1LDRA

Second repeat of the ldl receptor ligand-binding domain
Total Genus 1
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
1
sequence length
41
structure length
41
Chain Sequence
LSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the second cysteine-rich repeat from the human low-density lipoprotein receptor.
pubmed doi rcsb
molecule keywords LOW-DENSITY LIPOPROTEIN RECEPTOR
molecule tags Binding protein
source organism Homo sapiens
total genus 1
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 1995-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00057 Ldl_recept_a Low-density lipoprotein receptor domain class A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.400.10 Few Secondary Structures Irregular Low-density Lipoprotein Receptor Low-density Lipoprotein Receptor 1ldrA00
2FYJA 1J8EA 2LGPA 1LDLA 1XFEA 2M96A 1JRFA 2M0PA 1K7BA 2KNXA 1D2LA 2I1PA 2KNYA 1F5YA 2JM4A 2M7PA 1D2JA 1LDRA 2FCWB 1CR8A 2FYLB 1N7DA
chains in the Genus database with same CATH superfamily
2FYJA 1J8EA 2LGPA 1LDLA 1XFEA 2M96A 1JRFA 2M0PA 1K7BA 2KNXA 1D2LA 2I1PA 2KNYA 1F5YA 2JM4A 2M7PA 1D2JA 1LDRA 2FCWB 1CR8A 2FYLB 1N7DA
chains in the Genus database with same CATH topology
2FYJA 1J8EA 2LGPA 1LDLA 1XFEA 2M96A 1JRFA 2M0PA 1K7BA 2KNXA 1D2LA 2I1PA 2KNYA 1F5YA 2JM4A 2M7PA 1D2JA 1LDRA 2FCWB 1CR8A 2FYLB 1N7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYJ A;  1J8E A;  2LGP A;  1LDL A;  1XFE A;  2M96 A;  1JRF A;  2M0P A;  1K7B A;  2KNX A;  1D2L A;  2I1P A;  2KNY A;  1F5Y A;  2JM4 A;  2M7P A;  1D2J A;  1LDR A;  2FCW B;  1CR8 A;  2FYL B;  1N7D A; 
#chains in the Genus database with same CATH topology
 2FYJ A;  1J8E A;  2LGP A;  1LDL A;  1XFE A;  2M96 A;  1JRF A;  2M0P A;  1K7B A;  2KNX A;  1D2L A;  2I1P A;  2KNY A;  1F5Y A;  2JM4 A;  2M7P A;  1D2J A;  1LDR A;  2FCW B;  1CR8 A;  2FYL B;  1N7D A; 
#chains in the Genus database with same CATH homology
 2FYJ A;  1J8E A;  2LGP A;  1LDL A;  1XFE A;  2M96 A;  1JRF A;  2M0P A;  1K7B A;  2KNX A;  1D2L A;  2I1P A;  2KNY A;  1F5Y A;  2JM4 A;  2M7P A;  1D2J A;  1LDR A;  2FCW B;  1CR8 A;  2FYL B;  1N7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...