1LDPL

Crystal structure of murine mhc class i h-2ld with a mixture of bound peptides
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC CLASS I H-2LD
publication title Structural basis of 2C TCR allorecognition of H-2Ld peptide complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (mhc i/peptide)
total genus 10
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1998-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ldpL00
3OWEA 3WN5A 3DIFA 3EOBA 5DJZB 3I75B 3DETD 4GMSH 5IJKA 2O5ZH 4HH9A 3C8KB 5FK9A 1KB9K 1OY3B 4FHBD 1N5AA 3U0WL 3LN4B 3RVTD 4G8EA 2R2EB 5C0BE 5DVNA 3HE6B 1WBXA 1TCRB 2BVTA 3CH1A 4NQCB 5EO0B 4ZSOA 3PABA 4HLZG 1ZT7A 1FNAA 4Z6AT 2YPLB 1UA6H 5D70H 3T3MF 1UCBH 4G8FB 3K4ZA 1TJGL 1I7RB 1K4DB 3V6ZA 4V2CB 3FFCE 2VDKL 2VL4A 2XKNA 4PJDF 1QACA 3SGKC 2QHRH 1FL3B 4GKSA 5E8OB 1U0QA 4GKZA 1OSZB 4J7RA 1EZVX 2HA1A 4M1GL 2H32H 4GXVH 5LBSL 4M6NL 3ZYJA 1BZ9A 4TN9A 1XGUA 3DVGB 2V7NA 3R06B 5EG6C 1G7QA 1Y6KR 4X6FA 3RWIA 1OM3L 3KLHD 4MWFA 4JPWL 2L4OA 4F7TA 3N85L 1MAMH 2A6JB 5KSBA 2BSED 2IBZX 4JM2A 2XQYG 2MFNA 5D6CB 4NYLB 3L5IA 1NLDL 4PJBB 25C8L 1KOAA 5GGSY 1CICD 4QRSA 5LG1A 2VNCA 2XWJA 3JXAA 5F7KC 4KTEL 3UTPD 2OJZL 2LQRA 2NY2B 4O2CA 4JFZL 4ERSL 2W38A 5C86A 1A6WL 2YEZA 2RGSA 1T83A 1IGMH 1VERA 1XZ0B 5EBWB 1DTUA 1KTLB 3RWEB 1JRHL 4R4NC 4R4FH 3HPJB 4PV9A 4XP5H 4QHNB 3FT2A 4L4VA 3O0RL 3JTSA 1VB9A 2HLFD 2OMNA 3IFNL 4JFFB 3P9MB 4UT9L 4MHHG 5I1LA 5I1IH 4HCRA 4WUUD 3M17B 3V5KB 2ICEB 4JO1H 3TVMD 2PCPA 3PWUA 2ATKA 1JGEA 1OTSC 3JUZA 5E7FA 3SGJA 3FO1B 3QCUH 1MVUB 2AJZA 2G75A 2UWEE 1UKSA 3MZTA 1MFEH 3QCTH 4AK1A 2CPCA 1JI2A 4XT1C 5DUML 4UV7L 3ZTJH 3QWOA 4FQPA 4UZGA 4AG4H 1FL5A 3U4BL 4ZFZB 1Q94B 4X7SH 4EUPG 2AABL 2BDNH 5E70A 1JF5A 4OBSA 3EFDH 1X5ZA 1NGQH 3ZYZA 4WW2B 3S3SA 4LRNL 1RZGB 4TNVK 1BM3L 3VWKC 4AIZA 2PTTB 5HHQA 5C09E 2ILLA 2EKJA 1KTRL 1SBBA 1ZLSH 4UUJB 3TJEH 4P48A 2Q20A 4JLRA 5B38G 1IAII 3OR6B 4P46B 4OV6F 2CLVB 3WFCH 1GC1H 3HAEH 3WSQH 1A5FL 2YOCA 5AWNH 1J0JA 4JJ5B 3SOBL 4NQED 3BKYL 4JM2F 3QA3A 2Q86B 4PJHF 3B43A 2VQ1B 1A3QA 4XX1E 1M71A 4PJFE 3HZYA 3O6KH 3MUY1 1UXSA 5L8LB 3BKCL 5L9DH 4KKCD 4KDTC 4DFIA 5E9DB 1KB5L 2HT3D 1E4WL 3B9VA 1A9BB 4NUJA 4U6HB 3LIZH 2JJWA 5EPMB 5FKPA 5FYLH 2I9TA 1OLLA 3QHZH 5I19L 1IKFL 1OD7A 3LKRA 1T0MB 3SO5A 5D7JB 3HA0A 2YXMA 4LSUH 5F1NA 4OFIA 3MRKA 1MHPH 4RAUB 1U8JB 2HT4D 5EC1A 3BRDA 4PGCB 4WFED 3VXRB 3JV5A 4JHBA 4XVUC 1BECA 2A0LC 4Y4HD 3U0WH 3SY0A 5FGCE 1XF3B 4HEPG 1EGJL 1A4KB 3D39A 1Z2KA 1J0HA 1MCCA 3DBXA 4KJQC 1AIFB 5CHNB 1EEYA 4EKXA 1UENA 3CFBA 1AFVL 4L8BB 2RCSH 4LHJB 2BNRE 4JHZA 5J1TC 4JVPA 4S11A 4LRIC 3EZJB 4X6EA 5K59F 1MFCH 1WFUA 4CMHC 1YUHA 4QY8B 1ZT1A 3O3DB 4Q6IB 2VDKH 1XCTA 3B9KC 3C6LB 4M7KH 5DQDL 2APTA 1J0ZA 4PRBB 3IJYA 4X83A 1G7MA 3NA4A 2DD8H 3O2VH 4M1GH 4PJEA 5LBSH 1HCFX 1QFOA 4I9WE 1JPFA 2ESVD 4Y4FA 1FVCA 3FL7A 2I9LB 1A4JB 4M48L 1QBML 4CN6A 4ZUTA 1UT9A 1HN1A 3BW9A 3SKMA 5JNYA 5JOPD 1NLDH 5GSVB 4NNPL 1SQ2N 2HTLC 3T4AB 3IDJB 3ZE1F 5ERWB 2MQ3A 3SDYH 4RIRB 3CFEA 4E0RA 4J4PA 4ERSH 35C8L 3D3VD 1MJ7H 2VKWA 1EO5A 2ATPA 1J05B 4IMKA 4NRZA 4IJ3C 5I30H 4JY4B 4QRRE 1JNHA 3EOTH 1M05B 1HSAB 4MXVF 3T2NH 1VFAA 1OTTC 3KPQA 5LAXB 5IQ7L 3BGFC 3DX6A 1EVTC 4CADB 1OGTB 3MV8E 5KBNC 3IFNH 5DUBB 3O4OB 3NABH 4R7DB 4WHCA 4ZUWA 4HJJL 4FQHB 2EDEA 4PRDA 1MSPA 5EFIA 2FR4B 4LEXL 3I3BA 4DN4L 2EYRA 4HS8H 3QO0A 3REWB 1A14H 4JZJA 1FH5L 4Y89A 5MEPA 4KROD 5GJSL 3TBYA 1M7DB 3PNWA 4O4YL 1ITBB 3UX9B 1DUZA 1JI1A 1SHMA 1JFQH 5EC2B 3RTQB 3KPLB 3ETBF 1Q0XL 2Y06H 1F4YL 1RURH 3JWNC 4P4KC 4UTBL 5CSBA 4MYWB 5HYJE 3O3EA 4LF3B 4M93B 3EYQD 2AABH 3ABZA 3UJJL 3QFDB 4FXLA 3N50A 4YDLB 1ZGLP 1VPOH 1XF5A 4U05A 1LK3H 4LRNH 4Y5YB 3VMNA 2JKXA 4UV4L 1LDPL 1RUKL 2VDRH 2VXVH 4C56A 1Y6MR 3VRJA 3FHAA 3SBWC 2AW2A 3WLBA 1EZVY 3AAZA 3TIEA 4LCUB 2DMKA 1UJ3A 3LS4L 1PVHA 2GK2A 4P5TA 1KCUH 5IQ9A 3GSXB 3O9WB 4Y5XB 3CU1A 3MMEA 3P3YA 1TZHA 1A5FH 1AHWB 3SOBH 2JJTA 1R5IA 1L6XA 3BKYH 5GRZA 1P7QD 3ARDA 3EJZD 2MPAL 3HI1B 4X6CB 2P7TB 1W72L 4NCC1 2IEPA 4N8VB 5EWIL 2DLGA 3BKCH 1QRKA 2YD5A 1EO7A 3NA9L 1NUDA 3WJLA 4MSWB 1H5BC 4WTZG 1B9ZA 5TF1H 1FGNL 1KB5H 4Q58C 3HS0A 1E4WH 3RFZC 1OAKL 4N8CH 2BRRH 4P3DA 2ZSWB 3QO1B 2HFEA 4ZQKA 3VGGA 1MRFL 4BFIA 2Y6SC 3PHQB 1G7HB 3L3GB 3MZGB 5HI3D 3QEUA 1RZIB 1JZ4A 4YHKH 2BXYA 2IFGA 4B5EA 5E6ID 5HYSB 5GGRA 3VXUE 4RMVA 4C83A 1ND0B 3ULVE 1YEIH 4HK0B 3SJVD 1BZQK 5C0CE 3SKOA 2SEBB 4HIIB 4NQTA 4XXDB 1P4BH 4JG0H 1BJ1H 1DFBL 1AFVH 1IKNC 4J3UA 4CN1A 3VXPB 1NQBA 5HHME 3SGEI 2XTLA 4QRQA 5I17A 3CFDA 5J0BA 1XR8B 5GGTA 3GMQB 5DQ9A 4UMGA 3F5WB 2OQJB 1ES0B 4ZUSA 3QUYA 1UACL 2VZOA 2W92A 1I9IL 2MHAB 4OUUA 2K7QA 4LBEA 4J3VA 3HMWL 2X1WL 1MRDL 3LEXA 1KPUB 2ICCA 4GQ9L 1QBMH 1BQLH 2FIRT 3TNMB 1OQOA 3NOIA 5TE4L 5DHVB 4EEEA 1J7VR 3PHSA 5E5MA 1S5HB 2ZUWA 5IESH 4HFWB 4NKMA 1U95B 5JIIA 3ARSA 1F6AB 2C26A 1GHFL 1I3UA 1H15B 3OSKA 3QEQE 2UUDK 5CD5C 1INDL 4J3SA 1S78D 3L5JA 35C8H 4AH2A 4F57H 2IPTH 1KJMB 5KG9A 5SWZD 3HPLB 2DQDL 4P2QB 1SEQL 2QQLL 5F7EL 1PKOA 2MWCA 1BP3B 4L9LB 4ZNEE 3KPRB 5GJTH 5DUPH 5IQ7H 5MENE 5HHOA 1NL0H 2V2XA 1OHQA 2GUOA 5D93C 4XX1G 2ADGA 3L3KB 3TO4D 4LEXH 1JWMB 5K33A 1U93B 1XIWD 2C5DC 2R0LH 5I73C 3FQRA 1KJVB 5DEZA 2R4RH 3RX5A 3R1GL 1U3HA 3O8XB 5IOPB 1LE9B 4O4YH 4PD4J 5ITFB 2DBJA 5C08E 1V3LA 4PJCE 4XMKH 5JLZA 2HN7B 1F4YH 1QUNA 2G9HA 1DQMH 2DICA 4UTBH 2VIRA 32C2A 4NO0A 4WWKB 3P2TA 1C16A 4J3OC 2J6EA 5EUKA 1G9MC 3BUTA 3MGTB 3EOYG 1U8LA 4JZOA 2WM0A 3BKML 3PL6D 1HINH 2MCG1 5EOQH 4XWGL 5D1QB 3MRQB 3C5JA 4A2MA 3RY6C 1IC1A 2YN5A 4UV4H 1KN4H 1RUKH 4Q9BA 1LEIB 2WP3O 3ARBA 3D2UB 1N64H 1AXTL 1FJ1A 5IV2A 1A8JH 5GQBA 3O11A 2R0ZH 3ILQD 3WHE1 2FZ3A 4BA8A 3BAEL 5I2IB 4WGVB 3BZFA 5HPMA 3LS4H 2VDPL 4UOW0 5HI4D 4NCDA 4Y16D 2JJSA 3F65A 3M45A 4DUVA 3TBSA 5T1DL 3FAXA 4EN3A 1YNTA 4WV1C 3QWRA 3BI9X 3PWJA 4LPYA 2QKIB 5EU3B 2E7LA 3EKCA 1U8NB 2YRLA 4DGIL 3NA9H 1ACYL 1QFUH 1U8OB 5CILL 4XAKE 1FGNH 3VFTA 4RDQF 6FABH 1Z3GH 3H6JA 5BQ7A 5DTFA 5I75B 4NFDA 3WFBL 1Q9KA 4LGPB 1ETZA 1OAKH 1XF2A 1GZQA 3CVHB 4NJ9L 5ISZA 1N4XL 1R3IH 2OZ4H 3VXOB 1K2DB 1NC2A 5F1OB 1TNMA 4RAVB 4X4ZA 4HLZH 4Z7QF 4YXHL 4ISVB 5DO2C 3OGCB 4LLUB 4ZAKC 4JFEA 4GW5A 4PJ5E 5CFHA 5INCB 1QO3B 5EIIB 1TVBA 4UNVA 2D03L 5SX5K 1M7IB 1TETL 1ADQA 3OKNA 1RIVL 5KTEH 4ZS6D 1P1ZA 5EU5A 3UPAA 4PJAF 4GBXC 5HGDB 2AXGB 2ITCB 1P7KA 1VGEL 1S9WA 3NFPA 4KPHL 2ZNWA 1I1YB 1WQVT 1HHKB 3W0WE 1XGYL 3HZVA 1UM4H 1YN7A 4NQSA 5EA0L 1NGYA 3G6JA 2K9UA 3FT4B 2FJFA 5C0RL 2HKFL 4D9RE 3OKOB 3T1WA 1NDMB 5AUMB 4BZ1L 5ILTH 4N8VG 4LLWB 3IXTA 4JPIA 5KVGL 5ECJE 1UACH 3KR3L 5KVFL 2AJ3B 1AR1C 1HHJB 1QSVA 5SV3A 4QTHB 1HSBB 3N1GC 2X9WA 3QP3A 3HHRB 5AZEL 4GQ9H 1HQ4A 1S7RB 1QFWL 5E2UL 5L7XL 5T5NF 1IC7L 4FQXA 3FQUA 3F7QA 4FQJH 5FECB 3VXSD 5AAWA 3HLAB 2Y5TB 4KAQH 1YEFL 1GHFH 2X4TB 1J8HA 4PY8I 4U49A 2VSDA 4FTVD 5HYSG 2Q3AA 4NHUB 1F8TH 1ZANH 3SE3C 3MBEB 1CDJA 3DXAB 3I9GL 4ZMAT 3TF7C 1RIUH 2R8SH 3FZUC 2AJUL 3W9DB 3FCTA 2BJML 3BVNB 3OXSB 1SEQH 4OKVB 5F7EH 5C0NC 3QZWB 3D6GA 4IRJA 4XVJL 3R8QA 3IDNA 4PRNB 4NFBA 5I8CB 2VLRD 3K3QA 3P0YL 4WW1B 2DAVA 1L7TL 4X5XB 4J12A 3TV3L 4YHNB 2EDKA 1FSKC 5HD8C 2Z91A 1FORH 2B39A 5CZXD 4ELKB 1EX0A 2QR0A 4U1MB 4DWHA 1DQQB 3GRWA 3QUXC 3I6KA 3FRUB 4EUPH 2GK0B 2W65A 3DURA 4LOUC 5FGSA 1EXUB 2G2RB 4R4ND 4NBZB 1UM5H 4X4MA 3BSZL 4UTAL 3H9HA 1DEEB 1F6FB 5F9OL 1CU4L 1DP0A 3T77B 3QJHA 3VFGL 4NZRH 1V05A 2IH1A 3P0VH 2H6PB 3PGDA 4IRSA 2MOVA 3FAWA 1GOHA 3AU1A 1EVUA 3KYNA 2APVA 4K7PX 1CDGA 1F4XL 1IGTA 1OTSD 4U1IA 4UINL 3O81A 2NPLX 3TPUB 4EIZC 3OJMB 3MRPA 1G9ML 4XPTL 1BLNB 3EBAA 3BKMH 1QP1A 3TH2T 4XWGH 4QYOA 1ERNA 4XNZC 5DC9B 5EIQA 1HHIB 3SQOH 2VWEE 1WJ3A 3K80A 1PX3A 2NW2B 4PRPD 4JKPL 1AXTH 2PYEB 1MCDA 3EAKA 4KHXH 4L3AA 4LVHB 4NWTH 1INQA 3D25A 2ID5A 2Q7NA 2FX8L 3L3DA 3QEHA 3TT3L 2GY5A 4JREC 3VWKD 3VFNA 2C1OB 4R7NB 2X89A 2VISA 3HB3D 5D2NE 4ZOCA 4R9HA 4WTXA 1KJ2B 3RGVC 5C0EA 4I0PC 5T1DH 2BCKA 3O4LE 1QEWB 1EK3A 1OAQL 3CFJA 5D7IB 1HH9A 3FB8B 4ODUB 3CDCA 2FJHA 4BKLB 4FA8A 3VFMB 3W81A 4M1CD 4DGIH 3X14A 1EIBA 5CILH 4LDLB 5L8KB 2IANE 4WCYL 1BWWA 4WTWA 5E00B 5JR1L 2VITA 5HGAB 3WFZA 4M3JA 2EO9A 5D1ZB 3LAFA 5KAQF 4ZUVA 5DJ8B 5ESAA 4JFDD 2D7OA 1KUMA 5CEZH 2BY2A 2F74B 3CSGA 2KUTA 1QRND 3PDGA 1FYTD 1NCBH 4UILL 3PP3H 4JDTH 1DVFB 4HKZB 3BMWA 4WU7A 3RRQA 1UVQB 4XBGA 2OL3A 4ZPTA 2JJUA 3L5WB 3MREA 1PQZB 3TO2B 3IT8D 3QQ9C 1D5IL 1KT2B 1U8IA 3TA3B 3TNNB 5KSVB 5DRNA 5CJ5A 4ORGB 4O02L 4PP2B 4H20L 2DQUL 5CP7A 3L7FA 2GJ6D 4NQVB 4OBRA 4QXTB 2F54B 5DJ2A 4XVUD 2A0LD 4N90D 1QVOA 2Y7QA 4P23C 4RBPK 1SMAA 3KS0J 1OTUC 1XGYH 5CBAB 4QF1A 5EA0H 3S4SB 2WINA 2V5TA 1TDQA 3I02B 4KJQD 3BPNB 5JORB 4JY5H 1CR9L 4BZ1H 2BX5A 1ZVSA 2P5WA 5F88A 5CJOH 3KR3H 4OGYH 1AD0B 4RGMB 4LPVA 5IT2H 3IAPA 2FEEI 4NKIL 3HE7A 5LGJB 2HFFB 1NGPH 1PBYA 5AZEH 5EB9A 3B9KD 5E2UH 1CG9B 3KYOA 2MSPA 2R2HA 4IMLB 5I16A 1XMWA 3DX7A 4NSKA 4L8DB 2NY3C 1HOCA 1ZHNB 1MIEH 5I1HH 1CXEA 1FC1A 2WQRA 1YEFH 5FM5O 4L4TE 1T1XA 2HG5A 2JCCE 3RWGA 1E0OB 5C9KA 4WU5B 5JDJA 4LLMA 5E03A 4FOMA 3I9GH 1RMFH 1YMMA 2XY2A 4PJ7E 4HX1B 3OGOE 3ELAT 2EE9A 4H1LA 1LP9F 2HTLD 3OF6D 4I18A 1YYLL 4YO0A 3CJJA 3QDJA 5HYQA 3A67H 3VXMD 1BJ8A 1CGTA 1VCAA 2O26U 3HFML 4H0IA 4DKEH 5FM5M 3CXHK 3FN0H 3TV3H 3QXDA 3LRSB 1A9EA 2I24N 3L7EA 3NCJL 2X4QB 2R0KL 4X8XA 5EBLA 1OTTD 2JB5L 5DXWA 2YS4A 1IQDA 5AZ2H 3RWDB 2PO6A 3IAGC 1AGBA 3BSZH 4UTAH 3LHPH 3MFGB 4PJGA 1A2YB 5T1LA 4CW1A 1CU4H 4Z7VA 1JWSA 3ZE0E 4YWGH 2Y36L 5GGSB 3EO0B 3VFGH 4PRAB 5DK2B 1R3KB 3HUJB 3ULVC 5F9WC 3ZKND 5IGXL 3L3IA 3RZCA 3H7BA 4Y88A 1YEHL 1F4XH 5GGVL 4N1HB 2DL9A 4S2SB 4XPTH 2DI9A 2KKQA 4X6DB 5JDSA 3WCYA 1F00I 3OPZL 4HFUH 5J12B 2EEBA 5F6IC 2VXUL 4P4KD 2VABB 2YN3A 5E8PB 1U8QA 2W0PA 3G9VA 4G7VL 4UT7L 4JKPH 4TQEL 4HWBH 5MP6H 3F6IA 4U6VL 3GSUA 3QIWC 3VGAB 3MOQA 4WI6A 3OAYK 2IC2A 4NT6A 4E5XA 2FX8H 3DMMA 3T0ED 5TQ0L 3HR5A 3TT3H 4NZDA 1NCNA 4URTB 2FX7L 5CEXB 5J1AA 1JHTB 1NCAL 2OTUA 1IAMA 4FFVC 1DLFH 2QBWA 1KIRA 4PRIE 5BVJB 2Z35A 1P2CB 5CCKL 1KPRB 4XAWH 5I1AA 1EERB 1N2RB 3OKKB 2HJKB 4WI5A 43CAA 5CD3B 2W0FB 5C8JB 2DBLH 2OLDA 1ONQB 4GG6E 5IBUB 1REIA 1S7XB 3NN8A 1EEZA 4XC1L 5CJXC 3EYSL 3P77B 4GRLC 4MAYB 3VI3E 2CQVA 2AK4A 4RMWA 5DA4A 3MLSH 3S96B 2ENSA 3SE9L 1IM3B 3V2AR 4NQCE 4P2YA 2Q76B 4XNMA 3QISA 1RJLB 5KW9L 1BQUA 2CUIA 4NUGH 2GTWB 1MHCA 3EW3B 1P4LB 4NM4L 1U41A 3FFDB 3MV7D 3BKJL 3D5OF 4F7PA 1VENA 3E6FB 2CDEA 2Y6SD 1AO7D 4PJDB 5DA0B 1AH1A 1CTOA 2VXTL 3MJGX 2DWDA 1JTPA 1CXHA 4YHOL 5IJVA 1U8HA 4H20H 2DQUH 2XWBA 4Z7WF 4JANB 4FFYH 4S1QL 5GGUA 2BVOB 4GG8B 3W9EB 3CK0L 4I1NB 2C1PB 4ZSOE 3AM8A 4X99B 4NPYA 5I1CL 2HJLB 4CU6A 3D85A 4GQPH 3RDTA 1WFTA 1MHEA 2ERJB 3H0TB 5IMLA 2P42B 2XFXA 5IHZB 4Z7NE 3RI5F 1T22B 4NKIH 1FPTL 4JO4L 3SE8H 5AG8A 1A1NB 3FB5B 2ZCKL 1EUUA 1JNNL 4G8IA 1JPSL 1RIHH 2V17H 3PIQA 1B4RA 5KANI 4A6YA 5C1MB 5HGHB 4XCEB 3FO2A 4JG1H 3S5LB 5DK3A 1UKQA 2BMKA 3BQUB 4EI6A 3L1OL 1N7MH 3MO1A 3DI2B 1QBLL 5FIEA 1IEAA 3TH4T 3DIFB 4W68A 1Z0MA 3GHBH 4G6FD 1B4JH 1YMHB 5CJBA 3BD3A 4HUMB 3VXTB 1T1WA 1YYLH 2VZUA 3UC0L 1KGCD 5CD5D 3RWHB 1WBXB 1I4FA 3S88L 1JGVL 3TBWA 1IMHC 4WUKL 4TPRH 4JFOB 1CXFA 5DVMA 1ZT7B 4PUBL 3S4SG 1S7WA 2Q7YB 4EI5C 4JFHD 4KRNA 3TC9A 2R0KH 2F8XC 2JB5H 2J4WL 2DQJL 4FP8L 4Z7UA 3BZEB 2F53D 1DBMH 2PW2A 4OZGA 5CAYB 4DGVL 1RD6A 1BFOA 3QDMA 5JZ7C 1C8PA 2E5EA 3STZB 3C9NB 2Y36H 5E56A 3VMPA 2D9CA 4GKZB 3ULVL 1IZKA 1QR1A 3IDMB 2CRZA 1M7XA 3UTSA 2NY0C 4LSPL 3RU8L 2FGWL 1YEHH 4TVPH 4JDVB 4APQA 1BJ1J 5C0BD 3NFNB 1KLUB 4DCQB 5EUOF 4JM2B 2B0SH 4PJHB 3B3IB 4AL8H 1TQBB 4RRPA 3AY4C 3MLVL 3T3PE 3OL2A 1ZA6A 7CGTA 1ULVA 1P9MA 3AREA 4OKDA 1BVZA 4F33B 4HIXL 4UT6H 4OFKA 5GRUH 5HDOA 3KPSA 4U6VH 4O2CB 3H9SB 3PWLB 2PXYB 4KQ3L 3SCMC 5ACZA 3MCLL 4KKAC 1SJEA 1CD1B 3FFCD 5TQ0H 3EZ8A 4HF5H 3PDOA 5EN2B 3SO3C 2YZ1A 4WVRA 3SE4A 4ZOAA 4HXAH 4HT1H 2VN7A 4NN5B 1DSFL 3VGFA 2HWZL 2NNAA 3EOAB 4QHLA 4PV9B 4MNQB 3UTQB 5I8KL 2R1WA 2CGRL 4RISL 3K1KC 1DE4B 1NCDL 2B7DT 4NRYA 1YPZF 1D5ZA 2BOBB 2OTWB 3CDYA 3TN0A 3C60A 3HMXL 3QIUB 4XC1H 5CGTA 2GJZB 3VFOA 1ORQA 3LZFH 1C1EL 2XY1A 1IC4H 4LLVB 4N0RA 4D9QD 1IAOB 1UFUA 3WNPA 3NPZB 2DQEL 3SE9H 5IHLB 4F7MB 1MFDL 2EDRA 1JGDB 4MZ2A 3SGDI 4P57A 4TSAL 2QSVA 3LQAC 2VQUA 4NM4H 5ICZB 1CWVA 2JE8A 3BKJH 3QWOB 1IVLA 4V1DE 3OMZA 2DTML 4HS3B 3DV4A 4MD5B 4OZIA 3V4PL 2VXQL 1M4KA 1E4KC 1XGTB 4CDGC 2ARJA 5BJTA 3PP4L 5DO2D 4Y7MA 5HSFA 2J5LB 2O61A 4YHOH 3KWWA 1HHGA 4O2FB 4ZAKD 3IDUA 5IB4B 2WZPD 4AIZB 4FRWA 3GJEB 3OKMA 4OZFB 5I6XB 1MCOL 2JIXD 3BP6A 3SDAC 5HHQB 4N0UB 3VD3A 3DYMA 3D39E 3EJYC 3CK0H 1IC5L 4JY6A 1L9NA 4U1NA 4R3SA 2I07A 3X11A 5E9DD 5AEAA 4MA7H 4O5LL 4F9LC 1T20B 4GBXD 2BVQA 4U3HA 4ZPVA 4QT5A 3ZTNH 3QJFB 3QXVA 2YUVA 5C0JB 1D9KA 4HUWA 5FDYA 2VWEC 5IBUG 2P45B 3MNVB 3OR7A 4JO4H 4F58L 3B6SA 3VGHA 4NQDA 1RK0A 1JNNH 2B1HL 5F7DA 1JPSH 1X6NA 3ARGB 5K9JL 2AI0L 1J11A 4PJEE 4Y19A 5GS2D 4N5EC 1AR1D 2A1WL 4OLVH 1NKRA 3QUZB 4I3SL 5D2NC 3HR6A 1VEMA 5EZLA 5C09D 3HI6H 4Y2DB 3MV9B 4JFYA 1K8IB 3ZYIA 4MLIA 3WUWB 5IIEA 2O5YL 1BREA 3BEWA 5DJAA 4YUEL 4PTUB 4YHML 1NEZB 3UC0H 1B2WL 3TYFA 2EIBA 4DK6A 4OCXH 4LCCC 1Y18A 5E24E 1CL7L 1K5NB 4ZYKA 2C7UB 3LN9A 2D0HA 2ZCHL 4FMFA 4X9BA 3S88H 1I7UB 3FZUD 4WUKH 3VXNB 1E4XI 1CFSB 5DHVH 1U8KB 1VHPA 2XA3A 5JO5B 1CBVL 4HWZB 3MRNA 5BRZA 1JGLL 5EOTB 1RY7B 2VLKB 1FHGA 3SPVA 3H9ZA 4AZ8A 4FP8H 1AGFA 5T33H 1QHOA 1RI8A 3EYVA 4B7LA 5FV2A 1S8DA 3TZVC 5F93C 1ZHBB 1X5LA 4ELME 5I1KH 5HD8D 4MB5A 1G0YR 2WBJA 3LKQA 2ICWJ 5DRXA 3QUXD 3I6GA 2YMXL 5E2JA 1AP2B 1JN6A 3MV11 1FN4A 3MLRL 4LOUD 4YE4L 4LSPH 3S5LG 2FGWH 2FLBT 3LV3B 5A43C 4MJ6B 2KQNA 1RJZA 5EU6A 2EDQA 4PJ9B 4ODWA 2PR4H 1FVEA 4J2XA 1H9VA 4GRWE 4TSBL 2AJYL 1DUYB 3E8UL 4TVPD 5ESQA 3RVVD 3V4UL 2BNRD 3D69B 4AENA 1X5XA 3X3GL 4K2UL 5L2KB 3RWJB 4C56E 1C5DB 4M6MH 4XNQA 2ATPB 1HZHL 2GITA 3G08A 3LKSA 3QH3A 2CKBL 2VUOA 4ZS7L 1PJ9A 1JNHB 1MLCA 4HIHB 3V8CA 3KDMB 3M1BB 3TBVB 4Q9CA 5SX5H 3IVKB 4M5ZH 1DSFH 4FQCL 5LXGL 2HWZH 4I9WD 2VLMD 4FMKA 5D7LA 4NOBA 2W1NA 3IAQA 3QXTA 3RTQD 4GKNB 4YDKH 1JYNA 3VFWA 2CJUL 4JB9L 4L29B 4NQXB 2IADA 5F3HA 2G5BA 5DD1H 3BGMA 2UYLA 3HMXH 5KS9F 1EAPA 1HK6A 2EYRB 1T5WB 2R23A 3T8XB 1FZOA 3ZDYF 1EFXA 1IBGL 4ONFL 2R4SL 4PRHB 3MLUL 5IMMB 3I6LD 1RZFH 2VN4A 3HG1B 5E94B 1BHGA 1W0YT 3HC0A 2DLEA 2VDOH 4HIJA 2W60A 5DEFB 3BP5A 3GSNL 5D8JL 3BPCA 4M7ZB 1WITA 3LQAL 3LEVH 4QRRD 3G5ZA 1KEGL 1KJ2L 1UGNA 1UZ8B 4FXKA 3C6SA 3GGWB 5JA8B 3C5ZA 4U0RB 3MJ7A 5MEQB 4RX4D 3NCMA 3PQYA 5T3ZE 3V4PH 1IT9L 3SDDB 1PZUB 2NTFA 3ISWA 3MV8D 2DQIL 3T65A 2X4NB 3ZKSD 2X7LB 1FRGH 1FV1B 1NCWL 5C9JB 2PETA 2W9EL 3WLBB 3CVHH 4KV5E 2OK0H 1IC5H 3QQ9D 5C0AA 2AJVL 1NFDF 2E7MA 5EU4B 4HS6A 1JHLH 3GSQA 3IFPB 3Q6FA 1QQDB 4NC1E 4I3RH 1QZ1A 4QHKJ 4NFCA 3I50L 4P23D 1OTUD 2NLJB 3WMSA 5HYJD 4AIXA 4PLKD 1Y0LB 2XXCB 3VWJB 1FFQA 5KZCD 4X8JA 1JK8A 1XF4B 2AI0H 1EBAA 3QB7C 1VEPA 5B8CB 5D1XC 1I85A 4XVTL 2A1WH 3GSVA 5FO8A 4UU9A 2H26A 4DKFL 2JK5B 3AUVA 3L3OA 4KZDH 1B90A 4QOKB 4WI9A 4HW6A 1C7TA 4YFLI 3CAFA 1OQXA 4M43H 5DMYA 2NY3D 3RWFA 1S7QA 5T1KD 3VE0A 5H2BB 5DFWH 1Z9LA 3BP7B 1A6PA 1RAMA 4N68A 3PV6A 2ZCHH 3WJJC 2GEEA 1QNZL 1UXWB 3MJ8A 1WEJL 2B20A 5D71L 1NAMA 5GS1C 3WIIH 1DDHB 5KSAB 1OF2A 3REVA 1JGLH 1DANT 1R3HA 1T7YA 2UZXB 5K9KB 3MODL 3FOLB 2XOTA 2XXMB 3MJ9L 4L8CB 4KUZH 3WN5C 3LPGA 5IJKC 2DI8A 4U1KB 2B1AL 2QV2A 4TNWF 1QBAA 1XGRB 1CLZL 4YE4H 3C8HA 4P2OB 2WWMD 1A3LH 4EDXA 2EKSA 2IH3B 3GDBA 4DEPC 5IM7B 3WIFB 3HTLX 5DURB 3ULVD 5I8OH 1PD6A 3G9AB 4X4XA 5ANMB 5BV7C 1F3JA 1VFBA 4LAQL 1G6RB 2AJYH 3DV6B 4IIQA 4TSBH 5IW6A 3NIGE 2CRYA 3V4UH 1Z6JT 1JPTH 3X3GH 1BJMA 4GS7C 5HHMD 1L7IL 1MCRA 4XI5C 3MRGA 1NEZG 5JHDB 4Z0XA 4AH2B 3IDYB 4LP5A 4DGYL 2FL5A 4P2RA 1XT5A 4OZHA 4L8SB 3ZDZE 4K8RH 1AY1L 2DYPB 1ACZA 2XZQL 1E4JA 1R24A 1NJ9B 3ES6A 1J88A 3QIWD 5IB3B 2VZSA 2A6IA 5HHOB 3UBXI 2GQHA 2P48B 5DD3L 4ZNCD 2L0DA 4JM2C 5HPOA 3FB6B 4JB9H 2VL5B 3PGCA 4FFVD 3QI9A 4CVXA 2EYSA 1HIMH 4MXQC 2DQFA 1I1CA 1TVHB 1HQRB 1U3HB 5CUSL 4WEUD 4AJ0A 4DFHA 2VTFA 3OKDA 2OTPA 1HDMA 4PJAB 4XNYL 3QEQD 2UVEA 1UCTA 4NDMA 3FOMB 1IGJA 1PGRB 4IBLT 5J13C 4PG9B 3F7RA 2GSGB 4QHUB 2A6DA 1SYVB 1T83C 4GXUM 5FUZL 4EBQH 1GPOL 5ISZE 4ZUUB 5DK0B 3LKOA 2HVJA 4GRLD 1KEGH 1KJ2H 4CVZA 1F11A 4NN7C 1T1YA 4Y0GA 5ALCL 1JTOA 1C16B 3Q6GL 3RNQA 4EXKA 5HXMA 5MEND 2Y07L 4WEBL 4R2GC 5DD0H 4JFEE 3V4VL 4M03A 1T89A 2A9NH 5F96L 4BSWB 2XQBL 3OJDB 4KK9C 2XWTB 3BPLC 3CFIC 3PDDA 1DQJA 4Z18A 3SHSA 3MRJA 3RY5A 2X4PB 4P9HC 3SGJC 5J57B 3EO1A 3KLDA 4YDVA 5T1MA 1FZJB 5D6DA 1M6OB 1HXMA 2D2OA 4J1UB 5DHYB 2BNQA 4LDOB 5GRJL 1GJIA 3LRGA 4MNHA 2AXFB 3PGFH 5DEGA 5GIRA 4J8RA 5E2WL 1FCGA 4NHCL 3QUML 4P59H 3G6JE 1ORSB 2XN9A 4GAFB 1NBZA 1RU9H 2FYYB 4ZG1A 2AP2A 2BXZA 3U30C 1QLRA 1OAUL 5CWSA 3CNKA 3N1MC 2AEPH 3MBXL 1I8KA 4OD2B 4GW1B 5E99L 1YYMH 4JHAL 5INDA 1CICB 4J6RL 3QG6A 4BH7A 2Q3ZA 2V2WB 2IPUK 1T7WA 2HRPH 3TCLB 3UBXB 5FAAA 3W5NA 3RL2B 4HPOL 3TVMA 1WBYB 2VR5A 4EOWL 5FYJE 5FCSH 1I3RA 1FO0A 3BUYA 1JNLL 2E6PA 4TOYH 1J8HE 4NN6C 2A38A 3G5YA 5IEHA 3G6AB 1TVBB 3EYUH 4K3DL 2VE6B 4JGMA 5HBBA 1BQSA 1NCCH 2D4FA 3FHQA 5DLML 3MR9B 3B9DA 4NRXA 1QNZH 4XBEH 4WI4A 3WIHL 1KJ3L 2IQ9H 3GK8L 5D71H 2AKRA 3CFKA 1WTGT 1X5GA 3N9GL 4WUUB 4K9EC 3P4NB 3ROLA 4Z5RA 3MODH 1KPVB 4PD4K 3OAYH 1YN7B 5HYIA 1I9JH 3VG0H 2CIIA 5J06A 4Y1AA 3KPNA 2B1AH 3CVIL 3P4OA 4EI5D 1NGZA 2N7AA 5A2FA 4X4ME 1I75A 3OKYA 4PJ5D 4YXKH 4DJMA 2QHLA 2XICA 4X5WA 3MYZA 1F58H 3W39A 1CFTA 5JZ7D 1K85A 1CXLA 3K0WA 3QFJA 2Z31A 1F13A 2YUZA 3FQWB 5BV7L 1Q0YH 5DJ0A 4OQTH 4PJBF 5C2BH 3WFDL 3QIBC 4XNXL 1AE6H 2ADJA 3IXAA 3J8F7 5EORL 2P43B 4WI2A 2DIBA 3IU3B 4KJPC 4BYHA 1F3RB 2NXZC 4DGYH 4G43A 4I3GA 4NBXB 4LIQE 4NQEB 1AY1H 3S34L 1C12B 4D0CA 1CQYA 4WHTA 4Y4FC 2ZOKA 1X5AA 3SCMD 3QAZB 4WJ5A 4PGDB 5E8EB 2E7CA 4KKAD 3UYRH 2VB5A 3GO1H 4OT1H 5E8NA 5DD3H 2MCPL 2DWEA 3QHFL 1EO8L 3MYJA 4M62L 4M8VA 1PLGH 5FF6A 4U1GC 1CFNB 3BPOC 5FO9B 3HZMA 4J4PC 1WC7B 3F58L 3GMPB 1IFHL 2ZKHL 4IMKC 3IYLW 1CD0A 2EEDA 1GPOH 2X9YA 3U79A 3ARUA 5DJXA 3IFOA 4Y4HB 3UJIL 4U1IB 1W0VA 3Q6GH 4X0KB 3MRPB 2BNUB 4LQFL 4IEFB 2UVFA 3L95A 5ID0B 1F4WL 2Y07H 5TQ2L 3RWCB 4ALAL 2AJSH 4RDQG 2A9MH 5IVNA 2XQBH 3G5XB 1O7VA 3UTTA 1ZGLA 4HCRL 1RUMH 4JZJC 4U1LA 2AEIT 2CUHA 2B5IC 4X7DC 5BS0E 4G9FA 4HDIB 4P9HL 5J89A 2X41A 1FAKT 3OG4B 5SWQB 1YNKL 2OYPA 1RHHA 3VFNB 4YGVA 1D5MB 3UZVB 1MEXL 2VISB 4FQLL 3SDAD 5FEBA 4RFEA 5E2WH 3S3PA 1T6VN 4NHCH 3EJYD 3NZ8A 1AKJD 2ESVB 1FBIL 2IPUG 5K9OB 1TNNA 4JN2A 3F8UB 2PNDA 4N9GA 3AMKA 3O3UN 1AD9A 2P5WE 1LP9B 4KZEL 3K8MA 3GBNH 4XPGH 2H32B 5E99H 3B2VH 2CLZA 4KMLB 4LARH 3CUPA 4J6RH 2UWEF 4OCRL 1E6JL 1AQDB 2PW1A 4QXUL 5I1JL 2CO7B 1HEZB 1GSMA 4R0LA 4HPOH 3NCCB 3CSYA 1PKQA 1RULL 4WNQA 1UJ3C 4EOWH 2IPKA 4R26L 4P5TC 2CLRA 2V7HA 1ZXQA 5ICYA 4Z76B 1JNLH 1LVEA 1FZMA 2JJTC 4N5ED 1AQKH 3ARDC 4CMMA 2XV6B 2CK0L 4LSQH 2Q8AL 4MA8H 2J88H 4POUB 2FJGB 3F7YA 3O4LD 3OB0K 2VZVA 1YMME 2D31B 3MLPA 3B83A 4XBPA 3WJLC 3ZLQC 3RA7L 2Y25A 2EZ0C 2X1PA 4KVCL 2F8OA 5T5NG 1AGCA 4PGZA 4ZTOL 5C92A 3WIHH 4OZ4A 5C7XL 3HUJE 2IAND 5AD0A 3INUL 1L9MA 1GRWA 3N9GH 5DJDB 2EDTA 2EDOA 4K9EL 2NX5A 3NFSH 5JPNB 2Y7QB 4KROB 5EIVA 1MJ8L 3I3DA 3BXNA 4AEHH 3LN5A 2XTJE 1V3JA 5I71B 3VA2C 1BBDL 3TFKC 2X4UB 4ZO8A 4MB3A 3MQIA 2D7MA 4PJFF 3RPIB 4XP6L 1U91B 4U1HA 2B4CH 4YDIL 1ZLVK 2V9TA 1IQWH 4GAYB 5TDPB 4PJGE 1CFQA 1F2QA 1QLFB 4JQXC 3NACL 3SDXA 3MACL 3TZVD 4QRPA 4YXLL 3WFEL 3PWPA 4DOHB 1IAIL 1LO3L 3LCYA 3HAEA 1JHKL 2A73A 4NSKB 4NC1C 2IQAA 5BV7H 4XMLL 1MCEA 1UEYA 3WFDH 3TESA 3KYMA 3OX8A 5I74C 5HYFA 2HG5B 3P73A 4LVNB 2DS4A 5IVXE 3LKPB 1O0VA 4BFBD 3D0LA 1NLBL 4JEGB 1JF1A 4ONOA 3HNSL 1BZ7A 3QUYC 4PLOB 1P7QB 1TJHL 5C0IA 4H25A 1JWUB 4G9DA 4POZC 4IS6B 2AQ3A 1LGVA 5HJ3B 1G7JA 1DBBL 2GTZA 3BH8A 3GM8A 2FGZA 3KPOA 3V5DA 1NBVL 1WWCA 4JRXA 3RZWA 3ILPB 1KLGB 3DYOA 3HRZB 1I8MA 1ZA3A 1A6ZA 4M62H 1FZKA 1HXYA 2P8PB 2ZNXA 2LU3A 1G7PB 3P30H 2H41A 4X4YA 3FT3B 1CGXA 1AGBB 1FCCA 1ZS8B 2ITDB 4F37F 1MH5A 3MRBB 4HXBH 4PTTA 1YN6B 3U0TB 4Z7WB 3ZT5A 4IRZL 5AAMA 5M7QA 4TYUA 2VAAA 3KXFE 5TDNA 3MGOB 2P4AB 1A6AA 2NCMA 1L0QA 2BSTA 3CXDH 1XH3A 5E6IB 2AK4E 3S97C 3TH3T 4TUJA 3U7WL 3VCLB 4PGEB 2J8UA 3UJIH 1H0DA 3HZKB 5DJYB 3F62A 3ZT7A 4WFFE 4PB0L 4NZTH 3GHEH 4LMQE 5JDSB 4Q2ZB 3MRCA 1F4WH 2CXGA 3SJVB 4ALAH 1J1XH 4KK5C 3QG7L 1OT1A 4BSVA 3H42H 2WP3T 4JFQA 4HCRH 5DD5L 3D9AL 1FFNA 1MCWW 1T5XB 3EYOA 5KAQG 1U3HC 4KDVA 1YY8B 3GSUB 4P9HH 1S9YA 4X9FA 4E5XB 5C07A 1BQHA 3P11H 1BBJA 3U2SB 1MEXH 2FIKB 4XB8A 3GJFB 5DZLA 1PG7W 1P6AB 4Y4KA 3QQ3A 4ODTH 3GSOB 1A7OL 4GW4A 3GMMB 2MQ0A 2XRAH 1CGWA 3HC3L 1A6VL 2MNUA 3VXUA 3FONB 1EJOL 4WHYG 5F1IA 1BD2A 2JJVA 5E1AA 4LHUA 2DQGL 2OJEB 4UB0L 3E2HB 1MQ8A 3ARBC 5DRZB 1CDBA 4G6AC 1E6JH 4M5YH 3T04D 4QXUH 4KTDL 5I1JH 2N1KA 2VR9A 1QD0A 1RULH 5FO7A 2EO1A 3S37X 4R26H 3MNZB 4LEOB 4BM7A 5SWZB 5D1XD 2JJSC 3UYPA 1WFOA 5KJRL 1IM9D 1UKTA 1X5IA 2HKHL 4U6YB 3BJLA 4EN3C 1FL6A 4PRID 5F9JA 5D2LE 5DRWA 3QXAA 5GGVY 2E7LC 3MFFA 2DWDB 1K8DA 1QSEA 3F7VB 3RA7H 1YEJL 4KVCH 3A6CH 1U8PA 3PL6A 4U2ZA 4ZTOH 2PN5A 5FM8A 5C7XH 3V9FA 4NO2A 2DJ4A 4S1SL 3TO4B 4ONGL 4PYHA 4K9EH 1XIWB 3RI5K 1TTGA 4MQ7B 1AXIB 4HUVB 5H35B 5EUOB 4YFDB 1FFPB 4YX2L 4PY7B 2X4SB 1KSRA 1IL1A 3BIKB 4MMXC 5T3ZL 2EDXA 1I1AA 3FB7B 2VDQL 3AFLA 4L5FL 2ADFL 2EC9T 4MA1C 4Z7UE 5IMLB 3U6RB 3BIAX 1PEWA 4OZGE 1FIGH 2F58L 2ORBL 4NC2B 4MJIA 3VFPA 1IGIL 3OZ9L 3ZSSA 5J6GA 2J1KA 3QDME 3JTTA 1NMCC 3V6FA 2XKSA 2C3WA 3GJFK 5CSZB 1CLYL 4YDJA 3MACH 2UY6A 4PGBA 4YXLH 5F97E 4JQVA 3JV4B 3IKCA 5K93A 4A6YB 3UTSE 4BH8B 3FO2B 1JYWA 3NPSC 1JHKH 5I8EB 4XMLH 1GGIH 1ZHKA 1A7PH 2X5PA 1Z5LA 2FO4A 4OF0A 4YIQA 1YPZB 1ZWIB 3V5HB 2RHEA 4ZXBB 5GGTL 3O41A 1DBKL 4R8WL 3BDYH 1BVKB 1UH2A 1H3VA 3MUGB 3BN3B 1XR9A 3RUGA 4Y16B 1E6OH 2DTSA 3HNSH 1UC6A 1OARL 3KLAA 3SDCA 5DMJB 3V6OE 3KPSE 1C5CL 4PJCA 3RQ3A 3ULVF 2EH7H 3KJ4B 3CLEL 3OHXB 4QO1A 4QRUB 1V7NL 4XI5D 4GUPB 2E27L 3ARVA 3RNKA 1JNJA 4DQOH 1HILB 2COQA 4LLYA 2VXSL 2XA8L 4FQXC 4X7TA 5HHXL 4R96A 4WO4A 3W11C 4BK4A 4CDHA 3RY4A 1S5IL 5TGBA 2WWKO 3WUZA 1KCRH 5KOVC 1OB1A 3GB7B 1JPGA 1ZSDA 1K3IA 4G8GB 4MX7A 2VDLL 5H94B 4JM2D 1KB5B 2WIIA 4ZFFA 3VD4A 3MC0A 4IRZH 5HI5C 4LCWA 4KVNL 1PFCA 1QA9B 4P5KA 3CCHB 5TDOB 2VLLB 3LSOB 4MXQD 4M61B 3T1FA 5IEKB 4IRJC 4OV5A 2EDFA 3W5MA 2PXYD 5GS0H 5E5UB 4PB0H 3VJ6B 2A6KA 4HEME 1QSFA 4ONHA 3CZJA 4F7CB 3AREB 4OZIE 5J56B 5DD5H 4DK3A 1FC2D 1CT8B 4H1LG 3VG9C 5DMKB 2GAZB 3CDFA 2R1YB 1MQKL 1UQSB 4L4VD 3KYKH 3WS3A 4R2GD 4L3EA 4M7LT 3UZEA 1IEBB 5JHLH 4KK9D 1QPXA 1MLBB 4IRSC 4MDIB 4OAWA 4MA3A 4LU5L 1S7UA 1WK0A 1MI5A 2J6EL 5IFJA 4XCYB 4KQ4L 4PREA 4KMQA 2VYRE 4RGNC 2CIKA 4QWWD 1QLEH 1I7ZA 2OR9L 3VFUA 5DMGC 4MDJA 2VLRA 3B9EA 2DQHL 4XP1L 4F2MA 3AVEA 4Y5VA 3VXSB 3HI5L 3VFOB 3IFLH 1G7LB 1W0WA 4NQDE 1A6UL 5CIPB 1QFWM 2UV3A 3VXQB 4FTVB 4PJCF 5HDQL 4KTDH 5KVMC 4FFZH 3NCBB 5BZWA 4EIGB 3ROOA 4Y19E 3OJVC 4IOIA 3S36X 1UADC 1UB6A 2OS7A 3D0VA 3QPQC 4XPAL 2EYTA 4JGJA 2ZOLA 4HKBA 1Q9WA 3GI9L 3STLB 1RZ8B 1OGAE 5KSUA 1OAXH 5MHSE 1WIPA 4E42A 4W81A 4W6XB 1JMXA 1TENA 3MCG1 4QXWA 1BIIA 4TUOB 4PR5A 1YQ2A 5DYOB 4ONGH 5I1GH 4HUKB 3UTZA 5SWSA 1HCVA 4AEIH 2BHYA 4R3SB 2N7BA 3O6FA 1HI6B 1OP9A 4W6WB 3P4MB 4TSCL 5BRZE 3NZHL 3ZL4L 3MLZL 5A3IC 2BVQB 2DKMA 2ADFH 4HWUA 5MEOB 1GGCH 4H0HB 4Q0XH 2NW3A 2QEJA 5DFVC 3CSPA 1IGIH 3U46B 4RA0C 3B6SB 4GAGL 2VMFA 4LNRA 4UQ2A 3IETA 5F7DB 1OSPL 3X12B 1ADQL 1U3YA 1ED3B 3EO9L 4KFZC 15C8L 1T0NB 3CDGA 4PRPB 3TIDB 1S3KL 4B50A 4M8QB 4M7JH 5A2KH 2BSRA 5EU6E 3D39D 4OD1L 5I71C 5IKCA 4R8WH 5KS9B 3GEWB 1YEKL 1GGUA 3VWKB 3Q3GA 4P4RA 4G42A 2OP4H 4MNGB 1OARH 4ZDHA 4O51B 4XXCC 2QSQA 1C5CH 2EIZA 3HE7C 2HJFA 3VGDA 3CLEH 3JUYA 1MAKA 2OZ4A 3MLXL 3ZHDA 5HGBA 4LVEA 4KJPD 5FA4A 2AV1A 1KG0B 2NXZD 3DSFL 3R0NA 1S9XB 3HKFA 2XA8H 1I1RA 1C08B 5FYJL 4BQ9A 1SM3H 4CU8A 1W72B 3IJHA 1T04A 5DD6A 1S5IH 5D7LE 1QTYT 4JVUA 3ARYA 4Y4FD 4QCIA 1E28A 1G6RH 3ZZ1A 3IGAA 2YPVH 2XPGB 4UIKL 1HHHA 1T1ZA 1QRNB 4MHHI 2GCYB 4ZD3L 4Z77A 5TPWH 4UBDD 1FYTB 1BGXH 2H8PB 4KVNH 1JGUH 2BSSA 4PIRF 4I18C 2PTVA 3I84A 1FN4B 4M3KB 1NFDB 4YPGA 2OXHA 2FD6H 2Q8BH 2FRGP 4J4PD 3DTXA 2RFXA 3C5SA 4QHMA 5B39B 2XTJC 3ZE2E 1RFDH 2A77H 2GJ6B 4LL9A 1NKOA 5DT1H 4IDJL 4LFHG 4S1DC 3GRWL 3MUZ1 3PQYE 1TTUA 3LY6A 2PO6C 4MJ5A 3RBSA 2ICWB 4YHIB 1G1CA 3WL9A 1R3LA 4JAMA 4W70A 5BMFL 2NY4C 2E6JA 3G08B 4HMDA 4CGTA 2X09A 4LKCB 1ZHLA 4XCFL 3RZCC 2BVPA 3O3BB 3LQZB 5CJQH 5C0AE 4LU5H 3TBTB 2BC4B 5EZOL 4YR6A 1MREL 4PJ8A 4CMHB 4O2EB 3LD8C 3OXRB 1N59A 3B9KB 5CGMA 2DJSA 4KGLA 3VD5A 1U92A 4WDIB 2DQHH 2EDDA 1BEYH 4M00A 2Z92B 3HI5H 3PWNB 1MRCL 1BFVH 5IB2B 4LIQL 4UIMA 3G5VA 4LPTA 5EBMA 2Q6WA 4ZFGL 4Z0BL 4AQ1B 5HDQH 3EDDA 3EIFA 1QYGH 1WWBX 4GKOA 5D7SL 3DMMC 5B3JE 1PDKA 4C56D 1F90H 2W60B 2KH2B 3M8OH 2P49B 3PHOB 1BOGB 3BPCB 1VACB 1QOKA 5GGQH 5C0FB 5C2UB 1DR9A 3LDBC 1T80A 3GI9H 3WEXA 4RRPG 4EUPA 3DO7A 1MF2L 2F19H 4PBWD 3VXMB 4PLNC 3U9PL 2BFVL 4P5TD 3CC5B 4G6ML 5FYKU 1ZGLM 5L6YH 1WISA 3ARFA 3E0GA 4IJ3B 4D0DB 2FSEA 1NFIA 2DM4A 1X7QB 3T0BA 3GMOB 1KCVH 2E9WA 1FE8L 3JV6B 2APXA 4XP4H 5ESVA 4Z78B 3BGFB 5B38A 4ETQB 1XGPB 2H9GA 2JCCA 5ADOL 3RHWF 4HKJB 5L2JA 1GGBL 4TSCH 3BT2L 3ZL4H 1GIGL 3A0OA 2P5EE 3T0EA 4PJIA 4LNVA 2OL3L 5FOBA 4I2XA 2B2XL 3MRFB 5MERB 1GOFA 3TFKD 1OSPH 2XQYK 3DYPA 3JWDH 2F9BT 4NWUL 1ADQH 4HGMA 3MRLA 3EO9H 1I8IB 4K7FA 4P4KB 1PW3A 4LGSB 4LSTL 5TH2A 4D0BB 1S3KH 4LLDA 2VLJA 2DQTL 4U3CA 4XCNB 5KVEL 3AM8C 4OD1H 1L0YA 3MRDB 4F3FB 2ENYA 4XMPL 4E41A 1CFVH 4POYA 1U58B 1Z9OA 2Y5EA 3V0WL 3RDTC 1N6UA 3KVQA 3RWFB 1A0QL 3V8OA 3VDCA 1FNGA 3BHBA 12E8L 4L3CA 2J8OA 2GSIB 1GZPB 4AM0A 1FNEA 1NUFA 2A83B 4AT6A 1WWAX 1ZAGA 3MLXH 3VD7A 5FUOL 4P2RE 2JELL 2D3VA 4OZHE 2WUBL 5I66B 4TNWK 3EFFA 2P8LB 4U31A 3BWAA 1OAZL 4HZLA 3UPRA 3QUYD 2IBGA 1JUFA 5FYJH 3TT1L 2AERT 3BO8A 4IM8A 4POZD 4P2OD 2FWOB 2XG5A 1OCWL 4IDLA 5FDWA 2WW8A 1H5BB 2XIDA 3ARTA 3VH8A 2XNAA 1S7SA 4GLRH 4Y8AA 3U1SL 2BVEA 2V5SA 4UOW1 3MV7B 4XPBL 1BAFL 5DJCB 1LE5B 2HLAA 3OG6B 1SEBA 4OCYL 5F7WC 3IF1B 2KZWA 1AO7B 3EGSB 5JHDD 4JRYB 1DL7H 1RZKH 2IAMA 4OLZL 5DJZA 3I75A 1MIMH 2ZSVB 4GG6A 4HUXB 3MLYH 4HPYL 1F3JB 3U7YL 3C8KA 4HIEB 3P40A 3U82B 3BH9B 3GRWH 4KRPC 1NGXB 5IW6B 4PJ7F 1X5JA 1TPXC 3AXLB 5LWYH 4WHYH 1MJJB 1P5UA 4JJHA 5C3LD 5HHOD 2HTKC 3LN4A 4LCYB 1RQ5A 1VGKB 4GSDL 3HE6A 1TCRA 2E7HA 4YBQC 4KK5D 3VRIB 4NQCA 5EO0A 2FL5B 3BGAA 2AK1L 4XCFH 3OB0H 5L88L 2Z9TA 4YFEA 2D0FA 2YPLA 1U3HD 4APQC 1G9NH 3QXWA 1GYAA 2YK1L 2BNQE 5FKAB 1INEL 4G8FA 2R56H 1I7RA 4C54A 1K4DA 4RQQA 1CVSC 1CK0L 3GUTB 2XN9E 2P8MA 4NKOB 4X6BB 1FL3A 1P9MC 3AREC 4OF6A 3A6OA 4NO0D 4N5UA 1OSZA 4KH2A 3BZ4B 3ZE0F 2CDGB 3QDGB 3LMJL 2DDQL 3V6OC 1PSKL 4I0KA 5LQBL 3GMNB 4ZFGH 3OKDB 4Z0BH 5HHPB 3DVGA 2DLTA 1RHFA 4G6FB 3R06A 5AYUH 5CBEB 5J11C 1ZLVH 1MHHB 2A6JA 3ARBD 5LCVL 4G6AD 5IB1B 5D6CA 1RJCA 3O2DH 1EH9A 1NMAH 1RPQA 5B39G 3SE4C 1UH3A 4MXWL 1MF2H 3U9PH 3F7PC 4JKWA 5C0DB 3TN0C 2IMNA 2NR6C 3C60C 1S7VB 3PP3K 4G80B 1N5YH 1FNSH 1YEGL 2PUQT 1QSZA 4BZ2L 2BP3A 2XG4A 3EUUA 4EN3D 5DVKA 1WCBB 1XZ0A 4MD0B 2DOCA 1KFAL 2F53B 5EBWA 2X70B 1KTLA 3QPXH 3EO1B 3RWEA 2GT9B 4I4WB 3HPJA 5ADOH 5D93B 2X44D 1LEGB 4QHNA 3A6BH 1GGBH 4JFFA 3BT2H 1ZT4B 3P9MA 4J23A 2R69L 3NCEB 2D7TL 5I73B 5ISZD 4DKDC 3K1DA 5F7MC 5B22A 1NC2D 1MCPH 4GG6F 3GIVB 3M17A 3V5KA 1AXSB 2ICEA 5LGHL 3PJSB 1II4E 4HWBA 4Y1AE 5C0BB 1AGDB 4X7CC 4FQ2L 3BX7C 5CWSB 5EZJB 3VI3F 5DJ6B 1MVUA 1I8KB 3Q1SL 4WHDA 4JFED 2O5XL 2W9LA 3QRGH 5F9AC 3MCKB 3GSWB 5M94B 4O9HL 5DVLA 2ARJQ 3L3HB 2FECL 2XKUA 2NY5C 2H45A 5FM4A 5TFSL 2DQTH 5FA3B 4MCYB 1KC5L 1JMZA 1PZ5B 4WI8A 4ZFZA 1Q94A 3QFJE 4BQCA 1H3WM 3CMOH 3FFCB 4JM4L 4NCC2 4WW2A 1VKXA 1A0QH 3QDAA 1CTNA 1D9KC 1RZGA 1RZJC 3JWOH 5JMRA 3NTCH 1J0KA 5A16B 4H5SB 2PTTA 4Q9QL 1RZ7L 5FUOH 3MRIB 1NGWB 2WUBH 2LTQC 4A6YL 3OR6A 4P46A 1KIPB 3KS0H 2LVCA 2FX9L 2CLVA 3G6DH 4P9ML 5BXFB 4CBPA 3O6MH 3ROLB 4TNVF 4LASH 3WFHB 2C3HA 4FQQA 4P99A 4WV1B 3PE9A 4NNXA 3LB6C 2Q86A 2NYYC 2VQ1A 2X4RB 4JPKL 2VDMH 4PP1C 4Z7NF 1CLCA 2KZ1B 4H8WC 4FQXD 4I5BB 4U1SB 3W11D 4S1RH 5FYJD 4C55A 3U1SH 4D8PB 4H1LH 5IK3B 1BAFH 1A9BA 4U6HA 1J8HD 1HWGB 2YRZA 4OCYH 5CLWA 1T0MA 4HLJA 4MB4A 1CFTB 5D7JA 5BVPL 4CNIB 5J9PB 3EHBC 4OLZH 4LLAA 2YR3A 4ZAKB 5KSBF 4RAUA 2I26N 4HPYH 2OR7A 3U7YH 2JIXB 1U8JA 4BQ6A 5E08L 3VRLE 2JB6B 4IRJD 4PGCA 3VXRA 3QULB 1EBPA 4U1JB 3B5GA 1A22B 3SQBA 1XF3A 1HNFA 4GSDH 3N1PC 3UTTE 4MAUL 2Z4QA 4GBXB 2UWEB 2WBJC 2OR8A 4HC1A 1Q72L 2AGJL 2YKLL 1AIFA 1UM6H 3QYCA 4G9FE 3NAAL 3ARXA 5CGYC 5CHNA 5L88H 3MXWH 1YJDH 4L8BA 4V1DA 4LPXA 2A2QT 2YK1H 1INEH 3LKNB 1B0GB 3D3VE 4QY8A 1FFRA 1CDCA 3O3DA 1WIUA 4IRSD 4MJ2A 3MYJB 4Q6IA 1CK0H 3C6LA 5HHVL 4K94C 2C4FU 1SJHB 1LD9B 4U7KA 4PRBA 5GRXG 2GFBB 3LMJH 2CH8A 2DDQH 3T2PA 1PSKH 5IROA 5C09B 4RGND 4GMTL 3RX7A 2I9LA 1A4JA 1CZ8L 2ZP0T 1KENL 4M7LL 5DMGD 3I3EA 4HKXB 3G04B 1UYWL 1F4AA 4M02A 2I27N 1A1OB 3GJFH 3QIBA 5BO1L 2C4FT 3WXWL 4D3CL 1PKQE 3T4AA 3IDJA 1W0VB 1KIQB 1HNGA 1TJGH 2P46B 3QNXB 4PJFB 5ERWA 3T3PF 4OB5L 4Q9RL 1FP5A 4RIRA 5C6WH 3BD5A 3QPQD 5GS3A 2X89D 4ENEC 1ZGLB 2WQ8A 1J05A 1EFQA 4LSSL 4XGZB 4M6NH 1YEGH 2R0WL 1TQCC 4JY4A 4BZ2H 1UG9A 2F8VA 2YSSB 5CMAB 1HSAA 1MCLA 1OM3H 4RFNC 3VMOA 4JPWH 3FN3A 3N85H 5LAXA 5DWUL 2VC2L 1FSKB 4CADA 3P4LA 1OGTA 25C8H 1EHLL 2MKLC 2NX5E 4YGVB 3NBNA 3QUXB 5DUBA 4NNYB 5ID1B 4R7DA 1IAKB 3W2DL 4FQHA 1TVDA 2FR4A 3C5ZC 4KTEH 4N0FB 2OJZH 3REWA 4JFZH 1WBZB 4N9GB 4GXUN 5FGCB 2NY1C 3U7AA 1L0XA 1M7DA 3GMRA 1A6WH 4FXGB 3ZKXC 4OFPA 5A3ID 5EC2A 3Q1SH 5FXCH 3KPLA 1J5OL 4N9OB 3MRMB 3TWCL 2NY5L 1JRHH 3SDXE 4QRPE 2BNRB 1DLHB 4TVSa 3OBAA 3PWPE 1WAAA 1KC5H 2EDNA 3O0RH 4LF3A 2X4OB 3T0DA 2ED7A 4XNZB 2QSCL 1Q9OB 3QFDA 4UT9H 4ELMA 3OKLB 3V52L 3VW3L 4JM4H 1FZMB 2WBKA 4Y5YA 3O3AB 4C4KO 3RP1A 1FG2B 1RZJL 1KNOA 4ODSL 4XNUL 1WIOA 3FMGL 4KXZH 2GI7A 4KJYB 5I15L 1RZ7H 1YEDB 4JREB 2P5WD 4LCUA 5DUMH 4A6YH 4OZ4B 4UV7H 5FYLE 1I1FA 3GSXA 3O9WA 4Y5XA 3RGVB 1I85C 4I0PB 5J3HC 3HE7D 3LRHA 5F71A 1AHWA 3U4BH 4F15C 4ODVL 2JF1A 4RNRB 3HI1A 4X6CA 2P7TA 3CFCL 4JPKH 1Q9LB 4PBXA 4JRXE 1U9KA 2R9HC 4N8VA 4O58L 4H8WL 4XP9L 1BM3H 4MSWA 5DQJB 3ZO0A 1ZK9A 3FQTB 5FHBL 5B21A 3BN9C 1RVFL 3IJSA 4QRRB 2IF7A 3H9YA 5F1KC 3WO4B 4XC3L 1B6UA 4OD3L 4PJEF 1A7BA 2ZSWA 3QO1A 4MGXA 4QRTB 5BVPH 1YMMD 1JL8A 1G6VK 3PHQA 1G7HA 3MV8B 4EDWL 2IG2L 1RZIA 1LO2L 1A6TB 3QUKB 4MVBD 2J8UE 4TULL 4LSVL 3DRTB 3QDJD 2ZG1A 3CLFL 5HYSA 1LO5B 1VADA 1MNUL 5GXBB 2HT2C 2XTJD 1JF1B 1P4IL 4P3CL 4MAUH 1ND0A 3T4YB 4HK0A 3GSRA 4S1DD 2SEBA 1Q72H 2YKLH 4HIIA 1IKFH 5I19H 4P23B 4XXDA 2BRQA 2PO6D 1RUAL 3NAAH 3WLWC 3ECBB 5HGGS 5HYJB 3MA7B 5C07E 3GMLB 3VXPA 2HH0L 1J1OL 2NY4D 4F37K 3RIAF 1XR8A 3GMQA 5KZCB 3V5DB 2E8YA 1EJ6A 3F5WA 4I48B 2PYFB 4OGAC 3RZCD 2VRAA 2OQJA 4K94L 1ES0A 2YHGA 1T2QL 3FQXB 4IIQC 2XZAL 4R90L 4ELMF 5C70A 1H3GA 1ZOXA 4JQXA 5EDXA 2MHAA 1EGJH 1BD2E 4IHOB 3DROB 3CPLB 1GOGA 1A1MB 1CLOL 1CZ8H 1KENH 1FVDB 3TNMA 5FCUL 2NY3B 1E4XL 1D3CA 1UYWH 2WNGA 5DHVA 1WF5A 4HMCA 1K4CB 1U3JA 5T1KB 1S5HA 2EDYA 3WXWH 1CGVA 2PKDA 1F6AA 4GRWF 4U6XB 3U4EB 1H15A 5E2TL 4KTYA 4OB5H 3DMMD 3WV0A 2X6MA 5BZDB 4KRMB 5DQDH 3L9RB 4NP4L 5JW4R 5CINL 2P24B 3QI9C 1KJMA 3BE1L 4JFXB 1PY4A 4LSSH 2R0WH 2KDGA 5EO9B 3HPLA 2CXKA 4P2QA 3GBLA 5CIPH 1QSEE 4M48H 1S9KC 4L9LA 1KCLA 3KPRA 4K3HA 4KRLB 5JW3L 5LGKA 5DZOA 4JCMA 1JZ2A 2DM7A 3EYFB 1EHLH 4NNPH 4HGWB 4LLQB 1WZ1L 3IB4A 3KNBB 2Y9RT 3L3KA 2AK4D 4FG6C 1JWMA 1U93A 4OJFL 4G7YL 1KJVA 3VXUB 5IOPA 3O8XA 4WFFD 5I1DA 1LE9A 1G7IB 2ZUSA 3QT2A 5ITFA 5F9WB 1T89C 2IGFL 5TE6L 2NXYB 4MJIE 5C0CB 4QEGA 5A2LH 3TWCH 3MA9L 2HN7A 2NY5H 2YD3A 3OQ3B 3SEPA 1A3RL 5HHMB 4WWKA 5D6DC 3QNZB 1B0RB 5GISL 1NBYB 1PY9A 2AS5M 3MGTA 2BVYA 3WNOA 3RAJL 1WV7T 4HJJH 5F6IB 2EDHA 3VW3H 3D18B 3MRQA 5D1QA 4DN4H 5HHNB 3S9DB 4HJ0D 1FH5H 4N8PA 2NQCA 1RZJH 4BK5A 5GJSH 1LEIA 3D2UA 4ODSH 4XNUH 3QIWB 5DRWB 3FMGH 4X7FC 3RUGE 3THML 5E8DL 1S9VB 3D85D 2V2TB 3RDTD 1H3XA 4KV5F 5GRWA 5I2IA 2VO5A 1Q0XH 4H88L 3DSNA 5C0GA 5MI0C 3DGCR 2E9JA 4LVOC 2ZCLL 5K9QI 4ODVH 2XYCA 1UB5A 5ETUB 3BEVB 5F7FA 3S35X 5KN5B 2ED9A 3CFCH 3UJJH 3TVMC 3QEQB 4YNYA 2AJXL 2QKIA 5EU3A 1U8NA 4JFPA 1LDPH 4FZEL 5FB8B 1NUNB 1JBJA 4ODXB 5FUCE 4LSRL 5FHBH 4GRLB 2MTPA 1NMBL 4ZXBD 3CVHA 4W4OA 2EH8L 5IHUL 1ZTXL 1OP3K 4LCWE 4PGBB 1K2DA 3VXOA 4NO5B 5JW4Q 5MENB 4LFHD 4RAVA 4E9LA 4EDWH 2IG2H 2Z8VC 4YHYC 3V0VB 1LO2H 4ISVA 1NAML 2MPAH 4TULH 3OGCA 1W72H 4LLUA 3WS6A 5EWIH 5INCA 3O41B 4R6UA 1QSFE 1QO3A 1NSNL 5IMOA 3NIFE 1P4IH 4KUCD 4P3CH 3UDWA 4DVRL 5C08B 4M4RA 4KRPD 4PJCB 5HGDA 2AXGA 4RZCA 1RUAH 2ITCA 1MRFH 4G8GD 2HTKD 4L3EE 3ZT6A 1KTDB 3QDMD 1I1YA 2HH0H 4YBQD 3B5TA 43C9B 3DUUB 2Z31C 4R96B 2H2PC 3OKOA 1NDMA 2FBOJ 4LLWA 3UTSD 5D96C 1MI5E 4UNTA 4APQD 1HH6B 2XZAH 4HBCL 4R90H 4EJ1C 2AJ3A 1U3ZA 1C5BL 1HHJA 1YQVL 4QTHA 1HSBA 2VLRE 2WIIB 3PWVB 4ZFOA 4DTGL 4K71C 1S7RA 4OCWL 5FCUH 4U7SA 3ARED 2HRLA 1DFBH 4U7MA 4WI7A 1CI5A 3RL1B 3T1FB 1TZIB 5J6HB 2FHFA 3KPSD 1YDPB 3HAEG 1OPGL 3HLAA 2Y5TA 4UOJA 1CDUA 1UWXH 5GGRY 2X4TA 2H3NB 1JYVA 4X98B 5IMKA 3NIGF 4Z9KB 4AMKL 3U9UB 3DXAA 3MBEA 4NP4H 5D72L 4JZNB 3HCVB 1I9IH 3W9DA 3MROB 1RUQL 1MY5A 3OV6A 5IW1A 5I76B 3BVNA 1LMKA 3HMWH 1MRDH 4OFYA 4OKVA 3RJDA 2XZCL 3ZKMC 3QZWA 3ZDZF 3LH2L 1CIDA 5TE4H 4PRNA 1ZMYA 4OCNC 5JW3H 7FABL 3TN0D 3IU4L 4RGOL 1PYWB 4WW1A 4EI5B 4X5XA 4QTIL 2YD4A 3PXHA 3GBML 4YHNA 1SJVA 4GRMB 4M9PA 5CEYB 4ELKA 3B8YA 5SWSE 2IFFL 1DQQA 4PJ5B 3FRUA 5IFAL 2GK0A 1FFOB 1EXUA 1INDH 2G2RA 4OJFH 3GKZA 1H8SA 3VFSB 4YHLL 5ITBL 1DEEA 2QLVB 3DRQB 4BJLA 5F7UA 4OLXL 4N0CC 2ZUVA 2IGFH 4WIQA 2RIKA 5TE6H 3T77A 3ZDYE 2DQDH 2YWYA 2QQLH 4DKAA 2NY0B 1TITA 2H6PA 3MA9H 1Z9SA 4QNPE 3W0WB 3RVUC 2YA1A 3TPUA 4N0YL 5BZWB 4KMTL 3RX8A 1A7RL 4IOIB 3KPPB 1BLNA 3RAJH 2LV4A 3D0VB 4WENB 1G9EA 2RBLA 2EYTB 3DGGB 2ZOLB 1HHIA 1MFAL 3KPMB 4RA3A 2NZ9C 4FZ8L 3R1GH 4F7EB 2X10A 1MELA 1T21B 3OAZH 3SCMB 1ZEAL 2PYEA 1NAKL 4V2BA 4JFDE 5E8DH 2CKBB 3WKNA 1FYTE 2CMRL 3SO3B 2PTUA 2OSLA 1BMGA 4X80L 3OKEB 1D9KD 3O2WL 4NZJA 1IGFL 4YHPB 1YY9C 2ZCLH 4R7NA 3RVXC 1SVCP 1H3PL 1X9QA 4NQDD 4R0LC 1JZ3A 1QEWA 5D5ME 5JOFB 5D7IA 4QLRA 2FBJL 3FB8A 3G6JF 4ODUA 4DVBB 2AJXH 1J18A 1R3JA 4Q6YA 3GFUA 4BKLA 2A74B 3VFMA 4Y19D 1FO0L 4FZEH 3ULSB 1WWWX 1WSST 2NW3B 4KU1A 4LSRH 4LHUG 4AEEA 4KJWC 3LB6D 4JO2L 2NYYD 5E00A 1RUPL 1NMBH 5HGAA 1OD9A 2YPKB 5D1ZA 3B9AA 1ZTXH 3BAEH 5MHSD 3K4AA 5E2VL 1VFMA 2VDPH 5DJ8A 2C3GA 3GSNB 3CZFB 1PAMA 2F74A 4G6KL 4WFGE 1XGQB 1NAMH 1DVFA 3QNYB 1DN0A 4OFVA 1LEKB 3DUSB 4D9LL 2FLRT 1UVQA 3TYGL 3EHBD 1N3NB 1ACYH 3L5WA 3R8BB 5HVHC 1PQZA 4UAOC 3TA3A 3TNNA 1I7TB 3DX9B 5KSVA 1YC8A 4DVRH 4EXPX 5BRZD 3VFVB 3WFBH 4ORGA 3H3PL 3SDAB 4PP2A 3L5XL 2H1PL 4NJ9H 4NQVA 4QXTA 1AKJB 1N4XH 2F54A 3QXUA 3WO4C 4FNLL 5IB5B 5HGBB 5JXEA 2D9QB 5DZNA 5CBAA 3S4SA 4YXHH 3GNML 2WBJD 3I02A 1LK2B 1MCKA 5JORA 1K6QL 1YC7A 4DZBB 3LS5L 5F1SA 5CGYD 5DD6B 4MCZB 2XACC 1VESA 2D03H 1AD0A 2QTEA 4YPJA 1C5BH 1TETH 1YQVH 5EU6D 5BS0A 5LGJA 1HHHB 1RIVH 1A7NL 1X5FA 1CG9A 5HI3C 1VGEH 3BDBA 1EEUA 3H7LA 5HY9A 1J9CT 4IMLA 4KPHH 4RSVA 3LEYL 5D2NB 3WNMA 1MCNA 4L8DA 1FLRL 1ZHNA 3UPCA 3O4LB 3V95A 3DTXB 5C0RH 2HKFH 4YBLC 4WU5A 2IALB 4AMKH 4GO6B 5KVGH 2IANB 4HX1A 4XXCA 5KVFH 4X9HA 1RUQH 4GAJL 4MJ5B 5D7LD 4LCCB 2L7JA 2XZCH 3WL9B 4OQ1A 1QFWH 2YBRB 5L7XH 1IC7H 1ZLUK 1X44A 4ENED 2EDWA 3IS0X 3LRSA 1EFXD 2X4QA 1D5XB 2IFFH 4OQTA 1UA6L 5IFAH 5D70L 1N8ZB 3TZVB 4FABL 1NDGB 1UCBL 8FABB 1BVLB 4HV8B 3PUCA 4WEMB 2AJUH 2C3VB 4OLXH 1T7ZA 3T0EE 4PJIE 2BJMH 2BOCB 2QHRL 4PRAA 2R1XA 1R3KA 5DK2A 3HUJA 3C5ZD 4I2XE 2ED8A 3PQYD 4CVUA 1IAIM 5F3BA 4XVJH 5DDHB 2NY1D 4HWNA 2Y4SA 3P0YH 1L7TH 4S2SA 4KMTH 2F5BL 3MRHB 1MAML 1NCUA 4X6DA 4EQ2A 1F2XK 2VLJE 1S78C 2EECA 2ZG2A 4NZUL 5LVEA 1D6EB 4Y4KC 3L3JB 5GSRB 5JW5B 2VABA 5E8PA 3RKDC 4FZ8H 5C0AD 1Z0NA 1I8LA 4E41E 2NY6C 4PJXE 3ESUF 5F9OH 1ZEAH 3P9LB 4K7PL 3RHWK 4HGKC 3U0PA 2CMRH 2NXYC 1G0XA 5ABDE 3GI8L 3K2MC 1IGML 3E6HB 5CEXA 3FN9A 1JHTA 2R2BB 4UINH 5H8DA 1G9MH 1OLZA 2IMMA 5BVJA 5CEZE 4TTGA 4L4TB 3C09C 2FBJH 3K81A 3X13B 1N2RA 3OKKA 2HJKA 5CD3A 5IVXA 2EXYC 4PJ7B 5C8JA 4UQ3B 1ONQA 1XF1A 1WLHA 5F7NC 2APFA 5J3HD 1S7XA 4K3JL 1I3GL 3L5HA 2BK8A 1RUPH 3P77A 4MAYA 4IOFC 1MFNA 2RR3A 4IOSD 2R9HD 3WNKA 4HJGB 4MS8C 3QCUL 3VFRB 2HVKB 1IM3A 3PL6C 2Q76A 4KI5E 4OF7A 3QCTL 1RJLA 4G6KH 3T2QA 2GTWA 1P4LA 1A47A 1I3VA 2F5AL 3DHJA 3FFDA 1OAQH 3WO3B 3E6FA 3TYGH 4X7SL 2BDNL 4PS4L 4PJDA 1BFSA 3JBG7 4X7EC 2QQQA 4WCYH 5IF0B 1I1AC 3AS0A 2QL1A 5JR1H 4NKDB 3KXFA 3H3PH 1A02N 1D6VL 3U36B 4CUCA 2H1PH 5E4EC 3SKNB 3IDXL 4TRPL 1S7TB 2BVOA 3DVFA 4FNLH 4FQIL 4GG8A 3W9EA 2DMCA 2CDFB 2C1PA 3FTGB 4JQVC 4X99A 4UILH 4G5ZL 3QUMB 2YPLE 4YK4C 1K6QH 2HJLA 5AWNL 4LKXB 2WWKT 4R4BB 3WLWD 3H0TA 4OLWL 2GY7B 2GHWB 5IHZA 1AC6A 1U8MB 1T22A 4JRYD 1AJ7L 1D5IH 5FDWB 3O6KL 3IDIB 1A1NA 3FB5A 4XZUB 4O02H 1T3FB 4PJGF 5L9DL 1S7SB 2BHZA 1A7NH 3DX8B 3NVQA 4OGAD 4Z7VF 1BF8A 5D1XB 4P5MB 3SDCC 5HGHA 4XCEA 1IM9B 4JFHE 3V7AE 3MRRB 4FQ1L 3S5LA 3LIZL 1R5WB 3LEYH 5FYLL 3KAAA 1FLRH 4PRIB 5B3NA 3BQUA 5DSCB 1HKLL 4NKQB 4LSUL 1CR9H 4P2RD 4DZ8B 1MHPL 1AGEB 5CLTA 4PJBE 4WO4C 4TUKL 3EJJX 4GG6B 1YMHA 4HHAB 3WXVL 2FO1A 1JV5B 5F89B 5E95B 5GS2H 3DOSA 5IVXF 4ZS6C 1ZLWH 5FUCC 1OVZA 3VXTA 3MLTB 4GAJH 5IBLC 3F12B 4NO3B 1T4KB 3RWHA 1T2JA 2V5MA 1IJ9A 3FQNB 5DI8B 4YAQB 3QI9D 5GS1B 4JN1L 1R6VA 3NH7L 4JFOA 1PG7L 4NC0B 5ALBL 3QDGD 2Q7YA 1G7JB 4WGWB 5DFTA 2RCSL 3O6LL 3WN5B 3EOBB 3Q0HA 5L0QC 1MCHA 3BZEA 2NY7L 4FABH 5IFHL 5D2LA 3FJTA 2NZIA 4HH9B 4JFFE 1MFCL 2H2SC 5FK9B 2QADC 4J3TA 4RQQB 3MTRA 3DVNA 3STZA 3C9NA 2P8MB 4M7KL 1N5AB 3ARWA 4WFHE 3UMTA 3IDMA 4G8EB 4FG6D 2DD8L 3O2VL 4I8DA 3CH1B 4DEPB 3HFMH 4JDVA 4ZSOB 1B88A 3PABB 2B8OT 3NFNA 5EH1A 2F5BH 1KLUA 4DCQA 5BV7B 3NCJH 4PJHA 3B3IA 4NZUH 3VI4E 4GS7B 3MNWA 4F33A 3WE6A 4D9QE 4ZTPL 1F42A 2LE9A 3SDYL 3V6ZB 4CJ1A 1IGCL 5HVFB 2BHUA 2XKNB 1N26A 3E3QE 2BNQD 3H9SA 4K7PH 4GKSB 3PWLA 2PXYA 2CO6B 4Q97A 4YBHA 1MJ7L 5IGXH 2FH6A 1TCMA 4Y5VC 1CD1A 3GI8H 1BZ9B 1CGSL 2XN9D 5I30L 1XGUB 5EN2A 2UY7A 5CZXC 2V7NB 5GGVH 3EOTL 1G7QB 4KWUA 4X6FB 3RWIB 3T2NL 4MWFB 4BFEA 1NUGA 4F7TB 5KSBB 4MD4A 3EOAA 1X4YA 3UTQA 4MNQA 3OPZH 3DHMA 1DE4A 2WLZA 2VXUH 4PPTA 3NABL 4CN4A 1KYOJ 2BOBA 4QRSB 4CAGA 4EZMA 2OTWA 4G7VH 4UT7H 2XWJB 4TQEH 3S6CA 2VERN 2VOTA 4K3JH 1I3GH 4LDEB 1KACB 3QIUA 4HS8L 3V6OA 2GJZA 1A14L 4R97C 1MAJA 1ODAA 4LLVA 1IAOA 2YXFA 3J7HA 4HZAA 5E9DE 2YEZB 5J13B 2DN7A 1JFQL 1CE1L 4QKXB 4F7MA 2FX7H 1JGDA 1DJSA 1NCAH 4YC2C 2DLIA 1J0YA 4NN7B 2Y06L 3BP4A 1RURL 2F5AH 5ICZA 5KOMC 5CCKH 3FT2B 4L4VB 3JTSB 4HS3A 3O6FC 4MD5A 3MOBL 4R2GB 1XGTA 4PS4H 3QEGL 5I1LB 2YRPA 2WV3A 2R39A 3QBTB 1VPOL 5D2LF 1VKXB 1LK3L 3BPLB 3VXRE 2HFGL 3WDIA 3EYSH 4O2FA 2PCPB 1D6VH 2VDRL 2VXVL 3PWUB 5IB4A 1MFBL 2ATKB 1JGEB 1H8OA 3GJEA 4OZFA 1B6DA 3HB3C 3IKKA 3IDXH 4TRPH 4N0UA 4FQIH 4U6TA 2AJZB 5CSGA 2G75B 4Y1AD 1DZBA 1NPUA 1FNFA 4RAHA 5KW9H 1W8OA 1ZKAA 4JDZA 1V8HA 4G5ZH 1KCUL 4M1CC 1CXKA 1FAIL 1T20A 2EE6A 2BZDA 1FL5B 4KUCF 4FQQB 3QJFA 4NNXB 4OLWH 5C0JA 2F15A 2VXTH 3U30B 1AJ7H 4Z7UF 3MNVA 4OZGF 3C2AL 1XEDA 3QFJD 2Z31D 2H2PD 4ODBD 1K3ZA 2W91A 5TF1L 1X5KA 3BMVA 3ARGA 4JVWA 4S1QH 2J8HA 3N0PB 4FQ1H 4N8CL 2BRRL 3QUZA 4JLRB 3DJ9A 5I1CH 1HKLH 4Y2DA 3MV9A 4YZFE 4YHKL 1K8IA 4TUKH 5A40E 3K46A 3QA3B 3WXVH 4NN6B 4EVNA 5JOEA 3UYOD 1CE6A 3WUWA 1M71B 4PTUA 3HZYB 1FPTH 1UXSB 2ZCKH 2V9QA 1NEZA 1HYRC 3NGBC 4Z7OE 1XCQA 1K5NA 4ODHL 2C7UA 2Z4QB 1YEIL 4Z95L 2EDJA 4K3EL 4NUJB 5FKPB 4D94A 2I9TB 1I7UA 4JN1H 3NH7H 1SVZA 5HVWA 1PG7H 3VXNA 3LKRB 1CFSA 5ALBH 1U8KA 1P4BL 3L1OH 1WGOA 4JG0L 5JO5A 4HWZA 4TVPE 1QBLH 5EOTA 3O6LH 2VLKA 5F1NB 3ZKMD 4V1DB 4Q7DA 1OGAA 3MRKB 2CR3A 1YA5A 2NY7H 1DQDL 5IFHH 4ZO6A 1L6ZA 5EC1B 1KCSL 3Q2CA 1ZHBA 4NBYB 3VH8G 3SY0B 3AMLA 1AP2A 3D39B 2ZUQC 2VLME 2DQCL 3PG2A 2DLHA 1JGVH 3DBXB 3LV3A 3NCFB 4OM0L 4MJ6A 4PV8A 4N0CD 4PUBH 1BQLL 3V7MA 2ADIA 1EEYB 4PJ9A 3CFBB 3UTTD 4C59B 5C0ND 5CP3H 2J4WH 2DQJH 2OM5A 1WAAE 3QIBB 5IESL 1SYSA 4MJ4A 1OP3H 4G9FD 4X6EB 1DUYA 3RVUD 4DGVH 1IGYA 2CRMA 4PJ8C 3BDXA 3BJ91 1YUHB 4ZTPH 3D69A 1QHPA 1ZT1B 3I6LE 4OZIF 1IGCH 1XCTB 2NXZB 2HFTA 3Q5TA 5L2KA 1G0DA 3ULVH 3IJYB 3RWJA 1G7MB 4F57L 1C5DA 2IPTL 3L6FA 4M1DL 2CR6A 4PJEB 2NZ9D 1JPFB 1CGSH 4Y4FB 3RU8H 1FVCB 4HIHA 3KDMA 3M1BA 3TBVA 3AB0C 5GJTL 1JZ8A 1AC0A 4ZUTB 3IVKA 5DUPL 1KBGL 3BW9B 3SKMB 5JNYB 1NL0L 4K3GA 4BZYA 4GKNA 3MLVH 1NFKA 4L29A 4NQXA 4U1GB 1YY9D 4X6CE 1QFPA 1QPPA 3RVXD 4HIXH 3ZKNC 2X1QA 3BPOB 1T5WA 3T8XA 2R0LL 3CFEB 4E0RB 4KQ3H 2R4RL 1MUJA 3MCLH 2X1XR 4PRHA 1XFPA 3GMRB 2VDNL 3V7AG 5IMMA 4NRZB 1CE1H 3HG1A 3ARFC 5E94A 3HNVL 4KJWD 1VFAB 5DEFA 4XMKL 3KPQB 1DQML 4LHQB 1UZ8A 3DX6B 1CFBA 5I8KH 3GGWA 2CGRH 5MEQA 4RISH 3WKML 1NCDH 3MOBH 2PF6A 4ZUWB 3SDDA 4UDUA 1HINL 3BISA 3QEGH 4ELMB 4PRDB 5EFIB 5EOQL 3QO0B 3RGVD 4I0PD 2HFGH 1UZ6E 2NX5D 4JZJB 1P84J 5MEPB 3T0EC 1KN4L 1C1EH 2X4NA 2X7LA 3TBYB 1MFBH 1KNOB 3PNWB 1N64L 2B5IB 1FV1A 5C9JA 4QXGL 1DUZB 2CSPA 2DQEH 2R0ZL 2VJXA 1MFDH 5JQHC 3DI3B 5EU4A 4TSAH 5JMOC 3IFPA 1QQDA 1FAIH 1I1FB 3O3EB 4GRWB 4K07A 2DTMH 2ZG3A 2IBZY 2VXQH 4QRPD 2NLJA 3OTTA 3PP4H 3PWPD 2AXHA 1XF5B 3C2AH 1Y0LA 5J1SC 3VWJA 4C56B 1QFUL 1H3UA 2JLLA 1URLA 6FABL 1MCOH 1YEEL 2KPNA 3VRJB 1Z3GL 3IJSB 1XF4A 4OCMC 5B8CA 3AAZB 2GYSA 3TIEB 5HDLA 2LFGA 4XPHL 1R3IL 2OZ4L 2JK5A 1UJ3B 1V7ML 4O5LH 4P5TB 5IQ9B 1R0AL 3MMEB 5IWLA 1TZHB 4QOKA 1R5IB 3FRPA 1DN2A 3ARDB