1LDPH

Crystal structure of murine mhc class i h-2ld with a mixture of bound peptides
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
272
structure length
272
Chain Sequence
GPHSMRYFETAVSRPGLGEPRYISVGYVDNKEFVRFDSDAENPRYEPQAPWMEQEGPEYWERITQIAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQWMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLKTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of 2C TCR allorecognition of H-2Ld peptide complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (mhc i/peptide)
molecule keywords MHC CLASS I H-2LD
total genus 55
structure length 272
sequence length 272
ec nomenclature
pdb deposition date 1998-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ldpH02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1ldpH01
3WFHB 1FYTB 4WFHD 2V2WB 4H8WL 4PY8J 4ZOBA 4DKAA 2D31A 3N1MC 5MEOA 5F7DB 2IAMD 3RX8A 4LDEB 1RUQL 4TSCL 4R2GC 3IDIA 4K7PH 5C0FB 4KHXH 4L8DB 5IWLC 4AK1A 4FQPA 3CK0L 4LHUA 5D7IF 3IU3B 5I1LB 5I8EB 4QRRE 4EUPG 4IIQC 3T1FA 5A1AA 1V7ML 4YE4L 2AK1H 2VXTH 1UB5B 4MJ5A 4NQED 2JB5H 2MFNA 1HZHH 4MA7H 4CMHC 4MZ2A 3QZWA 5HHME 35C8L 5J0BA 2PXYB 4KFZC 4XBPA 1D5XB 5MI0B 1EA9C 4Z0BH 3S35X 3UTZA 3RVWD 5E2WL 2EH7H 3Q6GL 3FO1B 1CTOA 3W2DL 3DSFL 1J1XH 3HCVA 4ZPTB 3GI9L 2R23B 3MRKB 2DLEA 3KYKH 1EHLH 1A3LL 1G7JB 4OZIE 1MY5A 1OTSC 1QFOA 3G08B 2FO4B 3ARBA 5HGHA 1FZMA 2HH0H 2Z35A 1F90H 4PRAA 2CDEB 1A6TA 2PO6C 2NXZC 3TFKA 1P7KB 4PLNC 4RGOH 4JPIA 4LPXA 4G6ML 1GGBH 1NMAH 1RUQH 4TSCH 3IXTB 3QDGB 5EO9A 2APFA 3VXMD 1RIHL 4D94A 1H15B 5DK3A 2DYPB 5MERB 4LGSB 2VC2L 2Q20A 5C3LD 3PHSA 3RHWK 1FVDA 4GG8B 4YBQC 4PRPA 1KEMH 1KJ3H 5J56B 4FQIL 4J12A 5F88B 2UUDK 3G5XB 3ULVH 4QY8B 3BGMB 2DQJH 3ME0A 3KYMA 2XFXA 3OGCA 4WI8A 2DBLH 2B7DT 3VDCA 4K8RC 3QFDA 3MCG1 4G8FB 3D2UB 3NCFB 3NFNB 4EUPA 1FORH 4KJQC 2DYPA 1HINL 2KL6A 2WIMA 2OZ4H 3K2UH 5DJ8B 3U0PA 3KHQA 1V3JA 3GBMH 4GRWH 3EYSL 3OAZK 1H3TA 1YC7A 3D0LA 4J3WA 1RZGA 3L95B 4H20L 4EDXB 2FD6L 1RZ8B 3QIBC 4BSVB 3RZCD 1VFOA 1WTGT 3DSNA 4OLXL 4MDIA 1RJYA 1CXHA 5ELIA 2VN4A 3BE1L 3WFEL 1RK0B 4N8CH 2D7QA 2V5RA 1MREH 1FN4B 4JM4L 4LL9A 2FL5A 5D72H 5CGMA 4LCWD 4KPHL 2Q8AL 4M61A 3K8LA 1SQ2N 1CFVH 2QHRH 4J4PA 4L29A 4PJHF 1OPGH 1TJHL 2YD9A 4JFEE 3GJFA 4J7RA 3ARDB 3MMEB 2EDDA 4HXBH 4Z7VA 1Q9WA 2VLRD 3TBSA 4LSVH 2Y4SA 4PP8C 4GRWB 3OKEB 3IKCB 3WXVL 4P9HL 4XAKD 3NOIA 1A14L 2QSTA 4OD2B 4XHQA 2FL5B 4RA3A 2EKSA 3D2UD 4NQDB 1BFOB 3VI4E 2AJVH 1OP3H 3GMRA 3MLSL 5DLML 1EHAA 3BFOA 4QEGA 5JORB 5L8LB 4QGTA 5KVMC 3EO9L 4OLZL 2FO1A 3TO4B 5IW6A 5I6XB 3EDKA 2WY3A 2CIIA 4CVZA 4Y5VA 1DQQB 4TSAL 4ZPTA 3WO4B 4KQ3H 5SV3A 4R0LA 3CFEB 3LEVL 1NCNA 3HB3C 1DUZB 1S7XA 1S3KH 4QRRA 5CEZL 1TDQA 3P4LA 3F5WB 2AGJL 5CEYB 3ZKND 1N6QL 1KG0A 4DQOL 5CEZD 4DUVA 1KPVB 3WJLC 3TNNB 1DBJL 1LE5B 4OI7A 4LLUB 4NCDA 1EEYB 3BDBA 4FZ8L 1HHJB 1SY6H 3CFEA 1DP0A 1C5BL 1OPGL 5I1JH 3P77B 1Z5LA 5H37G 1WIUA 4AMKH 3TIDB 1IT9L 4P48A 3O3AB 4KUZH 3WIHA 4HFWA 5MERA 4BZ1H 5E0QA 4HK0B 2YN5A 4JFZL 5I16B 2P5WE 4ZD3L 1CL7I 3WS3A 5DWUL 2R1XB 3ULSA 4NQSB 3PWJB 3WUWG 2CLVB 3RWIA 3O6FC 2DI8A 4GAYA 4PJ5E 2P8PA 4Y5YC 4WFHE 5FKAA 1W72B 3T0DA 1X5ZA 3HI1A 4WENB 1P84J 2E7LA 4JHZA 1JRHH 1A21A 1K9TA 1X5AA 2J7LA 2X2YA 1H8OA 2AJXL 3BYTA 1OGAE 3RGVD 3T4AA 3KXFB 5KSBF 4XHJD 4BQ6A 3FAXA 3P4NA 2OMBA 1CXKA 4LIQE 4NO2B 3EW3B 2XKUA 1JGLL 4I77H 1TMCB 3JV5A 1TNNA 2ZUXA 2M1KA 1VEPA 3FB5B 3GZKA 4PJEF 3ZYZA 4NUJA 3H9SB 1S5IH 3ELAT 1DDHA 4G9DB 1FZJA 1FIGH 3G5ZA 3HI6L 3IETA 4P57A 5FGSA 1UA6L 1JNNL 4ONOA 5C8JA 2EZ0C 5E5UB 3U83A 5IFHL 4WWKC 3HZMB 5KW9L 2BMKA 4WUUD 4NO2A 3D3VB 1DCLA 5I1AB 2OSLA 4HK3J 1T66D 3HNSH 1KB5B 5T1KB 3T09A 5F9WB 1P4BL 1W72H 4GG6A 1ZA3B 2MKLC 4KVNL 5E6YA 3ARUA 5EWIL 2R0ZL 4JM2D 2DQDL 4WEBL 3TPUE 5BS0A 3P0VH 1NLBL 1MJJA 3THML 1LEKA 2X44D 4GBXB 4HIEB 1I1RA 5FYJH 4NOBA 4LLDA 2BNQA 4OCYL 4N5EC 1ZTXL 2X1PA 3BD5A 5LBSH 4OD3H 3V52H 5DS8B 1Q9LA 4HAGA 2ZKHH 2OLDA 4JY4B 5I8KL 1SJEA 2C3HA 4LFHG 4NKDB 1UCTA 3RZCC 5BMFL 3HI5H 2BFVH 5M7QA 1SJXA 3VFSA 4M1CC 5FGCB 3VFNA 1ZHNB 1CXLA 2VYRE 4TYUA 1MH5A 3OX8A 1H15A 3BN9D 4JFED 2BDNH 5F9JB 1B4RA 5HHPB 4G8GA 4LHUD 5FYKD 4F9PC 5F1IB 2EIZB 1MFBH 5BS0E 4U1JA 4XC3L 5IFHH 2GTZB 3S4SB 2X4NA 6FABL 5I1EH 3O3UN 3RQ3A 1B6DA 4GG6E 4HQQH 2ESVE 1BD2E 1D5IL 3HC4H 1UXSA 5FHBH 3NCJL 4H5SA 4JPVH 1MHCB 2YC1A 3U4AA 2X70B 3HG1D 4Z77A 1UZ8A 5IQ9B 2R0ZH 4PGBA 1KN2H 2BNRE 3EZ8A 3BKML 3RY4A 1KJVA 1JHTA 4ALAL 3O3AA 1U3HB 4R96B 3V9FA 3QDMB 1RZJL 3QWRA 2MSPA 1GGIH 1KIPA 5GS1C 4X6EB 3WHXA 3BRDA 5IW1A 2PO6D 1W0VB 3IF1B 4Y1AB 4NIKB 5EBWA 5DVLA 1WC7B 2OXGA 2F74A 2A2QT 3P11H 1TPXC 4U1NB 4GQ9H 1FRGH 5HDLA 2D4DA 1I85A 1QSEA 3QUYC 4LVNC 1LO5A 3LN5B 1I8IB 2FGZA 4FXKA 3WDHA 2RFXB 3CNKA 4JKKA 4CDHA 1CFSB 3TF7C 2QL1A 3WMSA 1D5IH 4XP6H 2BY1A 4L9LB 4PB9L 3DYMA 5ACZB 4MQXD 2XQYG 1DLFH 2YEZA 1HXYA 3Q6FB 2APTA 3R0NA 1KB9K 4QHMA 5EB9A 2XQYK 4F80A 3WLBA 4IEFB 3H42H 5EULV 5CJ8A 1WK0A 3BKMH 5CD5C 5L8KB 2C1OA 5DQDL 1OAYH 3QHZL 4GLRH 4K9EH 1UXWA 1JWMA 4WO4D 1T5XA 2GSIA 1J1PL 4R4FH 5IBTL 3AAZB 1UZ6F 2VZVA 2J8UE 3OKDA 4IRZH 5IIEA 3LN4A 3VGFA 2IFFH 4CADB 3MLVH 3EYVB 2FZ3B 4KWUA 4TUJA 2W9LA 4Z7VE 4PV8A 4U1LA 3VH8G 3VXPA 5HVHC 1UH3A 3DHMA 3L7FB 5FUZL 2DQTH 1LP9F 1IM9A 4JKMA 5C07B 2C4FT 3ZL4H 3LQZA 3EFFB 2GFBA 4JPKH 1CCZA 5ICYB 1TJGL 4O58H 4D9RE 3CX5K 2V7NA 1JMZA 4HUXB 1K8DA 3IAPA 2Y7QA 5JW4N 4YXLH 3FO2B 3GMQB 4PJ5D 4AENB 4JGUA 4PB9H 1P6AB 3AU1A 1BJ8A 4OCMC 4PJDA 5IF0B 1DBKL 2XWTA 4L4VA 1FO0B 2JB6B 1Z3GL 1KFAL 1MWAB 5EU6A 3N85H 5M94B 1HNFA 4FQ2H 1OGTA 1F00I 1YMME 2BJMH 4IRJC 5IKCB 4M9OA 4ZOEA 5T3ZD 4P2OB 1U8KA 3W0WE 3CLEH 5LQBH 5F8RC 4ZDHB 1CQYA 3NAAL 3GMNA 2XZAH 4JO4H 4R7NA 3O9WA 1RJLB 4U3HA 2IADB 1TQCC 4LF3B 3QT2A 2F5AL 3X11A 4ORGA 1J0IA 3P40A 2FGWH 3ALWA 1NANI 4Z9KB 3KWWA 2VL5B 5EO0B 1MCDA 2NZIA 3WFDH 1KEGH 1IEBA 5E03A 3ZL4L 1QSFA 1I1YB 4JG1H 2Y25A 3C5ZB 4WO4C 5F72S 2R1WB 2QSCH 5INDA 4Y89A 3MO1B 2R2BB 4JRXD 3I75B 1KIRB 1CFTB 1TJIH 4YAQB 2AJYL 2VZTA 1NBQA 3HPJB 2D03H 1H5BC 3PGDB 2EXYC 1RHHB 2RQ8A 4APQB 2AEQL 5L9DH 4XNMB 3LKPA 1FSKB 5DK0B 4HFUH 3BZFB 4M5YH 4OLUH 2IG2H 1FFNB 4KKCD 5JO5B 4HHAB 2XZCL 1TZIB 1IGCL 4JFYB 5IEHA 1AQDB 4LDLB 5GIRB 1IGTB 4NT6A 2XTJD 1F11A 3TJHD 2PTVA 3MV9B 4TVPD 2A6DB 5E6ZA 1X5KA 3VMNA 1IAOB 4ONHA 4YFEA 2ZP0T 1OF2A 2FWOA 3RWHA 1FFNA 4JKPH 2Y5TB 5HHPA 1L6XA 1PLGH 4B7LA 3V5HB 1U8QB 1BQLH 1UKQA 4BM7A 4PRHB 1G7IB 1YEHH 4HULB 4I2XB 2ORBL 3S4SG 1JGEA 3TVMA 1CD9B 1JPFA 5TQ0H 2EIBA 3SQOH 4PJ5A 4Z7WF 1PQZB 2V5YA 3QEQE 2NNAB 4YFLF 3W0WD 1BPVA 2X4SB 3S3SA 3O9WC 4PJCF 1AGEB 4EBQH 1IQWL 2EDQA 3SPVB 4WTXA 2X4OA 1FE8L 1U91B 3HI1B 5TQ2H 5CIPA 4JM2F 5BS0D 4MNQA 5FDWA 2V7NB 3TA3A 2RHEA 4WTZG 2KUTA 5L2KB 5MENE 1TTUA 1IC7L 4IM8A 2MOVA 3WXWL 2ESVA 1U6AH 2CIKA 4XCNA 3MXWL 2FCBA 3HZVA 1W0VA 3IF1A 2NTFA 4O2CB 2VN7A 5D7IA 3V6OA 5KVDL 4OCXH 4FZEH 5EU6B 5LJYH 4N1EA 3DGGB 3FQTA 2CUMA 2XTJB 3SY0A 4NP4L 1MELA 4UDUB 1JUFA 2OR9L 5ISZB 4NBZB 4XGZA 3T0VA 1DSFL 1Y6KR 3S3PA 2EYTB 1GPOH 3HHRB 5IUSA 1F5WA 3UC0H 3GNMH 2BHUA 2HAZA 3VXSA 5F3BA 4FFZH 4Y2DA 2ZSWB 2CR3A 4P5KA 3H7LA 3MBEC 2KQMA 5DUPL 3QRGH 1VGEH 5MEQB 1BF8A 5DEFB 5GGRY 1U8PB 3CUPB 4N5ED 4WHTA 1VFAA 3C9NA 1E4JA 3NTCH 4FQ1H 3H9SD 4PJIF 1QFPA 2A74B 4KRLB 1RJCA 4FABH 2V17H 3UTSE 3VXSB 5F3BB 3ULUF 2F8OA 2NY4D 1J1OH 3AB0C 2X5PA 4RFOL 5INCB 1A0QH 5GJTL 1OAUH 5A2LH 3L6FB 4M8VA 4UILH 2VLLA 5CBEB 1FL6B 5DD5H 1IC7H 3L7EA 4N1HB 1L0YA 4HUUB 1KPUA 3RGVA 4X83A 4NQXB 5EBMB 3WNKA 1FFRA 3QIUD 2ICCA 4UQ3B 1RV6X 5C0AB 5JO5A 3BVNA 3AMKA 1YEFL 1CLOL 2G75B 4JFFB 4LAJH 3BDYL 3VH8B 1VKXB 3B2UC 3LQAC 4LRNL 4LEOA 5AZ2L 1IBGH 4M6MH 1KPUB 4RBPK 4WI2A 1KN4H 3BGFB 5F1NB 1JPSL 2P5WD 2BOCA 4JLRA 2D7TH 1P4LB 5DZOA 1HSAB 3MNZB 2PCPA 2DD8H 4PJIA 2YPLB 5HGDB 1Q9KB 5FM5O 4QCIB 2N56A 1CU4L 2IGFH 5E5MA 3VD9A 4ODUA 3GJEB 4UMGA 2XG4A 4X5WA 4R0LC 4EOWL 2WINB 4JCMA 4TRPH 4FMFA 3T8XB 2OL3A 4F7TA 5C07D 3EFDH 3D3VD 2P47B 4RFOH 3IDJA 4QYOA 5FYLH 4MXWH 3VXRA 3DSFH 1AD9A 2OP4H 3GJFB 3L3DB 3PP4H 4M5ZL 5K9JH 3TM6A 1AGEA 3ZTJG 4XHJC 4Y4FB 5SV4A 2VLRA 4HWBA 1EO8L 1A3LH 2GK0A 4KHTH 5TE7L 5IB5B 3BD3A 1EMTL 2ATKB 4RNRA 4IOSD 4D0BA 4OM1L 1FIEA 3QUZA 2EKSB 2H2PC 1HH9A 4JR9H 3QIUB 1MWAL 3LCYA 5EU4A 1LO4L 4RCAA 3DV6B 2VABB 2XTJE 1I8KB 2NR6C 3O4LD 3OAUL 4XPFH 5DURB 4HKBA 4MCZB 1IAIM 1SJHB 3PDOB 3P30H 5CILH 5I15H 2GK0B 5M95B 1JBJA 1MFCL 4TTGA 5AZ2H 5C70A 5C0CB 1QRNE 1BJ1H 1NMCB 2UZXB 3CMOL 4MNGA 1KN4L 3S5LG 2K1MA 2Q87A 1DANU 3I75A 2DQFB 3EGSA 3QUMB 4LHJB 3DV6A 3VCLB 4RMUA 4WI4A 1QSVA 1QFUL 4JM2C 1EK3A 3RKDC 2J2ZA 4LSUL 2OI9A 5GXBB 1WF5A 2VWEC 1ZT4B 3OQ3B 1NDMA 5HYQA 5K9OA 2YS4A 3FQXA 1N5YL 2NY7H 3GBNL 5ETUA 5TFSL 3UBXB 1G1CA 4YK4C 1R6VA 1L7IH 4WWKD 3UTPE 3SDDB 3H3KA 4JRXB 3L1OH 3ZDYF 2X1XR 2XZQH 4DKEH 5C0NC 1YQ2A 1UEMA 1IKNA 4WCYH 1EMTH 3SGKC 1LWRA 4U1LB 3ARDC 4WUUE 4ZS6D 2J6EL 1N8ZB 2F8XC 4DN4L 3V4PL 1IE5A 4NQCD 1KCLA 5DI8A 1JPGB 5KS9F 4TVPH 3RL2B 1YY9D 2GJZB 1Q94B 4PJGF 5GS0L 4U7KA 43C9B 2VXQH 5T1DL 3RPIB 3MA9L 2QSQA 2DOCA 5DURD 2J8HA 3CIQA 1MREL 3CMGA 3FQNA 4X6CE 2FHCA 4JHWL 4Y5XC 1K6QH 3SGDH 4YEFA 1YN7B 3ORJA 4LEXL 1U3YA 3MJ8B 4MCYA 1QBLL 3QUZC 4NBXB 4JJ5A 2AEWA 4RZCA 4OIBA 3OKOA 2B5IC 4HK3N 5D7KE 4PRDB 2NXYC 2LVCA 2R4SL 1CL7L 3LRSB 3IDMB 4ZUSB 4ZFGL 1MJUL 4KKAD 4KK8C 4D9QD 3LOWA 1TLKA 3G5YB 2DTSA 5I1AA 1BM3H 5E5MB 1H8SA 1N26A 5DLMH 4F9PA 2CK0L 3FOMB 3HFMH 3RA7L 2XQBL 1XCQB 3F65A 5D5ME 5FA4A 4DW2H 4LSQH 3EJZD 3RAJH 3T8XA 3T65A 3MLRH 4XI5C 3MLXL 3VFVB 5TF1L 1QYGL 3OR7A 2AJ3A 3KNBA 4M9PA 3GSXA 3TZVA 3QZWB 4YC2B 2R69H 1N4XH 2AGJH 1CE6B 5E2UL 2VO5A 2VXQL 5T1DH 3FTGB 4OCSH 3CJJA 2FJGA 1OT2A 1CQKA 2NY6D 5JW5B 2EIDA 2JK5A 5HYEA 3JV4B 4FZ8H 4WW2F 2F54D 1TZHB 2ADJB 4TPRH 4WUKL 4MNQE 4F7PA 1EXUA 4XCEB 4OTXL 2FHFA 5IWLA 1S78C 3CC5B 1MCQA 1CE1H 2Z31C 1AHWB 4ZD3H 3C2AL 2EDBA 3TA3D 2V5SA 1UXSB 5DJYA 3CZFA 2JJSC 2ZCKL 2EECA 5EBLA 5D5MB 2C5DC 1VCAA 1T03L 4D9LL 1TVBB 1QKZH 3RAJL 2W0FA 3MLRL 5EC2B 2FBJL 1NFKA 4UQ2A 1QQDB 4JDVB 5B38G 5GISL 3RDTB 1JHTB 1C12B 3ARYA 3WCYA 3ZKXC 3NFPA 1RK1A 1YYMH 3I6GB 5IM7A 4JHBA 3SE8H 4YHLH 3E3QE 1A6ZB 1V7MH 3HMWL 3H9YA 1RQ5A 3WDIA 3ARBC 1A3RL 4HJGB 1YJDL 4MA7L 3P9MA 3O81A 5IVOA 1RUPL 3VRLE 1DBBH 1V8HA 5GS2H 4LAQL 2Z31B 1ODAA 4EDXA 5GGTL 4KRNA 4RFEA 3PWUA 1J5OL 5D6CB 4R2GD 3WUWB 3RIFF 1MVUA 1UJ3B 5KSVB 3C09C 4AM0A 5DJXA 2O5XH 2AW2A 2H9GA 1I9EA 5D1XD 1KIQB 4OGYL 1FVCB 1C5CL 2BCKB 3WS6C 3B3IB 3ES6B 3N9GH 1F4YL 5HHXH 3RBSA 5IVXF 2W1NA 3T4AB 5IT2H 3T1FB 4FP8L 2EO9A 1CXEA 1ZLSH 4UUJB 3K46A 4ODSL 4LLWA 3ZT5A 1QLRA 1T03H 1UT9A 4X6CA 3UTTB 2ZKHL 3DLQR 4KZDH 3S34L 1BBJA 1JZ5A 3I9GH 4WI6A 5LGHH 1E27A 1KB5L 1OAZH 2ATPA 4FQIH 4U6TA 4HV8B 4U0RB 5FKPB 3BJLA 1CBVL 4S10A 1MFBL 3GMLB 1YJDH 1FG2B 2QQNH 3HE6B 4K94C 3IGAA 3SGEI 3FL7A 1VA9A 5CAYB 3VXOB 3DXAD 4U1HB 1J10A 2VDKH 1FBIL 3NCJH 3L7FA 2YPKA 2WIIA 2GITB 1EO7A 2YMXL 4OD1L 4LSTH 5E4IA 3DETC 4C56B 5HHOB 1QSED 3VRIB 4Z7QE 2CMRH 3MJGX 4YX2H 4F7PB 1LNUA 3BO8B 1RMFL 3UBXG 2XN9E 2XRAH 2YSSB 1BOGA 4LLDB 4HF5L 2AJZA 4ZUUA 4ALAH 5C2UB 4EI5C 1KPVA 1U0QA 3VGBA 1Y0LB 2XKSA 3AY4C 2LTQB 2BSTB 1T5XB 4RMWA 3WSQL 4NKOA 1FC1A 5E8EA 4LCCB 3CFDB 5EN2A 3GHEL 3QFDB 2XICA 1ZLUH 3FFDA 1DJSA 1H5BA 2WMPA 1Z9OA 2IAMA 4RRPA 1KTLA 1KTRL 1HKFA 3PQYA 4LKCB 4BKLA 1XIWB 3VXNA 4IDJH 2A0LD 1IM9D 5I16A 3ESVF 5EC2A 4HMDA 1PEZA 3MRGB 1KACB 1ORQA 4NKOB 1JZ7A 2AK1L 2VXTL 1TFHA 1NCDH 4ZO6A 5E6IC 2WNGA 2DIBA 5JW4M 2LU4A 3GIZH 3ARFC 5EIIA 1CT8B 35C8H 2BHYA 1X7QA 3FB8B 4XMPH 1A9BA 4XP6L 1PZUB 4OB5L 4Z95H 1DQDL 5E8DL 1QLFA 5EC1B 4NDMB 1U8MA 1BF2A 2JIXD 2DI9A 3DUHA 1QOKA 4HJJH 1FYHB 1NGXB 5IF0A 3KYKL 4PLOB 2LTQC 3DURB 3QEHA 3FOMA 2PYEB 4X6FA 3BKYH 1G9NC 3VG9C 5C0BE 1M6OA 4HGKC 2EDEA 1X4YA 4M48H 5DK2A 3BDXA 3TVMC 3DO3A 3NACL 3TIEA 1MQ8A 3GIVA 4PTUA 3C5JA 1X6NA 5MEPA 1AXSA 2D4FA 4RFNB 5KN5A 3EO1B 1KENH 3PJSA 3ROLB 5I1CH 2V2TA 5B4MD 3I50H 4M8QA 3LKRA 3QJFB 3PABB 3M07A 3BIKB 3CCHA 1FFQA 2LE9A 4RWYL 3ARFB 3SKOA 2AJSH 4V1DB 4WFFE 2DLTA 2RBLA 3GMPA 5E8PB 1BVKA 3TFKC 3HAEH 5EU3A 4M4RA 1EAPB 1JP5A 3LKRB 1EJ6A 1V3KA 3OG4B 1FL3A 3OKMB 5K9OB 3H3PH 2ARJA 4MJIE 2B8OT 3AM8A 4KK6D 3SKMA 1JRHL 2P46B 1ZHNA 1MAKA 3TVMB 3EYSH 1Z3GH 4M93C 3I02A 4HX1A 2VDNH 4HGWB 3GSOA 4HC1A 3RHWF 3UDWC 2HFFB 3VXMA 3KR3H 4LKXB 4EN3A 4MS8A 1U9KA 5KSAC 1MCJA 3L5WA 3EYUL 1ADQA 1GAFH 2XY2A 5DVOA 4CRPA 3SDXB 5MEND 1EUTA 4LSSH 2P4AB 3C6LB 3T3MF 1HHKA 2PW1A 4M7JH 3VFMB 1PVHA 3MZTA 4X9FA 1YYLH 2XZAL 1RY7B 1A7QL 1LO3L 4JB9H 4LSPL 1JVKA 5TDNB 5L0QC 3N50A 3I50L 3IDUA 3H9SE 4Y4HB 4FTVA 4JM4H 5D72L 3U46A 1CFVL 4FQHA 4Z77B 2NTFB 3PWPE 3TCLA 2IPTL 4FNLH 5E8EB 2W91A 4JJ5B 3RU8L 3EDJA 5BVJB 1FP5A 1T89A 2HMID 3KLDA 1T1ZA 1HYRC 3FONB 3WXVH 2DQDH 4WEBH 1T2QH 2QKIA 1A14H 1T6VN 1DN0A 3IFNL 4MD5A 3H3PL 5IHLB 4L4VB 1DQLH 2V5TA 4Z78A 5KSAB 1SY6A 4DGIH 4NM4H 4ELMF 2AEQH 4PJ7F 3PP3H 1OD9A 1J12A 1PG7X 5SWZB 3NFNA 4D8PB 4YDJA 5DYOA 5A2JH 3LB6C 1JYXA 4J1UB 5C3TA 3HI5L 2I26N 2NX5A 5EOQH 2LAGB 3IU4H 3TT1H 3GSUA 5C0FA 3OXSB 4OZGE 4ELKB 2FO4A 4LQFH 3O9WB 1K5NB 5A2IH 2NYYD 3X17A 1RI8A 3ILPA 2A0LC 3R8BB 2DRUA 2W9DL 3B9AA 4LSPH 1NJ9A 5SX4I 3WKNA 1A64A 4JGMA 5BJTB 3UAJD 2PXYA 2ENYA 5AAWA 5B22A 4YGVA 4M7LL 5FF6A 1GC1C 4QRTB 2ZOKA 3L5XL 1AP2B 3HNVL 2WIIB 1KJMA 4KDVA 1WEJL 5FUCE 4CMMA 1EERB 5DD6B 1Q9OA 3WN5C 2IQAB 1BZ7A 3MRLB 1UM6L 3QUMH 2HT3C 4JDZA 1P4LA 5L88L 1MHEA 2A9ML 1NAMA 3WHE1 3IXAB 1NCUA 2GT9B 3U30C 3D25B 2CUHA 2FEEL 2VDOH 3MXWH 5F44A 1II4E 1KLFA 3DX7A 5C0CD 1WUNT 1B3JA 5F6HI 5A43C 3RGVB 4WV1B 5GSRB 5ICYA 5KVDH 4OLWH 3INUH 1KIUA 3QXDA 5GRXG 4HX1B 2XOTA 2Y7QB 1S5IL 4LKCA 4O9HH 4PRHE 1NGPL 3BP4A 3C6SA 4Y5YA 2G5BA 4O4YH 4Y5VB 5D1QD 1UA6H 1FZKA 2OR9H 3UJTL 1UCBL 4JFFA 3OHXA 5F7HA 2HFGH 5GPRA 3S7GA 2PO6B 4WHCA 3MOAL 1OP5H 3B9VA 4MLSA 3BI9X 3V5DA 4YHOL 3A0OA 3OJ2C 5E8NA 4HCRA 3B83A 1MLBB 1QBBA 3WEXA 3MJ7B 3BZEA 4WFGE 1FZKB 2YHGA 3MCLL 4GT7A 1QHOA 3HNTH 2HJFB 4FOMA 4GKNA 4HAFA 4YDLB 3P0VL 5HVFB 5CIPB 5DQDH 4W6YB 4NHUA 3T0BA 5BCAA 5L88H 3EYFA 5DDHA 1LO5B 3BP5B 3F7PC 3LN5A 4HIHA 3VCLA 3A6CH 2HN7A 5IROA 3V5KA 5F97E 1CS6A 3MLVL 3RWIB 3VWJA 4PJGE 5D7IB 4K3EL 4PD4K 3O2WH 1OGAB 2XKNA 4N9GB 1ROWA 4HG4J 5L2JA 3FQTB 4L9LA 4OLWL 1T21B 3O6LL 1MSPA 4IRSB 2R0LL 4EZMA 3VXUB 3V7AG 1YPZB 4AIXA 4XGZB 4ZTOL 4ZNCD 2YEZB 3UJTH 2VOTA 1WFUA 2GKIA 4JQVC 2K7PA 5GRZA 4XBGA 1ZT7A 2VL4A 4MDJB 3UTTD 1AQDA 5E95B 5H8DA 1AFVL 4D0CA 1NKOA 4GLRI 4MQXC 4YR6A 3EYOB 3D0VB 3DRTB 2IEPA 3OX8B 1P2CA 5GQBA 2OI9B 1IVLA 1M05A 2NTSP 3BPLC 3CSYA 1WCBB 4AQOA 3MGOA 5I9QB 2PR4H 1GGIL 4FFYH 1MCWM 5J1AA 1HILB 3UZQA 5EU7E 1MJJB 3IXTA 2XXMB 3DVIA 1HHIB 1T1YA 3ZT6A 4G6FD 4JRXA 4JRWA 3RJDA 4UAOB 3PWVB 3VI3E 1PBYA 1QRNB 3DO7A 2C1PB 4Y4HA 4JR9L 1PYWB 3O6LH 3ZE0F 4BH8A 2YPLE 3M1BA 5IB1B 1U8LA 1OW0C 1ETZB 3GGWA 1G6VK 4ORZC 4PJDB 4GKZB 1BD2D 5EUOA 4XPFL 2R29L 2P48B 1PY4A 1N64L 4NWUL 4WWID 3O0RL 2IMNA 5TJWK 1UQSA 2VAAB 5CFHA 4OZIB 5GGRB 1IGFH 4ENED 1JZ3A 3VWJC 5AUMB 3SDDC 2E6PA 2VR4A 3CSBA 3KJ6H 4L4TB 4XWGH 2FJHB 4NRYA 3KPLA 4R7NB 1IZKA 1NDGB 4RZCB 1CFQA 2Y23A 4Q9RH 2VISB 2CKBH 1G7QB 4I5BA 2VQUA 3PUCA 4WI9A 1HQ4A 5DJ2B 1AD9B 5EZJB 5E00A 3TF7A 4G43B 2ADJA 2FR4A 5EH1A 4YO0A 4YDVB 1K3ZA 1CLYL 3CH1B 4NUJB 4Z8FL 3D87B 4X98A 3U6RA 3O6FB 4PJGB 2EKJA 4NSKB 1NEZG 2F8VA 4NZUH 1HK6A 3IFOB 1RZ7H 2Q6WA 2CDGB 2Z31D 3TV3H 3WO3B 5HYIA 3D3VA 1AGBB 1EAJA 3CZFB 3SEPA 3MRNB 3FB7A 2AK4B 1N64H 4FTVD 4MYWB 5D7LB 1CIDA 4XPTH 1OAXH 4GXVL 2KH2B 1NFDB 1LK3H 5SWQA 3BT2L 4HIXH 2CRIA 5HI5C 3NABL 5BS0B 4XZUA 4NGHL 2DQCH 5HI5D 3P0YH 3SN6N 4JFDD 5JW4R 4QXTA 3E8UH 2CIIB 4MD0A 1OP3K 4LCWA 1JF5A 4HMCA 2ZPKH 3CC5A 3QIWC 2OR7A 1PX4A 4AEIH 4XNUH 5HDOA 2L7UA 4UDTA 2VLKE 4PTTA 5HGGS 4QHMB 1ZV5A 3G6AA 1AGDB 1CLYH 3EJJX 4HWBL 5J8OA 2JJTC 2F54E 1JTTA 4LCWB 2ITDA 4KY1L 1GPOL 4NZTH 1K2DA 3UC0L 3AGVA 1QEWB 4XTRD 1U91A 1T3FA 4A6YA 1F4WH 5BVJA 1KBGL 1S9XA 3ULUH 5F21B 2FZ3A 1UADC 4FQCH 1QSEB 5F96H 3PXJA 4QYOB 3BEWA 5IB4A 4X4YB 1QR4A 3V6FA 4RMQA 5HHNB 3QUXA 3WNOA 3OKOB 5HPOA 3IS1X 4Z76B 1FNSH 4HFUL 4M5YL 3NMEA 4OTXH 4U3CA 4X7SL 1HOCA 2NXYD 4X6CF 2VLMD 5ISZA 5KOVC 3WKML 4FQLH 2XZCH 3Q5OA 3TC9A 4C56D 2DM2A 1NPUA 5T3XD 4S1RL 4GW5B 4BFIA 2E9JA 1SYSA 2EE6A 1NL0H 2IANE 2MPAL 2OQJA 4HC1H 4CN4A 3H8NA 2RAMA 1F3RB 5ERWA 1AI1L 3G9VA 5E6IA 3B3IA 1INEH 1YEFH 2YPKB 1FLTX 1CZ8H 4XP1H 3C5SA 4V3DB 1A7RH 1R5IB 4XMLH 3O2DL 3TBTA 1C5DB 3RVUC 4B50A 5CS7A 3W0WB 1U3HC 4PY7B 2NX5E 3OKDB 5IIEB 1KLGA 2KPNA 2P5WB 4F7MA 5FECB 5GISH 2P8MA 1OSZA 3LKOA 3VD5A 1C08A 4NUGL 2DQGH 4KRPB 3MUJA 3ZTNH 3BHBA 1I7TB 4HJ0C 1T7ZA 3LQAH 1VDGA 1WTLA 3P3YA 5K9QG 3MUGA 1B90A 5HYJB 1T7YA 4HKJA 2YBRB 1BQSA 4G42A 4S0TD 1HXMA 5GJSL 3ZTJH 4F15B 4GRWF 43CAB 3DIFA 5IV2A 4LDOB 1VACA 1FNFA 3WXWH 4JN1H 5SWQB 3KPQB 5TE7H 4ZO8A 1YECL 4P59L 4WFGD 4RISL 3REVA 1ZS8A 4PG9B 1M4KA 4YXKL 1AXIB 1C5CH 4TQEL 5EBLB 1KCRL 5EPMA 1OSPH 5C9JA 5JXED 1FGNH 1QP1A 1F4YH 5HHXL 2C1PA 2R2HB 5DHVB 2NYYC 3BJ91 2OJEB 1U58B 1C7TA 1A7RL 3SKJH 1FNGB 3HA0A 1L8JA 5CWSA 1BJMA 3A67H 4QTHB 5DMJB 1HYSC 5BQ7B 1ZHLB 1CVRA 3S34H 3JWOL 5DO2C 3VJ6B 4PLKC 4GRWE 4PG2C 3GSWB 5IP4A 4JAMA 2C4XA 2ID5A 1PJ9A 5EORL 3V6OC 2YUXA 2R2HA 5DHVA 1W2KT 2A6IB 3KPMB 4ODXB 4J4PD 5KJRL 1PGRB 1FNGA 3B9KD 2ZUUA 2BSSA 1S9VA 1U8IB 2QQNL 3ZKQD 3VFTA 5IEKA 1GOFA 1U92A 4FABL 4LCCC 2HG5A 2VDKL 2GTWA 2ADFH 2YPVH 4YDKL 1P84K 4LU5L 1B88A 3QAZC 4Y2DC 1IGYB 2EDXA 1RHHA 4LSTL 4MD4B 2Z93B 4DKEL 4Y5XA 5A16B 3O3DB 1YECH 4P59H 5MEQA 3CXDL 4YXKH 2I25N 1ZVHA 1JGVH 1T89C 1ZANL 2OS7A 4L3EE 4JFEB 2NY2D 4WHYH 2C4FU 1NEZB 5GS0H 1DQTA 5DJAA 5FFLA 3VXQB 1OCWH 5I2IA 2B20A 1KGCD 4KZEL 1I8LC 1MCPL 4PJBA 4PRAB 4PGZA 2P1YA 4GMTL 2YRZA 5KSAD 5J7CC 5LCVL 5CKGA 3BESR 2E7LC 2V2XA 4AJ0A 3I6KA 1TETL 3OKKA 5I1IL 2J1KA 1KJ3L 1HNGA 1GSMA 4KMTH 1WT5A 3QO0A 5EO9B 3ULVL 2JTDA 3RNQB 3LHPH 4ELME 4Y2DB 3VXME 3GJFK 2R4SH 1YMMA 4I48A 4UQ3A 4Z7UA 5KVFH 4GUPA 1WZKA 1LE5A 4IS6A 4TRPL 4XMPL 1J87A 5E1AB 1HINH 1U8PA 4WHTB 2ADFL 4FMKA 4F8QA 3MUGB 3QCTH 4WO4B 3SPVA 4P0DA 5ANMA 2QQLH 3BUYB 1RU9L 3GBML 4Q9QH 4PG2A 1Y18A 2BOCB 4JLRB 4HUWA 4LFHD 4OGAC 3WFHA 3VXSE 3FT4B 4CN6A 5DQ9B 3D6GA 4K7FA 3W39B 4IS6B 4BH8B 3O41A 5DEZA 5B39G 2H8PB 4NQVA 3R06B 5C07A 4LCCA 3EIFA 4CN1A 2P8PB 5E1HB 1ADQL 4LHUG 5CBAB 5ADOH 2O5YL 1N4XL 4I9WE 3SDAA 3BD4A 2Z31A 1FYTD 3V8OA 1QNZL 2B4CH 3WFEH 4OCSL 3PHOB 2ZG3A 4M62H 2CKBA 4M93B 1CGSL 2OJZL 9CGTA 4F57H 3GSNH 4JZOA 3X14B 4LEOB 3WL9A 2DQHH 2KBGA 3P73A 1KCKA 2YD8A 4PJ7B 1G7LB 1SYVB 3VRJB 3UO1H 3VJ6A 2DKMA 1S7SA 3C6LC 4LPCA 1G7QA 4I4WA 1MAMH 1E4XL 3ARQA 5IMKB 3JTSA 1CXFA 1I8LA 4Y2DD 5JHDD 3QXVA 3MLTB 2ICES 3H3BC 2AK4E 4N9OB 4UV4H 3STZA 5GRUH 2XV6B 4NJ9H 3RUGA 1U8IA 3HC0A 3JXAA 4XP4L 5D71H 4OLZH 5JPNA 2CDEA 4S1DC 3FN3A 2UWEE 2VLLB 1NUGA 1JF1A 3P4OA 4WCYL 2CDGA 2VXVH 1N0LA 2HFEB 1IAKA 2J4WL 3V4PH 4KTEL 3VGDA 3SDCA 3NIGE 4M7JL 5FM4A 3WFBH 3O8XC 2D7OA 5D7LA 1DQQA 2B4CL 4QHNA 5F89B 3K3QA 5DZNA 1A3RH 2GITA 1CFTA 1P5UA 2VDRH 1CGVA 1SJEB 4MJIB 4IMKA 4YWGH 1O7SA 4MAYD 3I3DA 3TJHC 4M6OL 1Q9WB 5FYKE 5JXEC 5GGTH 5HHQB 1OTTC 4L8SA 1ZSDA 3T0XA 2HJKB 2ADIA 3U7YH 5LG1A 2EXWC 4QWWD 4HKXB 4UT7H 1DQMH 2CKNA 3T1WA 5DWUH 1OGAD 2EDNA 4ZFGH 4GW4B 5FAAA 4CMMB 1JCKA 4PREA 3ZLQC 2DTML 1KXTB 3LH2L 4HFWB 4NWTL 3IJYB 5IT2L 3ISWA 4OLYL 2X4UA 5J89A 2AJXH 2EYRB 4NC0B 3E6HB 5AYUH 1YNTA 5C0IB 4HKXA 3QH3A 1U8QA 2YUZA 2H2SD 5FA3A 4KZDL 4HWEL 3GJFH 5ETUB 2PW1B 3NCYP 1S78D 2IJ0C 3QDJD 3HZKB 2UY6A 3VXRD 1MOEA 4XX1E 2CH8A 1FIGL 4PJXF 3TBYB 1NBVH 2JJWA 2VXSL 5HI3D 4EKXA 2C3VA 1ZOXA 1XF5A 1UWEH 4FQHB 3EOYG 1B2WL 1QZ1A 4UB0L 5EO1B 4X4XB 4YWGL 1A02N 2ICWI 5DMIH 1EVTC 3HNSL 3S98A 2O61A 4X7EC 3MQIA 4KDWA 3IAQA 2IH3B 4U4BA 2P45B 1W72L 4MXVE 2D31B 5MEOB 2UYLB 4YQXL 3K74B 5F71A 4G9FB 3TZVB 2CJUH 1WLHA 4TSBH 3AUVA 3EO1A 4Z7UE 5D8JL 1OW0A 5EO1A 1KCGC 2Q76A 4YHKH 3QUML 3RZCB 1MFEH 1XAUA 3AS1A 2YA2A 1Q1JH 5F8QC 2A9MH 1XT5A 5D96B 3WIFB 2JK5B 1WZ1H 4E5XB 3BP5A 4D9LH 2BXYA 5J11C 4O2EB 5T3XH 5TDOA 1EGJH 2XWJA 2WUCL 1HHGA 4M6NL 3MCKA 1WIOA 2NW2A 3HC0B 1FNEB 1ES0A 4IDJL 4LLYB 3IETB 1LK2A 1JGUL 4YDLC 4NNPH 2D2OA 4CGTA 3VFVA 2XPGA 5FGRA 1NCDL 1KB9J 1A6VL 4Y8AA 4NRZA 3C8HA 3BP6A 1F3JA 5D2LE 4HKJB 3QO0B 1OD7A 1B2WH 4MAUH 4NKIH 4Q9BA 4CADA 1QACA 4YPJA 3HG1E 1HWHB 4K2UH 1YUHA 2BSED 2AV7B 5J13B 2BHZA 3CSPA 4JDTL 3PNWB 4KDTC 4MJ6B 3TPUB 4PP1D 2YK1L 4Q74A 5JDSB 1DQJB 3BSZH 4NNXB 2VDPL 4OGXH 4ZYKB 1IM9B 5FCSH 5ADPH 5I66B 4MCYB 2HP4A 3HPLB 4FQXC 4R3SB 1OVZA 5DJ6B 1WICA 2FH8A 4IRSC 4ZODA 3F5WA 5CEYA 3RWFA 4LIQL 2LFGA 5J11B 3IDYC 3EOTL 2NY6C 4P3CL 4OLEA 3TYGL 5D70L 3FO2A 1MFEL 3QG7H 1WCBA 2E7BA 3U46B 1Z9SA 3TO4C 3D25A 5C0AD 3OXRA 1FO0A 1Q0YL 1XCQA 2NQCA 3H9SA 3ZMRA 5EUKB 3L5JA 4Y16C 1PKQA 4TNVF 3CFCL 4BZ2L 5I1KH 4Y4HD 3BKCH 1UACH 3MODH 2ICWJ 2AKRB 2H32A 5ID1A 2A6KA 4ZMAT 4OZFG 3U0TB 4NN6C 3PGFH 2VMFA 1CBVH 5IVXB 2F74B 3TT3L 5FKAB 1EFQA 1EV2E 1IC1A 3MUHL 3OL2A 4X5LA 5DGQA 1LILA 4UNTA 4H0GA 4HZAA 3QA3A 2D9QB 3V5DB 1CD1B 4JCLA 4OZIA 2X10A 3DNKA 2EE9A 1TNMA 1U8NA 1MHCA 3MV9D 3Q6GH 5ANME 3GKZA 5KS9A 5EO0A 1TXKA 3CVIH 3G5YA 3NCYS 2YMXH 5IJVB 2JJTA 1BBJB 2VRAA 4PLKD 4X4XA 4U33A 3EHBD 1BD2A 3MLYL 3E0GA 1DVFC 1CR9L 3KR3L 4ZFOB 4PJFE 3BPNB 2Y6SC 2NY0D 4LOUD 3QUZB 4RAHA 2B5IB 3OPZH 1F90L 1NJ9B 3N0PB 5EOCL 2BVPA 3QDJE 5CJBA 5L7XH 1QFWL 4Y4FD 2QQKH 3TYFA 3DBXA 3GSXB 4U1IB 4G6MH 1CK0H 4D9QE 2D3VA 1CVSC 4MMZC 5D7SH 2EE2A 1OAQL 3HCVB 5JR1L 3BN9C 1RIHH 5F1IA 3BKCL 2YD7A 3UTQB 4TUKL 4BK5A 1B0RB 4QOKD 1A5FH 1UKTA 4QF1B 2X4NB 3TA3C 3VRLF 4EXKA 5CEXB 4YHZL 4M02A 5MENB 4CNIB 1LEKB 1IAOA 1ZLUK 3U7WL 2I07A 1MHEB 3B9EA 1AD0A 4NWUH 2DM7A 2ZUQB 4XBGB 2DLIA 5E1AA 1ACYH 1S7TA 1P9MA 3CVHA 5FYKU 4UV7L 2WWKO 3O6KH 3CDCA 5ENWA 1X9QA 3HRZB 5KTEH 1T4KB 5I1DB 1CGYA 1O0VA 3QQ3A 1KFAH 3IJYA 4G8GD 5IOPB 2X9YA 3G6DL 3QNYB 4L8BB 2FD6H 3BKYL 1TVBA 5D1ZC 2XXCB 3HR5A 3S5LA 1JTPA 3TWCL 4P49A 1HH6A 3O11A 3VA2C 1R24B 3MBEA 1S7WA 1U93B 1N6UA 2X89A 2AABL 1U8OB 1AHWC 4UIMA 4ZO7A 4KJYA 3QRFM 1JPST 4XI5D 2FB4L 2GY7B 3EO0B 4TULL 1NEUA 3C60B 1F58L 2MCPL 5IOPA 1GZQA 4GRLB 5D7SL 3WS3B 1MQKH 4MQ7B 3FRUB 3MNVB 1KC5H 3OF6A 1MCRA 4TUKH 5GGSY 1J8HE 1S7WB 3BQUA 1I1FA 2R1YA 3SO3B 1U2CA 4UI2A 5DR5H 1DFBH 1MJ8L 3HNVH 2LU7A 5KG9B 1EDQA 4G6JL 5E2TL 3RZWA 4XWOD 1X4ZA 2A6KB 4QRUA 4EDWH 1JHLL 1TJIL 4MA1B 3N1FC 3S36L 2NY1D 5CINH 5DSCA 5FO8A 4HDIB 4LBEB 2R4RL 5KTEL 1CICB 4O02L 4H1LH 3UPCA 1G7PA 3HC3H 4LK4A 5IHUL 2X05A 2DQIL 3S8WA 5ITBH 1I9IH 3O4LB 1U8KB 1JZ2A 2R0WL 1G7JA 5D1ZD 7FABH 3TWCH 3FQWB 5B8CB 2VLME 1N2RB 1I1AA 4RDQF 1P9MC 1RIUL 3AFLA 2LABA 1A7BA 3ARGA 3KPPB 4OQTL 5F7WC 1NFDE 3STBA 1TPXB 4K71C 1EZVX 4PJCE 1QBAA 1F42A 2FEDD 2NY1B 1IARB 2Z8RA 1MQKL 3KXFE 3MOAH 5FK9B 3UDWA 4KI1A 3UPAA 4PJXA 4TNWK 3BKJH 4EN3C 4JFHD 4Z7NF 4OZFA 5ICZA 1T66C 4H88H 4I0CC 1IT9H 1XGQB 1YEDA 4XP9H 3MCLH 2XWTB 4YNYA 3QI9B 4X6DA 5C09D 4XZUB 1JWUB 4HPOH 4WV1A 4EDWL 1XMWA 3OAYH 1IQWH 1PAMA 5EIIB 1I85C 2EEAA 4W4OA 1PQZA 1MRFL 4LLQA 2R4RH 1FNSL 5B8CC 5TPWL 5EC1A 2RCSH 4OV5A 1HHJA 3OHXB 1I9IL 4XPGL 5FA3B 4MHHG 1EHXA 4XB7A 2XTJC 4FQLL 1LP9B 4JY6B 2R0WH 4HCRH 1IAII 4HIJB 4IIQB 5L6YH 2ZCLH 3Q48A 2QBWA 4BZYA 4NRXB 2MPAH 1UENA 3VG0L 2R0LH 3JV6B 1RUML 1XGRB 4RGMB 1OF2B 3NFSL 4MB4A 2PW2A 4G6KH 1QFWM 3SJVD 5E9DE 2EXYD 3BZEB 3IKKA 2W9DH 3DTXB 3O2DH 4G6FB 4OJFH 2J8UF 3VXUE 4F15C 5ITFB 1ORQB 5BRZE 1DSFH 3BEVA 4QRSA 1RK0A 5HTSA 4HKZA 4PGDB 3MBED 4JREB 5ID0A 2O61B 3MREA 3K8KA 4DOHB 2E7MA 4WFEE 2LAAA 2NY0C 4LOUC 5DD1L 1JIBA 2PETA 4GRLA 1VGEL 4X6EA 3WHXB 5DT1L 4LLAA 1BLNB 2EC9T 1U8MB 3V0WH 1KTDA 2F53E 3BOVA 1NLBH 3ECBA 3G5ZB 4P57B 4U1MA 2JCCE 1VPOH 3DARA 1Q0XH 1QSFE 3CUPA 5GJSH 1ZEAL 1G84A 5GIRA 5I0DA 5GJTH 3H0TB 4FFYL 4E5XA 3RL1B 1AY1L 3C08H 4J3TA 3F58H 1TCMA 4G80A 4XH2B 1JL8A 4PJ9D 4Y4KB 4B5EA 5A16A 4WW2B 3ZE2F 1CXIA 4YDJB 1KIRA 2EDLA 4F33A 2EC8A 4CVXB 3C87A 3GMLA 1YEGH 1YQVH 3DRTA 5E2VH 1D5XA 1QO3A 3OB0H 3SGJA 5HGAB 5D1QA 3MGTB 3P9LA 2ZCHH 1NGWB 1UWGL 3TJEH 3CSYB 4BH7B 5GGQL 3DXAB 3LKQA 3D5OF 4JFPB 1XGUB 3ZE0E 5FOBA 3G5XA 1G7MA 4I3SH 3PWPD 4MGXA 4Z7WA 4P4KD 4LNRA 3VXTA 2IF7A 4Q9RL 2W07A 3D39E 3EZJB 5I8OL 1D9KD 2AEPH 2CKBL 2EDRA 4PJIB 1H3PL 4QRTA 4XCCL 3RVWC 3M1BB 1DANT 1HH6B 3SE4A 2DKUA 1R3LA 1FFPB 3OXRB 2JE8A 3QBTB 3L3HB 2OX5A 4ETQB 4AL8L 1I4FA 4IOIA 3F58L 1LDPH 3OB8A 5E4EB 4IMKC 3MR9A 4HUWB 4XP5L 5GGRA 3R1GL 5DYOB 3OV6A 3Q3GB 4JFFE 3DUSA 5H37H 1JGVL 1R3HA 4FRWA 1NBYA 1U58A 3K8MA 1SHMA 1MPAH 4PJFB 5CBAA 4WUUA 1DDHB 2ED8A 4G9DA 2PYEE 1INQB 4N90E 4TTDC 2BZDA 5F1NA 2Y5EA 5BRZB 3T2NH 3VU2A 1FGVL 3CMOH 3C9NB 3BT2H 5T33H 1VFUA 1UWGH 3NZHL 3CFBA 3VFUB 1QA9B 5DRNA 2HN7B 4P46A 5I6XC 4NPYA 4PJ8A 3MUZ1 5E8OA 4K07A 1K3IA 5BV7L 1RIVH 2OSLB 4QRPE 4BFIB 4KMTL 5JHDA 3P4MA 1M71A 4D9RD 3OBAA 4XPAH 1UKSA 1ZA3A 5KVEL 4GRMA 4AIZA 1P6FA 2Z92B 4MB3A 1M6OB 3UCRA 5H94A 1QLEL 4J6RL 3JTSB 3RDTD 32C2A 1KJ2H 2VDQH 5FB8B 1RJYB 5D1QC 3MFFB 4TTDD 5FIEA 4QHUA 4IRJD 5CZVH 1TITA 3RUGB 3CU7A 1VGKA 2FYYB 3L3KA 4E42B 4M8QB 4NQCE 4PB0L 3K81A 3VH8A 3FHQA 3D0VA 1R3JA 2IPUK 5DJCB 2I9TA 4ESKA 1IAKB 4QWWC 4RMRA 5FUZH 2L0DA 5IK3B 2QLVB 4U1GB 4UT6L 4HLJA 4B0MM 4GG6F 2DQEL 4IOFC 1J8KA 3BAEH 2HT3D 2VKXA 3HMXH 3L5IA 3SE4C 3VXSD 3IDXH 4PUBL 5FYKH 2ZOKB 1XGTA 3CSGA 5IGXH 5T33L 3RWEB 2A6JA 2CK2A 2GJZA 2BNQE 1UM5L 1JRHI 4LEXH 3NH7H 3QO1B 1X5JA 4ZTPL 4S2SB 5IBUB 1QBMH 1J8HB 1CL7H 2X70A 1UYWH 2FLBT 1LO2L 3SCMB 3RWEA 1E6JH 4NC1C 3JTTB 4PJIE 4Q9CA 5FHAL 1HN1A 3FN0L 4PRHA 1CGUA 3QR2A 5CUSH 5CP3H 1AQKH 5DC0A 4QHLA 3QPQD 2EC9U 2J5LB 4DW2L 5JUEL 4JAMB 2UYLA 3MLUL 3BN3B 1NC2A 1L0XA 1A7PL 5DHYB 3H9ZA 5F70A 4OBRA 5C0GA 3C6LD 5E24E 4HLZH 3IKCA 3DX8B 1Z5LB 3CU1A 1I4FB 3LPGA 4IOIB 1J0HA 3ZTNL 3NCBB 43C9A 2V6HA 5C9KA 3MV9E 3RUGF 5EUOF 1FL5B 3RY6C 2NY5C 4UUJA 5FCUH 4EN3D 4XPTL 3RY5A 3ULVD 2AS5M 5JORA 3Q1SL 1T20A 4F2MB 2VKWA 4LBEA 4X6BA 2DQCL 4WU5A 4QXGH 4PJ9C 4PRDA 3PG2A 1D5MA 4NO0A 4X99B 2ATPB 4XNQA 3SDAD 4R0LB 2N1KA 4F3FA 3KPRD 1RURL 5E8OB 1Y6NR 3PP3K 4RIRA 4RX4D 4KKAC 5D2NE 1LO2H 3QCVH 2ED7A 4GBXA 4HIEA 5FV2A 4AEIL 2OBGA 5FHAH 4UZGA 1L7TH 3H7BA 3FB7B 3RWGA 1ZVYA 4PGJA 1X4XA 1ZAGA 3NZ8B 2Q76B 2I27N 4NWTH 3U4BH 3ETBF 1ITBB 3KHOA 4PJCA 3SKJL 4BSWA 2VZ3A 4NOFA 4RMTA 5DI8B 5AYUL 1YPZF 1PLGL 1EVUA 2FBJH 5HYSG 1WWCA 5BW7C 2AVGA 4GMSH 1WCQA 4YGVB 1YYML 5F6IC 3SE8L 1EUUA 1QTYT 2W0FB 3I84A 2EEBA 5JOPE 2DL9A 1DVFA 2GTZA 2VXSH 3GUTB 1I7RB 3G04B 3O2VH 5F96L 4G7YL 3JV4A 4XPBH 2DMBA 5IVNA 4HUUA 3B5TA 4OZHB 4Z7UF 1MI5D 1OOAA 5AWNL 3ARDD 1NFIA 3TFKD 2BNQB 1ZSDB 3RWHB 3LDBB 1MCKA 5EIQA 4V2CB 4X9BA 5I73C 4S0UC 4XVUC 4RAVB 4N5UA 3RWJA 1NDGA 1V05A 1CGTA 1K8IB 4MXQA 3QUYB 4H1LA 4LVNB 5HHMD 4TSBL 1HCVA 1ACZA 1NL0L 4I5BB 3GO1H 4NBYB 1J8HA 3DI2B 4K7PX 2GJ6E 4ODWB 2CKBB 2DBJA 2OI9C 1U8LB 5J13C 4XMLL 2BP3A 5EZOH 5HDBF 5EUOB 4JO2H 1EBPA 1MCPH 4GXUM 4NQCA 4RMVA 3VFWB 4HEPG 2QR0A 2WUCH 4M6NH 1OT1A 1CDIA 3AM8C 4U1NA 4QHLB 3SE3A 3ET9F 2ILLA 4GMSL 2DQGL 2R8SL 3F12A 1JGUH 3QNXB 1KB5H 3GIVB 4PTUB 5GGUA 2Q8BH 1MCWW 3W9DB 3MLTA 3LDBC 3QHFL 1LEGA 4ZOAA 5TH2B 2VUYA 3L9RB 4FQ1L 5I73B 4XPBL 5KVFL 4PRBA 4M1DH 4DFHA 5CMAB 5EZIL 1FNHA 1L9NA 5JPNB 2OTUB 1U3HA 4KXZI 3MYJA 5SWSE 5ACZA 5JMRA 2PNDA 2EDKA 1N59B 1U8NB 3RTQD 3QQ9D 1JTOA 2EICA 3ZSSA 4G9FA 2DAVA 3VXQA 1BZ9B 1J7VR 3QQ9C 5IJVA 3RTQC 1MY7A 2HRLA 1WC7A 4KKNA 1EH9A 5I18L 4C83B 3NN8A 4GAFB 3C8DA 2AERT 3MRJB 2GIYA 4FG6D 3EOTH 4KRMB 1LDSA 4O2FA 3IDNA 1YJDC 2AQ3A 3WJJA 2A77L 5DRWB 3GRWA 3SKMB 3HLAA 3VGAB 4WGVB 5TF0A 4KJQD 2D0FA 4JO2L 1CFSA 5D2LB 5E6IB 2Y5TA 1CGSH 2APBA 1HEZB 5ANMB 1TQBC 3QNZA 4G5ZL 3GRWH 3RPKA 4Y7MA 4XT1C 1MLCB 4L1HA 1MAML 3MA7A 4XVSH 1ZE3C 4M1DL 1CD8A 3AU1B 3ZYJA 1EEZA 1J11A 2GHWB 3FRUA 4NM8L 3AREA 5HHNA 5EU7C 1VFMA 2R2EA 1MFNA 3ARGC 3RVTC 1J0JA 2WBWB 4X9HA 3SDYH 3ZDYE 2GEEA 5CSZB 4F37F 1EO8H 2EZ0D 2BY0A 4XAWL 2JCCF 2P5EA 2WM0A 1Z2KA 3Q3GA 1EEQA 5FXCH 4G8GE 4OM1H 4M48L 1MWAH 4HJGA 1ZANH 3B8SA 5AAMA 4K3DL 3MNWB 2QQKL 5JNYB 4UIMB 2XN9A 5AYQA 5I15L 3FT2A 1KTLB 1KJ2A 3G5VA 5C09B 4N0CD 2Y07L 2Y6SD 5LCVH 4NJAH 4L4TA 4P5TB 3PWNB 4N5EA 2H26B 4OZ4A 3JSSA 1NLDL 1T5WA 5DJXB 1CFBA 1NC4D 4P23B 3WJJC 1FN4A 5HD8D 2BCKA 3W11D 4GS7C 3FO1A 1JK8A 4LSUH 4XVSL 5EU4B 5GHWL 3GSNB 4LLWB 4Z0XA 1NCWL 1C8PA 4M3KB 3VRIA 3N1QC 4LCYA 5TDOB 2YRLA 3PDOA 2W0KA 1GGYA 4M6AA 4IJ3C 5TH2A 3M45A 3MLSH 1HXMB 5DJZA 5TFSH 1MHPH 3T4YB 3EHBC 2WW8A 1DR9A 1P7KA 1RZKC 2HWZH 5IESL 2VIRA 3GMOB 2J6EH 1NAMH 1SM3L 1GH7A 1XH3A 4KQ3L 2VLJD 1I1CA 3LQZB 1LQSR 1Z9MA 3HB3D 5J06A 1WAAF 2P43B 2O5YH 4LLQB 3LMJL 4K8RD 4RGOL 2ZOLB 2IANA 4L3EB 3MA9H 1FAIL 1JYVA 2G75A 5ESVB 2F53D 5I76B 4LMQE 4XBEL 5T5NF 5DHVH 1EIBA 4XRCA 3VFSB 3MACH 3BMVA 2D7MA 1QFHA 2VC2H 4XXDB 5I1JL 3LEXB 4ERSH 2FECI 1Y6MR 4KUZL 1IEHA 4YGAB 1E6OL 5HHOD 2DQJL 1FL3B 4HS3B 4PFEA 3TCLB 2YUWA 3CVHB 4R90L 3MRHA 3KAAA 4YH6A 3EJYC 2BSSB 1MJUH 5FGBC 4RRPG 3IJHB 4LRIC 1FNAA 1WAAE 4RAUA 5E94B 4L9DA 1GVIA 1EPFA 2P7TB 3SO5A 5DQJA 2PYFA 1RJZB 4L3ED 2YPLD 3HFML 4Z7UB 3RA7H 4O02H 4QRPA 3VXMB 1BFSA 2X40A 3HC3L 4G6AD 1RUKL 1KF9B 3B9KB 1EGJL 4L8DA 3SDXA 4CBPA 3AXLA 4JZJC 2X7LB 5EOQL 3PJSB 5I74C 1T0MA 4FHBD 2EXWD 4WGWB 2OCFD 2UV3A 4YIQA 4XCYA 1CD1A 4OIAA 3CCHB 1NCTA 3W39A 5IB2A 3BEWB 4XVTL 4OQTH 5C0BA 4OFDA 3WNLA 5T1LB 5DTFB 4NKIL 1N6VA 4EI5A 5EBWB 2YKLL 2ZG1A 2QHRL 1H9VA 1NAKL 5FA4B 3VE0B 1EAPA 3BXNA 3A6OA 3QFJB 4POZD 4WUKH 3MRDA 3G5VB 2OTWB 4ZNEA 4OCWH 1JNJA 4LSVL 4Y16A 4GRLD 5EDXA 1CDCA 3C5JB 2IAMC 2ZUYA 2Q86B 3TYFB 5F7EL 3U30B 4ZOCA 2R0KH 2KZWA 5TDPA 3X3FH 4Z7WE 3FRPA 4PP2B 3JVGC 3KLHC 4R9HA 4UDUA 4DZ8B 3TJHA 5T5FH 2YD4A 5E9DB 3ARFA 3NCEB 1RUKH 1MNUH 3BZDA 3CFJA 1HXYB 2IQAA 1PG7L 2PF6A 2YD3A 5FECA 2NY0B 2DDQH 2PTUA 5BVPL 3CAFA 4TSAH 2EH8H 2IALA 1MCOH 2NXZD 4OFPA 3NIDF 3TNNA 3VG0H 4LVOB 4J3SA 1HI6A 4O9HL 1NGPH 2IPKB 3LSOB 4O4YL 3I6KB 3TT3H 1N6QH 3I3BA 4JRXE 2A74A 1DUYB 5DJ0A 4UB0H 3L3IA 1UWXH 3MR9B 2GUOB 1AO7A 5ICZB 5L2KA 3AS0A 3RUGE 1DTUA 2X4PA 5F9JA 2IANB 1YN7A 1NBYB 5JOEA 4XNZB 3CVIL 5KSBB 4ZO9A 4OCWL 2PO6A 3RI5F 2OK0H 2CLRB 1X5IA 4LMQI 1J88A 3BUYA 1OQXA 2B2XH 3DGGA 1ZWIB 3QDAA 5C08D 5A2FA 5E56A 3VWKB 3ARTA 2P8LA 3JUZA 4YFLI 3FT4A 2YD1A 3X3FL 3TN0C 4R26H 5CJXA 2VWEE 2C3WA 5JPMB 5CD3B 4PGBB 3KPNA 1D6VH 5IB5A 3PV6A 1NANH 3CVHH 4GSDH 1YY8A 2VXUH 4GRMB 4AIZB 1N5AB 4H26A 1OTTD 1JGLH 4I77L 2ZJSH 3FONA 3TEUA 1A7NL 3N1PC 4DVBA 1I8KA 4QRPD 1SBSH 3DTXA 3NBNA 4NFCA 4ODUB 3TH2T 1MCFA 3L95A 3ERYA 3Q2CA 5A3ID 2XYCA 5JIIA 5MHSD 4QHNB 4NFDA 4P2QB 5J3HC 2DQFA 2WV3A 5IB2B 4J1UA 5DVKA 1ND0A 5DD6A 4QHKI 4WU7A 2VDPH 4OGXL 1P4BH 2NY2C 4TNWF 1G9MC 2XN9D 1O7VA 4X5XB 3FFCB 4CJ1A 5KZCD 1INDL 4B41A 5EWIH 1UB6B 3VI3F 4NN5C 4URTB 4LIQH 5DMYA 2GT9A 4Y2OA 1H3PH 4XCCH 4N1CA 2A83A 5F9AC 3HPJA 5DRWA 3W9EB 3QG7L 2D9CA 5BJTA 2ZZUT 4I1NB 1ZTXH 2J12B 3GMPB 4TULH 2MCPH 2H6PA 3GHEH 4UU9B 4IHOB 4M4PA 4HHAA 3DJ9A 3T2PA 2EDTA 3R1GH 2J3SA 5B3JF 4LVHB 1HILA 3CFJB 1R3JB 4OZGF 1TCRA 4HH8A 4ISVB 2W60B 4FXLA 2WANA 5HGHB 4OM0L 4QT5B 3FT3A 1DFBL 1MJ8H 5D1QB 3MRMA 4ZPVB 1CGWA 3SKNA 3UAJC 1MHHA 2VDMH 1A6TB 4CVWA 3GIZL 5F1SA 5CGYD 3LV3B 1HI6B 1HSBB 3MLZL 1RVFH 2F19L 4G8EA 4YXLL 2VLJA 4P2RB 5AD0A 5I71C 4DEPC 1DQDH 4NRZB 4XWGL 3WE6A 2QADC 3EFFA 1MCEA 2FX8H 1DUYA 2YXMA 3GMMA 3QXUA 2BVYA 5IHUH 4H8WC 3MLYH 5EU5B 4X4MA 4YC2C 3AMLA 5KZCB 2F53A 4U31A 1GCFA 3TPUA 3V4UH 3WIIL 4YHPA 1V7NH 1UH2A 1KJ2L 1VADA 2VDQL 4IBLT 2GQHA 2H9GB 5DF0A 2ZNXA 5IBLC 3OKNB 1SJVA 1QRND 4K8RL 5JQ6L 4OFKA 5CZVL 2X4TA 4JO4L 4KK5C 4MWFA 1KENL 3BRFA 4XCYB 4XNQB 1UG9A 5C08A 3DO7B 5KS9B 3CPLB 4NZUL 2Q7YB 1RZ7L 4HH9B 3MCKB 5C0GB 2AJSL 3O2DA 4P23A 4ODVH 4GKNB 1BP3B 4AY0A 5GSVB 4OZGA 4JRYB 1PKQB 4QOKA 1E0OB 3LB6D 4KV5E 4UOW0 1OP9A 2OTWA 5D7JA 1G0XA 3I6LD 3KDMB 4DUWA 5BOPA 4DKFH 1EZVY 3S35L 2FDBP 3CPLA 2GJ6B 4HPOL 4U6YB 1ONQA 1BIHA 2AJYH 2F19H 5B39A 3FB5A 4Z7NE 4WNQB 4LASH 2C1OB 2A9NL 3P0YL 5GSVA 1FV1B 2EE3A 1I9RL 4ZTPH 3ILPB 4OLUL 3QYCA 3KPSD 4HPYL 4RX4A 2IBGA 3KDMA 3V79C 2X4QB 4PJHB 3ZYIA 4RA0C 1UYWL 5C7XL 3TCXA 3B43A 4NZJA 4PJEE 5L8JB 4K9EL 5K33A 3RWFB 1P7HL 5CUSL 1BOGB 4ZUUB 1J1PH 4R4FL 2FYYA 3L3KB 3QXTA 3HZYA 4E42A 5INCA 2ZOLA 1AQKL 3ARVA 1DBML 1NGWA 5F7KC 2P24B 4MA3B 4JFYA 2J8UB 3ABZA 2HFTA 4NSKA 2BK8A 4P2YA 4KK6C 2JIXA 5HY9A 3TNMB 3QDGD 4RAVA 2YWYA 5E08H 4PJ9B 5H2BB 2A6DA 1A7PH 3HRZA 3VFOB 5IK3A 4KROC 1BZ7B 3MRLA 3E2HA 3G6AB 4HW6A 1F4WL 2NZ9C 1YEHL 3RFZC 4X7FC 3G6JF 5C07E 4P5MA 2YC1B 4WTZA 1AGCB 1YEKL 1FQ9C 4MXQD 5LGJA 3V0WL 3VW3H 4G6JH 1T2QL 5E2TH 3Q1SH 5GRVK 1D9KB 3L3GA 5J9PA 4JO1L 2MWCA 2QADD 4R96A 5B4MC 3A6BH 3DETD 4ZFZB 1CDGA 4IMLA 1AXTL 2WAHA 1U8JA 4U6HB 3HUJE 1T80A 1NCAH 5F6HJ 2OMNA 1IQDA 2HJLB 4U1JB 1BOYA 1F02I 3GSRB 1WV7T 5C7XH 3SKUD 5D7JC 5IHZA 1K8IA 3LD8B 4K3HA 4A2MA 5K59E 1QPPA 1WT5C 4ZFZA 3QG6B 1AI1H 3NAAH 4KROB 1DBMH 3ESUF 3VXRB 5ESAA 1YQVL 5F7UA 1MJ7H 1MUJA 4LLMA 4DJMA 4U7SA 5FDYA 3AREC 2WBJD 3RVXC 2FGWL 1YNLH 4D8PA 2R9HC 1JGDB 4RDQG 3WFDL 1KEGL 5E6ID 4WDIB 4YAQA 4M7LH 5HYJD 4LP5A 4Z7OE 1FG2A 2P5WA 4F7MB 1HKLL 3ZHKA 5TGBA 5CCKL 1WEJH 5JZ7D 3VW3L 5GS1A 3JV0A 5EFIB 1FVCA 4X6BB 3EYQD 1I1AD 1BD2B 4JO1H 5TE4H 3VFGL 2MMXA 3WNPA 2RB8A 1DLHB 1A6PA 5ICXA 1RUAH 1OAUL 1QQDA 3LD8C 4F33B 2AV1B 2BMKB 3KJ4B 1F11B 4EEEA 1NCAL 1ERNA 2VQTA 1IMHC 2R56H 1LNUB 4G42B 4X7CC 1KT2A 3REWA 4JFOA 2ZCLL 4PRHD 2E8ZA 4OIIL 5D93C 3DXAA 3L5WB 5F1OB 1DLHA 3KPOB 1FGNL 2E6JA 4OSUL 2F54B 3GSQB 1B4JL 2XPGB 3FFCD 3KPQA 1F4XH 4LPYA 1T3FB 4A6YB 4YUEL 5CSZA 4OJFL 2VZOA 2HA1A 2HFGL 3CDGB 1XF3A 5EPMB 4M6ML 5TDNA 4PJBF 1BQLL 2AEIT 3NZHH 4GJTB 1FVDB 4GG8A 1FDLH 1WBXB 4XPHH 3OAYK 5JLZA 5DD3L 4HUVB 5BZDB 1P53A 4JE4B 1D6EB 1FLRL 2Q8BL 3TBWB 5TQ0L 5DJ6A 5IB3A 2Z8SA 5BQ7A 1P7QA 3BP7A 2IQ9L 1HKLH 2HLFC 5KVEH 2BX5A 3BMWA 3KJ4C 3OJMB 4RFNC 2IMMA 5EU5A 2G5BB 4J6RH 1BQHB 5FYLD 3BH8B 3UTPD 4IRSD 3C5ZC 3EFDL 1CLZL 4NQSA 4YJZL 4M7ZB 3QUYD 5FYLL 4G3YL 3UYOD 5H35A 3PP4L 1JFQL 4R6UA 1JWUA 3A6CL 1P7QB 1EGJA 2XA8H 3U82B 3M8OL 3OJVC 4A6YH 3OWEA 2BNRB 3S88H 5AG8A 15C8H 5T5NG 1HWGB 3KXFA 3KPSE 4OIIH 2C7UA 4PRNB 3Q5YA 2OL3H 1DBAL 1XR9B 1GZPB 5ESQA 1J18A 2I5YH 1B4JH 3HG1A 4Q6IB 5HVHB 2DQEH 1OTUD 4Q58C 1BEYH 3D69B 5B38B 3ULUD 1OCWL 3PABA 2HYMA 3ARGB 3KPPA 1M1SA 1RD6A 4L29B 3IDGB 3OKLA 2KKQA 3TJEL 1JNHB 5FK9A 1XH3B 4HIIA 5GS2D 5ITFA 3I2CL 5B38A 4MNGB 4JZJA 1ZMYA 1GGCL 1T21A 5I8OH 5CBEA 2VZUA 4N0UA 3T0EA 2DKSA 4N0CA 3FN0H 1QD0A 3ZE1F 4FS0A 2FSEB 4FFWC 2L7JA 3S9DB 2CR6A 1JFMA 5IMLB 5FV1L 3DX6B 4C83A 4U6VL 4LCIL 2XZQL 4WI3A 1NDMB 2NPLX 3LKQB 4JFPA 4S1QL 3S88L 5A40E 3NA9H 3GHBL 2BVTA 5D2NC 3VXTB 4I2XA 4PBWD 4TOYH 3Q5TA 3QUKA 3LKPB 3VD7A 4TVPL 1X7QB 1AE6L 3REWB 3QIWD 4K7FB 3BP4B 3GSVA 4G6AC 4GKSA 5EOTB 3T0WA 3O0RH 1ZA6A 3QH3B 2V2XB 2F54A 3GSQA 2WBKA 4GAGL 4N68A 3IAGC 3V4VH 1T6WA 4KH2A 2OJZH 3DURA 2HLFD 1IL1A 1J0ZA 5FO9A 1NLDH 4C4KT 3RPIA 1F4HA 3U1SL 4MA8L 3GSOB 4HGWA 2UWEF 4XPAL 3IDJB 3QNYA 4L8BA 1FSKC 1R3HB 4U6HA 1MLBA 3WEXB 5MI0C 3DHJA 5BW7A 4G8IB 1JPTH 4UTBH 1R24A 3U4EB 3TBWA 4OUUA 2KQNA 1J86A 1A2YB 5AZEL 4BELD 1JGEB 4Z7VF 3FB6B 5D2NB 4U0QB 1KCSL 3CXHK 1RJZA 1UB5A 4MJ5B 1MVUB 2WK2A 1PSKL 3VI4F 3AB0B 3O8XB 5ESAB 4PJAA 4DN3L 2ERJC 1R3LB 4DVRL 3GHBH 5JHDB 5GRWA 1WWWX 2OR8A 1MWAA 5C86A 1S5HB 2XIDA 5ABDE 4RQQB 4IRSA 3LMJH 2CRMA 3OAUH 3WIFA 3SE9L 2HFEA 4PUBH 4G43A 5FYKL 3UTTA 1RFDL 3D39D 2WP3O 1X5YA 3CLFL 3MXVL 4HS6B 5AWNH 5TGBB 1QO3B 3SJVE 4KTYA 1FZMB 4TPRL 4DGYL 1BHGA 4BH7A 3SDDD 1NCBL 1XZ0A 5EU6D 1F2QA 4JPIB 2XWBB 4UIKL 1E6OH 3H0TA 4BFEA 1A7OL 1TZHA 1WZMA 4AEFA 1PZ5A 3QDGA 4NQXA 3RVXD 4UTBL 2EO1A 3MV01 4KKLC 5CP3A 1AO7B 4O51B 3H2WA 4HBCL 4F7EB 4NHCL 4UTAL 2R2BA 1VHPA 1VKXA 4OF3A 4YHMH 3MGAA 1EJOL 1MIML 4KY1H 3BYYA 3TH4T 1XF3B 2E7LE 5D5MA 4HWZA 3RKDD 2JLLA 2VB5A 1NGYB 1QG3A 4QCIA 2CLZB 2R1XA 4FQCL 3HMWH 1NBVL 4CUCA 5JPMA 4ONFH 2AQ2A 3SE9H 4MJIA 3QIUC 1AO7D 1UWEL 5IB3B 3OGOE 3WLWC 3P73B 2ADGA 1DBBL 4OCRL 1Y18B 4HUXA 4JO3L 4IMLB 3ZHLA 1F6LL 1J5OH 5SWSB 1BQHG 4YQXH 1IGML 2A6JB 4LHQB 5FO9B 2BNQD 1M71B 8CGTA 1HIMH 3SDAB 3D1MC 4I0PA 4L8CA 1SVZA 2QTEA 3NIDE 4OGYH 4YHKL 4LNVA 4MNHA 1V5JA 4KRPD 1A4KA 1Q1JL 1WITA 3U4BL 1XGYL 5T5FL 5F3HA 4WFFD 4OGZA 2CPCA 1AKJD 3O3EA 1EO5A 3MRFB 5C92A 1JF6A 2GSGB 4PDCE 3QIBD 3ROOA 4AH2B 4K7PL 4NC1E 1CIUA 5BVPH 3CZJA 1FYTA 1LE9B 3MV8D 2Q6WB 2V9RA 1LQVA 5I8CA 2X1WL 3HE7C 2R69L 5DJCA 2I9TB 4G5ZH 4WI5A 1D5BA 5T1LA 3C8KA 2Z93A 5E2UH 1HHGB 4RGNE 3BPCB 3MRFA 4G7YH 2UVEA 1FPTL 1ES0B 1LD9A 1A1OB 4NHUB 4WY7H 5HHMB 3DYPA 2EYSA 1QRKA 4RGNC 5E2WH 3OJDB 3MRIA 4JN2B 3SDAC 4JFEA 4UAOC 2YK1H 3W2DH 32C2B 3ARED 3QIBB 3ULVE 5ADPL 1SVCP 1TZGH 2AV7A 1AH1A 1VGKB 5K93A 1XGPA 2H1PH 5E9DD 1TZIA 1F4AA 1XZ0B 4HF5H 5FGCE 3HUJF 2VLJB 4R26L 5D70H 2L4OA 1T7VA 3BQUD 4K7PY 5CEZE 4ODHL 1VERA 2YSSA 1QKZL 3F7VB 4ONHB 4ZXBA 3O3BA 5K59F 1Z0MA 1XEDA 2NY2B 3TO2B 5IB1A 4X0KB 1UACL 5K9KB 1JJUA 2WWMC 1VESA 3MODL 3ZDXE 2Z8VC 4I0PC 3NPSB 4OFIA 4YR6B 1VENA 2V5MA 5EORH 1F3JB 2B1HL 4RGNB 2ZUTA 3DMMD 4MAYA 1BIIB 4PG9A 1TIUA 4OZFH 4BKLB 1X5LA 5AUMA 1KIPB 1BQHA 4YZFF 2OJEA 5CIPH 1DVFB 3QQ4A 3E6FA 4NNYA 4PRPE 1WJ3A 1H3VA 1VFBA 3K2UL 3UZEA 3LS5L 2DJUA 3FQUB 2XG5A 3KGRA 4KMLB 3MRCB 5KANG 4OZHE 5I19L 2VISA 4JFXB 4MAYB 3HE7A 2CRYA 3FB6A 4JFQA 2HWZL 3PWLA 1CR9H 5IESH 2V2WA 5GS3A 2O5XL 2CIKB 3BH9B 2BVUA 3CXDH 3RRQA 4QNPE 3BZ4B 4JZOB 5LAXA 4GW5A 5C0DB 4ONGH 2WINA 3NZ8A 3LVEA 1ZLSL 4GG6B 4I0PB 3RWCA 3BE1H 1CK0L 3UTTE 2VSCA 2QADB 2IH3A 3RKPA 2LU3A 3WN5A 3DROB 4AEHH 5IQ7L 5EZLA 5IMKA 1BVLB 1T1WA 3HUJB 4PS4H 1CTNA 1HDMA 1OL0A 2HVJA 4G9FD 2GSGA 3DECA 1J05A 2GAZB 3QFJD 4YHZH 2CD0A 1BX2B 3U9PL 3WLWD 3FFCE 3D18B 4LCUB 4YE4H 5T1LD 4N0RA 4U1SB 3P4OB 4DZ8A 3DROA 3SKOB 1A8JH 4F3FB 3L3OA 2NLJB 2VABA 1ZK9A 1ZVSB 5HXMA 5MENA 1RVFL 1ED3A 2XTLA 4ZSOE 1KOAA 4RIRB 3SOBH 2AJVL 2EH7L 3RVVC 3IJSA 4JHAL 4QXTB 1J1XL 4L3AA 1WSST 4Q9QL 2Z35B 4OD2A 5IJKA 2VDNL 2FJGB 2HTKC 1NCCL 3ZKMD 3OJDA 3S37L 3V4UL 2IPKA 3LSOA 5JXAH 2ICEA 4N8VG 5D6DA 1AKJA 2HH0L 1MLCA 4NQTA 5DFVD 2O26U 4GRLC 5IBLD 4LSSL 3PV7A 3FRPG 2G2RA 4XCEA 1S3KL 4KJWD 1I3RA 4PJFF 5CJ5A 5EOTA 1A6AA 1QNZH 3PNWA 4L4TE 4JZNA 5GGSB 4F8TA 1GGBL 1NMAL 2H32B 4HWNA 4X7DC 2HVKB 4ZG1A 4AEHL 5IQ7H 4ZYKA 1DBJH 1LP9A 3MRHB 2YKLH 4M62L 5CZXC 3ARBD 5GSRA 4CNIA 5I1GH 5DJYB 3JWNC 4ODVL 5HPMA 1FG9C 4HUKB 1B0WA 2FATL 3V7MA 1FCGA 1XFPA 3AVEA 4HZLA 2DQHL 2PKDA 4FTVB 4Y19E 4NC2B 4X0KA 4NDMA 5GGUB 2VH5H 4ZSOA 1FVEB 4BZ1L 4KI5F 4L9LC 5CHNA 2JKXA 4JDVA 2J6EA 2CDFB 3DVGA 3MNWA 3RWJB 3VMPA 4QKXB 5C0JA 4YDIH 4MNQB 3S36H 1XF2B 5EUKA 3T0ED 1G9NH 2OZ4L 4DUXA 4DGIL 2OTPA 2HG5B 3K4AA 4NJ9L 1S9YB 3HZVB 4RBPH 5HHOE 4JQVA 1MNUL 5D9SB 1OB1A 3F7YB 1SEQL 3O3EB 3WL9B 4K3JL 7FABL 2DICA 4KDTA 2HT4D 5JXAL 4J3UA 5LWYH 1MCOL 2PUQT 5D7LE 5T3ZL 1GC1H 4OAWA 4JFQB 1T2XA 4PJXE 4FQXA 3WFBL 3F12B 2BERA 4Y16B 2X41A 5FO7A 4GW1B 4LCYB 4R8WH 3DXAE 2F5BH 3W9DA 1MUJB 4LLMB 2O5ZH 4XBEH 4TN9A 2Q8AH 5FM8A 4I9WD 1QSFD 4QOKB 3QI9C 5I1GL 3HS0A 4X6DF 3QWRD 5CZKA 3OKKB 3U7YL 1E4KA 2VUOA 4FXKB 2B2XL 2M2DA 4KI5D 4QLRA 1J05B 2GAZA 1KTKE 3SBWA 1DQML 5GS1B 4O51A 1UJ3C 3QHTC 1YMMB 4I48B 1C16A 3THMH 1EBAA 2AXGB 3C09B 1CICA 1IILE 4LLYA 4MQTB 3A6BL 4CVZB 2NY4B 3LH2H 4OCYH 5JW5A 2N4IA 4HUVA 4HV8A 5FKPA 1D6VL 4KC3B 1TTGA 3BPNC 4C59B 5CEXA 3BP7B 2MKWA 2VDOL 1MRDH 5FYJU 1Z9LA 1CDBA 4K23H 1AIFB 1T2JA 3G6JB 2Q1EA 5BMFH 4JDZB 3V0AC 3VWJD 4K3JH 2Z8WC 2NY5H 3MRMB 4ZPVA 3FAWA 3LEVH 5T3ZH 4NCC1 3W11C 2BVEA 3GMOA 4K55A 5AD0B 8FABA 2ICEB 4D3CL 5JNYA 4XC3H 5ENWB 1MH5B 2MQ0A 4EUPB 3JV6A 3DUUA 1WBYA 4TUOB 5JIHA 3OZ9L 4HQQL 2F58H 1C5BH 2YPLA 5DVMA 2CO6B 1YNTB 5C0IA 5ALCH 2VSDA 5I76A 2BVOB 4GQPH 3O11B 3AY4A 2WP3T 1G9ML 3LPWA 4QO1A 5DSCB 4X5WB 2E5EA 1RJLA 3KXFD 5CCKH 2RIKA 1OTUC 1MRCL 4ODTL 3IFNH 3LZFL 1VPOL 4GAJH 4JG0H 3ALPA 4A2LA 1ZEAH 2NX5B 4Y4KC 1OY3B 1IEBB 3RVTD 2HJLA 4EQ3A 2HTLC 3QJHA 3STZB 1YDPA 1T22B 2P8MB 4OFYD 1KJVB 5T3XL 4LSRH 1WWAX 5IVZB 2DLGA 2XN9B 3VMOA 2NCMA 1ORSA 3TT1L 5C6WH 1DEEB 2VLRE 1Q72L 4C55A 4OSUH 4GQ9L 2W65A 1FRGL 5T3ZE 4PIRF 3C60C 1XCTA 4ZDHA 3NPZB 4YO0B 5DXWA 3T3PE 5T1KA 3MROB 1L0QA 4HUNB 1KUMA 1MCSA 4M7ZC 2Z4QB 2FJFB 4ZFOA 2OTUA 3MSPA 3FTGA 1KELL 3OKMA 5KW9H 5ALBL 2ZCHL 3MLZH 3EKCA 12E8H 5E9DA 1FDLL 4XPHL 4BUHA 2W0LA 1E28B 1DLFL 1AFVH 2C9AA 5J6HA 4R4ND 4DZBB 2BOBB 2DL2A 4WHDA 4GO6B 4CW1B 5L2KE 4POYA 5J1SC 5I75C 1NGQH 3KYNA 5IVXE 1D5ZA 2AEPL 1P69B 2EDOA 3FQRA 3BIKA 3NVQA 1A4JA 1V7NL 3GKWH 3F8UB 4BQ8A 4P3CH 3CFKB 3TYGH 1UM6H 3QEQD 3BP6B 1LO0H 4KK8D 5F1KC 4LSDA 3VG9B 3VFMA 3J8F7 4G3YH 1E28A 5IBTH 1H3UA 1AKJB 4PREB 4ENEC 2MQCA 3WLBB 4OD3L 1IAMA 2FSEA 4U1KB 4LVEA 4PJ5B 5EU3B 2WUBL 3M8OH 1MHHB 3KVQA 4PBVC 5SX4H 1HSAA 3MNZA 3OSKA 5I8KH 3QSKB 2GSIB 1DQJA 4WTWA 2G9HB 1RULL 2ARJB 1HEZA 2Y9RT 5GGVY 3BEVB 2OL3L 4QRSB 4JFDA 1Q94A 1HHIA 2DQTL 4PTTB 3TN0A 1AIFA 3G6JA 2BDNL 4YIQB 2AI0L 4MLIA 3UROR 2VLKA 3LY6A 4TUJB 2X4RA 2IALB 1TJGH 5DMKB 4EIZC 1YEIH 2D7NA 3S35H 1FGVH 1U8HA 3FN9A 2W9EL 4V3EB 4L3CA 1G7HA 3MBEB 4QTIH 1QFWI 1M7DB 1G6RB 5BV7H 2VZ1A 1I8MB 4JPVL 3VE0A 2X1OA 4ZS6C 2HT4C 2EEDA 3HN3A 2UY7A 1CYGA 1S7SB 2VLKB 3SJVA 2BVQA 1INDH 3WIHH 2NNAA 1GZQB 3F7RA 4P46B 1KN2L 4PPTA 4FA8A 4P3WA 3R06A 3CLEL 3T3ME 3P4MB 4PJBB 1QFWH 1RPQA 1S9WA 1CT8A 5JHLH 5FDWB 2N7AA 4P2QA 3NA4A 3WFCH 4R7DA 4CU8A 1OARL 1QVOA 3WN5B 3VXUA 2BVQB 3EJZC 3WDJA 3TBVA 4S1QH 3DUSB 4K3EH 1QSEE 2F5AH 1GZPA 1HHHA 5C0BB 4EIGB 1J0KA 1YNKH 1NGXA 3TV3L 3FFCA 2I60L 3R8QA 3BPOC 3PXHA 4I18B 4I2XE 4TOYL 5IMMB 1AE6H 5JIPA 1JK8B 3RGVC 4MXQC 1G7MB 2ARJQ 2VDML 3L3OB 1IAIH 3LKNA 1F3DJ 4Z6AT 4GAGH 2UUDH 5IFJA 3IGAB 1S7RB 4EVNA 2D03L 2ZUVA 2AQ1A 2AK4A 5DFVC 3ZKNC 1A47A 2Z4QA 5L9DL