1GT3 A;  3FID A;  1YIV A;  5F58 A;  5HBS A;  3SZJ A;  1X8P A;  2XKL A;  5AJB A;  2K23 A;  3FA9 A;  2JW1 A;  3D97 A;  3P6C A;  1GT1 A;  3X00 A;  5CE4 A;  1JJX A;  2LB6 A;  2OVE A;  1ALB A;  1ADL A;  1SA8 A;  5FQ7 E;  3ZQ3 A;  4ZHF A;  4ZHH A;  2AF5 A;  2ZSC A;  4XMF A;  1TOU A;  1DC9 A;  2QCB A;  4NYR A;  3SOT A;  5L8N A;  1X89 A;  1DZK A;  3BLG A;  4CSB A;  4YBU A;  1NC9 A;  4MIR A;  1HQP A;  4EKV A;  1IKJ A;  2LFO A;  1G74 A;  3TGC A;  2RTM A;  2RTG B;  2FLJ A;  1SWK A;  3EW1 A;  5CHK A;  1JJJ A;  3O22 A;  1VWO B;  1HBQ A;  2X32 A;  5IXG A;  3SLT A;  1EQD A;  1VWA B;  2R74 A;  4YH0 A;  1FTP A;  3MG5 A;  1MVG A;  4HFO A;  2Q9S A;  2F73 A;  2OY7 A;  1SWC A;  4KC7 A;  4EXZ A;  1Z24 A;  2Q2P A;  2DJG A;  4I9R A;  4TKJ A;  2WQA E;  1QWD A;  2A13 A;  3IFB A;  4U8U O;  3WJF A;  4EDE A;  1QY1 A;  2RTE B;  1RXH A;  3EMM A;  5AJC A;  3VG4 A;  2Y3F A;  1GX9 A;  4IB7 A;  4U9C A;  1YUP A;  3TF6 A;  1KT4 A;  2ASN X;  2QM9 A;  4IB6 A;  5IO7 A;  3GAQ A;  3T2W A;  4I3D A;  3FA7 A;  5AQ6 A;  2POA A;  2IZL B;  4U8U N;  4YCH A;  3WZO A;  4WFV A;  2Q39 A;  4QZU A;  4Y59 A;  2MO5 A;  3L4R A;  5H9N A;  3VU1 A;  2ALL X;  4ES7 A;  2BT9 A;  2CM9 A;  3PK2 A;  3AKM A;  3KVN A;  1QG5 A;  3CKF A;  4PJ2 A;  2MWH A;  2A0A A;  4GUZ A;  3TGA A;  2ANS A;  1SRE A;  4AZQ A;  1DFV A;  1N4J A;  1BSO A;  1SLG B;  3RE5 A;  4L3R A;  5F7G A;  1SXY A;  5HZ9 A;  1EIO A;  1NQN A;  4PSQ A;  1MUP A;  3FEK A;  4FGI B;  4QGX A;  1DZJ A;  1QFT A;  2G78 A;  2BS6 A;  2WQ9 A;  1GGL A;  2FKG A;  3O2Y A;  4Z2O A;  2OF9 A;  1LDQ A;  1S7D A;  3O19 A;  2W2B A;  3T6L A;  1VYO A;  1KT7 A;  1O1V A;  4QZT A;  3HOE A;  1ZND A;  1VWH B;  2LBA A;  4D6B A;  4A60 A;  3WYP A;  3DSZ A;  1N43 A;  5B11 O;  4O9S A;  1EPB A;  2Q4N A;  3ZUI A;  1SWP A;  3FR5 A;  5IRA A;  4AW8 A;  5FQ8 E;  3NX1 A;  1TW4 A;  5IRU A;  3SZI A;  2AL0 X;  1YP6 A;  2GTL M;  4UU2 A;  2IZE B;  3FW5 A;  1BM5 A;  4QRL A;  1STS B;  4I3B A;  4IRW A;  4QQ1 A;  3WJD A;  3APV A;  4GRJ A;  1VYF A;  4ALB A;  3MX7 A;  1EAL A;  3D9W A;  4Y0R A;  1CBI A;  3RWX A;  4BX5 B;  5FEN A;  2R56 A;  1CJ5 A;  2L9C A;  4EFG A;  3NX2 A;  1AB0 A;  1LIC A;  2G5L A;  4DNE A;  2VFC A;  4GZV A;  1IIU A;  2DM5 A;  3FA8 A;  1JMZ A;  2C1Q A;  3VHM A;  4YFR A;  4A1H A;  5D48 A;  3UEX A;  3CR6 A;  5CSE A;  4QGW A;  2EU7 X;  2OFR X;  4M7M A;  3WJG A;  2KD2 A;  2UZ2 A;  2G8C O;  3PEC A;  3KQ0 A;  4IMO A;  1VWD B;  4MVI A;  4TNN A;  2NNQ A;  4BX7 B;  4CPH B;  1KT6 A;  5LJD A;  1DZP A;  3HWF A;  5L3Y A;  4DCB A;  4YCE A;  4FBR A;  3E3C A;  4BGF A;  4YDB A;  1MM9 A;  2WSJ A;  2ACP X;  1OEJ A;  1SMP I;  2FHN X;  2A2G A;  3F6Z B;  3FEL A;  1EXS A;  2AT3 X;  5H8T A;  3MM0 A;  1TVQ A;  3OJY C;  4Z28 A;  1BEB A;  4A8Z A;  1FEM A;  1W6F A;  4IAX A;  2FGS A;  4CDF A;  5BVQ A;  1JZU A;  2VFB A;  3EBK A;  3QKG A;  4XMH A;  2NNE A;  1FJ1 E;  1I4U A;  2CBR A;  1QY0 A;  2CAM A;  4ZGF A;  3CQN A;  1BRQ A;  4QAE A;  2RTB B;  1MOY A;  2WUT A;  3T2X A;  3V8U A;  1YP7 A;  2RTH B;  1LCV A;  4ZFX A;  4BJ8 A;  2FR3 A;  4O3W A;  1LF7 A;  1JBH A;  4IAW A;  1KT5 A;  5AEO A;  3K3L A;  1SLD B;  5KIC A;  1VWF B;  1X71 A;  1OPA A;  3NAD A;  3PP6 A;  1PBO A;  2AT6 X;  3KFF A;  2XST A;  1AVD A;  3SAO A;  2E4J A;  3ZW1 B;  2GJ5 A;  1NBX A;  2W2F A;  3NR3 A;  4CPE A;  1B8E A;  3JSQ A;  4HWM A;  3SLJ A;  1OBU A;  1OEE A;  5B3M O;  5KID A;  3OD9 A;  4GNY A;  4ID2 A;  1N9M A;  4U46 A;  3BY0 A;  3VE1 A;  3T6F A;  1ML7 A;  1I78 A;  3KFH A;  4IMN A;  2GTF X;  3P24 A;  1O8V A;  1LIF A;  3N91 A;  1KL5 A;  3FEP A;  1ERB A;  2HZR A;  4INN A;  1HBP A;  1SY2 A;  4DQ3 A;  2L68 A;  1X8U A;  1GT4 A;  2JU8 A;  3ZUO A;  1SWL A;  3RDQ A;  1T8V A;  2FKJ A;  4YFQ A;  5LKF A;  2ZAG A;  3FW4 A;  3HPE A;  1EPA A;  1PM1 X;  2WEW A;  3BDR A;  4FQB B;  3WZP A;  1JQP A;  2FWV A;  2G7B A;  2IFB A;  3WJE A;  1ERX A;  1SRI A;  2HYS A;  1O1U A;  1PBY A;  2KTD A;  2OF8 A;  4Y0Q A;  3RE6 A;  4ZGU A;  3LTW A;  5KHP A;  3VHH A;  3AKN A;  2OY1 O;  3PH5 A;  3C77 X;  2AMM X;  4I60 A;  1HQQ A;  1U17 A;  1SWS A;  2Y32 A;  2OFM X;  1VWQ B;  4JO6 A;  5DPQ A;  4ORY A;  2BHV A;  1MDC A;  4GU8 A;  4YKM A;  4ZHC A;  4BX6 A;  1SY1 A;  2CZT A;  1SRH A;  1SWU A;  1CBQ A;  1A2D A;  2QO6 A;  2IZC B;  3P6E A;  5L8I A;  1BRP A;  2HZQ A; 
#chains in the Genus database with same CATH homology
 2IZH B;  2C4I A;  3WYP A;  1N43 A;  2OFA A;  1SWR A;  1SWP A;  4GJV A;  1LCZ A;  1STP A;  5IRA A;  4OKA A;  5IRU A;  3SZI A;  1SWN A;  2AVI A;  2IZE B;  1AVE A;  1STS B;  3RDM A;  4IRW A;  1SWG A;  1SWD A;  1RST B;  1MEP A;  1SWB A;  2RTO B;  4BX6 B;  2RTF B;  1PTS A;  4Z6J A;  1LCW A;  4BX5 B;  1HXZ A;  1N9Y A;  3WZN A;  5B5G A;  2IZF B;  5B5F A;  2G5L A;  4DNE A;  1I9H A;  1N7Y A;  3RY1 A;  3EW2 A;  1NDJ A;  4Z2P A;  2C1Q A;  3VHM A;  5JD2 A;  1KL4 A;  2C1S A;  1VWN B;  1RAV A;  2RTN B;  1LUQ A;  5CSE A;  3WYQ A;  5K67 A;  1NQM A;  4CPF A;  1VWL B;  2UZ2 A;  4CPI A;  3RDO A;  3WZQ A;  4CPH B;  1VWD B;  4YVB A;  2FHL A;  2IZJ A;  4BX7 B;  2RTK A;  2RTD B;  1KL3 A;  2RTR B;  2WPU A;  4GGR A;  2IZK A;  5L3Y A;  1Y52 X;  1IJ8 A;  2BC3 A;  2RTJ A;  1Y55 X;  4JNJ A;  1VWG B;  2F01 A;  1VWC B;  1Y53 X;  2RTQ B;  1MM9 A;  1DF8 A;  1SRG A;  1WBI A;  1SWJ A;  1SRF A;  2FHN X;  2IZA A;  3MM0 A;  4Z28 A;  2OFB A;  2UYW A;  1SWO A;  5F2B A;  2RTL A;  4BCS A;  3RY2 A;  1VWI B;  3FDC A;  4Y5D A;  3SZJ A;  1SWQ A;  3RDU A;  2CAM A;  3X00 A;  4GGT A;  2RTP B;  2RTB B;  1MOY A;  3T2X A;  5K68 A;  2ZSC A;  2IZD B;  2QCB A;  2RTH B;  2A5C A;  1LCV A;  4BJ8 A;  3SZH A;  1RSU B;  1NC9 A;  1VWR B;  2A5B A;  5IRW A;  1SLD B;  4EKV A;  1VWF B;  2RTM A;  4BBO A;  2RTG B;  2MF6 A;  2RTA A;  1SWK A;  3EW1 A;  1AVD A;  1SWH A;  5CHK A;  1NBX A;  1VWO B;  4CPE A;  3VHI A;  1SWT A;  1SWA A;  1VWA B;  3MG5 A;  3VGW A;  1SLE B;  1VWJ B;  4U46 A;  1N9M A;  4GJS A;  4GGZ A;  4GD9 A;  1SWC A;  2IZI A;  3T6F A;  1RXJ A;  2RTC B;  1KL5 A;  1SRJ A;  1RXH A;  2A8G A;  2IZB A;  2RTE B;  4BX5 A;  1VWM B;  2Y3F A;  1RXK A;  4JHQ A;  1LDO A;  1STR B;  3RDX A;  1SLF B;  3RDS A;  2Y3E A;  1HXL A;  1SWE A;  1SWL A;  3RDQ A;  1VWE B;  1MK5 A;  3T2W A;  1VWB B;  2IZL B;  3WZO A;  1LEL A;  4Y59 A;  2RTI B;  3WZP A;  3PK2 A;  1SRI A;  3RE6 A;  2OF8 A;  2GH7 A;  4CPH A;  1SRE A;  4BX7 A;  3VHH A;  1N4J A;  1SLG B;  3RE5 A;  4I60 A;  1HQQ A;  1HY2 A;  1NQN A;  1SWF A;  1SWS A;  2JGS A;  2Y32 A;  4Z27 A;  1VWQ B;  4JO6 A;  1KFF A;  2IZG B;  4Z2O A;  1VWK B;  1VWP B;  2OF9 A;  1LDQ A;  4BX6 A;  4Z2V A;  1SRH A;  1SWU A;  1VYO A;  3T6L A;  2IZC B;  4GDA A;  1VWH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...