1LDPH

Crystal structure of murine mhc class i h-2ld with a mixture of bound peptides
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
272
structure length
272
Chain Sequence
b'GPHSMRYFETAVSRPGLGEPRYISVGYVDNKEFVRFDSDAENPRYEPQAPWMEQEGPEYWERITQIAKGQEQWFRVNLRTLLGYYNQSAGGTHTLQWMYGCDVGSDGRLLRGYEQFAYDGCDYIALNEDLKTWTAADMAAQITRRKWEQAGAAEYYRAYLEGECVEWLHRYLKNGNATLLRTDSPKAHVTHHPRSKGEVTLRCWALGFYPADITLTWQLNGEELTQDMELVETRPAGDGTFQKWASVVVPLGKEQNYTCRVYHEGLPEPLTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS I H-2LD
molecule tags Complex (mhc i/peptide)
source organism Mus musculus
publication title Structural basis of 2C TCR allorecognition of H-2Ld peptide complexes.
pubmed doi rcsb
total genus 55
structure length 272
sequence length 272
ec nomenclature
pdb deposition date 1998-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ldpH02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1ldpH01
1UYWH 1F2QA 3RNQA 3CC5B 3MLVL 4LVNB 1IGJB 1TDQA 5D2LE 2H2SD 3U36A 1QSEB 3GRWL 3PWUB 2L4OA 4I0CC 5HY9B 4PJIB 4X80L 3LOWA 2EEBA 1G7JB 1WISA 1MCKA 1VADB 2WW8A 5ESVA 3WHXA 4PJEF 4R2GC 4LASH 3MV11 1GOGA 3BEVB 4DTGL 2HTKD 3EIFA 1TXKA 4X6CF 3VGAB 1JPSL 3RX8A 1KJ3L 4UV4H 4QY8A 2K3TA 2XI9A 1BFOA 5ICYA 2E9WA 3WN5B 4PRNA 3RTQC 2APXA 5FM5O 3QH3B 1I7UA 1R3IH 2VXQH 4D8PA 3PDOB 1T0MA 3Q5TA 1QRNB 4IRJA 4G6KH 3QUMH 1NFIA 5F7NC 4JEGB 1OHQA 2IADA 3ZMRA 2V2WA 3DJ9A 5FA4B 4D9RE 5F7DB 1NAMH 3RHWK 1KB5B 5I66A 4WENB 4I2XB 4MB5A 3SO5A 1KPVA 3MRCA 3QPQC 2Q8BL 1NCWH 3W11D 4ELME 4JANA 3WE6A 3SJVE 1WC7A 3GSQB 3MOAH 1KTDB 3RWCB 1MIMH 4Y4FD 4RSVA 1AGEA 3H7LA 3RIAK 3RRQA 4Z7WE 3DO7A 4BKLB 2YRZA 3WIIL 4O5LL 5BZDA 4CADA 1OF2A 2HMIC 4LPVA 3MRCB 5KVMC 2CLZA 1QFPA 2JB6A 3L3GA 4WTZG 5KOMC 1FE8L 4I3RH 1A6VL 4JPWL 1A7RH 4FZEH 5H35A 5T3XD 2QSTA 1A7QH 5IB1A 1PG7L 3O45A 1WZMA 4KRPC 2BDNL 1U2CA 4P0DA 2ICEB 1QKZL 2YK1L 5ANME 4QHKI 4IDJL 2DI7A 2BVPB 2C5DC 1OAKH 4X4MA 4NKMB 4TSAL 3AS2A 3GO1L 3OKOB 3L95B 3BRDA 5JPMB 4OZGE 5CJBA 4ZD3L 4EIZC 3OWEA 5DS8B 1G1YA 1K4CB 4K71C 5C0BB 4L8BB 3WFHA 1MIEH 3PWLB 1XCQB 5DVNA 3NCEB 4YDKL 3MA7B 3WKMH 3M1BA 3FQWA 4IBLT 3G08A 3BVNA 3GKWL 3IJSB 4H20L 4YJZL 2NZ9C 5IROC 2V2XA 5KSAB 2P5EB 2W92A 5GS2D 1FLRL 5CD5C 1FPTL 2AABL 1X5FA 4U1HA 1R3IL 1MHPH 2VXQL 1ACYH 3LKOA 1CE6B 3MXWH 4X99A 5EC1A 5I19H 3TVMA 4APQA 3F12A 2BFVL 2F53A 1AIFA 3QCUL 4TYUA 2VR9A 5AEAA 3O3EA 2ZNWA 2OR9L 2VWEE 2ZCLL 3LKPA 2F8OA 1K85A 1A9BA 2B0SH 4ZOEA 4KJWD 1QLEH 2JJSA 5CILL 2FYYB 5ITBH 4ZNCD 1AE6H 5L9DH 2HWZH 2NYYC 4W6YB 1OGAB 5DWUL 1LQVA 1S7WB 5IR1A 3WDHA 4G8EB 4KV5E 3QULB 5T1LB 4KMTL 3HAEB 4YAQB 4JFYA 1NSNL 5ANMA 2AJUH 1CDYA 1FAIL 5KSVB 3RKDC 1U8JB 3LV3A 4RGNC 1CXFA 2BFVH 1I8MB 1JZ5A 3BP4B 2APBA 1ZT7B 4KY1L 1QSEE 2GCYB 4ODSH 1TPXC 4PJ8B 1AQDB 2UV3A 2W9DH 1F4HA 5ID1B 1LEGA 3G6DH 2BHUA 3AS0A 1KCRH 4MS8D 5D7JD 2H2PC 3N1QC 3MV8A 3AROA 4JM4L 2MTPA 2Z35B 1UJTA 2OSLA 5CIPA 5KVDL 1ZA3A 1ZKAA 4G9FD 5AWNH 1RUKH 3EYVB 5FCUH 4XP4H 4JDZA 2Q86A 2D03H 2NY5C 2RGSA 3GO1H 4HGWB 5EZJA 2EDFA 4HS6A 1MREH 3DI2B 3HC4H 1NGYA 3U30B 5IQ7L 1U8PA 4PD4J 3OPZL 3EDKA 5F9OL 3AM8C 5CP3A 5ID0A 1QUNA 3MXVL 3GMMA 3HPJA 5J6HA 4OUOA 5E8OA 1B90A 2V9TA 5C9JB 3QDMA 3ZKMD 3GHEL 1W0WA 5HYJE 4UU9B 2IFFL 1RZFL 3BP7A 4KTDH 1Q94A 1TVHA 2RB8A 4G80B 1I4FB 1CE1H 4OZIB 1OTTD 5DJXB 4RFNB 1T1WB 4AL8H 3EYOB 2J6EA 1J8HA 1JMXA 2NCMA 2ITCB 4PP1C 2DRUA 2X41A 4OBSA 5B38B 5CJOH 4Z7NE 1EIBA 2OTWA 5AZ2L 3LQZB 3QJHB 3PGDB 5C0NC 4PJ5D 1S7XB 1I1YA 2ED8A 2DQIL 5DFWH 4N5ED 5JIIA 5C8JB 1T22B 3RVWD 1KN2H 1E6JH 2FECL 1I8KA 1SJXA 3TZVD 3CX5J 5JNYB 2I9LA 1MSPA 4ODXB 3VWKB 2AV1B 3CFCL 5L2JB 4AEHH 4FQXD 4M3JA 1YEIH 3BPOB 1FYTE 1T22A 2I24N 4G6MH 1IGML 2M26A 1BAFL 4QRTB 2VIRB 4WTZA 3PV6B 4IDJH 4UQ2A 5CBAB 1CGXA 2CGRH 3QUZA 2P47B 2RFXB 4JM4H 1KOAA 3VMPA 5IMMA 4U1GB 1V7MH 4ZFGL 1MFAL 2AJZB 1H3WM 5CUSL 3TBYB 3I2CL 4NWUH 4JPVL 2J1KA 5K9JH 3SE9L 5FO9A 3K8LA 3FT4A 1Q72L 5AAMA 4R7NA 4ODTH 3MLZH 1JGEB 2Z8SA 1KFAL 3QXDA 1QTYT 2QBWA 1SMAA 3BP7B 1HQ4A 4HUXB 1G7LA 3DMMD 5TH2B 4L1HA 2J6EL 3WHE0 4TUJB 4PG2C 5CZXD 2CQVA 3CLEL 5LGJB 2PF6A 2P8MB 4Y2DA 5CHNB 2FECI 3SGDH 4HAFA 4Z7QE 4JQVC 1LEKA 3TYFB 4HD9A 4RMQA 1A1OA 4EN3D 1HIMH 3EO0B 3HI6L 3NCMA 4EKXA 1CXIA 4P4KC 2Y5EA 2A1WL 3QQ3B 1DBJH 2R4SH 2NX5E 1UM5L 5FOBA 4BSWA 1PQZB 3GDBA 4W4OA 1CFTB 2X1XR 5HDOA 4EVNA 1U3YA 1YEIL 2X70B 2W9EH 1A6UL 5CJOL 4XRCA 1OGTB 1HOCB 2FLRT 5FHBH 2I25N 3RNKB 5DQDH 4OSUL 3K3QA 1ZVSA 2XACC 1UM4L 5GJSL 2RBLA 1FYTD 3VH8B 1ZLVH 4Z7NF 4WHTA 5KVFL 3MMEB 4HKBA 4JFOA 5I1EL 5E56A 3PQYE 5HYJD 1VESA 4RRPG 1GGCH 3LEXA 4KH2A 1HH9A 3MJ9H 1A6WH 3ARPA 2BSTB 3BEWB 2GJ6B 4ZUSA 1ZLUH 2J88H 3MXVH 4NZJA 2DTMH 5IR1B 1LGVA 4C58B 4IRJB 3RWHB 2YEZB 2XWTA 3AMLA 5DTFA 4HIEB 4RGND 3DROA 1I7UB 5F70A 5MENE 3JV4B 1JPTL 1EBAA 5IESH 4LL9A 4WHCA 5HHME 5IF0A 3L1OH 1TCMA 3JWOC 3VXME 3O6ML 2VDNL 3TCLA 2NY3C 4P2OC 3U46B 5CD5D 3UPAA 5GIRA 3GK8L 3WLWC 1FQ9C 2BOBA 4OF0A 3BN9C 2VZ3A 3F7VA 2AJVL 1WCBA 3OZ9H 4V1DA 3WFDL 3LH2H 1U8QB 1XR9A 2ADFH 2WMPA 5LKNA 2XWBA 3ULVE 3HLAB 3VD3A 5FGRA 3U9PL 3S4SA 2DQHH 1YPZF 4XMLL 1P4BL 1S7SA 4PJEA 4KQ3H 3TWCH 1JUFA 3U4EA 4MJ6B 3H7BA 4NZUL 4R2GD 3UYRH 4FZEL 1RQ5A 2F15A 4CNIA 1H3PH 2AGJH 4GW5A 4EOWL 1QSFD 1HSBA 1U3HA 2FX9H 1RD6A 3KGRA 4PJFA 5CGMA 5IV2A 3K4ZA 4NJ9L 3KR3L 4NZTH 1LO4H 2VLME 2ADGB 2FEDD 2UWEA 3AFLA 2VRAA 4HJJL 3D85D 3WSQH 3MOAL 1Z0MA 3PWPE 4Q7DA 2EIBA 2OP4H 4U7MA 2CLRB 2AV7B 2EE6A 3WHE1 4JKLA 2H32A 2VISA 5GJTH 1TZIA 1XGUB 3RZCA 1WGOA 3MV7B 1NMCB 5KANI 1FFOB 5T33H 1BJ1J 1BZ7A 3MLXL 3JVGC 3SDDB 5SWZD 3C60D 1PJ9A 5GS2H 2KQMA 3D25A 2R2HB 2B0SL 1VENA 4HFWB 3A6CL 1NDGA 2Y25A 1HXMB 1Q9WA 5E8EB 1KTDA 2AVGA 3RWCA 3H9HA 5C0CA 3G08B 3OAZK 3QEGL 1J5OL 3FT3B 5FV2A 1Q38A 5DD3L 4ZUTA 1V3KA 4KUCF 3FTGA 3QO0B 3J8F7 5K9JL 1F4YH 1A1NA 4N68A 1K4DB 4PRHD 2CO6B 2CRIA 4MA1C 1AQKH 3EYVA 5EBMA 3FO2A 3MCKB 3UJTH 5F44A 1BVKB 4MLSA 2DQFA 1XF1A 1PSKH 1SBBA 1T0NB 3S36X 5EC2B 5HHPB 3QJFB 1K5NA 1LP9A 3BW9A 1F3RB 1DBAL 3OKNB 4XH2A 2XPGA 5I18L 4GUPA 1FFQA 4XWGH 2DQTL 3TJEH 4LARL 3LEVH 1DBBH 3Q5YA 5DJXA 2KL6A 4XI5D 1A14L 3V0VB 1XF4B 4N0UE 5EC2A 4LSVL 3J7HA 3LN9A 4AMKL 3ME0A 4YHPB 4XPTH 5DC0A 4PS4H 3FO2B 3FO0L 3MCKA 2LAGB 2G60L 4G6AD 1MRFL 1DP0A 1KLGA 4Z7WF 1QFUH 2P8PA 4DVBB 3BKMH 2I27N 4HEME 4NJAL 2J8HA 4F8TA 4PG2A 5HVHC 3B2VL 5D1ZB 3LEVL 5D9SB 4HFWA 4XHJC 2YPLD 3VGBA 1U93B 1EHXA 1IEBA 1DE4B 1I9IL 3NIDE 3OTTA 5J89A 4FQXA 1JWUB 5EORH 2O5XL 5J3HD 3QWOB 2YD4A 4G9DB 5AD0B 4HQQL 2E7CA 1NKRA 1I7TB 2VJXA 4X4YB 4P9MH 1EDQA 2X4NB 5C0RH 5C0BA 5DC9B 2A9NL 3P30H 3ERYA 3RDTC 3BYTA 2UWEB 1WF5A 5HHNA 3MLTB 4KI5C 1FNSH 2XKSA 1F42A 5SWZB 1UACH 1YMMD 5ALCH 3RDTA 2DLEA 3T3PE 5J6GA 2CKBB 5IB4A 1M05B 4ZFOB 4J6RH 4DGYH 2DLGA 4MVBC 1CICC 5I76A 4FTVE 4NCC2 3D85B 2DJUA 3KLDA 4CVZA 1SQ2N 4LSQH 2CJUL 2MPAL 3U7YH 3QUXD 4HSQA 2X4RB 4XZUB 1KEML 3CFJB 1EZVX 2C3HA 1P4IL 3O41A 2EDEA 5D6CA 5LAXA 3UTTE 3TEUA 4M1GH 4PJXF 2X40A 3LS4L 1JYXA 2WSKA 1HWHB 2H1PL 1RSFA 4M7KH 4RBPH 4HZLA 2PO6B 5FHAH 2WIMA 4HMCA 4NC1C 5TPWH 5D7JA 5EZOH 3WIFB 2BNRD 3LD8B 3V5KB 2HJLB 2WBJB 2P8PB 3QBTB 4PJ5E 4Y16C 1PY4A 5DHYA 3TN0D 1KCUL 1KN2L 2NXYD 2WBWB 4FFYH 3VJ6B 2YD6A 3C6LD 1TIUA 4IRSA 4IMLB 1V05A 2FJFA 2GJ6A 1K8DB 2BSTA 1J86A 5D72H 2VABB 2SEBB 1LO4L 4LNRA 4R0LB 5DJ6A 4YFDB 4JCMA 4F15B 1K5NB 4GKNA 1KB9K 3ECBA 1WIPA 4X98A 2H1PH 3WNNA 2PO6D 4I13B 5I8CB 5K59E 4JRXA 3RTQA 4F7CB 4JFFD 3Q1SL 2R23A 4L5FH 4PGDA 4H88H 4HJGB 3PDDA 4ZUWA 4E41A 1KPUB 5BV7L 1YEGL 4G7VH 3WUWG 5CEXA 4PJIA 4CADB 1DVFB 4MJ5B 2W1NA 4JJ5B 4MAUL 4XP9L 4EDWH 4H20H 3W9EB 3DGCR 3B8SA 4Y8AA 1G7HA 4Q0XH 4D2NA 5HYSB 1YYLL 1WWBX 4C4KO 4GOSA 3IDGB 4GQ9H 4EIGB 4I3RL 1AD0A 5F97E 3ARFA 1NBQA 2OR9H 3BSZL 1TZHA 5BRZD 1S7QB 1CDIA 3IFPA 5C08B 5HGAA 4HXBL 3QISA 4UB0H 2AXFB 5D1QB 3TBSB 1JK8B 3HPLB 2HT4C 4BFBD 4U6HB 3CMOL 5DQJB 4MAYD 1FVCA 2EDYA 1P2CA 5GSRA 1VKXA 1YN7A 5JLZB 2R56L 5HPMA 1RK1A 2ZOLB 1IMHC 4FP8L 3S34H 3PWJA 5E2WH 4YFLI 2ENYA 5I1GL 4P2QB 4QHMB 4JCLA 1WAAF 2Q8AH 4XVTL 4E0RA 2OQJB 4I9WD 2OCFD 2FGZA 5FUCC 4J3TA 4OFIA 5IJKC 1YNKL 3MRDB 3H7BB 4FQPA 3GMOA 3PJSA 2R1YA 2FWOB 2CKNA 4R3SA 2WBJD 3IETA 4EI5B 4K9EH 5HHXL 2A77H 1OAXH 2A83A 4JRXB 3RTQB 2CLVA 3MLRH 4HV8A 3ULUF 1WBXA 5I1KL 1E4KA 3K1DA 2X7LA 4KKAC 3A6BL 4DGIH 5MEOB 3GSWB 5EORL 2ITCA 1UH2A 4OLYL 1MCCA 1IQWH 4RNRA 5IM7A 1ZHBB 4NN5B 1UGNA 4LLUB 3OB0K 4XWOC 2YPKA 3N50A 2VDPL 3OHXB 5DUML 1EGJH 4K94L 4YHKL 3BDBA 4AIZB 1QFWL 3TGXA 3RY6A 1NAKH 2F19H 4Z95L 4JO3H 1O7VA 2UY6A 3ARUA 1DBMH 3ROLA 3ULVD 3WO3B 2DMBA 2GT9B 1IC5L 2VLRA 2VOTA 5IJVB 1BHGA 5FUZL 1GAFL 2EDNA 3B9DA 3MR9B 1DQMH 4Y4KD 1C16A 4QRSA 1VCAA 2YPLA 3BE1H 3PXJA 4FABH 3O6FC 3UPRB 3UC0H 1DSFL 1MY5A 3AS3A 1DQQA 3V7MA 4OCSL 2ORBH 2R15A 4X6DE 2OYPA 3ULSB 3U4BH 1UWEH 4GRLD 4NC0B 4LPWA 1MJJA 1OVZA 3HUJB 4JO2H 4MQXC 1GGBH 3D85A 1WSST 2JJWA 4ZDHB 5DJ0B 3DOSA 4JKMA 1P1ZB 1OTUD 1RVFH 4MSWB 1MWAA 3ZE2E 4HJ0D 1UH4A 3RY4A 3NFNB 3E1F1 3SDXF 2E3VA 4KTDL 1IBGL 4MVBA 3QI9D 4AY0A 1JHKL 4D0CA 3MNWB 4MD4A 1N64H 1JHLL 2VR4A 3HZVB 3ABZA 5LCVL 2YPLB 4MXVE 2RQ8A 2GCYA 3CZFB 1OTTC 2DAVA 1QFWI 3V6ZB 3MLVH 4RZCB 3AREA 3WNOA 1UM6H 2GFBA 1YEDB 5H2BA 5D7SH 2K9UA 1CE1L 4FMKA 3VW3L 5AYQA 1NCCH 5C0ND 1D5MB 3PGCA 1W72B 4GRWH 1INEL 4MXWL 5D7LD 1GGTA 5D7IF 1JK8A 2FGWH 4NM4H 4LEXH 4MVBD 1NUDA 3HE7A 1G0DA 5HHMB 4PRHA 3X12B 4R2GB 3FJTA 5AZ2H 2VXUH 4TVPE 1KJ3H 3QUXC 1U42A 2ZPKH 5E5MA 4P2OB 5HPOA 4E42A 1NC4A 2K7PA 4I4WA 1CD9B 7FABH 2J2ZA 4FQXC 3WJLC 1X4YA 4WIQA 3S3JA 4JM2A 4YZFF 5JHLH 3E8UL 1AP2A 5F7MC 3V95A 2PXYC 4S10A 3PDGA 5CBAA 1BEYH 2IFFH 2UVEA 5IK3A 4W4NA 1NLBL 2EC9U 2NX5B 1I1AD 5J12C 2VXVL 5I74C 1M6OB 5LQBL 4OAWB 4ODWA 5FKAB 3PL6C 3MRJB 2E27L 3T0BA 5JA8B 1HH6A 5HDQH 2DOCA 3QDGB 4GLRH 2W9LA 1MQ8A 2HKHH 5I8EA 3C9NB 4XPBH 2XZAL 3MODH 3EDEA 1RUAL 4DN4L 4ODUB 3SDDD 4Q9RH 2PCPB 3CFCH 1IVLA 4OZHB 3LZFL 5CGTA 1D6EB 3DV6A 3AS1A 1NQBA 4NSKA 5GRJL 5IFJB 1T1YA 1EFXA 3PV7A 4FFEX 2FNBA 2XTLA 4Z5RB 4UUJB 1EUUA 3VWJB 3MPCA 4XNXH 5I1HL 4PJCE 3MQIA 2NZIA 4TSCL 1X5IA 3T0XA 3KYNB 3TBWB 2DLIA 3TZVA 2G2RA 2Z91A 1JHTA 4AG4L 3RAJL 4OCWH 1K3IA 1T1YB 1CXKA 4JRYE 4JPKH 4MA3A 3P4OB 2NY0B 1QSFB 1N64L 4G8GD 2ADFL 2KH2B 2OJEA 4NDMA 2D3VA 1WQVT 3V5HB 1NUNB 4FZ8L 5BO1L 5HHVH 3AY4C 4LRNH 3DV6B 1BD2A 4PJGB 5JHDE 5CEYB 5IHZB 5D7SL 5CIPB 2EYTA 1IGCH 1JF5A 3JWDH 4XVUD 3ZE1F 1CS6A 4OV6F 1E27B 4ZYKB 1LDPH 3I6KA 3NABL 1EVTC 2QQNH 2X1PA 2O26U 2YR3A 3VGHA 4J8RA 4PGBA 3ZHKA 2MJWA 5C0IB 4WUUA 4HT1L 1OB1A 1KIQA 4LGPB 4R9HA 4HIIA 4JQIH 4OGXL 4XC1L 3P9MB 4JDTH 5HI4C 4IMLA 3FRPG 4P2OD 5EOCH 3X14A 4A6YA 5CKAA 5E6ID 2HVJA 2Q6WB 1YY9C 3FN3A 3O9WD 3ZKQD 2HAZA 3R1GH 4UILL 2X4UB 4DW2L 4IRJD 2CXKA 3LB6C 1AD9A 4Q6YA 3VXPB 1OWWA 3K80A 3K81A 4BQ6A 2F5AH 1A9EA 3JVGA 3NABH 4F7PA 5B8CA 5C0FA 5IEKB 1VEOA 5LAXB 4JB9L 1J18A 1KB5L 4XCEB 5JW4R 2V2XB 4TSBH 4KJYB 4KJQD 2E27H 3QEGH 5F9JA 2WV3A 3L5WB 4JFDA 5HGHB 4XBEH 3L3JB 5TE6L 4JRYD 3QZWG 4LU5L 3OGCB 4DWHA 3U7WH 1NJ9A 5KSUA 1P6FA 1T7VA 1BFVH 2FJGA 1C7SA 3C6LC 3FOMB 4LDEB 5DTFB 3H3KA 3QZWB 4FS0A 4OZFG 5AYUL 1XCTA 3X3FL 4JFEE 1U8LA 5DURB 4PRPB 4KK8C 5JHDD 4K8RH 3VG9C 4S1QL 4DUWA 4M9OA 3B5GA 5GGSY 3VRIB 2YN3A 2R56H 5IHUL 1JRHL 3MBXL 5TE4H 2CUMA 4KZEL 3JTTB 3VCLB 2X10A 4WU5A 4MXQC 3TA3B 2J8UE 1ZE3C 3UYPA 4DVRH 1NFDA 5A16B 2HTLC 3RA7L 3OKDA 2CRYA 1IC4L 2AXGA 3ARFD 4FTVB 3HC0B 4RWYL 4ERSL 1KCSH 5L2KD 5KOVC 1JWUA 1QBML 4Q97A 3RWDA 1IT9L 1AXIB 1JPSH 3LY6A 1AXTH 3QB7C 3UPRA 3ILQC 4NIKB 2ZUQC 3ZKMC 4XMKL 1HEZA 3GSQA 2CO7B 1G9MH 4JO4H 5IFHH 3D69A 1VPOH 4M5YL 4GAGH 1I85C 5D2NE 3D0LA 2VN4A 3MUGB 3CMOH 4H1LG 5JORA 3QEQB 4KDVA 3GRWH 4JRXD 4KKCD 3RTQD 4JHBA 3QEUA 2HT2C 3WIHH 4OZHF 4TUJA 5E0QA 1TMCA 4EBQH 3HFML 1TJGH 3T4AA 4Y19D 2Y7QB 1RUQH 5DHYB 4Z7OE 1PBYA 2P5EE 3D2UD 5FA4A 1E6OL 4PRNB 5TDNB 3EYFA 3KPPA 2WWKT 4JFDB 3D87B 2C1PB 2O5YH 4D8PB 3IJYA 4LU5H 3VXUA 4G9FB 2VKWA 3DX9A 4YBQC 5FM8A 3K1KC 4ZXBD 2AJYL 4YO0A 5CJQL 2QEJA 1KG0B 2C1OA 5D1QD 2NY6C 1RK0A 4GW5B 3I75A 4Z7OF 4R3SB 1IEHA 3W0WA 4GRMA 4L4VA 1LO5A 1S9YB 1GGBL 1F97A 5BRZB 4JZNA 4OZGF 3EGSA 5D1XA 3WKML 4S1QH 1I9JH 4GG8B 4M43L 1AP2B 3BWUC 3WKNA 5BZWB 4K3JL 3G6JB 5EOTB 3P73B 3MV9D 1AGBB 5MEQA 2ICWB 2P24B 5AYUH 3TT3H 5I8OH 3AXLB 3FL7A 3O8XD 5SX5K 4FQHB 2A9MH 1FLTX 5HXMA 4EBQL 2PW2A 5I1AB 7CGTA 2J88L 3E2HC 3B9KC 1A64A 3QNXA 4J3UA 3SDDC 5C0CD 4PY7B 2GITB 4WI3A 3B6SB 5FGBA 4DJMA 4R96A 5EOQL 3IFPB 4HPOH 5IESL 3GZKA 2I9TA 3MRFB 2H6PA 2DQUL 2RFXA 3MOBL 5GSVA 1JFQH 5AUMB 4WO4D 1KEGH 1U3HB 3BIBX 4RAVA 4GAYA 2ZCKH 5DMJB 4KZDL 1U95B 2H2SC 1BJ1H 5DHVH 2BVOB 1PAMA 3CZJA 2VAAA 4QRUA 3WEXB 4DZBB 5CJ5A 1H3XA 5IFJA 1NC2A 4LFHG 4WFGD 2FSEB 3BD3A 5JPNA 4PJAA 3ARQA 4AEIH 5DRWA 3ZSSA 3VXSA 2YC1B 3B9KA 1A7PH 3H9SE 3MLXH 1A6UH 2AJ3B 1FNSL 3KDMA 4Z8FH 3WNPA 1QLEL 1KXQE 3H9SB 5EWIL 5CEYA 3BUYA 4PJGA 3DRTA 4PP2B 3U9UB 1EH9A 3I6GB 5T1MA 1MWAL 4WU7B 4BQCA 2RHEA 4DQOH 3V7AG 5DJ6B 4HK3J 5EU6E 3SDCA 1PZ5B 1CQYA 4LLDA 1A4KB 3MRHA 4HUVA 1BLNB 6CGTA 8FABB 3VXUE 5SX4I 4TVPD 1WT5C 4MNHA 1SJHA 5HGGS 1JFMA 3LEYL 3NBNA 1LNUB 1JFQL 4L5FL 1JGVL 4R4BB 2DWDA 1UXWB 2AJVH 5GGRB 3T1FB 3HI5L 1N6QH 5I17A 3VU2A 3RJQB 3AGVA 4G42B 3DIFA 3KG5A 5D6CB 2V9QA 2X9XA 4MXQD 4HZLB 3PE9A 3MLUL 4NOBA 3MLSL 2N56A 3P3YA 4WI4A 5GS1B 4Z0BH 1A3QA 3PGFH 4K7PX 2V7HB 1A9EB 3P77B 3PHQB 4F33A 1F4WL 4WDIB 3ZYIA 4OFKA 4NFDA 3QWQB 5L7XH 5I1IL 4KKLC 1R3HA 2V5MA 5E08L 1XGRA 5EUOA 3S5LG 3RBGA 3RKPA 1W72H 3JV6B 1JZ3A 1FDLH 3V6BR 3ZT7A 2CKBA 3BRGC 1DQTA 2ZOKA 4LLMB 1XF5A 4BQBA 4PJDA 1MFDH 5DK0B 3KPSB 1B2WL 2NY2D 4B53A 4EDXB 1OB1B 5C0IA 1GGIH 4TOYL 2A74B 4PUBL 4G6JH 4OCXH 3AB0C 5KW9L 1G7LB 3C09C 5DJZA 3IGAB 3I50L 4PJ9C 1ETZA 2WUBH 4LMQE 3QZWA 1GPOL 3KYMA 4PRIB 4U1LA 3SE9H 3E6HA 1JPGA 1KJVA 2X09A 1FIGL 2DBLL 1UWXH 4N0CD 4CMMA 4XPTL 4G8IA 2OBGA 4KROD 3VXQB 2YD1A 4OJFL 3EO1A 4HH9A 4PJHA 4F3FA 3MA9H 1KTLA 4OGAD 3DX7A 5F7EH 5CSBA 3UJJH 2QKIA 3ILQD 1DBBL 3L3IB 4FFWC 4FQXB 4KDWA 4ZPVA 5B8CB 5C0FB 5IEKA 3F7VB 1JTOA 1I8IA 1S7TB 5I1GH 4NC2B 1QPPA 3TZVB 4B7LA 5D2NA 1ZS8A 1E4JA 1BJ8A 2A1WH 2IG2H 4MA1B 1D5MA 5IJKA 5I17B 5JQHC 3OKKB 1MCOH 1LO0L 3OXSB 1G6RA 3DUHA 4XBGB 3T0EE 3OAYH 3VFWA 2V2WB 3WXWH 2YPKB 3ARGB 2WIIB 5ICZA 3PL6B 2FH8A 4Z7VF 3NIGE 1NMBH 1NGWA 2CIIA 1DDHA 2CDEB 1OP3H 3VFRB 4TOYH 2VQ1A 4WWKC 1AH1A 4KXZI 2EDHA 1R5IB 5C0AD 1D5IL 1FO0H 2DM3A 4XNZB 1F6FB 1OPGL 3D2UA 3UTSD 4WEUD 2OJZH 3HUJA 4YXHH 3VRLF 4Q6IB 3O9WC 3NGBC 4QGYA 2VDKL 1NGWB 2CIIB 2ORBL 4KVCL 1NBZA 1SYSB 3ULSA 2WBJA 5TDOA 4JFFA 4BSWB 3CDFA 2EDQA 3TFKA 1MOEA 2BRRH 4N8VG 1OAZH 5CS7A 1ZLSH 4GXUN 2ARWA 4X6CB 3IDNB 2GKIA 5J3HC 5D7KE 4XP6H 3FQRA 1KYOJ 3WXVL 2A6JB 2I60L 3S3PA 4UTAH 5HI3D 3RWEA 5JW5B 3FT3A 1WIUA 4HGWA 5EZIL 3WNKA 5J57B 1JGUL 4YC2C 2BOCA 1QFUL 2W91A 3QUYD 5E03A 4M8QA 1U8IA 2CUHA 4U33A 3KYKH 3G9VA 4HWEH 5FIEA 1FGNH 4OZHA 4JFED 3T77B 3FRPA 3BKCL 4ONGL 4H0IA 3LHPH 1AR1D 1HZHL 4X9FA 3PGCB 5IG7B 4WHDA 5TE7L 3OZ9L 1I3VA 5T1KD 3I84A 4NKIH 4E41E 3OJDB 2J7LA 4MMZC 3QA3B 1R5VB 5I71C 2J5LB 2QQKL 4OSUH 5ITFB 2NW3A 3FFDB 1FL3B 1NFDF 2NTFB 4B0MM 4MA7L 1G7IB 3QQ4B 2DIAA 2R0KH 3CC5A 1LMKA 2ICEA 3HLAA 4ODVH 3SKNB 5J56B 2APVA 4MSWA 4WHYH 1S9YA 1CLYH 1GVIA 1JZ7A 5GS0L 4J3OC 4JQXC 2E5EA 2YSSB 4WVRA 5D8JH 1LO2L 4ZFZB 1YMMA 4D9QE 3IVKA 3A6CH 4XC3H 1TJIH 2WQRA 1IC7H 2MHAA 5L0QB 4IS6A 1D9KA 5GJSH 1U3JA 1UH3A 1FGNL 1DQJB 1NGXB 1A6AB 1QEWB 4ELMF 1CIUA 2Q3AA 3H0TB 4NRYB 1Y0LA 3EW3B 4RWYH 2ID5A 3GSXA 1KULA 2DLHA 3HE7C 1HHHA 2EEAA 4ZFFB 3MRKB 4F7MA 2EO1A 1A6TB 3H2WA 4K7FA 1G7MB 1HI6A 3U82B 5TE7H 3HR5A 4GAJL 4WU7A 2N4IA 3ALWA 2CR6A 4NQSA 4DKEH 1S5IL 1ODAA 4QHNA 5D1XC 1KC5L 3O2WH 5GRJH 4KFZC 3MOBH 2PO6A 5F1KC 5LXGH 4X6DA 1BREA 4NO5A 5BJTA 3KLHC 1YY8A 2Q7YA 2JF1A 4YK4C 4YXLL 1NBYB 3OJVC 1H3PL 1BEYL 4OFDA 4MMXC 1HEZB 4RDQG 2AXGB 5C6WH 5DRXA 1LEIB 5DUPH 4LQ1A 1Q72H 1T5WA 3SHSA 4B41A 1Z3GL 3HG1A 4RISH 1CU4H 5EBLB 2DQHL 3NZ8A 1DN0B 4XMLH 5MP6L 3SPVA 3IU3B 1MCWW 2KDGA 2DWEA 3TBTB 3FTGB 3P0VL 3QO0A 5DDHA 2ZP0T 3QDGE 4OZGB 4KUZL 2NY4B 1INQA 4XPAH 1KT2B 1U8NB 4LHQB 4YHZH 4AQ1B 3MR9A 3O0RH 2HG5A 1IGFH 3V0WL 3LV3B 1EGJA 4ZTOL 4HUXA 3HE6B 5KS9E 1HKFA 1YN7B 4XI5C 2J12B 5ANMB 2W0FA 4AEHL 4Z7QF 4OGZA 5A2KH 4WW2A 3H42L 3N1MC 4V2BA 5K93A 3STLB 5KAQG 1EXUA 5H94B 3EYQC 3BGFC 1QO3B 1HSAB 1M7XA 3TVMD 4APQD 4DFIA 1VA9A 5DJDB 4PR5A 1NCDH 1OAUH 2HRLA 2DN7A 3HCVB 1UA6H 1NCWL 4QRTA 3LKNB 1I9IH 1AD9B 5C6TL 1OAQH 3K46A 1OPGH 1FE8H 4LGSB 3N9GL 5FO8A 2IH3B 4QEGA 2MWCA 1E0OB 4F7PB 3IJHB 2VTFA 3WLBA 2ICWA 2ZCHL 3EGSB 2PTVA 2WBJC 2VIRA 4WFGE 1WICA 4F7TA 3AVEA 1JUFB 4HXAH 1DEEB 3VXRB 2A6DA 4YDIH 3G6JA 4OLEA 2OMNA 4ZAKC 2NTFA 5D6DC 3F6LA 1G0YR 1FCGA 5TQ0H 1AR2A 3QO1A 2YD5A 2V7NA 1AQKL 1S7XA 1GYAA 2IH3A 4FG6D 4K7PL 1S3KL 4U1JB 4A6YB 5JLZA 1B4JH 5HDBF 4XNQB 2WP3O 3MRRA 3F7YB 3QR2A 1KIQB 1EGJL 4K94H 4YHKH 2YD2A 3L6FA 5L88H 1N0XL 2MMXA 1P84J 1MELA 1KB9J 3PHOB 1BX2B 4PUBH 3X11B 1UJ3C 4GRWE 1ZLVK 4N9GB 4LAJH 3HUJE 2G75A 1F3DJ 4OUUA 5F1IB 2OL3A 2PN5A 3CDYA 4YDKH 1B88A 3FQTA 4RFEA 1DVFC 1BOGB 4CMHC 4DTGH 5CJ8A 4KI1A 1A3LH 1NFKA 2HLAA 2HH0H 3VD5A 3DI3B 4FQCL 5IWLC 3BPLB 1NL0L 1WZ1H 4HH8A 5ECJE 1LK3L 5E6IA 1U3HC 4A2MA 1I8IB 1OTUC 5JW3L 1SM3H 5CINH 1CT8A 4W81A 5L2KE 1UCTA 2EYSB 4XP1L 2I5YL 3SJVD 3CFJA 4CBPA 1KPUA 5EU6A 4NQDB 1XGTB 4ZAKB 4Y16D 5IIEA 4QOKB 2ZG2A 3GBLA 1EEZB 1FGVH 5ALCL 4DCQA 3GSNL 4N0YH 4NN5C 4AQOA 5AAWA 1LK2B 1T0MB 1ZT7A 2ZNXA 5FYKU 3BP4A 4UNUA 3NA4A 2DMCA 5GRXG 4EJ1C 5ID1A 4XCFH 2VABA 3EOBB 1KELH 1CLOH 1QBAA 2D9QB 5IVXB 1MEXL 4EUPG 1NGZA 1XGPA 1Q9KA 1JRHI 4N0CC 4YHOL 4UAOC 4X5XA 5FCUL 4UNTA 3RKDD 3WJJC 3TFKC 3P2TA 5HGDB 3FCTB 5D71H 2XY1A 5FM5M 3LKPB 4OZ4A 1C1EH 4BFGA 4CMHB 3RL1B 2BHZA 4KVNL 3VMOA 2FYYA 4WCYL 1LO0H 3L3DA 4GH7B 4Z7UB 2FR4B 1BOYA 5IW1A 3ZLQC 1CD1A 4ZPVB 5DRNA 4L8DB 4XHJD 1MCSA 4P2CG 2FO1A 4I48A 3DTXB 2IBZX 4HMDA 3SGEI 4X6FA 3SCMB 3ES6A 2H41A 3X13B 4RX4D 1S78C 4H5SB 5DMIH 4PTUB 5EU5A 2DF3A 4MGXA 4N0YL 5AG9A 4YPJA 4TRPL 1HHKB 2Q8AL 3GHEH 3GKZA 5HHMA 4NQXB 3HG1D 4OZFB 5TJWK 3RWHA 5FKPB 5BRZE 2IAMC 1BJMA 1EEUA 1MLBA 2P7TA 1YQVL 1X7QB 4YDIL 1K4CA 4HUKB 3SCMD 1P4IH 3QUKB 1GXEA 1GC1C 4QHUB 3RIAF 1IARB 2Q76A 4NNYB 3FN9A 3PUCA 3O6FB 1BD2E 1N2RA 5I73C 3V4UL 4I3SH 5JOEA 3DVFA 1EAPB 1JBJA 2XA8H 2YUWA 4U1SB 1Q94B 1TVHB 4JQXA 2A73A 3VGFA 3E2HA 2DL9A 4N0UA 2VLLA 4TUOA 4G6KL 5AG8A 3RGVD 3TH2T 1DE4A 1DQQB 4PREA 1G7PB 2VAAB 5E9DB 3OKKA 1LO2H 2G5BB 5I74B 4PGZA 4PLJD 3QPXH 5F72S 3U4AA 3EHBD 3VG0H 2LQRA 3C60A 4KAQL 2A9ML 4UUJA 4ZOAA 4X7SH 5F9AC 4HLZG 5DJ8A 1JN6B 1KCLA 5EUKA 1AI1L 5C9KA 4J4PA 3JWDL 3R0MA 1I7ZB 1R24A 3BEWA 1XH3A 4Z9KB 1OL0A 1H0DB 5IFAH 4YBHA 1HHHB 1INEH 4PGCA 4HWZA 1TZIB 1N5AA 1Y6MR 1AGFB 2CJUH 2MPAH 2FX9L 5EO1A 1ZHKA 3U7YL 2I60H 2CLRA 3TM6A 2D31B 3BI9X 3UEZA 1QSVA 4NWTL 2CD0A 5DJYB 3Q0HA 5BS0E 5M95B 2GHWB 1R3KB 5IB5A 2EDBA 2I26N 2X70A 4PJFB 4YWGH 5IV2B 4PLOB 5KVGH 3UYOD 4WTXA 2YSSA 1NDMA 4HIHB 1KNOB 1DCLA 3B4NA 2NY1D 4GMSL 1HDMA 4LSRL 1GHFL 1ROWA 5KZCD 4XXCA 2IPUK 4EXKA 2Y6SD 4LHUG 4JM2B 3MRBA 5K9KA 4POYA 3UTQB 1LD9B 2GAZB 2AEPL 2MCPH 2YMXH 3DX6A 4ETYA 3MRLB 4O58L 3DTXA 5E08H 4CUCA 4OF6A 4FNLH 1UQSA 4Q9CA 5DJYA 5D7IB 1NCTA 1KJMB 2P42B 4LHUA 4QXTB 2WINA 4JFZL 5JUEL 4BQ9A 5KAQF 1CBVL 5I1KH 1PG7W 3IJSA 1H3VA 4ZQKB 3MV7A 3C6LB 4YIQB 3MJ9L 2EKSB 4UIMA 4WW2B 2IG2L 3WDJA 4YE4L 2AV7A 5GGTL 2V5RA 4J4PC 2ZSWB 2P4AB 1UXWA 4HF5H 5D7LE 4BZ2H 1ETZB 4LHUB 5DMGC 1CLCA 1P5UA 4HIJB 5EO9A 2Y06H 1SY6A 3SKMA 3CFDB 1JNHB 5D93C 4NKMA 1T1XB 1YECL 1IM9D 2P5WA 3MRLA 4NOFA 2EYRB 2GY5A 3PWNB 3P73A 2A9NH 2P8LB 2VC2L 3HRPA 3SBWC 1F3JB 2B1HL 4CVXB 4GSDL 4MJ6A 1H8NA 4RQQA 2AK1H 3ZO0A 4J7RA 3VD4A 4NYLA 4LVEA 3GJFH 2PR4L 1QHPA 1FPTH 2AABH 4NRZB 4F9LA 4FQ2H 1BBJA 3EJJX 4PJIE 4U3XA 3HI1B 3W2DH 5DRXB 1LEIA 2Q20A 1AGEB 5KVEL 2DQUH 4JGUA 2JCCA 5CWSB 5D96B 2NXYB 5ALBH 4ZXBA 1W0VA 15C8H 4ODBD 1T2QL 1ORSA 4ODSL 4QKXB 1T83A 3JBG7 1FFNB 1N6UA 5BV7B 4YE4H 5FECB 1VDGA 4QGTA 2E6PA 4V2CB 3CMGA 2DJ4A 3G6AA 4WNQB 2CRZA 5CZXC 4WI8A 3RVVD 2F53E 5GGTA 3OAYK 1MLBB 4NQSB 2O5YL 2NMSA 2GT9A 5DD5L 4YFLF 2D0HA 2D7MA 1IKFH 4JG0H 3IF1B 4ZXBC 4F7MB 3BDYH 4QTHB 2CIKA 4Y1AA 1QFWM 4M1CD 3GM0A 5GRUL 3QUXB 1TJGL 4IIQB 4KPHL 3TC9A 2GSIA 3PNWB 3V0WH 4YFEA 1KXVC 1S7TA 2FEEI 5F3HA 3V4PH 4M7LH 4Q2ZB 2FWOA 1A02N 5ISZA 3PJSB 4XC1H 4FXKA 3LQAL 3QI9B 5M7QA 1BVZA 2VDMH 1P9MA 4UOW1 2CSPA 1G7JA 2R29H 1U6AL 3VXSB 1S9VB 5L8KB 2CLVB 2YZ8A 2GJZA 1UB5B 3RUGA 1XGYL 3ZTNL 12E8L 4ODHL 3FQWB 5EPMB 1AHWA 3L9RA 3H3PH 4RAUB 1ZEAL 5CLWA 3FB7A 1L7IL 5I1LA 2YKLL 3DSFL 4KRLB 3ZT5A 3RVTD 4BH7A 1IKNA 4XVUC 4HW6A 4XXCC 3SGJC 1C7TA 3HI5H 5ICXA 5CHNA 4NT6A 5GGQL 3H9YA 1UWXK 3LKRB 4Q9QL 5AUMA 5GQBA 1X5YA 4AM0A 2YUZA 3TJHD 3PP4L 3QDMD 3CXHJ 4OBRA 1HSAA 2ZSWA 4LPCA 4P57A 4AIOA 2VLMD 4MD5A 1VGEH 4LCIL 2AXFA 4ZS7H 2Y1VA 4UT7H 4RX4A 1PZUB 3G6JE 3S4SG 1E4WH 2IALB 3OAZH 4PLNC 1TMCB 5EC1B 2A6JA 1IEBB 3VGAC 2LV4A 1WBZB 2PR4H 3WV0A 5FO7B 2VE6B 1NEZG 1MFBL 5E6IB 1JNNH 3D39A 3ARXA 4LLVB 4WFHE 1KIRA 4YEEA 2VWEC 1RZJL 3HI6H 1DN0A 1ACYL 4FFZL 3VXSD 4PJBA 3W0WB 3WS3A 3P30L 1R3LB 3DUSA 4FOMA 1RIHH 4N1EA 2YN5A 4G8FA 3MUHL 2C1OB 1LO3H 5TF0A 2CGRL 3O6LL 1IT9H 1WZKA 3FQUA 5EOCJ 4B50A 2WWKO 5FHBL 3HHRB 1WAAA 3ARGC 1CDJA 1MAJA 3QIBB 2ZUXA 4ONHA 5C09D 4X6DB 4F7CA 1B2WH 1GZQA 4QY8B 5ICYB 1FZOB 5KJRH 3MRRB 3RL2A 2IF7A 4TSAH 3UXFA 1ERNA 5J7CC 5E7FA 4RWHA 1U8MB 4MHHG 2EXYC 2P44B 3ARVA 3PWPD 5IWLA 4YDVB 5EIIA 1O7SA 5F9WC 4X4XA 2BMKB 5F96H 3S35L 4GBXD 1C5BL 2VITA 1I1CA 5C07A 5DZNA 3ARFC 5ESQA 1T3FB 3ULUC 1MHEA 2JB5H 1N8ZB 1VPOL 1FO0B 1PLGH 1QBLL 4LHUD 4OQ1A 2IAMA 1FLRH 1Z3GH 2EDDA 4Z95H 4YHNA 4RIRA 4UOW0 2CKBH 1YZZA 3QHFH 5L6YH 2WWMD 3EUUA 1JYWA 2UUDK 4LKCA 3MRMB 5FO7A 5E9DA 1GH7A 1KCSL 1Q0XL 4MA8H 4HC1H 3B8YA 3MGOB 1BVLB 5LBSL 3MREA 4TSBL 4CU8A 1T21A 1UEMA 2ENSA 2VL4A 3IXAA 3P0VH 3NFSL 3P4MA 5F7KC 3IAPA 1S7UA 4DOHB 3MBXH 1Y6KR 3G5XA 3C9NA 3TP4A 4QXGL 4GAGL 4G8IB 1AQDA 1A8JH 2UYLB 4NN6B 4AH2A 2FZ3A 2JCCF 2EECA 4JREB 1TQBB 2D03L 5DVKA 1XGPB 2XV6B 1HYSD 4WUKH 3NZHL 1FYTB 1IGYB 1PEWA 2NY0C 4M6OL 4IHOA 3U0WL 3L5IA 5L88L 3QFDB 4X6BA 4I5BA 4YHLL 4PGBB 3ZHLA 4GKOA 3ZKSD 3FONB 4OJFH 4LSPL 2OXGA 1KCRL 3O6LH 1BFVL 5BVJA 5DD5H 3SE3C 4YLQT 3ZDYE 1D9KD 5D7JC 3VFGH 1VEMA 3TYGL 4JHAH 2XZCH 4X0KB 1CGUA 1MCEA 2BNRB 4NP4L 5HI5C 4JKWA 4NQDA 2ED9A 3VRLE 2XQYK 1I9RH 4XPGL 2EH8H 3V5HA 3RZCD 3F7RA 4EEEA 3OKEB 5HYJA 3HZYA 2BCKA 4O58H 4P4KA 5ISZB 2DLFL 4NO2A 4WWID 1LO3L 4PD4K 4LP5A 1IAOA 5J13B 1YMHA 4P46A 3CSYA 1NC4D 3ALPA 2KUTA 2G5RA 2HMID 4RGNE 3T3ME 4OB5H 5CCKH 1A5FL 1I7RB 3VXOB 2IAMB 4F9PC 3DLQR 5DS8A 5I1HH 2ITDA 3UTSE 1M7DA 1Z5LB 2OTPA 3A6OA 3JTSB 4NSKB 3ARWA 3B2UD 5DYOB 4WHTB 5CGYC 3S5LB 2AJ3A 4Q9QH 4GLRI 3UZEA 3LEXB 3BW9B 3UTPD 3M17A 3DRTB 4YXKH 1UJ3A 2NY5L 1U41A 4WI6A 4FQ1H 4U1NB 3BESR 4UDUA 4F7EB 1ZWIB 3VI4E 4YHYB 1P7KA 4HXAL 4XBEL 2HTLD 4HPOL 3HKFA 4ZFZA 5IFAL 3ZDZE 3KPLB 2R1YB 4YHOH 1LP9B 3Q48A 1FVEB 3QIWB 3DPBA 2CLZB 5IBTH 2FBOJ 3E6FA 4FQQB 4LCYB 1FZJA 1C5BH 5B4MC 3Q5OA 4RAVB 3U36B 4U6YA 4ENED 1WBYA 2F8VA 4B5EA 2F5BH 3KYNA 4EZMA 3LQMA 5DSCA 2FCBA 2V2TB 5D1ZD 1WWAX 4ZS6C 2AERT 4LLVA 2AK4E 3O6KH 3ARDA 1I1FA 5IEHB 3DGGA 3RHWF 1A6TA 4K7FB 4QNPE 5E8EA 3WFCH 2DKUA 4U49A 3GGWB 1S8DA 1MFEH 2IADB 1FZMA 2DICA 4OM0L 4Y16B 3UJIL 3T1WA 4LBEB 2PW2B 1C5CH 4OD1L 3GHBL 2NY3B 4MAUH 3SO3B 2R0LL 2WINB 1ED3A 1SBSL 2ZUQB 2GITA 4KK5D 2F19L 2YOCA 1JPFA 3RWJA 4V3DB 2PYEB 1EEQA 3LKRA 5DA0B 4J1UB 2XNAA 2DM2A 3GBMH 4QT5A 5B38G 4RFOH 4I0KA 5B3NA 4JVWA 2HT3D 3S98A 2DIBA 4O02H 1FBIL 3T0EB 1KCVH 3N1FC 3MRBB 4PJEB 1LP9F 5C07D 3OR6A 1A6WL 4PV9B 2KKQA 5C1MB 4IJ3C 2W9EL 3N1GC 1HHIA 4XP5L 5FYKH 4DQOL 4S0TD 2WWMC 1ZT1A 3SDYL 1QVOA 3QIWA 4PRAB 2ADJB 2O61A 1WZLA 4TTDD 1ONQA 1P7QD 2X5PA 4MZ2A 4XNYH 1JRHH 3OXRB 1ADQA 4LEOA 2VC2H 3DETD 4UT6L 5K9OA 3QHZL 4C56B 4U6XA 5CZKA 3QPXL 3EOTL 5GGQH 1TVDA 1J0HA 1IZKA 3A0OA 5E5MB 2AK4D 2C3GA 3DROB 2AJSL 2DLFH 5C71A 3CSPA 1IAMA 3GEWB 4NFBA 1A7BA 5A1AA 3U2SB 2XKNB 2ZCHH 4MAYC 5HGBA 2ZJSL 1JP5A 4A6YH 1B0RA 1G6RB 4XVSL 2BOCB 3W9DB 3MROB 4JFHE 2XZCL 1GOHA 4K3HA 1AY1H 2XYCA 5B39B 3DGGB 5E94B 3I6GA 1OSPH 2VLKD 2JELL 2HG5B 3ISWA 1X5ZA 4KUCD 1G7HB 3GJFB 4WFFD 5C0EA 1MFEL 3MNVB 3ZDXF 4JDTL 2D7PA 5C70A 4ZMAT 4JFFB 2BNUB 1HOCA 3I9GH 4NZDA 4XCCL 4NRZA 5CWSA 4PJFF 1F02I 2FSEA 5HI5D 1PQZA 1XIWD 2FHFA 4U6VL 5CD3A 4PJ8A 3K2UH 1OGTA 3QUZC 5DJAB 1S5HB 4WO4A 5GJTL 1N4XH 3I02A 3QFJD 3T2NL 5L7XL 4CVUA 2R2BB 3BE1L 3BO8A 3GMQA 4FABL 5DD1L 1EVUA 1YNLH 2FL5A 3T0EA 1CYGA 4KWUA 1AI1H 5C0EB 5JIPA 3VXRD 4O2CA 5GRWA 4XAWL 1F3JA 1JL8A 1Z9LA 3MRFA 5C0AE 1DLHA 2I9TB 1A1MA 2FEDC 2E7LC 4MJIA 2L7UA 4HS8H 4PJ9B 4Y4KC 1NMBL 2GJJA 1ZSDA 5KZCB 1FL5A 3LPFA 4YWGL 5J9PA 5E8DL 1T1ZA 4DN3L 2IGFH 4BELD 2GJ6D 4BK5A 1JHKH 4L4TA 4TVPL 4XCEA 3TVMB 4APQB 2DQDL 3KPNB 2PETA 3WFBH 1KTLB 5L0QC 3MV8D 5D1ZA 3UTQA 2BNRA 3QIUC 3HS0A 4CN1A 3BHBB 3WFCL 2DLTA 3I50H 4NBZB 2Y07L 3NACL 4XMPL 4LLWA 1CN4A 5JZ7C 4KK6D 2NW2A 1RUPL 5EFIA 4P2QA 1FL5B 4QHMA 5LWYL 1AR1C 1NKOA 2RR3A 3MACH 4NHUB 5FYJL 5T1DH 1XF3A 4JG1H 3LQZA 1U8MA 3X14B 1OAXL 2ESVA 4UIKL 4G9FA 2NYYD 3NCFB 3KLAB 1KLUA 5TDNA 3GSRA 4PGEA 1CIDA 3G6JF 5E1AA 5E9DD 3NGBB 3O9WB 2VLJD 2HFGL 1VGKA 3KYAA 2IMMA 2VLKE 2R9HD 3CUPB 2YRLA 4YDLB 2A6KB 4HCRA 5IIEB 3JZ7A 1HILA 4P9ML 5JDJA 1U95A 1MCPH 5E5RB 2YUXA 5E6IC 3S97C 4H26A 2G9HA 3VXNB 2Z92A 1BPVA 5D2NB 4I18B 3IDNA 3H9HB 3IDJB 4DZ8B 1MCIA 1IAOB 4XVTH 1MCNA 1MFCL 4WEMB 2FD6H 2JIXD 2PYEE 1HNFA 1ZLWK 5F9DC 3B5TA 3LS4H 1TITA 4P5MB 2OZ4A 4MS8A 1JJUA 3E3QC 3RX5A 3S36H 4TQEL 1MRDH 1JWMA 2HKFH 1HCVA 4PLKC 4PY7A 3I6LE 3U9UA 4YH6A 4WU5B 4BSJA 2BJMH 2VLLB 1DBKH 1N2RB 2GUOA 4H25A 3RL2B 1MVUB 1R5IA 4LKXA 4R97B 1FC2D 3GSWA 1MI5E 5FYJU 1T5XA 1AKJB 1IGIH 1YJDL 2A74A 1OOAA 3NCJH 1JHLH 3CVIL 2GI7A 4OCSH 3KLHD 5LGHH 4L8SC 5IVZB 1IC1A 2WZPD 5I1IH 5MEQB 1JZ4A 3FO1A 3VFSA 4TPRH 1A7QL 2BDNH 3BD5A 1NCBH 3T0WA 1OAYL 4NUGH 3QHTC 5GRUH 4XMKH 1YPZE 1M6OA 1ZS8B 3B2VH 3CLFL 2OR7A 4K94C 5DFTA 1Z2KA 1I3UA 1EMTL 2EEDA 1HHJA 2AK4A 4ELKB 2C4FT 3TV3L 1BM3H 2B8OT 3FHAA 3MGOA 2BZDA 4P2OA 3BIKB 1BZ9A 4X4ZA 4S1RL 5D9SA 1PG7X 5FB8A 4MX7B 1GC1L 3B6SA 4PB9H 4K8RC 3IS1X 4L8DA 2W38A 4XX1G 4X6EB 5I1DB 3PQYA 2BHYA 1KJVB 5KSAA 5C08A 5GGUA 3OKMA 1NLDL 3NACH 2E7HA 43C9B 3IRPX 2WAHA 3GGWA 1SY6L 3C8HA 4JQVA 2PTTA 4Y19B 1UT9A 3EYSL 4UV4L 1J1PH 4YHML 5J0BA 1DLHB 2DS4A 1RHHA 5BW7A 1LO5B 4OB5L 1Y18B 4I1NB 4GRMB 4L4VB 1T7ZA 5A2FA 3BXNA 5H35B 3Q2CA 1YEFH 3O11A 5EPMA 3HR6A 5JQ6L 1RUAH 1XIWC 3MFGB 3SGKC 2VMFA 4Z7VB 1FVDA 4KJQC 3S34L 5A3IC 1CT8B 4BZ2L 3NFPB 5EBGA 3UTOA 3N9GH 1R3LA 3MNVA 3IJYB 3KPSD 5DXWA 1V3MA 3KS0J 5J11B 3MRPA 1Z6JT 1CFSA 3MJ8B 4Y5YA 4LVNC 5E00B 1AO7D 4RCAA 5JZ7D 4LAQL 3PWNA 1KIPA 5MERB 1T89C 2WUCH 3IF1A 4K9EL 4H1LB 1MUJB 1IAII 1SJHB 4TNWF 3SBWA 2FJFB 4K71B 4CDHA 1FSKB 2E6JA 1YYML 2EH7H 5E2UL 3U2SA 3CPLA 3P11L 4D9RD 2BSRA 3O8XC 3QCVL 2EXYD 1MI5D 1AE6L 2QSCL 3F58H 4L9DA 5C07E 2GSGB 1GIGL 3NCCB 1OAYH 2XKNA 4NUGL 5HGHA 2GQHA 5KSBA 5CINL 1KIUA 5IGXH 4MZ3A 1QRND 3DO3A 2DL2A 1RZFH 2WUBL 1MAKA 5FUZH 1LE9B 1T2QH 3DBXA 4CDGC 1SEQH 4PJAB 2QHRH 4RGOL 4BFIB 4O4YL 4WUUD 3IDYC 3THML 4LSVH 3SE4C 3MRNB 1YEJH 5K9QI 1IGJA 4XGZA 3KXFB 4LCWE 3CX2A 1PKQE 1C1EL 1NPUA 3BH8A 3V6OC 3VFUB 1HHIB 4FQ2L 2IPTH 3O4LB 4LGRB 3SOBL 5J1AA 1J1XL 4MCYA 5GGSA 3O3UN 1LE5B 1FYHB 4ONFL 5AWNL 4PB0L 4F7TB 1YEFL 4NM8L 4F57L 4QCIA 2R2HA 1JNHA 1M1SA 4QRQB 1JPFB 4KQ4L 2HN7A 5E24E 1TTGA 5EIQA 3EOYG 1WCBB 3SDDA 3JWOH 5F3HB 1J8HD 3C5ZC 3P11H 4KKAD 5E8NA 1EXUB 2DIJA 5GIRB 1HYSC 4OF5A 4KRPB 1XGUA 3UPCA 3OGCA 5FYKL 4P2RB 3GBNH 1QFWH 4LDLB 5BS0B 2NY2B 3DVNA 4NQTA 4OIIL 4UU9A 3R8QA 4BZ1L 4HWBA 4JFQA 1UM4H 4R90L 5EU4B 3U30C 5E8OB 3VE0A 1E4XL 4LKCB 4IRZH 5FECA 1MHHB 3U1SH 1YEEH 4TNWK 5IMLA 1TLKA 2PO6C 4ZNEA 4LCCA 1OM3L 4X6CA 1WEJL 3C60C 1S5HA 1KT2A 1T5WB 3ZTNH 4OTXH 3H9SD 3S6CA 3SKJL 1LVEA 1QLFA 1VFAA 4QXGH 3PWVA 2H8PB 3CVHL 4D0DB 2GK0B 2D7QA 4OLWL 4FTVA 3B9AA 3A6BH 3Q6GH 2QL1A 3PGDA 1CFTA 4EVNB 2Z93A 4N90D 3TA3A 1KACB 1SEBA 4WFFE 1WTGT 5DUBA 1MY7A 5E2TH 3QQ3A 1P9MC 4LLAA 4KKNA 2HTKC 2EYTB 3N85H 3V4VL 3QRGL 5EU3B 2DKSA 1YY8B 1EK3A 3QEQE 4KZDH 1BD2D 4NQCB 3S88L 4ELMB 3DX8A 3MROA 2BSRB 4BQ8A 1CLOL 4O2EB 3BKCH 4L8CA 3W0WE 1FIGH 2DBLH 3ZDYF 2V5TA 1KSRA 3MFFB 1CTNA 2W60B 2Z31D 4KTEL 5TFSL 1V5JA 3QEQA 1U58A 1RUPH 4PJ9D 4KGLA 1ZA6B 5GRVL 5IW3A 1DEDA 5ACZA 1KIRB 4HX1A 3HZYB 3RVWC 3WN5C 4PLJC 2QSCH 1D5ZA 3H3PL 4WUUE 1D9KB 5T3ZH 2HVKB 1JNLH 2NXZD 1RZKC 1TQCC 2B7DT 1SYVA 3SKJH 4GG6B 2AK4B 2P5EA 4I9WE 1BZ7B 1DSFH 2XN9A 3W82A 2VXUL 4G7VL 2EDRA 5BQ7A 2X2YA 2DD8H 1XIWB 3RDTB 4PRPE 4CVXA 4BZYA 1MI5A 1JPGB 1ZT4B 5HHMD 4NWTH 1A3LL 2VLJE 1M05A 1A1OB 1HH6B 5LJYH 1DQDL 5EN2B 4GJTB 1D5XB 3NH7L 4POZC 1MCDA 5J11C 3D3VB 4HIIB 3MRQB 4OIIH 2HKHL 1NLBH 1SM3L 1HSBB 2IANA 1I7TA 3ZL4L 4HIJA 4X4YA 4CL7A 4OLUL 4JGJA 2JJUA 2L7JA 1V7NL 2BY1A 3GMPA 3QWOA 5D5MA 2IQ9H 3MREB 1FV1B 2Y36L 4JFPA 3UAJD 3KPQB 3P4MB 1N3NB 4K3DL 1BQLL 1UZ6E 2BNUA 1AJ7H 4S0UC 3CH8A 3MYJB 1JIBA 3HA0A 2YRPA 4U2ZA 4WTWA 4XWGL 1E28B 4Z7UA 3CH1B 2FR4A 1KCVL 3VXPA 4M7ZB 4GQPH 1YC8A 4O00A 2OLDA 2BNQE 3ET9F 2DQCH 4NNPL 5DMKB 1M71A 4GSDH 1A21A 2EXWD 4KV5F 1HZHH 1ZA6A 3PWPB 4PDCE 4XAKD 1QG3A 1MHEB 4PP8C 3NFSH 3OB0H 5TPWL 1YQ2A 1A1MB 2OL3B 1YNKH 3RY5A 3P9MA 5IMOB 1QRNA 1SYSA 2B4CC 3UTZB 3GSRB 1MCBA 4YNYB 2OL3L 5D2LA 4XP6L 4XAWH 3VDCA 2FX8H 3LIZL 3O6FA 3NAAH 2A83B 3QG7H 1WVZA 5L8JB 5EOQH 4OIBA 5HI4D 1RIVL 4Y4FB 3IAGC 1E6JL 3MRDA 4B7IA 1MRCL 5BZDB 1HE7A 4JLRA 1SJVA 2VH5L 2FDBP 4NNXB 2EDLA 4U6VH 4DZ8A 3NZHH 3SE4A 1HHKA 4J3VA 3VGDA 4OZFH 3VXTB 5HSFA 3WL9A 2H6PB 1FNEB 3TYFA 4MLIA 4OLZH 1GCFA 1KGCD 2G5BA 1RJLA 2X1WL 3W9DA 2YZ1A 4XBPB 2YBRA 5J1SC 1MVFA 3CH1A 4NKIL 1YYLH 3GSVA 2X9YA 4L3EB 4LLYB 3BN3B 2YA0A 3CXHK 3ELAT 3CCHA 1D7FA 4TN9A 2QR0B 2UUDH 3NTCL 1A7PL 3QXVA 3IRZA 3X12A 1AY1L 2NY0D 3MCLH 3UBXA 5IBTL 1IAIH 4OKVB 1L4IA 2P24A 4M1CC 1KLUB 1BF2A 4L8BA 2D7OA 3BPLC 4NT6B 1ZXQA 1OY3B 3BH9A 5DK2B 3QRGH 2ZOKB 4EI6A 5CCKL 4NPYA 2KZWA 1YDPA 3REWA 1INQB 3EFDH 2AW2A 4PV8B 4ZO6A 4KHXH 3IKCA 4G5ZL 3S8WA 2NW2B 4HT1H 3VH8G 4NCDA 5KS9B 4LCIH 5EU6D 2HFEA 5DJAA 5IB1B 4FFYL 1U8QA 4NUJB 4ZUUA 2CUIA 4H5SA 3WNMA 4ZDHA 3ZTJH 5HPMB 3W5MA 3TNMA 1FL6B 3CAFA 4BFIA 4WEBH 1NL0H 4G7YL 4L3EE 1QQDB 1D5ZB 1J10A 5CZVH 3QDGD 4NKDA 3VFGL 3REVB 4R7DA 2PYEA 4R4NC 5T1DL 4QYOA 3BPCB 4WCYH 3MUZ1 4XHQA 4JKKA 2E7BA 1RZ8A 3KAAA 1ITBB 4XP1H 1FO0A 3P4NA 1CCZA 4N5UA 3DSFH 2EDOA 4X9GA 4JANB 1ZSDB 4FFZH 1XCQA 4HWZB 1TCRA 4HPYL 4P5KB 2EZ0C 1IFHH 5C7XH 3FQXA 3KNBB 3GBNL 1OT1A 5EIVA 3L3HA 4LP4A 5DVMA 3U79A 1NCNA 1Q9KB 1ORSB 1YEEL 1WFUA 5SWZE 3TO2B 5A2LH 3GI8H 5C0DA 3VFPB 2NXZB 3C08H 2RIKA 5BCAA 2BNQA 2AJXH 4RNRB 4F80A 1WBYB 3WCYA 3QIUA 4FNLL 3EYQD 5GS3A 2DWEB 3TBTA 5F6HI 4UINL 3QJFA 3T2PA 4NM4L 5EZJB 1VSCA 4WO4B 3Q1SH 3O45B 3IVKB 4XPBL 5FYKD 1MCQA 3KPOB 3O0RL 4NYLB 3LRSA 3ZSTA 1T66D 3HC3L 1NC2B 3NFPA 4GT7A 1AGDB 4OGYL 4KMQA 3RNKA 3VFTA 2NY5H 4Y89A 5C3TA 1X4ZA 2NY6D 3N1PC 1BBJB 5E95B 1C12B 4HHAB 3ZHDA 3PP4H 2VZUA 4H1LH 1MHPL 4S2SB 2H8PA 3QDJA 4I0PA 3UP1A 4PFEA 1JZ2A 4Y1AD 2N7BA 4AT6B 5HVFB 4PJBF 4TVSa 1KCGC 1V7ML 4ZFGH 3CSBA 4NGHL 5D2NC 1JTTA 1C16B 1JCKA 4QRSB 1QRNE 1RHHB 4CVWA 4L8SA 2NX5D 5FO8B 1RK1B 5EO9B 4HJ0C 4BYHA 1K8IB 5HVGB 3DWTA 5EZIH 3OKMB 3VG0L 3GMLA 2P8MA 3QG7L 2DKMA 3FO9B 1U91A 1ES0B 4ODHH 5GSVB 1LQSR 4WFEE 4P9HH 5SX5H 5JMOC 1FZKB 4YPGA 2F54B 4P57B 4P46B 1OD7A 3X3GH 5DJ2B 1OW0C 5D7LA 4F2MB 4F58H 1JGLL 4ELKA 4NP4H 1BFOB 4PTTA 2ADIA 2HH0L 3BAEH 3ARBD 1Q1JL 5IQ7H 2M1KA 5ALBL 3JWDC 5GGSB 5C86A 2BY2A 4G6FB 1S7VA 4FMFA 3T4YB 4UQ2B 3BH8B 5KN5A 5KS9A 2FLBT 2Z4QB 1MRDL 3DUUA 1T89A 4BSVA 3DETC 3SE8L 4LSQL 3V8OA 1FH5L 4K3EL 1CK0L 3LN4B 3EOTH 2Q87A 4JPVH 1CLYL 3MLWH 1IC5H 4OCRL 2DTSA 3KPLA 2QV2A 1H15A 3LRSB 1CWVA 2D31A 1CD0A 4HK0B 1EZVY 4LVOB 3VRJB 4QXUL 3KPTA 1N5YL 1AFVL 2X4PB 4YBLB 4RMTA 3HB3C 2XTJD 5I30L 3DX9B 3JUYA 2CDEA 2OR8A 4HS3A 1CVSC 4FXLA 5INDA 3S5LA 4P23D 2A38A 5DA4A 5E6ZA 4QOKE 4XVJL 3D1MC 4Y4HB 1PX3A 3P4LA 4OLWH 2AXHA 2Y5TB 3MNZB 3ARFB 4FTVD 5EZLA 5F88B 5C0AA 4XTRC 1H0DA 3CJJA 1K8IA 1Q1JH 4GAJH 4YDLC 1VB9A 3TZVC 4AK1A 3GUTA 3QDMB 4NRYA 1UC6A 1B6DA 1QR1B 2VUYA 2D7TL 5HD8C 3ALXA 2JJTC 1E28A 5C0JA 2ARJQ 5DD6B 2AEQH 3HI1A 4MXVF 4ODVL 4Y2DD 4Z0BL 5EUOE 3S96A 1CFSB 3MJ8A 3RY6C 3S9DB 1S9XB 3BX7C 3JXAA 4Z8FL 3MV01 3MOQA 3GJEB 3I3BA 1RZGB 1RZKH 3T8XA 3QYCA 4NN6C 1DFBH 3K8MA 1PEZA 5DK3A 2WLYA 2F5BL 2ZG1A 2VQ1B 1G7QB 2IANB 1CQKA 1U8HA 1R5WA 1MNUL 4XCYB 3SDXA 3PGFL 4PPTA 1D6VL 5E2VH 4D9QD 5HVHB 3C87A 3H6JA 4UQ3A 1ND0B 3BSZH 3NIFF 5F7FA 1DVFD 1HKLL 2ILLA 3JTSA 3JWNC 1GGCL 1NUGA 4O02L 5DUPL 2XN9D 5DVLA 5HY9A 3F5WA 3KPRD 1A6ZA 3U4EB 3QULA 1MIEL 4JZJB 5T1LA 5E2JA 2P7TB 1Y0LB 4QOKD 2HRPL 5JR1L 5KTEH 2JJSC 4YHIA 5ESAB 4O51B 1XCTB 5F7HA 3S4SB 4EI5C 3KWWA 3OMZA 5I75B 4Y5YC 1YC7A 3FMGL 1A9BB 2H9GB 4I77L 3QUZB 4OGAC 2F54D 2OK0L 1I8LC 2DQGL 4XNMB 1MNUH 3BN9D 1NANI 1FCCA 5A2IH 3LKNA 3FZUC 5F9WB 3C8DA 3GMNB 4I4WB 4CVZB 5T1LD 4OZIF 5KSBE 3QQNA 4PR5B 3PWLA 2CIKB 5EZOL 4IEFB 4UTAL 3U0TB 5IHLB 4JN2B 2B4CH 5DQDL 1XGQA 4MJ2A 3MFFA 4DKFL 1NGZB 2X4UA 1A4KA 1Q9OA 3MRHB 3CVHH 5IVZA 1H5BB 5T5NG 3G6AB 3D3VA 4WNQA 2VZ1A 3VFNA 1CFVL 2AEQL 1FYTA 2NY7L 2O5ZH 1UZ8A 1ADQL 1F90H 1GPOH 2ZZUT 4HUWA 5DK2A 5I1JL 2DQGH 2R0WH 4U1KA 1BM3L 1BFSA 3SDXB 2QHRL 1UADC 4JG1L 2R0LH 2JCCE 4JRXE 4ZODA 2FATH 1I4FA 3OG6B 4XAKE 5EU6B 4JRWA 1PFCA 1OP5K 5DRWB 5FEBA 2V7HA 3PHQA 4F33B 2GUOB 3QIWC 4H25B 4D0DA 2LTQB 1U36A 4D94A 1RJCA 5AZEH 4Q74A 2FH6A 4GRWF 2D4DA 1TJHL 3RU8L 5GGRY 4X6DF 4P2QE 3NVQA 1BWWA 5F1SA 4L9LB 4UDTA 4LCUA 4CU7A 1L9MA 1X5XA 3IXTB 2F54E 3O3BA 3JWOL 2IBGA 4I2XA 2QJDA 2Q3ZA 5T5FL 2P5WB 2BX5A 1JV5A 4JO1H 1IAKA 3VXNA 4DKFH 1F8TH 4OFPA 1YJDC 1BLNA 3WE6B 3IT8D 4IOFD 8FABA 5TQ0L 5FV1L 3EJYC 4ZTPL 4DKAA 4RA3A 1W8OA 2R1WB 4LRNL 2X42A 3RPIA 3U7AA 4KXZH 1NLDH 3BT2L 3RWGB 1GOFA 1B0RB 2NR6D 4MQTB 3NN8B 4W4OC 4QWWC 5D5MB 4P9HC 1CG9A 2R2CA 4HK0A 4HFUH 5HYEA 4JY4B 2AQ3A 5C0GA 3BZEB 1FRGL 5CMAA 3PHOA 5ETUB 1BQHB 4U1JA 3I9GL 4XCCH 3V5DA 4WV1A 3UTZA 4P23C 2I07B 3IDYB 4LSTL 4WGVB 3RWIA 4F37F 3QNZB 3F7YA 5FYLD 3S37X 1UVQB 4XCNA 1ZANL 2XWJB 5IKCB 1EO8L 1Q9OB 2DM4A 2UZXB 1YMMB 2WUCL 4U31A 1NH6A 4BH7B 4HKJB 4L29B 3U0PB 1FGVL 5F6IB 2NPLX 1MREL 4KROC 3BQUD 1X6LA 1RURH 5SWQA 3EZ8A 1CVRA 2CDFB 4HPYH 5DO2C 3MV7E 2A6DB 3HRZA 2DI9A 5IVNA 2XN9B 3CXDH 2G60H 5D1QC 2Z4QA 2DD8L 2IJ0C 1HYRC 4LIQE 4LVHC 3H3BC 3ZKNC 1T2JA 4JO1L 1CD1B 2XZQH 2IBBA 5JQ6H 1KJ2A 1DLFH 1LWRA 5BS0A 2BOBB 5TE6H 3SDAC 2X4SB 1FFOA 3KJ4C 4LBEA 3VGEA 1T20B 3D3VE 1RULH 4ZO9A 5E99H 5D1QA 3TBSA 1NAML 2PUQT 3BKJH 3CDCA 3ZL4H 5DUMH 1IEAA 4KK5C 3T1FA 2YS4A 2AJZA 3WUZA 5FGCE 1WFOA 1QBMH 4P3WA 1T1ZB 4PJXA 2BXYA 2XTJB 1JV5B 3TNNA 2C3WA 4C83A 3HZVA 4WWKD 5EU7C 1AGBA 4HLJA 1FJ1A 3T3PF 4F8QA 5MERA 5LXGL 3C60B 1ZAGA 3STBA 1C08B 3OJMB 4OLVH 4G6AC 1FZJB 5TE4L 3BUYB 4PP2A 1X3DA 2BERA 1CFBA 3LKSA 1QNZL 1RUMH 1FVEA 2DJSA 5D8JL 1FSKC 4OFYA 1OGAE 1DBJL 4NKOA 3QDHA 4JQIL 4OGXH 3HN3A 1DQLL 5DR5H 5A2JH 2Z35A 2C4XA 3E2HB 3LKQA 1C12A 3C2SA 4HHAA 4U2YA 1AJ7L 4RAHA 5D2LF 1MLCA 3HMXL 1AFVH 4MNQA 3ESVF 3MA9L 3UX9B 4LNRB 4R0LA 4PJBE 3MGTB 3IS0X 1XZ0A 3CX5K 3BT2H 5DMIL 4OI9A 3KLSA 4LASL 5KG9A 3GSNA 4NQDD 3TF7A 1NEZB 4M7LT 5LCVH 4M9PA 3MLZL 4IOIA 3SJVB 4KJPC 4XPFL 4XPHH 3QDME 1B4RA 4HIEA 4ORGA 3KNBA 2EYRA 2R1WA 4JB9H 3RDTD 3DRQB 4Q9BA 5JXAH 2IWGA 5TQ2H 5DT1H 1BMGA 2VDML 2DYPA 1CFQB 4XT1C 4MNQD 4XWOD 1QA9A 4Y2OA 5E94A 2LAAA 3W5NA 1HI6B 3GMMB 1MFDL 3HPJB 5F7WC 3C5JB 1IRAY 5DI8B 1K9TA 4M48L 3OL2A 3SJVA 4Z7UF 4X8JA 3MV9A 4XMPH 5DMKA 3TVMC 4APQC 1L0YA 3C6LA 4R7DB 1UA6L 4ZD3H 4P99A 4Z7WA 1XZ0B 3NAAL 2W65B 3KHOA 1DL7L 3MJGX 2YD9A 4PJHF 3WIHL 5L2KA 4P49A 1N6QL 4X7DC 1WJ3A 3IFNL 1SEBB 3TNMB 4QXTA 1FG9C 3IETB 4NO2B 4EI5A 4KTYA 1KC5H 3B9KB 2OSLB 4MAYB 3REVA 3WD5H 2R2EA 1QFHA 4U7SA 5DHVA 5GXBB 2XQBH 1WCQA 4Y7MA 1CGWA 1QSEA 1DFBL 4YHIB 5ESAA 1EAPA 5SWQB 4BSVB 4ETQA 3PABB 3OKLA 2XTJE 4M02A 4NKOB 3TPUB 2O61B 5E7BA 5BV7H 2P5ED 4GW4A 5JW4N 1IL1B 25C8L 2A6IB 4P59H 1X5KA 2AJUL 2NY4C 1A6VH 5I2IB 4N9OB 1EJOH 3ZE0E 2HJFA 5LWYH 3AU1B 4NO0D 5HDBE 2NXYC 1ORQA 3L7FA 3RWFB 3VXMA 4HBCL 5IG7A 4AEFA 4GFTB 4KKLD 3LAFA 5GZOC 5L9DL 1FNAA 5BV7C 2F74B 3C6SA 1J0YA 1I8LA 1OAKL 3PG2A 1C8PA 4H8WL 3ARGD 5FDYA 3LSOA 1EHNA 4YK4B 1JGDB 4YIQA 4PP1D 2QADD 3L5WA 1U8KB 2BC4A 4PBXA 4G80A 4HUUA 4OCRH 2NY6B 4M61B 5HHOE 3T0ED 1NCAL 3L3OB 1QLRA 3D18A 2EYSA 1RMFH 4ZOCA 3WL9B 1GSMA 5T3XE 4BK4A 4QO1A 4WGWB 2FIKB 5DT1L 5GPRA 4N90E 3DMMB 5CZVL 2Z92B 4NZUH 5DQ9B 3SPVB 4LAQH 2B1HH 4JR9L 3HE6D 2VDRH 1RULL 5GGRA 2EDKA 1KPRA 1MFNA 3U83A 1XF4A 2LU7A 5T3ZD 4LRIA 4KRPD 3K74B 4HUVB 2BK8A 2UWEF 4U1IB 3M8OH 5TDOB 4L8CB 4JKPH 2R0WL 4YHPA 4Z6AT 3EDDA 4YDJB 4U7KA 3T65A 4Q6IA 3FB6A 3TO4B 3G04A 4G6ML 3GM8A 3QIUB 1GIGH 4KMTH 4X5LA 1YQVH 4Q6IC 4AZ8A 1ZHKB 2B20A 3MCG1 1KENL 1NCCL 2J8OA 2Z31C 3VD7A 1R0AL 1VFMA 3VFWB 1QNZH 5T33L 3NCJL 3SGDI 3BQUA 4O2FA 3GSOB 2YC1A 3KXFD 2PTTB 3T4AB 1BVKA 4K2UL 3MZGB 5FM4A 1J1PL 3V5KA 1JGVH 3MRIB 1RZKL 3BQUC 4QNPF 1U8LB 2B39A 3INUH 4XBGA 3VXRA 2BJML 2DQEL 1CTOA 1T66C 3P4NB 2NXZC 2J6EH 2W0KA 4I8DA 3P9LB 3IJHA 3QFJE 2I5YH 3RGVB 4K23H 2P48B 2W0PA 4L1DA 3HS0B 4LCUB 1OARH 1GGYA 1CLZH 4OT1L 4R4FH 3EOAB 4PY8I 2P1YA 1TQCB 1EHLH 3SDXE 3WMSA 4NN7C 1IQWL 1CE6A 4JFDE 4GRLC 1WZ1L 5F1NB 3RZCC 4ONOA 3D0VB 3PDOA 1UM5H 5IW6A 3E6HB 4F3FB 3KYMB 4U1LB 2VLRE 2FHCA 1P4LA 3FFCA 4K2UH 5MENB 12E8H 4Y19E 1FRGH 5J9PB 5JIHA 1NBVL 3QAZC 3WN5A 3GI8L 2LU3A 1ES0A 1F58H 1F00I 5C6PB 5BXFA 2X44D 3IDMA 2CKBL 1A14H 3MLWL 3QA3A 3S35X 5IB4B 4K8RL 1WIOA 1J12A 2ZUWA 2OZ4L 2BXZA 4ZO7A 4BFEA 3CDGA 3FB7B 3RWFA 1PY9A 1A7NL 4QRPE 5FYLH 4UOJA 1XF5B 3ZKXB 43C9A 5FF6B 4JKPL 4NQEE 5FYJD 3MBEA 3RFZC 2XA8L 2DQIH 3MYZA 4N8PA 4PJ5B 4JM2C 1MCHA 5EBLA 1INDH 2CR3A 5IVXF 1H8SA 2AQ1A 4M6NL 3WO4B 1EEZA 2LE9A 2VLKA 4PJ7E 4X6FB 2VDRL 3SCMA 3N0PB 3ROOB 2YBRB 2NY7H 1NCDL 2W65A 4H88L 2JKXA 4MQXD 3DBXB 3K4DA 3OF6A 4OQTA 1UKSA 2WNGA 1QSFA 1U3HD 3C2AH 1GGUA 3LPGA 1I3RB 4S1SH 4LVOC 4R8WH 5CSZA 3CVHB 2BP3A 4HDIB 4TNVK 3GB7B 5EULV 3WBDA 3C5ZD 4NJ9H 3TO2A 3IDIB 1MHCA 2EIEA 5GS0C 1BWMA 1A6ZB 3AMKA 1T7XA 4CKVX 3OAUH 1VGEL 2W0FB 5JOFA 1YEDA 4QRPB 4QWWD 5F7DA 3DV4B 5EU3A 3P40A 4LQFL 3BDXA 5IVXA 3RQ3A 4KDTA 3ZE0F 3F8UB 3KDMB 3DX8B 4M62H 1WWWX 1NFDE 3LZFH 1OSZA 3OKNA 1J05B 4IOIB 4Y0GA 3T0DA 4NZTL 35C8H 4X5WA 3TO4A 4NQCD 1DR9A 4HV8B 5DEGA 1FZOA 2WP3T 2VQTA 4S11A 4PJ8D 1E4KC 3RWDB 3TFKD 1HCFX 1MCLA 1Z9OA 2R0ZL 4IRSC 4Z7VA 4FRWA 4C57C 4P5MA 3BOVA 3MV7D 3QO1B 3LN4A 4QRRD 1L6XA 3S96B 2GEEA 2OJEB 4ZUVB 2DMKA 5C6TH 3CVIH 5IMLB 4NO5B 5BJTB 4G8GA 5FOBB 7FABL 3L5XL 3D39B 3ILPA 5DJCA 3MJ9A 3TF7C 2FIKA 4NZRH 3MGAA 2KZ1B 4BM7A 5DLMH 3D25B 4DUXA 3BP5B 2VDLL 5KJRL 1TENA 2VDKH 4KVCH 3OJDA 3HR5B 3BH9B 1V3LA 5C0CB 1P2CB 5GSRB 3C09B 5ISZE 1IEAB 5I1EH 3WDIA 2C7UB 5KVEH 4LSRH 3HPLA 5F1IA 1D6VH 2P5WE 4PRPA 4IDLA 2VO5A 4Y4HA 5JW4M 1F4AA 1J9CT 1Q0YL 1MFCH 5TQ2L 4LPXA 3W0WD 1RV6X 4M62L 2CDGA 2DTML 2F74A 3C6SB 3IFNH 4K07A 3TT1L 5I8KL 1DQLH 4UMGA 3GKWH 1IGCL 4Z18A 4XNXL 5D7KD 4M4RA 4W70A 4YEFA 32C2A 1KN4L 4XNQA 5EG6C 1NAMA 5BVPH 2CDFA 4Y5VB 3EFFA 3VFVA 4R90H 2V7NB 4U05A 5HYSA 4MB4A 2MNUA 4YHYC 4PJCB 3E0GA 3CZFA 4MA7H 5BRZA 4OAWA 2E9JA 3KXFA 5MI0B 1I8KB 3I6LD 3HE6C 5ACLA 4RAUA 2O93L 1SY6H 4C55A 3DYPA 1MH5A 5BZWA 4NHCH 2JB5L 1ZHLA 1L8JA 4E5XB 3ZYOA 1EV2E 5I1LB 3FO0H 4PS4L 2ZOLA 4M3KB 4OZHE 5E4EB 1QACA 4MAYA 3LB6D 2X4QA 4KJWC 4OCLC 4XGZB 3VI4F 5LGKA 2H3NB 4K3DH 4FQLH 3WUWA 2R23B 1MQKL 1VKXB 1DUYA 3O2WL 2XNAB 2BY3A 1J0JA 4Y5XA 5KSAD 5FGBC 3HCVA 2XWBB 5EO1B 1CL7L 1MAMH 4WUUB 5IBUB 3NN8A 1UJ3B 5CUSH 4HBCH 5DJDA 2MKLC 4HZAA 3V9FA 5DJ2A 5F93C 1PW3A 5KSBB 3CCHB 4OTXL 4HS8L 1F11A 1FG2A 4Z78B 4Z77A 2C7UA 3RVVC 3TBVB 1U8IB 3JV4A 3T3MF 3BGMA 4X83A 1AO7A 3U6RB 4JRYB 4DGVL 5HHOB 3HNVH 3WLWD 3AM8A 4UDTB 2BVQB 3DECA 3TESA 2AJYH 4NRXA 3MC0A 4NNPH 3TBWA 3V4PL 1MJ7L 3AREC 3SGJA 5JORB 4I18A 1I3GH 2VLJB 3AAZA 4WJ5A 5F71A 3MYJA 3EYSH 3DYOA 2R2BA 5E00A 1UACL 1T0PB 4JVUA 1EHAA 4L9LA 1BFTA 3CD4A 5MHSE 3DX7B 1P7HL 2HFFB 5DWUH 5DLML 5D4QA 4HIXH 4HWBH 1FAKT 4PGDB 4N8CL 4OCYL 3VXUD 4NJAH 4LNVA 1CL7I 5C0RL 3QIUD 4LRIC 4WW2C 3NPSC 2Q76B 2VN7A 1HQRA 3BXNB 4Y19A 2P49B 2O5XH 2YXFA 1G9ML 3KPSA 2ATKA 4X7EC 2A2QT 4L4VD 4X7SL 4NNYA 5I16B 4OD3H 5EUOB 5JOFB 2GW5A 2ZSVA 4ACPA 1B9ZA 4PBWD 5SV4A 4C56E 1T1XA 1MCPL 1IM3B 5K9QG 1CF8L 3EO9H 1IC4H 3UBXI 2NLJB 1JWSA 4PBVC 3ES6B 5AD0A 3EKCA 5FDWB 2NX5A 3HNSH 5CJXC 3INUL 3PQYB 4GW1B 4QXUH 5I1CH 3MTRA 3R4DA 5IB3A 1UCBH 3IKKA 4C56A 3QNYB 3ZTJG 2XA3A 4M5YH 4JDVB 4XP9H 3ULVL 4MJID 1F2XK 4GXVH 5DO2D 2GJ6E 2J4WH 4UBDC 3HRZB 2VLKB 5EOTA 1MRCH 4HIXL 3VWJD 1CK0H 1UQSB 4UIKH 4F9LC 4G43A 3KJ4B 3SDAB 1FC1A 3TN0A 3S7GA 3O4LE 4KI5F 5GS0D 3MUJA 3HE7B 2C3VA 4M93B 3OR6B 3TN0C 5JPMA 3HMWL 4YR6B 1W72A 3CFBB 1G84A 3SDCB 3UTPE 2IPUG 2XICA 5JNYA 1D5XA 4YC2B 3QFJB 3BZFA 3BD4A 3OR7A 4NQVA 5T1MB 5D70H 4P46C 5ETUA 3FO1B 3VFSB 3UTTA 3G5ZA 3VFOB 1RZJH 4PLKD 2RJMA 4Q58C 4AH2B 3QNZA 2J4WL 5JXEC 4IIQC 5B39G 2MKWA 4U3HA 2CK2A 1CZ8H 4P3CH 3FB6B 4HC1A 4RDQF 3CLFH 2VZVA 2JB6B 4KQ4H 3B9KD 5KSBF 3K4AA 1MWAB 1RZGA 1XH3B 1K8DA 1J88A 4K9EC 4OI8A 5GS1A 5C09B 5GGVL 4BKLA 5C2BH 2QQLL 2ZKHH 5HD8D 4A2LA 2B4CL 5EUKB 4LHJB 3RVUC 2FHBA 1H3GA 1TFHA 1MCRA 5I71B 5JHLL 4Q0XL 5FGCB 1J8KA 1R24B 5K59F 1FAIH 1CFVH 5IQ9A 4KK6C 2OK0H 5ABDE 2IAND 2CK0L 1WTLA 3WJJA 5D96C 1JN6A 1UEYA 4AENB 1MPAH 1YMHB 3CVHA 4IRZL 4NO0B 4QF1A 2D7NA 2BCKB 4P4KB 1AC0A 4ZO8A 3QEQD 4M7KL 3E6FB 4FQQA 3MRGA 2X6MA 3HC3H 4LSPH 5IUSA 5C0AB 4U1SA 1DANU 3I85A 4K3JH 5BO1H 4FZ8H 1YMME