1LE8A

Crystal structure of the mata1/matalpha2-3a heterodimer bound to dna complex
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
53
structure length
53
Chain Sequence
b'KSSISPQARAFLEQVFRRKQSLNSKEKEEVAKKCGITPLQVRVWFINKRMRSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*CP*AP*TP*GP*TP*AP*AP*AP*AP*AP*TP*TP*TP*AP*CP*AP*TP*
publication title Structural and Thermodynamic Characterization of the DNA Binding Properties of a Triple Alanine Mutant of MATalpha2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/dna
total genus 17
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2002-04-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1le8A00
3MN2A 2XRLA 1AKHB 2XPVA 3HBLA 5HODA 2LR8A 1IG7A 3ZQGA 2Y30A 3L1PA 1Q1VA 5FKNA 1TWGJ 2NS7A 2JWTA 3FISA 4DZPA 1PUFA 3I4MJ 4DW6A 1G2HA 4RBOA 2M8GX 2XGDA 2WB1N 1T56A 1TWAJ 2YU9J 1WCMJ 5E3OA 4BY7J 3S1QJ 2DA5A 5FJ8J 1GVDA 1BA5A 3S2DJ 4C3HJ 1F43A 3S1MJ 1VNDA 3BR6A 3BTIA 3HOWJ 2XGCA 2OF7A 3LSRA 3JRCA 1U78A 3JRHA 3JREA 1WH5A 2VKVA 3O8GA 2HOTA 2LKXA 5C3EJ 3I4NJ 4XRSG 3ZQLA 2HI3A 5C4XJ 2Y0SN 1U9NA 1MBGA 5E3MA 2L9RA 1FIPA 1IC8A 2O8KA 5F1JA 3IH4A 1RPWA 1BL0A 3MKLA 1QVUA 1NK3P 5EYRA 4A69C 1TC3C 2M2EA 5JLWA 2R5ZB 1WH7A 4A3FJ 3M4OJ 5IYBJ 5M3FJ 1VFCA 3CQZJ 1WGXA 4QTRA 5M5YJ 1NTCA 1MBJA 1Y1WJ 1MH3A 4MFEA 2ZB9A 2DMPA 1JTXA 2JA7J 1JJ8C 5EZHA 2K9SA 3TW7A 4D5CA 3GTJJ 1X2NA 2CQQA 3JRBA 1ZKGA 3QPLA 3BR0A 1TWCJ 3WHCA 2CQXA 1U8BA 1ETKA 1WPKA 4M3GA 2MGQA 1GUUA 5FLMJ 2LTPA 3JRDA 3GTOJ 1FTTA 3LOCA 4DYQA 5C44J 3VPRA 4UUSB 4AC0A 3GBGA 3A03A 1IV6A 4X1EA 5IOYA 1FJLA 1HOMA 3E7LA 1LFBA 5M5WJ 1RKWA 3HOYJ 1RESA 1MSEC 1B8IA 1X58A 1Z0XA 3K7AJ 2E1OA 5DS9A 1E3OC 2LP0A 4HNVA 4V2FA 2DA6A 2IBDA 2Y9ZA 5EGOB 5K7ZA 4G12A 1GV5A 4XRMA 4A93J 2AO9A 4C2MJ 3TW6A 2TRTA 1OCTC 1ENHA 4BXXJ 3BR5A 3OSFA 2CUEA 2EQRA 3Q3SA 1HLVA 4BY1J 1H89C 2E19A 3CCYA 1IRZA 2XPWA 4M6VA 3UKGA 3DEWA 2NS8A 3G1OA 4GFBA 2VI6A 3HOUJ 1FTZA 3BT9A 4L5EA 3ZQCA 3FKIJ 2K9NA 2QF7A 2FJ1A 2DA7A 3HDDA 3LSPA 1F36A 3SDGA 4B3AA 2FD5A 4M3BA 3Q0VA 4M3DA 3A02A 5FKLA 2EBIA 2QCOA 1IUFA 1O4XA 1K61A 5EG0A 4IHYA 2HYJA 2XB0X 1JTYA 4XRSA 2X48A 2ID6A 3HM5A 5EEAA 1NK2P 5FKMA 2R0QC 3SFIA 3LSGA 3IV5A 4BBRJ 1HDDC 4CYCB 3S16J 1LE8B 1JUPA 2KT0A 1ETQA 4B4CA 1ETOA 2HDDA 1K83J 2LVSA 2ME0A 2CRGA 1P7JA 1S7EA 1Y1VJ 2L7MP 2N8GA 4QIWN 3BR2A 5F27A 1QVTA 4B1RA 4MFDA 4IHXA 3NAUA 1MBEA 5C4JJ 3LSJA 2X9DA 1MNMC 1WI3A 2H8RA 2DMUA 3GTQJ 4MO7A 2HOAA 2I10A 3WHBA 1H88C 4C3JJ 3S2HJ 1UG2A 1GDTA 4XICA 2NOGA 5DTDA 3RZDJ 2DMTA 4A3BJ 1MBHA 2DA3A 2LLKA 4BKXA 4LOCA 3TP3A 3HEFA 2X6OA 2Y2ZA 1D5YA 5K7FA 1A6IA 2FQ4A 5IOZA 2R5ZA 4AUXA 2R93J 4J19A 2OPTA 2EZLA 3QPSA 3TEDA 5J1RA 1IDYA 4A3GJ 3BG3A 4DZJA 3GTMJ 1B72A 1OCPA 4FE4A 1GT0C 5F04A 1QPIA 2E2HJ 1TWHJ 5M5XJ 3PM1A 3BQYA 4A3JJ 4IEJA 1HDPA 5IYDJ 1JKPC 3RQIA 3HB9A 3ZQHA 3S17J 4EEFG 2NVYJ 3JRGA 3NARA 3HOZJ 3W6VA 2DN0A 5GPCA 3BG5A 1DU6A 1XG1A 3JR9A 2HXIA 3FK6A 4M3FA 1ZQ3P 4I6ZA 3PO2J 4Y7NJ 1BW5A 4A3DJ 1B8IB 3ZQFA 4I76A 2JA5J 1JKOC 4MLOA 1RETA 1UHSA 1W0UA 2O9LA 2DJNA 3CDLA 2ME6A 2M9HA 2EZHA 3DCFA 1BJZA 1SFOJ 2D5VA 1TWFJ 3BTJA 3JRFA 2NVXJ 5F0FA 3GTGJ 1MH4A 3IH2A 1SANA 1YRNB 1AU7A 1JGGA 1JT6A 1HF0A 3S1NJ 5GPAA 4IHVA 4Y52J 2R5YA 4C3IJ 2DA4A 1GV2A 3A01A 2JMWA 1T33A 3S14J 1RKTA 2P81A 2H1KA 1CQTA 3S15J 2IAIA 2VKEA 3Q0WA 2R7ZJ 2EZKA 5E3LA 5M3MJ 1DU0A 4M3EA 1AKHA 4MIMA 4X6AJ 3BTLA 4A3IJ 2L0KA 4A3LJ 3Q0UA 2EH3A 4D7NA 5EG0B 1W0TA 1I50J 4A3MJ 1JT0A 4QSHA 1Z77A 4FTHA 4BBSJ 2GBYA 5EDNA 3FK7A 2HOSA 4FCYA 1PUFB 2JK3A 2JA8J 4ABZA 1ETYA 2K9QA 2MW8A 2CJJA 4V2GA 3OSGA 1VF9A 2YS9A 4JX6A 5F08A 2FX0A 4XIDA 4CYCA 3LNQA 2YUSA 1QRYA 3MVPA 3JRIA 1LE8A 5IYCJ 2CU7A 3OOUA 5J3LA 1P7IA 3ZQIA 2K40A 4D5FA 4FISA 3CMYA 5BNGA 3C2BA 2GLOA 4NDLA 3BR1A 3FIWA 2DA2A 5F0HA 1MSFC 2AHQA 2LY9A 3PO3J 2ECBA 2IEKA 2WV1A 3G1MA 5IP7J 5J1YA 2B63J 2ID3A 1OFCX 4JX5A 1JKQC 3SJMA 1VI0A 2DTZA 1BW6A 2XGEA 3GTPJ 2JA6J 1ETWA 3BTCA 1EF4A 3TP0A 3RKQA 1H8AC 1RR7A 5GP9A 1IGNA 3HOXJ 3GTKJ 2JN6A 3BR3A 4RDUA 1ZGWA 4S0HB 2NVQJ 3JRAA 1ZK8A 1U9OA 2HQ5A 4W97A 1ITYA 5IPAA 5FLVA 3G1LA 2LK2A 1I3QJ 2DMQA 1B72B 3HOVJ 1I6HJ 3GTLJ 4JP0A 2LD5A 2ECCA 4D7MA 3M3YJ 2MSYA 3B6CA 3K2AA 2E2JJ 2DMNA 4UUSA 3HGYA 5FKKA 3H3VK 1MBFA 1JKRC 3HGGA 3QQAA 5F0CA 2MG4A 4DYRA 4A3EJ 2R92J 5J1UA 1R9TJ 5IP9J 3OIOA 4JYKA 2RAEA 1UMQA 2L7FP 3S1RJ 2LFBA 3BG9A 2VPRA 2HXOA 1HCRA 2GM4A 2EZIA 5EZGA 2COBA 2DA1A 5JLXA 1JJ6C 2O7OA 3O8HA 5EGOA 3HKZN 1POGA 2VUMJ 2KDZA 1LFUP 2Y31A 1A5JA 1MBKA 4DYCA 9ANTA 5E3NA 4IHWA 3D1NI 2G0EA 1ZR4A 2TCTA 3IH3A 4FE7A 1IJWC 3BQZA 1IDZA 1ZTRA 2NVTJ 1X2MA 4W1UA 5EF6A 3RZOJ 2CUFA 2M34A 2XB5A 2W48A 5IP6A 2ELKA 2WAQN 2XPUA 1AHDP 3H0GJ 1XS9A 1YRNA 1FIAA 1JUSA 2Y9YA 2M0CA 5FKOA 2L7ZA 2R5YB 3B6AA 4UUTA 4A3CJ 5K7HA 4AYBN 1FEXA 2XSDC 1ORKA 1OJLA 4JX4A 3A01B 3ZOBA 2E2IJ 4XK4A 1XC5A 1APLC 1ETXA 2JJ7A 1JUMA 4A3KJ 1ETVA 1ZR2A 3F0CA 2PMZN
chains in the Genus database with same CATH superfamily
2IJLA 5DUKA 1YIOA 2UV1A 2OBPA 4M6YA 2X6XA 4KITB 4LB5A 3HOTA 3ZQGA 3QWLA 3FX3A 3J7YJ 3LAPA 2IT0A 1TWGJ 2AQEA 2NRAC 1JGSA 3F8BA 4U7BA 1TLHB 1G2HA 1SFXA 2ZSHB 3KP7A 3A1YA 1UCRA 3IWFA 2XGDA 1LDJA 2WB1N 4G7OF 1FWZA 1WCMJ 3EETA 5E3OA 1SVOA 2OD5A 3ZMSA 2V6EA 1T39A 5KNLA 3S2DJ 1BA5A 2CW0F 1F43A 2E34A 2BEOA 5LLQA 1D1CA 2OF7A 2E5NA 1Z91A 4U0YA 4MGRA 3LSRA 3JREA 2VKVA 5TGTA 1FC3A 2HOTA 2PQ8A 1WI9A 2F5CA 2IA2A 3DBRB 1U2WA 3VDXA 1U9NA 4XL9A 5E3MA 1BM9A 1RI7A 3OWTA 1IC8A 2CYYA 5F1JA 3IH4A 3E0JB 4CDGA 1Y39A 1IV8A 1IN5A 4UV8A 5EYRA 4XORA 5LGNA 1R1TA 4HF1A 2L7KA 1GXPA 1MKMA 4OMZA 5IYBJ 1K6YA 5EEGA 5GAEJ 4L18B 5F64A 4MFEA 2FBHA 4LLNA 3ZCOA 2JA7J 1JJ8C 2KHMA 3BZ6A 1XD7A 2BGCA 2K9SA 5TJJA 1BR4A 2FNPA 4M71A 3BR0A 1I3AA 2ZXJA 3GCMA 1KONA 3WHCA 1ETKA 3MCZA 2MGQA 3MKYB 3JRDA 3QYEA 2P5LC 1FTTA 4DYQA 4G9YA 3I55I 2R7XA 4XLPF 3GBGA 1IV6A 2XROA 4LMYA 5IOYA 3L2RA 1YIJI 3OY9A 4B09A 5J8CA 1ZRDA 3RJPA 3OYHA 3LFUA 2M7AA 4X0GA 2B9SA 3PUFA 2STTA 2HDWA 1G3TA 2LMDA 5HDKA 1TZLA 2E1OA 4PK4A 1Z6TA 2LOOA 1LVKA 4HNVA 1AA7A 4UB6C 2M7BA 3EQLF 2V6CA 3KZIC 3H5AA 1K78B 5J4VA 2AO9A 2ACJA 1J2XA 3L2QA 1GXQA 2F5FA 3BR5A 3OSFA 1IW7F 1HLVA 3Q3SA 3RPUA 4CZZA 1MJBA 3VYSB 2DDAA 2AXLA 4L5JA 2UXXA 3GVAA 1FMWA 1RC9A 4XLFA 3KFWX 1BC7C 1OYWA 2OCEA 4ZYGA 4GFBA 3LA3A 5EJCA 1T98A 1BOBA 1YG2A 2CUJA 5ICEA 2QLZA 2QF7A 2H09A 3V42A 3RDIA 4YFNF 2D2WA 4M3DA 5JVTA 2KL4A 5FKLA 2EBIA 2QCOA 2PBIA 2HR3A 1OR7C 1B59A 5EG0A 3L2WA 1D8JA 4IJAA 1JXSA 2Z9OA 4AYBA 1ZG5A 2CV1A 2L02A 3FMQA 1G6NA 4RS8A 3IP4B 4Y4RA 1HKQA 5HLGA 2UXNA 5KVRA 3N4MA 5EEAA 2K3PA 5FKMA 2OV7A 5FROA 3SFIA 5K5QA 3LSGA 5L3GA 3IV5A 2PMZA 3FHNA 2MBFA 4XLNF 3S8PA 2Z2SB 1HDDC 2CQKA 3M9AA 2BW3B 1TL8A 3LFKA 1LEAA 3CCEI 1KYZA 4IRHA 3VB2A 1JHFA 5FRMA 3BC8A 4RGXA 2FRHA 2BXZA 5JHFA 2QGUA 3H3ZA 3BR2A 1TW2A 4PJLA 5CQGA 1VQMI 4HZFA 3LSJA 2X9DA 4ANJA 1WI3A 4ZC3A 2DOEA 3S2HJ 5LHGA 4WWCA 4LLGF 1E2XA 2HFHA 2NOGA 5E8IA 5DTDA 1O57A 3RZDJ 1O7FA 2DMTA 2DFIA 1MBHA 2LLKA 4BKXA 4LOCA 2CV0A 3HEFA 4C2TA 1V55H 4NQWA 1D5YA 3DP7A 2OPTA 2EZLA 3CDHA 5DDGA 1Z9CA 4CH7A 5BMZA 3QODA 4IVNA 2H94A 3CCRI 4QPQA 2HQNA 2F4IA 1IO2A 2M30A 5M5XJ 3WE2A 3ZMUA 2XAQA 4A3JJ 2Q1ZB 2J5PA 4BS9A 3GEZA 3SQNA 1HDPA 4E7LA 4BUPA 3HB9A 4B47A 3SXYA 2ZMEA 4GRIA 4PJNA 1J09A 2KP6A 1XGMA 3CZ6A 2H1LA 1NHAA 2WY8Q 2M45A 5GPCA 1DU6A 3LAJA 1IXRC 3FXUA 1B9NA 1Z3YA 5K5OA 4P5OA 1H0MA 1ZQ3P 3H9JA 1BW5A 4XM3A 3TOBA 3E1SA 4GXOA 4A3DJ 3CF5F 1TQIA 3H5NA 4NHJA 4N9HA 2LG4A 4R8HA 4BQAA 3F3XA 5K5RA 2HPIA 5JI6A 4QPOA 4F3QA 2XAFA 3O2PE 2DJNA 3OIQA 1YQAA 3CDLA 1FBSA 2EZHA 2M9HA 3WODF 1VQPI 1PYVA 3LQRA 2F48A 3PQKA 1LQ1A 1OQYA 3DF8A 5JR3A 3L9FA 4DBQA 3M8EA 1A6QA 1MH4A 4I0BA 5JFRA 1YRNB 1A36A 3GW2A 1AU7A 3OYFA 3W6KB 5H6QA 1HF0A 5HLIA 3NWTA 5GPAA 2R5YA 3QYBA 4I01A 1MJ9A 2L54A 4RGRA 4AM3A 5LHHA 2QQAA 4R79A 3PFIA 3E6BA 2M4KA 5DYMA 1T33A 2EK5A 1RKTA 2P81A 3KZYA 5EEHA 5D8KB 3A0BC 1O3SA 2VKEA 3CCQI 1SFKA 1DU0A 1X1PA 2ZO4A 4M3EA 2ZNYA 4MIMA 1ZG1A 3M8JA 4A3IJ 3V4GA 1UHWA 5KAFC 4EM2A 3Q9VA 5D5WB 1JHHA 3F23A 4E7HA 4A3MJ 5D8LB 4FTHA 1Z77A 2FXAA 3GFJA 1XCBA 4ETSA 4FX4A 1U0JA 4PSWA 2OA4A 3FK7A 4CCJA 5EDNA 5L3DA 2HOSA 3DU6A 4KFCA 1ETYA 4LGWA 2MW8A 4F91B 4ESBA 4LB6B 4PGHA 3OSGA 3V7CA 4ON0A 2YS9A 3HUGA 2W1OA 3QU6A 2A05A 1DP3A 5F08A 2FX0A 1TW3A 3LNQA 3JRIA 3F8CA 1K7AA 2K4JA 3K70D 1LE8A 4A6EA 2DT7B 2GA2A 2W85A 4EQQA 3RCOA 2MC4A 2KIMA 3CUQB 2X0LA 2OUMA 5J3LA 1P7IA 2VQCA 2XAJA 3G4SI 2K40A 4P9UA 5E17F 2MFZA 4FISA 3C2BA 1YW7A 3DXJF 4IO9F 1ZARA 4NDLA 3RYPA 4CXFA 3CC7I 2L4MA 3W6JB 4XSZF 3BR1A 2FMYA 2DQRA 2DA2A 4ZZLA 5F0HA 4DNCA 2BY1A 5J4YA 2VL8A 4OINF 4EVIA 2E1NA 3SJMA 3GTPJ 2GZWA 2JA6J 4CCLA 3OYAA 3RKQA 2VONA 2EIMH 1KA8A 2DPUA 2Q2EB 1MZBA 2NVQJ 2FUG2 1F1ZA 3JRAA 1U9OA 2RN7A 3ZMZA 4HNTA 3B02A 5FLVA 3GUDA 3OYBA 4I7HA 3ISPA 4N4NB 4HX7A 2VKHA 3M3YJ 2OTLI 2LDUA 3OR2C 4IX7A 3HGYA 2R3SA 3B73A 4G94A 1L3LA 3BWGA 1MBFA 3QOPA 3QQAA 4A3EJ 1V4RA 3ESWB 3HRUA 1RUNA 3HSRA 5IY5H 2DCEA 3HTUA 2QQ9A 2OAZA 1R9TJ 3SFZA 2O03A 5IP9J 1UMQA 1QA6A 1FOKA 4DJAA 4B3XA 4KIGA 2F4MB 1E17A 1QZZA 2LYCA 4JK1X 5HLHA 4OMYA 5J8FA 1I27A 2HXOA 3CP8A 1JJ6C 3E5QA 1P9QC 2NNNA 2KDZA 2LSOA 3ABTA 4G6TB 3FWEA 1LFUP 1HW1A 1TBXA 4HLXA 1CGPA 2B7EA 4DYCA 1YJ9I 3D1NI 4BH9A 2A69F 3GO5A 3KEOA 1ZTRA 3IAS2 2M34A 2XB5A 3FXRA 1QHHD 1Q1HA 5IP6A 3E3VA 2XPUA 4WXDA 1XS9A 1JUSA 4GYIA 1IAWA 2Y9YA 3ULQB 5J47A 5FKOA 5L3EA 1WJAA 1D0XA 4E7JA 4P55A 2Y75A 4M9XA 4UV9A 2DQLA 1FEXA 2P5VA 3KETA 1ORKA 1OJLA 3A01B 3DKXA 3ZOBA 1ETXA 4F93B 2R7DA 1HW2A 5HNFA 2CW7A 1R1VA 2IA0A 3HTSB 1ETVA 3AL0B 1MIJA 2W7NA 1ZR2A 4M6VA 1KGSA 3HRSA 1AKHB 1KYWA 3AG1H 2EIKH 5HODA 2P5KA 3RKYA 2Y30A 4ZYHA 3FBIB 3L1PA 1Q1VA 4KT5C 5LGTA 1NG6A 2E7XA 1SFEA 3EUKL 2JWTA 2YX4A 4RGSA 1YFHA 1PUFA 1WWXA 5LHIA 3TDUC 3JSPA 3I4MJ 2QBYB 2CFOA 1IZ1A 5D5UB 1YO5C 4E6KG 3P9CA 1YS6A 1T56A 2QSGX 2YU9J 5HLTA 4OU0A 3I5UA 4XKVA 2PI0A 1A04A 3SEQA 2VN2A 4FX0A 1OPCA 4I99C 1XN7A 3ASOH 1P4WA 3BR6A 2TDXA 3BTIA 1LKXA 2LBFB 1S29A 2XGCA 3JRCA 3CP2A 3ZR8X 3IRQA 4LG0A 2LKXA 3I4NJ 4XRSG 3ZQLA 2IP2A 2HI3A 1ONVA 3FF5A 3J81K 2WB1A 3HRMA 4UVCA 4XRFA 1G4DA 4BXUA 3K70C 4ESFA 3OYNA 1B4AA 5D4SA 1FIPA 2O8KA 4Z6YA 1J75A 4BXFA 4RGUA 5DEQA 4ZTFA 3MKLA 1F5TA 1NK3P 4Y3OA 2L5QA 3K4CA 4A69C 2IS1A 1TC3C 1W5CC 3SZTA 2KZGA 4RA2A 1W7PA 5JLWA 1WH7A 4F92B 2R5ZB 4BACA 3Q5FA 2BOLA 3S3MA 5H20A 4CSWA 5M3FJ 2HZTA 1VFCA 1WGXA 5HS9A 3DPLC 5M5YJ 1FBUA 1IF1A 1MBJA 1W1WE 1MH3A 2BHZA 4AIJA 3KLNA 2XDVA 1BR1A 3OYJA 1BIBA 1CF7A 1XDSA 4FQGA 2CV2A 2HQRA 3FXQA 2K9LA 3U21A 4BEHB 1YW9A 3MMYB 5LEKA 4E7IA 1TWCJ 2P7CB 2VJIA 3CJTB 2J5OA 1EH6A 3KEYA 3OL3A 2W00A 2EIJH 4AC0A 4UUVA 2R7VA 3GLXA 3E7LA 1LFBA 3RQ4A 1HA8A 1RKWA 1RESA 4BNCA 4PUSA 1MSEC 1SAUA 1B8IA 1Z0XA 4EJTA 2DFFA 1U3EM 1E3OC 1XSVA 2LKPA 4LK0F 2LP0A 5CQEA 1WJ5A 4V2FA 1ZRFA 2Y9ZA 3BG6A 2QEXI 2DPDA 4HX4A 4G12A 4YEJA 3J81Z 4XRMA 2L9SA 4A93J 4C2MJ 3TW6A 1WJBA 3GMEA 2KFDA 4O5VA 3KP4A 5KK1A 5GAGJ 4WCGA 2K02A 5FLXK 2L9VA 3OR1C 3K4MA 2CUEA 4ENMA 2A5YB 3HKZA 3LA2A 1H89C 2E19A 4AIHA 3CCYA 4Y33A 4BE2A 1VQ5I 2WA0A 3HPGA 3CC2I 1IRZA 2GXGA 1Z7UA 4XMYA 4Q47A 3ZXSA 1Z1DA 2DT6A 2EFOA 3V7RA 4CUGA 1X19A 4RAZA 2R7WA 3FKIJ 1YJWI 1ERDA 3HRTA 4EJUA 3LSPA 2RVCA 5HS8A 1FSHA 3ECHA 4Z2YA 2WAQA 1ODDA 4DBRA 2Y48A 1HSJA 1O4XA 1KU3A 1MJAA 3E5XA 2DFHA 3PQJA 2HYJA 4A5MA 4XNFA 4QLCU 1L0OC 2HYFA 1JTYA 3MQ0A 3VYTB 1VZ0A 2X48A 2WV0A 2RREA 2ID6A 1XGSA 2VQLA 3HM5A 5ICGA 3K4JA 1A31A 3ZGKA 2Z99A 3LL7A 1WJCA 2AQFA 1D3YA 2KKOA 4BBRJ 4U87A 4CYCB 4IRGA 1ETQA 3BPVA 1ETOA 4WX9A 1K83J 2LVSA 3ROUA 3PNYA 4HEA2 4WK8F 1Y1VJ 1ZH5A 2XC7A 2PLYA 2XSJC 2A6TA 4QIWN 2V1XA 2E5ZA 5FLXZ 2HS5A 4XONA 2XRNA 1FY7A 4B1RA 1MDMA 4MFDA 3R4KA 2H27A 3BP8A 3KZZA 3TL4X 2H8RA 2RNGA 1JE8A 3GTQJ 4MO7A 2V9KA 1IN8A 2M1BA 2HOAA 2RQPA 3GFMA 1H88C 3WHBA 3F22A 2E60A 2EFQA 3GF2A 4XICA 1BJAA 1LNWA 1FX7A 1R5GA 3BCBA 2DA3A 4BAYA 3CO6C 5HOOA 3TP3A 1RRJA 5FO5A 2HU9A 3ZMTA 3RTRA 5CVUA 4UXNA 1BIAA 2IXSA 2LY2A 2WAEA 5FRNA 2Y0SA 1A6IA 3L2CA 4J19A 2XF5A 3QPSA 3TEDA 5J1RA 2X1DA 3I64A 3GXOA 3W2AA 2FQ3A 3H92A 3M1EA 3BZKA 2ZNZA 1B72A 4FE4A 1U5TC 3KP2A 1BI3A 1G3YA 2DBBA 2FEZA 4AU7A 4O3MA 2X6WA 3PM1A 4KN4X 3BQYA 3EYIA 3VOEA 3ZPLA 1JKPC 3L2VA 2DJIA 4I0AA 3ZQHA 3I56I 2V79A 5E1XA 1VQ9I 2NVYJ 2Z3YA 2QKLB 3U9GA 2VOOA 3G71I 3WTTC 3W6VA 2BXYA 1OYIA 1R23A 3OYCA 1XG1A 2DFEA 2F5VA 3HPHA 3K1NA 2HPMA 2IS4A 4PFPA 2A6EF 2BY3A 3JR9A 1PUEE 2W25A 4M3FA 4MEXF 4D0PA 3ZP5A 3NWSA 3JCUC 4KICA 2OTJI 2JA5J 1JKOC 2LRDA 2V9PA 3DWLE 3PFYA 1RETA 1UHSA 1XMAA 1W0UA 6PAXA 2CG4A 3FKJA 5CJ9A 1R49A 3D5SC 2HKOA 3BTJA 3VWBA 3VODA 2F5DA 1R00A 2V1NA 3GTGJ 2ZXHA 3F8FA 2IGKA 1FBQA 2XV4S 4YIFA 1JGGA 1U5TA 3I53A 1JT6A 5L3FA 4HDVA 3TO6A 2JQ7A 4P1WA 2GIVA 4EMSA 1MMSA 1PP7U 2NNYA 4YRVA 5BOXA 4Q5SF 1D8KA 2JMWA 4A6DA 3FM3A 2ZFWA 1T6SA 1D0YA 2H1KA 5DUIA 4ZDLA 2LY1A 1W36C 4KNYA 3GFIA 2GWRA 1FOWA 4X6AJ 2M87A 1M1EB 2L0KA 2PX9A 2CUZA 4BE1A 3DLLF 2BZTA 2O5RA 1F9NA 5EG0B 4MQ9F 5AIQA 1D5VA 4BBSJ 2BY2A 1DQUA 3WTUC 2PJRA 4M9SA 1HC8A 3WTXC 3W2WA 1UJ8A 4IHSA 2JA8J 3J7AY 4V2GA 3E6DA 2BW3A 1ZYRF 4PCQA 3TOAA 3OYLA 4HW0A 2JRTA 5ILUA 1G3SA 4KT6A 5BPIA 3F8MA 3HSFA 3CD6I 3CTAA 1UFMA 1REPC 2CU7A 3H9GA 3P7NA 3HG9A 1J5YA 1MD0A 3ZQIA 4XLEA 4AVPA 1DP7P 4D5FA 2A6HF 4ZH4F 1FNNA 3CMYA 2PG4A 1OR7A 5ERIA 3UR3C 2EFNA 3FIWA 4HYEA 4KN7X 4CZCA 4F7ZA 3OL4A 2VPLA 2AHQA 2LY9A 4RLFA 1KU7A 2WTEA 3C2GA 3KCCA 3MFKA 5J1YA 3ABKH 2ESHA 2K5CA 2RC4A 1YX3A 1QO0D 5DD4A 1VI0A 2DTZA 4BDYA 1JKQC 3BTCA 5FB2A 1EF4A 4ZJZA 3ML6A 4NQWB 1LDDA 2L9NA 3L00A 4ZYAA 3ZQ7A 4II2A 2O8XA 4GCVA 2GQQA 3R60A 2HQ5A 2HZDA 3VYRB 3I71A 5IPAA 2OC6A 1ZLJA 1I6HJ 4JP0A 2HTJA 3R61A 3CMEI 2PEXA 2ECCA 4D7MA 1XGOA 2MSYA 4N9IA 3PIPF 3QP5A 1SC7A 1X1AA 2E2JJ 4UUSA 1V3FA 1Z05A 2V1UA 2KPMA 1XB4A 3H3VK 1ACIA 4OAYA 2MG4A 4NNJA 4Y15A 3QPHA 3LSIA 2ZMEB 1Y8RB 2BY0A 3A0HC 5CVVA 5D6FA 2K7LA 1B9MA 2L7FP 3AKZA 2LFBA 3CJRB 1HCRA 3C7JA 1OLTA 5EZGA 4ENNA 3DFGA 4XSXF 2O7OA 1OISA 5EGOA 2HVSA 2ZKZA 3E6MA 1POGA 2KQRA 2KRHA 4XKWA 2Y31A 2P8TA 1WJFA 1MBKA 9ANTA 1FYLA 2G0EA 1ZR4A 3BG7A 5DD8A 4FE7A 2Z33A 2VBZA 1Y0UA 3BQZA 2QUFA 1X3UA 1IDZA 2JVGA 1X2MA 2NVUB 2XAHA 3JAMK 4W1UA 2FA5A 5B1AH 5CPRB 1HBXG 1YRNA 1LUJB 2HWVA 2X1CA 1UB9A 1BI0A 1FZPB 3CCSI 1MMNA 3TDZC 2OQRA 1D1BA 3C3WA 1S6LA 2EA2A 2VQGA 3B6AA 2KZVA 3O3KA 4BHPA 2Y69H 3CUQC 2R5YB 5KHDA 2DU9A 3WU2C 4AYBN 1Z21A 1VQ8I 4GDFA 4FHTA 1VQ7I 3HHGA 4L9NA 1RIOH 2R4GA 4LFUA 1APLC 4LIUA 1VTNC 3AG3H 1JUMA 4HV5A 5FFZA 4A3KJ 1Z67A 4LJZF 2M5WA 3QAHA 1JI8A 2PMZN 2QSFX 3MN2A 4QWQA 2R7RA 2XRLA 5GTHC 2DTRA 2XPVA 3VEPA 2DW4A 3TMOA 1LVAA 5DCMA 1IG7A 1I1GA 2KIUA 1P2FA 1YYVA 2LKSA 4BYYA 3MZ8A 2WY7Q 2DODA 1VQLI 2DK8A 2E1MB 2VXDA 2XKOA 3KPHA 3WU1B 3FISA 4DZPA 1XDUA 1KQ0A 2XHKA 3KE2A 3CDIA 2IS6A 1O7LA 1GVJA 4NC8A 3IUOA 1KU9A 3HUGB 1TWAJ 3HYIA 1QBJA 1YLFA 2OU2A 2VBXA 4GO1A 2DA5A 1E3HA 5FJ8J 1GVDA 4IOCF 2OZ6A 2RDPA 3QP6A 4PDKA 3GZNB 4O6JA 4A5NA 3HL2A 1VNDA 5E8GA 4HQMA 3GYHX 3HOWJ 3JAMZ 1YS7A 4V19K 1WH5A 1R71A 3O8GA 4LG3A 1MW7A 3OS1A 2DXIA 3R0JA 4AVZA 3DQVC 1R5ID 2P0WA 1D1AA 2DDBA 4U0WA 1USSA 4LD5A 3X2QH 2L9RA 2LNBA 2OZUA 3T8TA 2CWEA 3S93A 2GOMA 2ADUA 2JT1A 5DM6F 1RPWA 3CESA 3GX4X 1BL0A 4A12A 1PDNC 3MZYA 1R7JA 4A3FJ 1OCZH 5D5VB 3RSNA 2AS5F 4HG2A 5LGUA 3K2ZA 1Y1WJ 3HZJA 2JPCA 3SDBA 4XKBA 1TNSA 2VASA 2KLOA 2RV8A 2ZJPF 1ZGAA 3CCLI 1ON1A 2ELJA 4IQ4A 2LREA 2LH9A 3JRBA 1BOAA 1EH7A 2FMLA 3P5JA 1ZKGA 3I54A 3BPXA 2CQXA 2FOWA 3OOPA 1IXSB 1U8BA 2QSHX 3JSOA 4MEYF 3CO7C 1YE9A 5C44J 1FP1D 3VPRA 4JOMA 3PUBA 1QZYA 5E79C 2VJ5A 3ERED 3H3UA 1ZN2A 2CSOA 1DGWY 3EUHC 3HOYJ 3L2UA 3O6BB 3AL0C 1X58A 2XAUA 1IUYA 5GAHJ 2Y0MA 5DS9A 1YW8A 4OAZA 3S32A 5CVJA 1S3JA 1LPQA 1ZHFA 2DA6A 3HC7A 4RMNA 3D0SA 3OYEA 4NBQA 5HDGA 2O6GE 5K7ZA 1YITI 1GV5A 4CICA 5ICCA 3GFLA 4IPAA 2WWYA 2NAZA 1N77A 2EQRA 3FDYA 4A2UA 4BY1J 2IVMA 4HOBA 3W2VA 1P92A 2EFWA 1EH8A 1MMDA 4CCOA 5J40A 3M8FA 4MTEA 3DEWA 3ZRGA 2NS8A 1UELB 3G1OA 3BDDA 4HLYA 2VI6A 3HOUJ 1FTZA 3DTKA 1R22A 1TQMA 2L3DA 3M1CA 2JTVA 5KAIC 3V7SA 3OYGA 3SHFA 4KIBA 2VC0A 2K9NA 4WF2A 2FJ1A 2DA7A 3HDDA 1F36A 3SDGA 4B3AA 2FD5A 4M3BA 3Q0VA 2VT2A 3REOA 3EUHA 1IUFA 2KDOA 3I0TA 4RB1A 1K61A 2QENA 3K4KA 4IHYA 1ZG3A 1J59A 4U0VA 1QHGA 2XB0X 4D1QA 2P6SA 4NUBA 3FMSA 3MZHA 1NK2P 5BPDA 3QRFF 2ZJ2A 2BHYA 1K4TA 2R0QC 3V8JA 4XQFA 3IL2A 4K2EA 1HKSA 1SMTA 2X85A 5FFXA 1RUOA 3UNGC 2D1VA 2QZ8A 5FGMA 1WKMA 4DGWB 2K3FA 3S16J 2GAUA 4UVBA 5HS7A 2BV6A 2KT0A 1EA3A 2VB6A 4E7ZA 2LC2A 4M9ZA 2HDDA 5F6FA 4J01A 4I02A 2CRGA 1P7JA 1S7EA 4KMFA 2L7MP 1H9GA 4PFOA 3WGGA 4AIKA 1Z6RA 3RKXA 1T95A 5F27A 1QVTA 4EGZA 1MBEA 4HSRA 5C4JJ 1EJ9A 2JPBA 1BR2A 2NOJB 3ABUA 2FU4A 2I10A 3PL8A 4HBLA 2UWMA 4RAGA 1UG2A 1YTYA 4CO8A 5A2QK 3CJNA 5HDNA 1KU2A 1S7AA 4LG0B 5LFAA 2O61A 4NB5A 4LIVA 3I59B 4A3BJ 2EINH 3FM5A 4IZZA 3KLOA 1LFPA 3RPUD 1WHUA 3LSMA 3D5LA 2E36A 2CQNA 4IHTA 2X6YA 2W84A 2X6OA 4D9JA 5LRSA 1QGPA 5K7FA 2ZFUA 5IOZA 2R5ZA 1VQ4I 1W7PB 1T8IA 1GHCA 4XBFA 3U1KA 1VQNI 4A3GJ 3DKYA 4II3A 3T5XA 4DZJA 1XSXA 3PJRA 5ICFA 3V8LA 4KDPA 5JVGF 1GT0C 1V54H 1QPIA 3FXJA 2ZXWH 1CF7B 3WTVC 1C0WA 2KRCA 4IEJA 3F21A 2BVMA 2RGVA 2JSPA 5IYDJ 3RQIA 2EV0A 1UAAA 3TO7A 4M74A 1NG7A 1LJ9A 3NARA 2LF7A 2RKHA 3ERMA 3SZGA 2ICWG 4M6XA 4G7HF 3CUOA 2W82A 2YX7A 4L5IA 2ISYA 3CMMA 2HXIA 4EATA 3M07A 1K6OA 2XF6A 2EB7A 1X4OA 2EPFA 2MH9A 5B5EC 5E20A 2XF7A 1HQCA 4Y7NJ 2OQGA 1B8IB 3CCMI 4CGZA 3ZQFA 4I76A 3MKWB 2AXTC 4BHBA 4ENKA 1R1UA 4MLOA 5E18F 2FE3A 3BCAA 4E7KA 3E5UA 1X3WB 3IAM2 2ME6A 3DCFA 1IRFA 4LITA 3U2RA 5GADJ 2VQHA 1W5TA 1SFOJ 1TWFJ 2D5VA 4YIRX 2CFXA 3JRFA 1TT0A 1BC8C 3QYFA 1IRXA 3SEZA 3EDPA 2BYVE 3DBLB 3KYCB 3V8KA 2VXZA 3S1NJ 2V9VA 4ASNA 4Y13A 2F2EA 3DPTA 4E7SA 2VOPA 2A3SA 1IN6A 1BBYA 4C3IJ 1OCOH 2DA4A 1F4KA 3KYLA 4L9VA 2G9WA 2WBMA 2CMPA 3S14J 2CS3A 3F8NA 1U8RA 2E1CA 3M7GA 1SEUA 2MLKA 1CQTA 2KIFA 1MMAA 2EJRA 1S8NA 2IAIA 3BLYA 3IKVA 3Q0WA 3OIPA 3KP3A 2EZKA 2IS2A 4ZZDA 3K1PA 4AD9A 3G73A 1O3RA 3RI4A 3IHUA 2M0MA 4HF0A 1GLNA 1SD6A 4TV7A 3Q0UA 1FPQA 4D7NA 4YFKF 1W0TA 2Q0OA 1I50J 2BE5F 5BS6A 1P4AA 2ESNA 1JT0A 4QSHA 4PJJA 2D1HA 5IT9K 2MABA 4HV6A 4ABZA 3BY6A 1SMYF 1VF9A 5GTIC 4IQJA 1W4MA 3SYTA 1UHMA 3CCUI 4FT8A 2LF8A 4CYCA 1R36A 1WZ2A 4EJWA 1P6RA 3IC7A 3K6GA 3LMMA 3ZMDA 4J00A 3WE3A 3P9KA 4RAFA 3OOUA 2MLGA 2ZJRF 3NRVA 3BJ6A 1MDMB 5BNGA 3CJQB 2GLOA 1YOVB 2K86A 3A2KA 2HGCA 2L2OA 1XX5A 2EA4A 4XN3A 3ZN0A 1YJNI 2DK5A 3CCVI 1STZA 3PO3J 2ECBA 2K9MA 5IP7J 1WJDA 1WQ2A 1OFCX 2QWWA 1OYYA 1BW6A 2B0LA 4BJTA 2CW8A 1ETWA 1WJEA 1E0EA 1QU3A 3TP0A 2PMHA 1RR7A 1MNDA 1XMXA 5CVRA 5GP9A 2W4SA 1QNTA 3GTKJ 4YG2F 2JN6A 3BR3A 4RDUA 4HSTA 5JHUA 2FBIA 2JZYA 2OJED 1G3WA 2DO7A 3K4BA 2FBKA 1ZREA 1ITYA 1RR8C 3MD2A 5IT9Z 2M4GA 2LK2A 1I3QJ 2DMQA 4XR6A 2COMA 1B72B 2LD5A 4RB3C 4WXCA 2JUGA 3B6CA 4S04A 3E97A 1XPXA 1SD7A 3K2AA 2DMNA 3QOEA 2V1DA 5FKKA 2R92J 2HEOA 4B48A 2UZKA 5J1UA 3K10A 3ZMVA 3F9KA 2L4AA 3P9IA 3HJEA 3H0DA 2BVLA 3BJAA 2R7TA 2VPRA 1DDNA 1R58A 2EZIA 3CLQA 2FNAA 2GXAA 5D6EA 4B43A 3LSTA 2GXBA 3HKZN 3KYDB 4BQNA 5HVQC 2ELHA 2VE8A 3FHZA 1K78A 4MNUA 1T2KA 1X1DA 3PSIA 3WTWC 5E1ZB 2G7UA 1A5JA 2PJPA 4U7DA 5E3NA 1MMGA 2TCTA 1V5FA 1I6XA 2EWNA 1O3QA 5D5XB 2NVTJ 1AOYA 3FXKA 3I3LA 5EF6A 3TKYA 3CMAI 2CUFA 2P6TA 3RZOJ 4UB8C 1QZEA 3N97A 2ELKA 4KMUX 2WAQN 1AHDP 1U5TB 3WTSC 2E35A 3DPUA 3K9TA 2L7ZA 3DEUA 3DLAA 2UUZA 1PJRA 4EJOA 4UUTA 4A3CJ 4E70A 1VQKI 2XSDC 2EV6A 1V5EA 3I4PA 3VFZA 3S3NA 2E2IJ 4XK4A 2JJ7A 4M72A 4EGYA 2XGXA 5D4RA 5KCMA 4KA4A 3F0CA 2MD0A 3WGHA 1WFXA 2NYXA 4KJZA 3HSEA 1LDKB 1U6GA 2DT5A 3HBLA 4R1HA 2LR8A 5DV5A 2KMUA 4UHTA 2W57A 4P96A 1IN7A 5FKNA 5F1RA 2PJRB 2DYSH 2NS7A 1QPMA 1DPUA 4DW6A 3G2BA 1R5HA 4RBOA 1OKRA 2M8GX 3K4NA 1I39A 5H6RA 4L9JA 4BY7J 2IGOA 3IWZA 3S1QJ 4DIQA 3OYDA 4C3HJ 4BJ6C 2HQAA 3S1MJ 1NH3A 4G7ZF 4YIIA 3EUAA 5B1BH 1U78A 3JRHA 4IL6C 1SD5A 1HSTA 1BN5A 2ZMEC 2D45A 1A35A 5C3EJ 2DYRH 2VE9A 3EPZA 3K69A 3LQQA 5C4XJ 3C18A 5CLSA 2O0YA 1ZLKA 2Y0SN 3KP6A 1MBGA 4RB0A 1EV7A 2DLLA 2F4OB 1ZELA 4BQOA 2VODA 2WC2A 1TTYA 2Z16A 3L09A 3H9QA 1FOYA 1YHQI 4UNOA 1IRGA 3DTEA 2H6BA 2XIGA 1QVUA 3BJOA 1X3ZB 4OWRB 2M2EA 2NXNB 4Q4ZF 3M4OJ 5J6XA 2L01A 4RM2A 3CQZJ 2PN6A 3ASNH 4PGGA 1B6AA 4QTRA 2YPRA 3ABLH 1WSUA 4JBAA 1NTCA 5LEJA 2K85A 2HVRA 5LBQA 1YI2I 2ZB9A 2DMPA 1JTXA 1H9TA 3TGNA 4ZDPA 1V5GA 2JUCA 5EZHA 3TW7A 3VYUB 3F6OA 4D5CA 2ZBKA 1J7KA 5B66C 4IF4A 1X2NA 2CQQA 2V26A 2H8WA 3U1DA 3GTJJ 2YSRA 3H35A 3FXMA 3DV8A 3K1MA 3QPLA 3IKTA 4FASD 1J9IA 4G6DA 3AAFA 3A4CA 1WPKA 4M3GA 1GUUA 5FLMJ 2LTPA 4C30A 2IRFG 3GTOJ 1B1BA 3LOCA 4KISA 2HOEA 4UUSB 3AG2H 4IOAF 3CLOA 4H4KC 1TP4A 3A03A 1ZAOA 2RNJA 4XN0A 1KQ9A 4X1EA 1FJLA 1OCCH 1HOMA 5M5WJ 1XMKA 2QQ8A 4HX8A 2CH0A 1LB2A 3JTHA 4BGDA 3LA7A 3FXOA 3K7AJ 4OIQF 3ELKA 1XCVA 4KYWA 2E71A 3WTZA 2IBDA 3C2HA 4CHUA 5E1WA 2IGMA 4L9TA 5EGOB 5BQTA 4HQEA 4I09A 2TRTA 4N4OB 2E1MC 2IW5A 2QKMB 2V4JC 3FMRA 1G8XA 4CA0A 1OCTC 1ENHA 4BXXJ 2JSCA 4BL0B 4AWXB 4YFXF 4Q48A 1KZHA 3D5RC 2XPWA 2KJBA 3T8RA 3GWZA 4XLCA 3UKGA 3Q9SA 1SFUA 3RYRA 4XKCA 3G3ZA 3OS0A 1R4NB 5LRRA 2E7WA 4P9FA 3BT9A 4L5EA 3ZQCA 4CCMA 3G6EI 2YU3A 4AIDA 1T08B 4F55A 2EV5A 2GOXB 4OOIA 1W7PD 2ZJQF 2ETHA 3A02A 1PVEA 2PMUA 3FXLA 4IXAA 4L0ZB 3MKZA 3WG7H 3PIOF 3GZ5A 1TT5B 3KEQA 2HKXA 2KIQA 1DGRM 2MD5A 1R6RA 3J80K 4GGGA 2X1EA 3ZN1A 4ENJA 4XRSA 2QYOA 2MYSA 3AG4H 4PSXA 1HXDA 4YELA 3T1BA 3CCJI 5DCMB 2HDCA 4GYGA 2ZXIA 2CO5A 2GA1A 2Z1DA 5CYVA 1Y6IA 4HRIA 1Y56A 2MC3A 3VSLA 1ZRCA 1LE8B 2VC1A 1JUPA 4B4CA 3OV8A 2ME0A 1I5ZA 3CUQA 4HF2A 1XTAA 3MWMA 2N8GA 1S7OA 4BQQA 4BHCA 1DUXC 4RAYA 3OS2A 4IHXA 1FT9A 3NAUA 2CGPA 1MNMC 3JTGA 1QQIA 4XOTA 4IRIA 2DMUA 4XLAA 2MH2A 3W3CA 4G6QA 2C6YA 1Z7LA 4C3JJ 2DAOA 4M73A 1GDTA 2EILH 2DI3A 2X51A 4JQFA 3R6SA 3J7ZI 3DU5A 1OMIA 1SVMA 2MA3A 1T0FC 2OCCH 3TO9A 5ED4A 4U88A 4DQ2A 2HVQA 1X1CA 2Y2ZA 1Z3XA 1J0RA 2Q2EA 2FQ4A 5DCFA 4L0YB 2IGNA 4AUXA 2R93J 3PNTA 4BU2A 3T0YA 1IDYA 2QA4I 3BG3A 3GZ6A 3J80Z 3GTMJ 4IKFA 1O3TA 1OCPA 4CCKA 3N05A 4BE0A 1RZ4A 5F04A 2E2HJ 1TWHJ 2YR2A 2Z5UA 3PNVA 1KQ8A 1ZGJA 2PFBA 1ULYA 2VBWA 4EJVA 4EM0B 2VIXA 1TQPA 2M3AA 4LK1F 5CKTA 3S17J 4EEFG 2H6CA 2K27A 3JRGA 4ITVA 3HOZJ 1R4MB 2DN0A 3BG5A 1HW5A 1T38A 3EYYA 1MGTA 4E4HA 5FD6A 4BDZA 2R7OA 3FK6A 4Y17A 4I6ZA 3K0LA 1S5LC 4FETA 3PO2J 4A0XA 4EM1A 3ONQA 1P4XA 4NC7A 3I9V2 1PP8F 3COAC 1TNTA 2P4WA 3HOSA 4ESJA 1T0FA 1W5SA 3BOQA 1IN4A 4I2OA 5H2FC 3H36A 2R7UA 2O9LA 3KIOA 1BJZA 1FMVA 3BZCA 4MQVA 2FOKA 3DEEA 4PJ0C 5AONA 2A68F 2NVXJ 5F0FA 1MNEA 2DOFA 3WU0A 4H0EA 1VQ6I 3IH2A 1SANA 1S72I 4WXHA 3MEXA 1SAXA 3KX2A 1OCRH 2EFPA 2HNHA 2XVCA 4IHVA 2V7FA 1SVLA 3F6VA 1UG0A 4HPQA 2VT3A 4A0ZA 1GV2A 3C1DA 4ZDOA 2R7QA 2W24A 2I8DA 3A01A 4OIRF 2VJ4A 2ZSIB 3QU3A 4HNUA 3H5RA 4C9YA 2A5WA 4C2UA 3WGIA 1SD4A 3S2WA 3WTYC 3S15J 3LSHA 1ON2A 4HA8A 2R7ZJ 5E3LA 5M3MJ 4CCNA 1AKHA 3BTLA 3H1CA 4G8XA 2KRFA 5TISC 5ILVA 4A3LJ 1N25A 2DOAA 2EH3A 2QQBA 1Y0NA 5CVIA 3NQOA 2GBYA 2HYGD 3RKWA 1FYMA 4RLQA 3QPTA 4FCYA 1BI1A 1RNLA 2JK3A 1PUFB 2K9QA 2CJJA 1WRJA 2QBYA 3HXLA 3LWFA 2QVOA 2R7FA 3HIFA 1FP2A 2Q8KA 3VSKA 1K4SA 2P7VB 2VJJA 4B44A 4JX6A 3FZVA 5L3BA 4XIDA 3ABMH 2XASA 2YUSA 2A61A 1QRYA 3MVPA 2K4BA 1HKTA 3IRRA 1FSEA 3K4LA 2WAFA 2FSWA 2KISA 1K79A 2LBFA 5IYCJ 4NC6A 5LD2C 2XAGA 3CC4I 4UVAA 4RB2C 5AIPA 3GLLA 4F52A 3LSKA 1FYKA 3WG9A 3OYIA 5ILSA 1USTA 3ECOA 2F6CA 2KJCA 4KIFA 4B8XA 1IXCA 3TQNA 3SZPA 3FBNB 5B3SH 3DKWA 1MSFC 2IEKA 2WV1A 3G1MA 3I59A 3I58A 2B63J 3HHHA 2ID3A 1G59A 4JX5A 2XGEA 1VQOI 4ZTJA 1FLIA 4XOPA 3BROA 4A0YA 1H8AC 1E3PA 4RM3A 1IGNA 5HNHA 3JW4A 3HOXJ 4ZYEA 1ZGWA 2HTSA 4S0HB 2GIZA 4HDUA 1ZK8A 2CQ7A 1I1SA 4W97A 3S3OA 4BEHA 1BI2A 3G1LA 3HOVJ 3E6CC 3GTLJ 4DOZA 4OIPF 5IT3A 3OMYA 1X4PA 2R7SA 3CF2A 1JKRC 3HGGA 5F0CA 4DYRA 4MHGA 3KP5A 1UZCA 4BJ5C 3OIOA 4PZJA 4JYKA 2RAEA 2JVHA 4OIOF 3OYKA 5DM7F 3S1RJ 3BG9A 2ISZA 4KUMA 1FOXA 2VLAA 2NS0A 5L3CA 2STWA 3RPQA 2GM4A 4ZYDA 2IA1A 2WADA 2XKPA 5A2QZ 3OYMA 2COBA 2A07F 2DA1A 2ZC2A 3F72A 3O8HA 5JLXA 2G7HA 2VUMJ 3R0AA 4S05A 1LEBA 5FD5A 2VBYA 4IHWA 4PJMA 3IH3A 2M8EA 4HAMA 1YX5A 2JRMA 4I98B 4N0BA 1DPRA 1IJWC 3TBIA 1AWCA 1N78A 2BBYA 3RIRA 1X1BA 1XSDA 2VKDA 2O3FA 4MTDA 2W48A 4XLHA 3AFHA 3MAJA 4EV0A 5K1YA 3NEUA 1D0ZA 3H0GJ 3PSFA 1FIAA 2QM3A 2M0CA 2JA2A 1W36D 4LLLA 4UY8I 4CYDA 2XUBA 5K7HA 3J7AO 2IPQX 2RQQA 1WVRA 3DTIA 4JX4A 1EKEA 1S9HA 1XC5A 1N75A 1Y8QB 2FF4A 1XGNA 2F5EA 2ZCWA 5TRDA 3ZQQA 3DBHB 2I5UA 3L7WA 2X4HA 4Y52J
chains in the Genus database with same CATH topology
3MN2A 2XRLA 1AKHB 2XPVA 3HBLA 5HODA 2LR8A 1IG7A 3ZQGA 2Y30A 3L1PA 1Q1VA 5FKNA 1TWGJ 2NS7A 2JWTA 3FISA 4DZPA 1PUFA 3I4MJ 4DW6A 1G2HA 4RBOA 2M8GX 2XGDA 2WB1N 1T56A 1TWAJ 2YU9J 1WCMJ 5E3OA 4BY7J 3S1QJ 2DA5A 5FJ8J 1GVDA 1BA5A 3S2DJ 4C3HJ 1F43A 3S1MJ 1VNDA 3BR6A 3BTIA 3HOWJ 2XGCA 2OF7A 3LSRA 3JRCA 1U78A 3JRHA 3JREA 1WH5A 2VKVA 3O8GA 2HOTA 2LKXA 5C3EJ 3I4NJ 4XRSG 3ZQLA 2HI3A 5C4XJ 2Y0SN 1U9NA 1MBGA 5E3MA 2L9RA 1FIPA 1IC8A 2O8KA 5F1JA 3IH4A 1RPWA 1BL0A 3MKLA 1QVUA 1NK3P 5EYRA 4A69C 1TC3C 2M2EA 5JLWA 2R5ZB 1WH7A 4A3FJ 3M4OJ 5IYBJ 5M3FJ 1VFCA 3CQZJ 1WGXA 4QTRA 5M5YJ 1NTCA 1MBJA 1Y1WJ 1MH3A 4MFEA 2ZB9A 2DMPA 1JTXA 2JA7J 1JJ8C 5EZHA 2K9SA 3TW7A 4D5CA 3GTJJ 1X2NA 2CQQA 3JRBA 1ZKGA 3QPLA 3BR0A 1TWCJ 3WHCA 2CQXA 1U8BA 1ETKA 1WPKA 4M3GA 2MGQA 1GUUA 5FLMJ 2LTPA 3JRDA 3GTOJ 1FTTA 3LOCA 4DYQA 5C44J 3VPRA 4UUSB 4AC0A 3GBGA 3A03A 1IV6A 4X1EA 5IOYA 1FJLA 1HOMA 3E7LA 1LFBA 5M5WJ 1RKWA 3HOYJ 1RESA 1MSEC 1B8IA 1X58A 1Z0XA 3K7AJ 2E1OA 5DS9A 1E3OC 2LP0A 4HNVA 4V2FA 2DA6A 2IBDA 2Y9ZA 5EGOB 5K7ZA 4G12A 1GV5A 4XRMA 4A93J 2AO9A 4C2MJ 3TW6A 2TRTA 1OCTC 1ENHA 4BXXJ 3BR5A 3OSFA 2CUEA 2EQRA 3Q3SA 1HLVA 4BY1J 1H89C 2E19A 3CCYA 1IRZA 2XPWA 4M6VA 3UKGA 3DEWA 2NS8A 3G1OA 4GFBA 2VI6A 3HOUJ 1FTZA 3BT9A 4L5EA 3ZQCA 3FKIJ 2K9NA 2QF7A 2FJ1A 2DA7A 3HDDA 3LSPA 1F36A 3SDGA 4B3AA 2FD5A 4M3BA 3Q0VA 4M3DA 3A02A 5FKLA 2EBIA 2QCOA 1IUFA 1O4XA 1K61A 5EG0A 4IHYA 2HYJA 2XB0X 1JTYA 4XRSA 2X48A 2ID6A 3HM5A 5EEAA 1NK2P 5FKMA 2R0QC 3SFIA 3LSGA 3IV5A 4BBRJ 1HDDC 4CYCB 3S16J 1LE8B 1JUPA 2KT0A 1ETQA 4B4CA 1ETOA 2HDDA 1K83J 2LVSA 2ME0A 2CRGA 1P7JA 1S7EA 1Y1VJ 2L7MP 2N8GA 4QIWN 3BR2A 5F27A 1QVTA 4B1RA 4MFDA 4IHXA 3NAUA 1MBEA 5C4JJ 3LSJA 2X9DA 1MNMC 1WI3A 2H8RA 2DMUA 3GTQJ 4MO7A 2HOAA 2I10A 3WHBA 1H88C 4C3JJ 3S2HJ 1UG2A 1GDTA 4XICA 2NOGA 5DTDA 3RZDJ 2DMTA 4A3BJ 1MBHA 2DA3A 2LLKA 4BKXA 4LOCA 3TP3A 3HEFA 2X6OA 2Y2ZA 1D5YA 5K7FA 1A6IA 2FQ4A 5IOZA 2R5ZA 4AUXA 2R93J 4J19A 2OPTA 2EZLA 3QPSA 3TEDA 5J1RA 1IDYA 4A3GJ 3BG3A 4DZJA 3GTMJ 1B72A 1OCPA 4FE4A 1GT0C 5F04A 1QPIA 2E2HJ 1TWHJ 5M5XJ 3PM1A 3BQYA 4A3JJ 4IEJA 1HDPA 5IYDJ 1JKPC 3RQIA 3HB9A 3ZQHA 3S17J 4EEFG 2NVYJ 3JRGA 3NARA 3HOZJ 3W6VA 2DN0A 5GPCA 3BG5A 1DU6A 1XG1A 3JR9A 2HXIA 3FK6A 4M3FA 1ZQ3P 4I6ZA 3PO2J 4Y7NJ 1BW5A 4A3DJ 1B8IB 3ZQFA 4I76A 2JA5J 1JKOC 4MLOA 1RETA 1UHSA 1W0UA 2O9LA 2DJNA 3CDLA 2ME6A 2M9HA 2EZHA 3DCFA 1BJZA 1SFOJ 2D5VA 1TWFJ 3BTJA 3JRFA 2NVXJ 5F0FA 3GTGJ 1MH4A 3IH2A 1SANA 1YRNB 1AU7A 1JGGA 1JT6A 1HF0A 3S1NJ 5GPAA 4IHVA 4Y52J 2R5YA 4C3IJ 2DA4A 1GV2A 3A01A 2JMWA 1T33A 3S14J 1RKTA 2P81A 2H1KA 1CQTA 3S15J 2IAIA 2VKEA 3Q0WA 2R7ZJ 2EZKA 5E3LA 5M3MJ 1DU0A 4M3EA 1AKHA 4MIMA 4X6AJ 3BTLA 4A3IJ 2L0KA 4A3LJ 3Q0UA 2EH3A 4D7NA 5EG0B 1W0TA 1I50J 4A3MJ 1JT0A 4QSHA 1Z77A 4FTHA 4BBSJ 2GBYA 5EDNA 3FK7A 2HOSA 4FCYA 1PUFB 2JK3A 2JA8J 4ABZA 1ETYA 2K9QA 2MW8A 2CJJA 4V2GA 3OSGA 1VF9A 2YS9A 4JX6A 5F08A 2FX0A 4XIDA 4CYCA 3LNQA 2YUSA 1QRYA 3MVPA 3JRIA 1LE8A 5IYCJ 2CU7A 3OOUA 5J3LA 1P7IA 3ZQIA 2K40A 4D5FA 4FISA 3CMYA 5BNGA 3C2BA 2GLOA 4NDLA 3BR1A 3FIWA 2DA2A 5F0HA 1MSFC 2AHQA 2LY9A 3PO3J 2ECBA 2IEKA 2WV1A 3G1MA 5IP7J 5J1YA 2B63J 2ID3A 1OFCX 4JX5A 1JKQC 3SJMA 1VI0A 2DTZA 1BW6A 2XGEA 3GTPJ 2JA6J 1ETWA 3BTCA 1EF4A 3TP0A 3RKQA 1H8AC 1RR7A 5GP9A 1IGNA 3HOXJ 3GTKJ 2JN6A 3BR3A 4RDUA 1ZGWA 4S0HB 2NVQJ 3JRAA 1ZK8A 1U9OA 2HQ5A 4W97A 1ITYA 5IPAA 5FLVA 3G1LA 2LK2A 1I3QJ 2DMQA 1B72B 3HOVJ 1I6HJ 3GTLJ 4JP0A 2LD5A 2ECCA 4D7MA 3M3YJ 2MSYA 3B6CA 3K2AA 2E2JJ 2DMNA 4UUSA 3HGYA 5FKKA 3H3VK 1MBFA 1JKRC 3HGGA 3QQAA 5F0CA 2MG4A 4DYRA 4A3EJ 2R92J 5J1UA 1R9TJ 5IP9J 3OIOA 4JYKA 2RAEA 1UMQA 2L7FP 3S1RJ 2LFBA 3BG9A 2VPRA 2HXOA 1HCRA 2GM4A 2EZIA 5EZGA 2COBA 2DA1A 5JLXA 1JJ6C 2O7OA 3O8HA 5EGOA 3HKZN 1POGA 2VUMJ 2KDZA 1LFUP 2Y31A 1A5JA 1MBKA 4DYCA 9ANTA 5E3NA 4IHWA 3D1NI 2G0EA 1ZR4A 2TCTA 3IH3A 4FE7A 1IJWC 3BQZA 1IDZA 1ZTRA 2NVTJ 1X2MA 4W1UA 5EF6A 3RZOJ 2CUFA 2M34A 2XB5A 2W48A 5IP6A 2ELKA 2WAQN 2XPUA 1AHDP 3H0GJ 1XS9A 1YRNA 1FIAA 1JUSA 2Y9YA 2M0CA 5FKOA 2L7ZA 2R5YB 3B6AA 4UUTA 4A3CJ 5K7HA 4AYBN 1FEXA 2XSDC 1ORKA 1OJLA 4JX4A 3A01B 3ZOBA 2E2IJ 4XK4A 1XC5A 1APLC 1ETXA 2JJ7A 1JUMA 4A3KJ 1ETVA 1ZR2A 3F0CA 2PMZN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MN2 A;  2XRL A;  1AKH B;  2XPV A;  3HBL A;  5HOD A;  2LR8 A;  1IG7 A;  3ZQG A;  2Y30 A;  3L1P A;  1Q1V A;  5FKN A;  1TWG J;  2NS7 A;  2JWT A;  3FIS A;  4DZP A;  1PUF A;  3I4M J;  4DW6 A;  1G2H A;  4RBO A;  2M8G X;  2XGD A;  2WB1 N;  1T56 A;  1TWA J;  2YU9 J;  1WCM J;  5E3O A;  4BY7 J;  3S1Q J;  2DA5 A;  5FJ8 J;  1GVD A;  1BA5 A;  3S2D J;  4C3H J;  1F43 A;  3S1M J;  1VND A;  3BR6 A;  3BTI A;  3HOW J;  2XGC A;  2OF7 A;  3LSR A;  3JRC A;  1U78 A;  3JRH A;  3JRE A;  1WH5 A;  2VKV A;  3O8G A;  2HOT A;  2LKX A;  5C3E J;  3I4N J;  4XRS G;  3ZQL A;  2HI3 A;  5C4X J;  2Y0S N;  1U9N A;  1MBG A;  5E3M A;  2L9R A;  1FIP A;  1IC8 A;  2O8K A;  5F1J A;  3IH4 A;  1RPW A;  1BL0 A;  3MKL A;  1QVU A;  1NK3 P;  5EYR A;  4A69 C;  1TC3 C;  2M2E A;  5JLW A;  2R5Z B;  1WH7 A;  4A3F J;  3M4O J;  5IYB J;  5M3F J;  1VFC A;  3CQZ J;  1WGX A;  4QTR A;  5M5Y J;  1NTC A;  1MBJ A;  1Y1W J;  1MH3 A;  4MFE A;  2ZB9 A;  2DMP A;  1JTX A;  2JA7 J;  1JJ8 C;  5EZH A;  2K9S A;  3TW7 A;  4D5C A;  3GTJ J;  1X2N A;  2CQQ A;  3JRB A;  1ZKG A;  3QPL A;  3BR0 A;  1TWC J;  3WHC A;  2CQX A;  1U8B A;  1ETK A;  1WPK A;  4M3G A;  2MGQ A;  1GUU A;  5FLM J;  2LTP A;  3JRD A;  3GTO J;  1FTT A;  3LOC A;  4DYQ A;  5C44 J;  3VPR A;  4UUS B;  4AC0 A;  3GBG A;  3A03 A;  1IV6 A;  4X1E A;  5IOY A;  1FJL A;  1HOM A;  3E7L A;  1LFB A;  5M5W J;  1RKW A;  3HOY J;  1RES A;  1MSE C;  1B8I A;  1X58 A;  1Z0X A;  3K7A J;  2E1O A;  5DS9 A;  1E3O C;  2LP0 A;  4HNV A;  4V2F A;  2DA6 A;  2IBD A;  2Y9Z A;  5EGO B;  5K7Z A;  4G12 A;  1GV5 A;  4XRM A;  4A93 J;  2AO9 A;  4C2M J;  3TW6 A;  2TRT A;  1OCT C;  1ENH A;  4BXX J;  3BR5 A;  3OSF A;  2CUE A;  2EQR A;  3Q3S A;  1HLV A;  4BY1 J;  1H89 C;  2E19 A;  3CCY A;  1IRZ A;  2XPW A;  4M6V A;  3UKG A;  3DEW A;  2NS8 A;  3G1O A;  4GFB A;  2VI6 A;  3HOU J;  1FTZ A;  3BT9 A;  4L5E A;  3ZQC A;  3FKI J;  2K9N A;  2QF7 A;  2FJ1 A;  2DA7 A;  3HDD A;  3LSP A;  1F36 A;  3SDG A;  4B3A A;  2FD5 A;  4M3B A;  3Q0V A;  4M3D A;  3A02 A;  5FKL A;  2EBI A;  2QCO A;  1IUF A;  1O4X A;  1K61 A;  5EG0 A;  4IHY A;  2HYJ A;  2XB0 X;  1JTY A;  4XRS A;  2X48 A;  2ID6 A;  3HM5 A;  5EEA A;  1NK2 P;  5FKM A;  2R0Q C;  3SFI A;  3LSG A;  3IV5 A;  4BBR J;  1HDD C;  4CYC B;  3S16 J;  1LE8 B;  1JUP A;  2KT0 A;  1ETQ A;  4B4C A;  1ETO A;  2HDD A;  1K83 J;  2LVS A;  2ME0 A;  2CRG A;  1P7J A;  1S7E A;  1Y1V J;  2L7M P;  2N8G A;  4QIW N;  3BR2 A;  5F27 A;  1QVT A;  4B1R A;  4MFD A;  4IHX A;  3NAU A;  1MBE A;  5C4J J;  3LSJ A;  2X9D A;  1MNM C;  1WI3 A;  2H8R A;  2DMU A;  3GTQ J;  4MO7 A;  2HOA A;  2I10 A;  3WHB A;  1H88 C;  4C3J J;  3S2H J;  1UG2 A;  1GDT A;  4XIC A;  2NOG A;  5DTD A;  3RZD J;  2DMT A;  4A3B J;  1MBH A;  2DA3 A;  2LLK A;  4BKX A;  4LOC A;  3TP3 A;  3HEF A;  2X6O A;  2Y2Z A;  1D5Y A;  5K7F A;  1A6I A;  2FQ4 A;  5IOZ A;  2R5Z A;  4AUX A;  2R93 J;  4J19 A;  2OPT A;  2EZL A;  3QPS A;  3TED A;  5J1R A;  1IDY A;  4A3G J;  3BG3 A;  4DZJ A;  3GTM J;  1B72 A;  1OCP A;  4FE4 A;  1GT0 C;  5F04 A;  1QPI A;  2E2H J;  1TWH J;  5M5X J;  3PM1 A;  3BQY A;  4A3J J;  4IEJ A;  1HDP A;  5IYD J;  1JKP C;  3RQI A;  3HB9 A;  3ZQH A;  3S17 J;  4EEF G;  2NVY J;  3JRG A;  3NAR A;  3HOZ J;  3W6V A;  2DN0 A;  5GPC A;  3BG5 A;  1DU6 A;  1XG1 A;  3JR9 A;  2HXI A;  3FK6 A;  4M3F A;  1ZQ3 P;  4I6Z A;  3PO2 J;  4Y7N J;  1BW5 A;  4A3D J;  1B8I B;  3ZQF A;  4I76 A;  2JA5 J;  1JKO C;  4MLO A;  1RET A;  1UHS A;  1W0U A;  2O9L A;  2DJN A;  3CDL A;  2ME6 A;  2M9H A;  2EZH A;  3DCF A;  1BJZ A;  1SFO J;  2D5V A;  1TWF J;  3BTJ A;  3JRF A;  2NVX J;  5F0F A;  3GTG J;  1MH4 A;  3IH2 A;  1SAN A;  1YRN B;  1AU7 A;  1JGG A;  1JT6 A;  1HF0 A;  3S1N J;  5GPA A;  4IHV A;  4Y52 J;  2R5Y A;  4C3I J;  2DA4 A;  1GV2 A;  3A01 A;  2JMW A;  1T33 A;  3S14 J;  1RKT A;  2P81 A;  2H1K A;  1CQT A;  3S15 J;  2IAI A;  2VKE A;  3Q0W A;  2R7Z J;  2EZK A;  5E3L A;  5M3M J;  1DU0 A;  4M3E A;  1AKH A;  4MIM A;  4X6A J;  3BTL A;  4A3I J;  2L0K A;  4A3L J;  3Q0U A;  2EH3 A;  4D7N A;  5EG0 B;  1W0T A;  1I50 J;  4A3M J;  1JT0 A;  4QSH A;  1Z77 A;  4FTH A;  4BBS J;  2GBY A;  5EDN A;  3FK7 A;  2HOS A;  4FCY A;  1PUF B;  2JK3 A;  2JA8 J;  4ABZ A;  1ETY A;  2K9Q A;  2MW8 A;  2CJJ A;  4V2G A;  3OSG A;  1VF9 A;  2YS9 A;  4JX6 A;  5F08 A;  2FX0 A;  4XID A;  4CYC A;  3LNQ A;  2YUS A;  1QRY A;  3MVP A;  3JRI A;  1LE8 A;  5IYC J;  2CU7 A;  3OOU A;  5J3L A;  1P7I A;  3ZQI A;  2K40 A;  4D5F A;  4FIS A;  3CMY A;  5BNG A;  3C2B A;  2GLO A;  4NDL A;  3BR1 A;  3FIW A;  2DA2 A;  5F0H A;  1MSF C;  2AHQ A;  2LY9 A;  3PO3 J;  2ECB A;  2IEK A;  2WV1 A;  3G1M A;  5IP7 J;  5J1Y A;  2B63 J;  2ID3 A;  1OFC X;  4JX5 A;  1JKQ C;  3SJM A;  1VI0 A;  2DTZ A;  1BW6 A;  2XGE A;  3GTP J;  2JA6 J;  1ETW A;  3BTC A;  1EF4 A;  3TP0 A;  3RKQ A;  1H8A C;  1RR7 A;  5GP9 A;  1IGN A;  3HOX J;  3GTK J;  2JN6 A;  3BR3 A;  4RDU A;  1ZGW A;  4S0H B;  2NVQ J;  3JRA A;  1ZK8 A;  1U9O A;  2HQ5 A;  4W97 A;  1ITY A;  5IPA A;  5FLV A;  3G1L A;  2LK2 A;  1I3Q J;  2DMQ A;  1B72 B;  3HOV J;  1I6H J;  3GTL J;  4JP0 A;  2LD5 A;  2ECC A;  4D7M A;  3M3Y J;  2MSY A;  3B6C A;  3K2A A;  2E2J J;  2DMN A;  4UUS A;  3HGY A;  5FKK A;  3H3V K;  1MBF A;  1JKR C;  3HGG A;  3QQA A;  5F0C A;  2MG4 A;  4DYR A;  4A3E J;  2R92 J;  5J1U A;  1R9T J;  5IP9 J;  3OIO A;  4JYK A;  2RAE A;  1UMQ A;  2L7F P;  3S1R J;  2LFB A;  3BG9 A;  2VPR A;  2HXO A;  1HCR A;  2GM4 A;  2EZI A;  5EZG A;  2COB A;  2DA1 A;  5JLX A;  1JJ6 C;  2O7O A;  3O8H A;  5EGO A;  3HKZ N;  1POG A;  2VUM J;  2KDZ A;  1LFU P;  2Y31 A;  1A5J A;  1MBK A;  4DYC A;  9ANT A;  5E3N A;  4IHW A;  3D1N I;  2G0E A;  1ZR4 A;  2TCT A;  3IH3 A;  4FE7 A;  1IJW C;  3BQZ A;  1IDZ A;  1ZTR A;  2NVT J;  1X2M A;  4W1U A;  5EF6 A;  3RZO J;  2CUF A;  2M34 A;  2XB5 A;  2W48 A;  5IP6 A;  2ELK A;  2WAQ N;  2XPU A;  1AHD P;  3H0G J;  1XS9 A;  1YRN A;  1FIA A;  1JUS A;  2Y9Y A;  2M0C A;  5FKO A;  2L7Z A;  2R5Y B;  3B6A A;  4UUT A;  4A3C J;  5K7H A;  4AYB N;  1FEX A;  2XSD C;  1ORK A;  1OJL A;  4JX4 A;  3A01 B;  3ZOB A;  2E2I J;  4XK4 A;  1XC5 A;  1APL C;  1ETX A;  2JJ7 A;  1JUM A;  4A3K J;  1ETV A;  1ZR2 A;  3F0C A;  2PMZ N; 
#chains in the Genus database with same CATH topology
 2IJL A;  5DUK A;  1YIO A;  2UV1 A;  2OBP A;  4M6Y A;  2X6X A;  4KIT B;  4LB5 A;  3HOT A;  3ZQG A;  3QWL A;  3FX3 A;  3J7Y J;  3LAP A;  2IT0 A;  1TWG J;  2AQE A;  2NRA C;  1JGS A;  3F8B A;  4U7B A;  1TLH B;  1G2H A;  1SFX A;  2ZSH B;  3KP7 A;  3A1Y A;  1UCR A;  3IWF A;  2XGD A;  1LDJ A;  2WB1 N;  4G7O F;  1FWZ A;  1WCM J;  3EET A;  5E3O A;  1SVO A;  2OD5 A;  3ZMS A;  2V6E A;  1T39 A;  5KNL A;  3S2D J;  1BA5 A;  2CW0 F;  1F43 A;  2E34 A;  2BEO A;  5LLQ A;  1D1C A;  2OF7 A;  2E5N A;  1Z91 A;  4U0Y A;  4MGR A;  3LSR A;  3JRE A;  2VKV A;  5TGT A;  1FC3 A;  2HOT A;  2PQ8 A;  1WI9 A;  2F5C A;  2IA2 A;  3DBR B;  1U2W A;  3VDX A;  1U9N A;  4XL9 A;  5E3M A;  1BM9 A;  1RI7 A;  3OWT A;  1IC8 A;  2CYY A;  5F1J A;  3IH4 A;  3E0J B;  4CDG A;  1Y39 A;  1IV8 A;  1IN5 A;  4UV8 A;  5EYR A;  4XOR A;  5LGN A;  1R1T A;  4HF1 A;  2L7K A;  1GXP A;  1MKM A;  4OMZ A;  5IYB J;  1K6Y A;  5EEG A;  5GAE J;  4L18 B;  5F64 A;  4MFE A;  2FBH A;  4LLN A;  3ZCO A;  2JA7 J;  1JJ8 C;  2KHM A;  3BZ6 A;  1XD7 A;  2BGC A;  2K9S A;  5TJJ A;  1BR4 A;  2FNP A;  4M71 A;  3BR0 A;  1I3A A;  2ZXJ A;  3GCM A;  1KON A;  3WHC A;  1ETK A;  3MCZ A;  2MGQ A;  3MKY B;  3JRD A;  3QYE A;  2P5L C;  1FTT A;  4DYQ A;  4G9Y A;  3I55 I;  2R7X A;  4XLP F;  3GBG A;  1IV6 A;  2XRO A;  4LMY A;  5IOY A;  3L2R A;  1YIJ I;  3OY9 A;  4B09 A;  5J8C A;  1ZRD A;  3RJP A;  3OYH A;  3LFU A;  2M7A A;  4X0G A;  2B9S A;  3PUF A;  2STT A;  2HDW A;  1G3T A;  2LMD A;  5HDK A;  1TZL A;  2E1O A;  4PK4 A;  1Z6T A;  2LOO A;  1LVK A;  4HNV A;  1AA7 A;  4UB6 C;  2M7B A;  3EQL F;  2V6C A;  3KZI C;  3H5A A;  1K78 B;  5J4V A;  2AO9 A;  2ACJ A;  1J2X A;  3L2Q A;  1GXQ A;  2F5F A;  3BR5 A;  3OSF A;  1IW7 F;  1HLV A;  3Q3S A;  3RPU A;  4CZZ A;  1MJB A;  3VYS B;  2DDA A;  2AXL A;  4L5J A;  2UXX A;  3GVA A;  1FMW A;  1RC9 A;  4XLF A;  3KFW X;  1BC7 C;  1OYW A;  2OCE A;  4ZYG A;  4GFB A;  3LA3 A;  5EJC A;  1T98 A;  1BOB A;  1YG2 A;  2CUJ A;  5ICE A;  2QLZ A;  2QF7 A;  2H09 A;  3V42 A;  3RDI A;  4YFN F;  2D2W A;  4M3D A;  5JVT A;  2KL4 A;  5FKL A;  2EBI A;  2QCO A;  2PBI A;  2HR3 A;  1OR7 C;  1B59 A;  5EG0 A;  3L2W A;  1D8J A;  4IJA A;  1JXS A;  2Z9O A;  4AYB A;  1ZG5 A;  2CV1 A;  2L02 A;  3FMQ A;  1G6N A;  4RS8 A;  3IP4 B;  4Y4R A;  1HKQ A;  5HLG A;  2UXN A;  5KVR A;  3N4M A;  5EEA A;  2K3P A;  5FKM A;  2OV7 A;  5FRO A;  3SFI A;  5K5Q A;  3LSG A;  5L3G A;  3IV5 A;  2PMZ A;  3FHN A;  2MBF A;  4XLN F;  3S8P A;  2Z2S B;  1HDD C;  2CQK A;  3M9A A;  2BW3 B;  1TL8 A;  3LFK A;  1LEA A;  3CCE I;  1KYZ A;  4IRH A;  3VB2 A;  1JHF A;  5FRM A;  3BC8 A;  4RGX A;  2FRH A;  2BXZ A;  5JHF A;  2QGU A;  3H3Z A;  3BR2 A;  1TW2 A;  4PJL A;  5CQG A;  1VQM I;  4HZF A;  3LSJ A;  2X9D A;  4ANJ A;  1WI3 A;  4ZC3 A;  2DOE A;  3S2H J;  5LHG A;  4WWC A;  4LLG F;  1E2X A;  2HFH A;  2NOG A;  5E8I A;  5DTD A;  1O57 A;  3RZD J;  1O7F A;  2DMT A;  2DFI A;  1MBH A;  2LLK A;  4BKX A;  4LOC A;  2CV0 A;  3HEF A;  4C2T A;  1V55 H;  4NQW A;  1D5Y A;  3DP7 A;  2OPT A;  2EZL A;  3CDH A;  5DDG A;  1Z9C A;  4CH7 A;  5BMZ A;  3QOD A;  4IVN A;  2H94 A;  3CCR I;  4QPQ A;  2HQN A;  2F4I A;  1IO2 A;  2M30 A;  5M5X J;  3WE2 A;  3ZMU A;  2XAQ A;  4A3J J;  2Q1Z B;  2J5P A;  4BS9 A;  3GEZ A;  3SQN A;  1HDP A;  4E7L A;  4BUP A;  3HB9 A;  4B47 A;  3SXY A;  2ZME A;  4GRI A;  4PJN A;  1J09 A;  2KP6 A;  1XGM A;  3CZ6 A;  2H1L A;  1NHA A;  2WY8 Q;  2M45 A;  5GPC A;  1DU6 A;  3LAJ A;  1IXR C;  3FXU A;  1B9N A;  1Z3Y A;  5K5O A;  4P5O A;  1H0M A;  1ZQ3 P;  3H9J A;  1BW5 A;  4XM3 A;  3TOB A;  3E1S A;  4GXO A;  4A3D J;  3CF5 F;  1TQI A;  3H5N A;  4NHJ A;  4N9H A;  2LG4 A;  4R8H A;  4BQA A;  3F3X A;  5K5R A;  2HPI A;  5JI6 A;  4QPO A;  4F3Q A;  2XAF A;  3O2P E;  2DJN A;  3OIQ A;  1YQA A;  3CDL A;  1FBS A;  2EZH A;  2M9H A;  3WOD F;  1VQP I;  1PYV A;  3LQR A;  2F48 A;  3PQK A;  1LQ1 A;  1OQY A;  3DF8 A;  5JR3 A;  3L9F A;  4DBQ A;  3M8E A;  1A6Q A;  1MH4 A;  4I0B A;  5JFR A;  1YRN B;  1A36 A;  3GW2 A;  1AU7 A;  3OYF A;  3W6K B;  5H6Q A;  1HF0 A;  5HLI A;  3NWT A;  5GPA A;  2R5Y A;  3QYB A;  4I01 A;  1MJ9 A;  2L54 A;  4RGR A;  4AM3 A;  5LHH A;  2QQA A;  4R79 A;  3PFI A;  3E6B A;  2M4K A;  5DYM A;  1T33 A;  2EK5 A;  1RKT A;  2P81 A;  3KZY A;  5EEH A;  5D8K B;  3A0B C;  1O3S A;  2VKE A;  3CCQ I;  1SFK A;  1DU0 A;  1X1P A;  2ZO4 A;  4M3E A;  2ZNY A;  4MIM A;  1ZG1 A;  3M8J A;  4A3I J;  3V4G A;  1UHW A;  5KAF C;  4EM2 A;  3Q9V A;  5D5W B;  1JHH A;  3F23 A;  4E7H A;  4A3M J;  5D8L B;  4FTH A;  1Z77 A;  2FXA A;  3GFJ A;  1XCB A;  4ETS A;  4FX4 A;  1U0J A;  4PSW A;  2OA4 A;  3FK7 A;  4CCJ A;  5EDN A;  5L3D A;  2HOS A;  3DU6 A;  4KFC A;  1ETY A;  4LGW A;  2MW8 A;  4F91 B;  4ESB A;  4LB6 B;  4PGH A;  3OSG A;  3V7C A;  4ON0 A;  2YS9 A;  3HUG A;  2W1O A;  3QU6 A;  2A05 A;  1DP3 A;  5F08 A;  2FX0 A;  1TW3 A;  3LNQ A;  3JRI A;  3F8C A;  1K7A A;  2K4J A;  3K70 D;  1LE8 A;  4A6E A;  2DT7 B;  2GA2 A;  2W85 A;  4EQQ A;  3RCO A;  2MC4 A;  2KIM A;  3CUQ B;  2X0L A;  2OUM A;  5J3L A;  1P7I A;  2VQC A;  2XAJ A;  3G4S I;  2K40 A;  4P9U A;  5E17 F;  2MFZ A;  4FIS A;  3C2B A;  1YW7 A;  3DXJ F;  4IO9 F;  1ZAR A;  4NDL A;  3RYP A;  4CXF A;  3CC7 I;  2L4M A;  3W6J B;  4XSZ F;  3BR1 A;  2FMY A;  2DQR A;  2DA2 A;  4ZZL A;  5F0H A;  4DNC A;  2BY1 A;  5J4Y A;  2VL8 A;  4OIN F;  4EVI A;  2E1N A;  3SJM A;  3GTP J;  2GZW A;  2JA6 J;  4CCL A;  3OYA A;  3RKQ A;  2VON A;  2EIM H;  1KA8 A;  2DPU A;  2Q2E B;  1MZB A;  2NVQ J;  2FUG 2;  1F1Z A;  3JRA A;  1U9O A;  2RN7 A;  3ZMZ A;  4HNT A;  3B02 A;  5FLV A;  3GUD A;  3OYB A;  4I7H A;  3ISP A;  4N4N B;  4HX7 A;  2VKH A;  3M3Y J;  2OTL I;  2LDU A;  3OR2 C;  4IX7 A;  3HGY A;  2R3S A;  3B73 A;  4G94 A;  1L3L A;  3BWG A;  1MBF A;  3QOP A;  3QQA A;  4A3E J;  1V4R A;  3ESW B;  3HRU A;  1RUN A;  3HSR A;  5IY5 H;  2DCE A;  3HTU A;  2QQ9 A;  2OAZ A;  1R9T J;  3SFZ A;  2O03 A;  5IP9 J;  1UMQ A;  1QA6 A;  1FOK A;  4DJA A;  4B3X A;  4KIG A;  2F4M B;  1E17 A;  1QZZ A;  2LYC A;  4JK1 X;  5HLH A;  4OMY A;  5J8F A;  1I27 A;  2HXO A;  3CP8 A;  1JJ6 C;  3E5Q A;  1P9Q C;  2NNN A;  2KDZ A;  2LSO A;  3ABT A;  4G6T B;  3FWE A;  1LFU P;  1HW1 A;  1TBX A;  4HLX A;  1CGP A;  2B7E A;  4DYC A;  1YJ9 I;  3D1N I;  4BH9 A;  2A69 F;  3GO5 A;  3KEO A;  1ZTR A;  3IAS 2;  2M34 A;  2XB5 A;  3FXR A;  1QHH D;  1Q1H A;  5IP6 A;  3E3V A;  2XPU A;  4WXD A;  1XS9 A;  1JUS A;  4GYI A;  1IAW A;  2Y9Y A;  3ULQ B;  5J47 A;  5FKO A;  5L3E A;  1WJA A;  1D0X A;  4E7J A;  4P55 A;  2Y75 A;  4M9X A;  4UV9 A;  2DQL A;  1FEX A;  2P5V A;  3KET A;  1ORK A;  1OJL A;  3A01 B;  3DKX A;  3ZOB A;  1ETX A;  4F93 B;  2R7D A;  1HW2 A;  5HNF A;  2CW7 A;  1R1V A;  2IA0 A;  3HTS B;  1ETV A;  3AL0 B;  1MIJ A;  2W7N A;  1ZR2 A;  4M6V A;  1KGS A;  3HRS A;  1AKH B;  1KYW A;  3AG1 H;  2EIK H;  5HOD A;  2P5K A;  3RKY A;  2Y30 A;  4ZYH A;  3FBI B;  3L1P A;  1Q1V A;  4KT5 C;  5LGT A;  1NG6 A;  2E7X A;  1SFE A;  3EUK L;  2JWT A;  2YX4 A;  4RGS A;  1YFH A;  1PUF A;  1WWX A;  5LHI A;  3TDU C;  3JSP A;  3I4M J;  2QBY B;  2CFO A;  1IZ1 A;  5D5U B;  1YO5 C;  4E6K G;  3P9C A;  1YS6 A;  1T56 A;  2QSG X;  2YU9 J;  5HLT A;  4OU0 A;  3I5U A;  4XKV A;  2PI0 A;  1A04 A;  3SEQ A;  2VN2 A;  4FX0 A;  1OPC A;  4I99 C;  1XN7 A;  3ASO H;  1P4W A;  3BR6 A;  2TDX A;  3BTI A;  1LKX A;  2LBF B;  1S29 A;  2XGC A;  3JRC A;  3CP2 A;  3ZR8 X;  3IRQ A;  4LG0 A;  2LKX A;  3I4N J;  4XRS G;  3ZQL A;  2IP2 A;  2HI3 A;  1ONV A;  3FF5 A;  3J81 K;  2WB1 A;  3HRM A;  4UVC A;  4XRF A;  1G4D A;  4BXU A;  3K70 C;  4ESF A;  3OYN A;  1B4A A;  5D4S A;  1FIP A;  2O8K A;  4Z6Y A;  1J75 A;  4BXF A;  4RGU A;  5DEQ A;  4ZTF A;  3MKL A;  1F5T A;  1NK3 P;  4Y3O A;  2L5Q A;  3K4C A;  4A69 C;  2IS1 A;  1TC3 C;  1W5C C;  3SZT A;  2KZG A;  4RA2 A;  1W7P A;  5JLW A;  1WH7 A;  4F92 B;  2R5Z B;  4BAC A;  3Q5F A;  2BOL A;  3S3M A;  5H20 A;  4CSW A;  5M3F J;  2HZT A;  1VFC A;  1WGX A;  5HS9 A;  3DPL C;  5M5Y J;  1FBU A;  1IF1 A;  1MBJ A;  1W1W E;  1MH3 A;  2BHZ A;  4AIJ A;  3KLN A;  2XDV A;  1BR1 A;  3OYJ A;  1BIB A;  1CF7 A;  1XDS A;  4FQG A;  2CV2 A;  2HQR A;  3FXQ A;  2K9L A;  3U21 A;  4BEH B;  1YW9 A;  3MMY B;  5LEK A;  4E7I A;  1TWC J;  2P7C B;  2VJI A;  3CJT B;  2J5O A;  1EH6 A;  3KEY A;  3OL3 A;  2W00 A;  2EIJ H;  4AC0 A;  4UUV A;  2R7V A;  3GLX A;  3E7L A;  1LFB A;  3RQ4 A;  1HA8 A;  1RKW A;  1RES A;  4BNC A;  4PUS A;  1MSE C;  1SAU A;  1B8I A;  1Z0X A;  4EJT A;  2DFF A;  1U3E M;  1E3O C;  1XSV A;  2LKP A;  4LK0 F;  2LP0 A;  5CQE A;  1WJ5 A;  4V2F A;  1ZRF A;  2Y9Z A;  3BG6 A;  2QEX I;  2DPD A;  4HX4 A;  4G12 A;  4YEJ A;  3J81 Z;  4XRM A;  2L9S A;  4A93 J;  4C2M J;  3TW6 A;  1WJB A;  3GME A;  2KFD A;  4O5V A;  3KP4 A;  5KK1 A;  5GAG J;  4WCG A;  2K02 A;  5FLX K;  2L9V A;  3OR1 C;  3K4M A;  2CUE A;  4ENM A;  2A5Y B;  3HKZ A;  3LA2 A;  1H89 C;  2E19 A;  4AIH A;  3CCY A;  4Y33 A;  4BE2 A;  1VQ5 I;  2WA0 A;  3HPG A;  3CC2 I;  1IRZ A;  2GXG A;  1Z7U A;  4XMY A;  4Q47 A;  3ZXS A;  1Z1D A;  2DT6 A;  2EFO A;  3V7R A;  4CUG A;  1X19 A;  4RAZ A;  2R7W A;  3FKI J;  1YJW I;  1ERD A;  3HRT A;  4EJU A;  3LSP A;  2RVC A;  5HS8 A;  1FSH A;  3ECH A;  4Z2Y A;  2WAQ A;  1ODD A;  4DBR A;  2Y48 A;  1HSJ A;  1O4X A;  1KU3 A;  1MJA A;  3E5X A;  2DFH A;  3PQJ A;  2HYJ A;  4A5M A;  4XNF A;  4QLC U;  1L0O C;  2HYF A;  1JTY A;  3MQ0 A;  3VYT B;  1VZ0 A;  2X48 A;  2WV0 A;  2RRE A;  2ID6 A;  1XGS A;  2VQL A;  3HM5 A;  5ICG A;  3K4J A;  1A31 A;  3ZGK A;  2Z99 A;  3LL7 A;  1WJC A;  2AQF A;  1D3Y A;  2KKO A;  4BBR J;  4U87 A;  4CYC B;  4IRG A;  1ETQ A;  3BPV A;  1ETO A;  4WX9 A;  1K83 J;  2LVS A;  3ROU A;  3PNY A;  4HEA 2;  4WK8 F;  1Y1V J;  1ZH5 A;  2XC7 A;  2PLY A;  2XSJ C;  2A6T A;  4QIW N;  2V1X A;  2E5Z A;  5FLX Z;  2HS5 A;  4XON A;  2XRN A;  1FY7 A;  4B1R A;  1MDM A;  4MFD A;  3R4K A;  2H27 A;  3BP8 A;  3KZZ A;  3TL4 X;  2H8R A;  2RNG A;  1JE8 A;  3GTQ J;  4MO7 A;  2V9K A;  1IN8 A;  2M1B A;  2HOA A;  2RQP A;  3GFM A;  1H88 C;  3WHB A;  3F22 A;  2E60 A;  2EFQ A;  3GF2 A;  4XIC A;  1BJA A;  1LNW A;  1FX7 A;  1R5G A;  3BCB A;  2DA3 A;  4BAY A;  3CO6 C;  5HOO A;  3TP3 A;  1RRJ A;  5FO5 A;  2HU9 A;  3ZMT A;  3RTR A;  5CVU A;  4UXN A;  1BIA A;  2IXS A;  2LY2 A;  2WAE A;  5FRN A;  2Y0S A;  1A6I A;  3L2C A;  4J19 A;  2XF5 A;  3QPS A;  3TED A;  5J1R A;  2X1D A;  3I64 A;  3GXO A;  3W2A A;  2FQ3 A;  3H92 A;  3M1E A;  3BZK A;  2ZNZ A;  1B72 A;  4FE4 A;  1U5T C;  3KP2 A;  1BI3 A;  1G3Y A;  2DBB A;  2FEZ A;  4AU7 A;  4O3M A;  2X6W A;  3PM1 A;  4KN4 X;  3BQY A;  3EYI A;  3VOE A;  3ZPL A;  1JKP C;  3L2V A;  2DJI A;  4I0A A;  3ZQH A;  3I56 I;  2V79 A;  5E1X A;  1VQ9 I;  2NVY J;  2Z3Y A;  2QKL B;  3U9G A;  2VOO A;  3G71 I;  3WTT C;  3W6V A;  2BXY A;  1OYI A;  1R23 A;  3OYC A;  1XG1 A;  2DFE A;  2F5V A;  3HPH A;  3K1N A;  2HPM A;  2IS4 A;  4PFP A;  2A6E F;  2BY3 A;  3JR9 A;  1PUE E;  2W25 A;  4M3F A;  4MEX F;  4D0P A;  3ZP5 A;  3NWS A;  3JCU C;  4KIC A;  2OTJ I;  2JA5 J;  1JKO C;  2LRD A;  2V9P A;  3DWL E;  3PFY A;  1RET A;  1UHS A;  1XMA A;  1W0U A;  6PAX A;  2CG4 A;  3FKJ A;  5CJ9 A;  1R49 A;  3D5S C;  2HKO A;  3BTJ A;  3VWB A;  3VOD A;  2F5D A;  1R00 A;  2V1N A;  3GTG J;  2ZXH A;  3F8F A;  2IGK A;  1FBQ A;  2XV4 S;  4YIF A;  1JGG A;  1U5T A;  3I53 A;  1JT6 A;  5L3F A;  4HDV A;  3TO6 A;  2JQ7 A;  4P1W A;  2GIV A;  4EMS A;  1MMS A;  1PP7 U;  2NNY A;  4YRV A;  5BOX A;  4Q5S F;  1D8K A;  2JMW A;  4A6D A;  3FM3 A;  2ZFW A;  1T6S A;  1D0Y A;  2H1K A;  5DUI A;  4ZDL A;  2LY1 A;  1W36 C;  4KNY A;  3GFI A;  2GWR A;  1FOW A;  4X6A J;  2M87 A;  1M1E B;  2L0K A;  2PX9 A;  2CUZ A;  4BE1 A;  3DLL F;  2BZT A;  2O5R A;  1F9N A;  5EG0 B;  4MQ9 F;  5AIQ A;  1D5V A;  4BBS J;  2BY2 A;  1DQU A;  3WTU C;  2PJR A;  4M9S A;  1HC8 A;  3WTX C;  3W2W A;  1UJ8 A;  4IHS A;  2JA8 J;  3J7A Y;  4V2G A;  3E6D A;  2BW3 A;  1ZYR F;  4PCQ A;  3TOA A;  3OYL A;  4HW0 A;  2JRT A;  5ILU A;  1G3S A;  4KT6 A;  5BPI A;  3F8M A;  3HSF A;  3CD6 I;  3CTA A;  1UFM A;  1REP C;  2CU7 A;  3H9G A;  3P7N A;  3HG9 A;  1J5Y A;  1MD0 A;  3ZQI A;  4XLE A;  4AVP A;  1DP7 P;  4D5F A;  2A6H F;  4ZH4 F;  1FNN A;  3CMY A;  2PG4 A;  1OR7 A;  5ERI A;  3UR3 C;  2EFN A;  3FIW A;  4HYE A;  4KN7 X;  4CZC A;  4F7Z A;  3OL4 A;  2VPL A;  2AHQ A;  2LY9 A;  4RLF A;  1KU7 A;  2WTE A;  3C2G A;  3KCC A;  3MFK A;  5J1Y A;  3ABK H;  2ESH A;  2K5C A;  2RC4 A;  1YX3 A;  1QO0 D;  5DD4 A;  1VI0 A;  2DTZ A;  4BDY A;  1JKQ C;  3BTC A;  5FB2 A;  1EF4 A;  4ZJZ A;  3ML6 A;  4NQW B;  1LDD A;  2L9N A;  3L00 A;  4ZYA A;  3ZQ7 A;  4II2 A;  2O8X A;  4GCV A;  2GQQ A;  3R60 A;  2HQ5 A;  2HZD A;  3VYR B;  3I71 A;  5IPA A;  2OC6 A;  1ZLJ A;  1I6H J;  4JP0 A;  2HTJ A;  3R61 A;  3CME I;  2PEX A;  2ECC A;  4D7M A;  1XGO A;  2MSY A;  4N9I A;  3PIP F;  3QP5 A;  1SC7 A;  1X1A A;  2E2J J;  4UUS A;  1V3F A;  1Z05 A;  2V1U A;  2KPM A;  1XB4 A;  3H3V K;  1ACI A;  4OAY A;  2MG4 A;  4NNJ A;  4Y15 A;  3QPH A;  3LSI A;  2ZME B;  1Y8R B;  2BY0 A;  3A0H C;  5CVV A;  5D6F A;  2K7L A;  1B9M A;  2L7F P;  3AKZ A;  2LFB A;  3CJR B;  1HCR A;  3C7J A;  1OLT A;  5EZG A;  4ENN A;  3DFG A;  4XSX F;  2O7O A;  1OIS A;  5EGO A;  2HVS A;  2ZKZ A;  3E6M A;  1POG A;  2KQR A;  2KRH A;  4XKW A;  2Y31 A;  2P8T A;  1WJF A;  1MBK A;  9ANT A;  1FYL A;  2G0E A;  1ZR4 A;  3BG7 A;  5DD8 A;  4FE7 A;  2Z33 A;  2VBZ A;  1Y0U A;  3BQZ A;  2QUF A;  1X3U A;  1IDZ A;  2JVG A;  1X2M A;  2NVU B;  2XAH A;  3JAM K;  4W1U A;  2FA5 A;  5B1A H;  5CPR B;  1HBX G;  1YRN A;  1LUJ B;  2HWV A;  2X1C A;  1UB9 A;  1BI0 A;  1FZP B;  3CCS I;  1MMN A;  3TDZ C;  2OQR A;  1D1B A;  3C3W A;  1S6L A;  2EA2 A;  2VQG A;  3B6A A;  2KZV A;  3O3K A;  4BHP A;  2Y69 H;  3CUQ C;  2R5Y B;  5KHD A;  2DU9 A;  3WU2 C;  4AYB N;  1Z21 A;  1VQ8 I;  4GDF A;  4FHT A;  1VQ7 I;  3HHG A;  4L9N A;  1RIO H;  2R4G A;  4LFU A;  1APL C;  4LIU A;  1VTN C;  3AG3 H;  1JUM A;  4HV5 A;  5FFZ A;  4A3K J;  1Z67 A;  4LJZ F;  2M5W A;  3QAH A;  1JI8 A;  2PMZ N;  2QSF X;  3MN2 A;  4QWQ A;  2R7R A;  2XRL A;  5GTH C;  2DTR A;  2XPV A;  3VEP A;  2DW4 A;  3TMO A;  1LVA A;  5DCM A;  1IG7 A;  1I1G A;  2KIU A;  1P2F A;  1YYV A;  2LKS A;  4BYY A;  3MZ8 A;  2WY7 Q;  2DOD A;  1VQL I;  2DK8 A;  2E1M B;  2VXD A;  2XKO A;  3KPH A;  3WU1 B;  3FIS A;  4DZP A;  1XDU A;  1KQ0 A;  2XHK A;  3KE2 A;  3CDI A;  2IS6 A;  1O7L A;  1GVJ A;  4NC8 A;  3IUO A;  1KU9 A;  3HUG B;  1TWA J;  3HYI A;  1QBJ A;  1YLF A;  2OU2 A;  2VBX A;  4GO1 A;  2DA5 A;  1E3H A;  5FJ8 J;  1GVD A;  4IOC F;  2OZ6 A;  2RDP A;  3QP6 A;  4PDK A;  3GZN B;  4O6J A;  4A5N A;  3HL2 A;  1VND A;  5E8G A;  4HQM A;  3GYH X;  3HOW J;  3JAM Z;  1YS7 A;  4V19 K;  1WH5 A;  1R71 A;  3O8G A;  4LG3 A;  1MW7 A;  3OS1 A;  2DXI A;  3R0J A;  4AVZ A;  3DQV C;  1R5I D;  2P0W A;  1D1A A;  2DDB A;  4U0W A;  1USS A;  4LD5 A;  3X2Q H;  2L9R A;  2LNB A;  2OZU A;  3T8T A;  2CWE A;  3S93 A;  2GOM A;  2ADU A;  2JT1 A;  5DM6 F;  1RPW A;  3CES A;  3GX4 X;  1BL0 A;  4A12 A;  1PDN C;  3MZY A;  1R7J A;  4A3F J;  1OCZ H;  5D5V B;  3RSN A;  2AS5 F;  4HG2 A;  5LGU A;  3K2Z A;  1Y1W J;  3HZJ A;  2JPC A;  3SDB A;  4XKB A;  1TNS A;  2VAS A;  2KLO A;  2RV8 A;  2ZJP F;  1ZGA A;  3CCL I;  1ON1 A;  2ELJ A;  4IQ4 A;  2LRE A;  2LH9 A;  3JRB A;  1BOA A;  1EH7 A;  2FML A;  3P5J A;  1ZKG A;  3I54 A;  3BPX A;  2CQX A;  2FOW A;  3OOP A;  1IXS B;  1U8B A;  2QSH X;  3JSO A;  4MEY F;  3CO7 C;  1YE9 A;  5C44 J;  1FP1 D;  3VPR A;  4JOM A;  3PUB A;  1QZY A;  5E79 C;  2VJ5 A;  3ERE D;  3H3U A;  1ZN2 A;  2CSO A;  1DGW Y;  3EUH C;  3HOY J;  3L2U A;  3O6B B;  3AL0 C;  1X58 A;  2XAU A;  1IUY A;  5GAH J;  2Y0M A;  5DS9 A;  1YW8 A;  4OAZ A;  3S32 A;  5CVJ A;  1S3J A;  1LPQ A;  1ZHF A;  2DA6 A;  3HC7 A;  4RMN A;  3D0S A;  3OYE A;  4NBQ A;  5HDG A;  2O6G E;  5K7Z A;  1YIT I;  1GV5 A;  4CIC A;  5ICC A;  3GFL A;  4IPA A;  2WWY A;  2NAZ A;  1N77 A;  2EQR A;  3FDY A;  4A2U A;  4BY1 J;  2IVM A;  4HOB A;  3W2V A;  1P92 A;  2EFW A;  1EH8 A;  1MMD A;  4CCO A;  5J40 A;  3M8F A;  4MTE A;  3DEW A;  3ZRG A;  2NS8 A;  1UEL B;  3G1O A;  3BDD A;  4HLY A;  2VI6 A;  3HOU J;  1FTZ A;  3DTK A;  1R22 A;  1TQM A;  2L3D A;  3M1C A;  2JTV A;  5KAI C;  3V7S A;  3OYG A;  3SHF A;  4KIB A;  2VC0 A;  2K9N A;  4WF2 A;  2FJ1 A;  2DA7 A;  3HDD A;  1F36 A;  3SDG A;  4B3A A;  2FD5 A;  4M3B A;  3Q0V A;  2VT2 A;  3REO A;  3EUH A;  1IUF A;  2KDO A;  3I0T A;  4RB1 A;  1K61 A;  2QEN A;  3K4K A;  4IHY A;  1ZG3 A;  1J59 A;  4U0V A;  1QHG A;  2XB0 X;  4D1Q A;  2P6S A;  4NUB A;  3FMS A;  3MZH A;  1NK2 P;  5BPD A;  3QRF F;  2ZJ2 A;  2BHY A;  1K4T A;  2R0Q C;  3V8J A;  4XQF A;  3IL2 A;  4K2E A;  1HKS A;  1SMT A;  2X85 A;  5FFX A;  1RUO A;  3UNG C;  2D1V A;  2QZ8 A;  5FGM A;  1WKM A;  4DGW B;  2K3F A;  3S16 J;  2GAU A;  4UVB A;  5HS7 A;  2BV6 A;  2KT0 A;  1EA3 A;  2VB6 A;  4E7Z A;  2LC2 A;  4M9Z A;  2HDD A;  5F6F A;  4J01 A;  4I02 A;  2CRG A;  1P7J A;  1S7E A;  4KMF A;  2L7M P;  1H9G A;  4PFO A;  3WGG A;  4AIK A;  1Z6R A;  3RKX A;  1T95 A;  5F27 A;  1QVT A;  4EGZ A;  1MBE A;  4HSR A;  5C4J J;  1EJ9 A;  2JPB A;  1BR2 A;  2NOJ B;  3ABU A;  2FU4 A;  2I10 A;  3PL8 A;  4HBL A;  2UWM A;  4RAG A;  1UG2 A;  1YTY A;  4CO8 A;  5A2Q K;  3CJN A;  5HDN A;  1KU2 A;  1S7A A;  4LG0 B;  5LFA A;  2O61 A;  4NB5 A;  4LIV A;  3I59 B;  4A3B J;  2EIN H;  3FM5 A;  4IZZ A;  3KLO A;  1LFP A;  3RPU D;  1WHU A;  3LSM A;  3D5L A;  2E36 A;  2CQN A;  4IHT A;  2X6Y A;  2W84 A;  2X6O A;  4D9J A;  5LRS A;  1QGP A;  5K7F A;  2ZFU A;  5IOZ A;  2R5Z A;  1VQ4 I;  1W7P B;  1T8I A;  1GHC A;  4XBF A;  3U1K A;  1VQN I;  4A3G J;  3DKY A;  4II3 A;  3T5X A;  4DZJ A;  1XSX A;  3PJR A;  5ICF A;  3V8L A;  4KDP A;  5JVG F;  1GT0 C;  1V54 H;  1QPI A;  3FXJ A;  2ZXW H;  1CF7 B;  3WTV C;  1C0W A;  2KRC A;  4IEJ A;  3F21 A;  2BVM A;  2RGV A;  2JSP A;  5IYD J;  3RQI A;  2EV0 A;  1UAA A;  3TO7 A;  4M74 A;  1NG7 A;  1LJ9 A;  3NAR A;  2LF7 A;  2RKH A;  3ERM A;  3SZG A;  2ICW G;  4M6X A;  4G7H F;  3CUO A;  2W82 A;  2YX7 A;  4L5I A;  2ISY A;  3CMM A;  2HXI A;  4EAT A;  3M07 A;  1K6O A;  2XF6 A;  2EB7 A;  1X4O A;  2EPF A;  2MH9 A;  5B5E C;  5E20 A;  2XF7 A;  1HQC A;  4Y7N J;  2OQG A;  1B8I B;  3CCM I;  4CGZ A;  3ZQF A;  4I76 A;  3MKW B;  2AXT C;  4BHB A;  4ENK A;  1R1U A;  4MLO A;  5E18 F;  2FE3 A;  3BCA A;  4E7K A;  3E5U A;  1X3W B;  3IAM 2;  2ME6 A;  3DCF A;  1IRF A;  4LIT A;  3U2R A;  5GAD J;  2VQH A;  1W5T A;  1SFO J;  1TWF J;  2D5V A;  4YIR X;  2CFX A;  3JRF A;  1TT0 A;  1BC8 C;  3QYF A;  1IRX A;  3SEZ A;  3EDP A;  2BYV E;  3DBL B;  3KYC B;  3V8K A;  2VXZ A;  3S1N J;  2V9V A;  4ASN A;  4Y13 A;  2F2E A;  3DPT A;  4E7S A;  2VOP A;  2A3S A;  1IN6 A;  1BBY A;  4C3I J;  1OCO H;  2DA4 A;  1F4K A;  3KYL A;  4L9V A;  2G9W A;  2WBM A;  2CMP A;  3S14 J;  2CS3 A;  3F8N A;  1U8R A;  2E1C A;  3M7G A;  1SEU A;  2MLK A;  1CQT A;  2KIF A;  1MMA A;  2EJR A;  1S8N A;  2IAI A;  3BLY A;  3IKV A;  3Q0W A;  3OIP A;  3KP3 A;  2EZK A;  2IS2 A;  4ZZD A;  3K1P A;  4AD9 A;  3G73 A;  1O3R A;  3RI4 A;  3IHU A;  2M0M A;  4HF0 A;  1GLN A;  1SD6 A;  4TV7 A;  3Q0U A;  1FPQ A;  4D7N A;  4YFK F;  1W0T A;  2Q0O A;  1I50 J;  2BE5 F;  5BS6 A;  1P4A A;  2ESN A;  1JT0 A;  4QSH A;  4PJJ A;  2D1H A;  5IT9 K;  2MAB A;  4HV6 A;  4ABZ A;  3BY6 A;  1SMY F;  1VF9 A;  5GTI C;  4IQJ A;  1W4M A;  3SYT A;  1UHM A;  3CCU I;  4FT8 A;  2LF8 A;  4CYC A;  1R36 A;  1WZ2 A;  4EJW A;  1P6R A;  3IC7 A;  3K6G A;  3LMM A;  3ZMD A;  4J00 A;  3WE3 A;  3P9K A;  4RAF A;  3OOU A;  2MLG A;  2ZJR F;  3NRV A;  3BJ6 A;  1MDM B;  5BNG A;  3CJQ B;  2GLO A;  1YOV B;  2K86 A;  3A2K A;  2HGC A;  2L2O A;  1XX5 A;  2EA4 A;  4XN3 A;  3ZN0 A;  1YJN I;  2DK5 A;  3CCV I;  1STZ A;  3PO3 J;  2ECB A;  2K9M A;  5IP7 J;  1WJD A;  1WQ2 A;  1OFC X;  2QWW A;  1OYY A;  1BW6 A;  2B0L A;  4BJT A;  2CW8 A;  1ETW A;  1WJE A;  1E0E A;  1QU3 A;  3TP0 A;  2PMH A;  1RR7 A;  1MND A;  1XMX A;  5CVR A;  5GP9 A;  2W4S A;  1QNT A;  3GTK J;  4YG2 F;  2JN6 A;  3BR3 A;  4RDU A;  4HST A;  5JHU A;  2FBI A;  2JZY A;  2OJE D;  1G3W A;  2DO7 A;  3K4B A;  2FBK A;  1ZRE A;  1ITY A;  1RR8 C;  3MD2 A;  5IT9 Z;  2M4G A;  2LK2 A;  1I3Q J;  2DMQ A;  4XR6 A;  2COM A;  1B72 B;  2LD5 A;  4RB3 C;  4WXC A;  2JUG A;  3B6C A;  4S04 A;  3E97 A;  1XPX A;  1SD7 A;  3K2A A;  2DMN A;  3QOE A;  2V1D A;  5FKK A;  2R92 J;  2HEO A;  4B48 A;  2UZK A;  5J1U A;  3K10 A;  3ZMV A;  3F9K A;  2L4A A;  3P9I A;  3HJE A;  3H0D A;  2BVL A;  3BJA A;  2R7T A;  2VPR A;  1DDN A;  1R58 A;  2EZI A;  3CLQ A;  2FNA A;  2GXA A;  5D6E A;  4B43 A;  3LST A;  2GXB A;  3HKZ N;  3KYD B;  4BQN A;  5HVQ C;  2ELH A;  2VE8 A;  3FHZ A;  1K78 A;  4MNU A;  1T2K A;  1X1D A;  3PSI A;  3WTW C;  5E1Z B;  2G7U A;  1A5J A;  2PJP A;  4U7D A;  5E3N A;  1MMG A;  2TCT A;  1V5F A;  1I6X A;  2EWN A;  1O3Q A;  5D5X B;  2NVT J;  1AOY A;  3FXK A;  3I3L A;  5EF6 A;  3TKY A;  3CMA I;  2CUF A;  2P6T A;  3RZO J;  4UB8 C;  1QZE A;  3N97 A;  2ELK A;  4KMU X;  2WAQ N;  1AHD P;  1U5T B;  3WTS C;  2E35 A;  3DPU A;  3K9T A;  2L7Z A;  3DEU A;  3DLA A;  2UUZ A;  1PJR A;  4EJO A;  4UUT A;  4A3C J;  4E70 A;  1VQK I;  2XSD C;  2EV6 A;  1V5E A;  3I4P A;  3VFZ A;  3S3N A;  2E2I J;  4XK4 A;  2JJ7 A;  4M72 A;  4EGY A;  2XGX A;  5D4R A;  5KCM A;  4KA4 A;  3F0C A;  2MD0 A;  3WGH A;  1WFX A;  2NYX A;  4KJZ A;  3HSE A;  1LDK B;  1U6G A;  2DT5 A;  3HBL A;  4R1H A;  2LR8 A;  5DV5 A;  2KMU A;  4UHT A;  2W57 A;  4P96 A;  1IN7 A;  5FKN A;  5F1R A;  2PJR B;  2DYS H;  2NS7 A;  1QPM A;  1DPU A;  4DW6 A;  3G2B A;  1R5H A;  4RBO A;  1OKR A;  2M8G X;  3K4N A;  1I39 A;  5H6R A;  4L9J A;  4BY7 J;  2IGO A;  3IWZ A;  3S1Q J;  4DIQ A;  3OYD A;  4C3H J;  4BJ6 C;  2HQA A;  3S1M J;  1NH3 A;  4G7Z F;  4YII A;  3EUA A;  5B1B H;  1U78 A;  3JRH A;  4IL6 C;  1SD5 A;  1HST A;  1BN5 A;  2ZME C;  2D45 A;  1A35 A;  5C3E J;  2DYR H;  2VE9 A;  3EPZ A;  3K69 A;  3LQQ A;  5C4X J;  3C18 A;  5CLS A;  2O0Y A;  1ZLK A;  2Y0S N;  3KP6 A;  1MBG A;  4RB0 A;  1EV7 A;  2DLL A;  2F4O B;  1ZEL A;  4BQO A;  2VOD A;  2WC2 A;  1TTY A;  2Z16 A;  3L09 A;  3H9Q A;  1FOY A;  1YHQ I;  4UNO A;  1IRG A;  3DTE A;  2H6B A;  2XIG A;  1QVU A;  3BJO A;  1X3Z B;  4OWR B;  2M2E A;  2NXN B;  4Q4Z F;  3M4O J;  5J6X A;  2L01 A;  4RM2 A;  3CQZ J;  2PN6 A;  3ASN H;  4PGG A;  1B6A A;  4QTR A;  2YPR A;  3ABL H;  1WSU A;  4JBA A;  1NTC A;  5LEJ A;  2K85 A;  2HVR A;  5LBQ A;  1YI2 I;  2ZB9 A;  2DMP A;  1JTX A;  1H9T A;  3TGN A;  4ZDP A;  1V5G A;  2JUC A;  5EZH A;  3TW7 A;  3VYU B;  3F6O A;  4D5C A;  2ZBK A;  1J7K A;  5B66 C;  4IF4 A;  1X2N A;  2CQQ A;  2V26 A;  2H8W A;  3U1D A;  3GTJ J;  2YSR A;  3H35 A;  3FXM A;  3DV8 A;  3K1M A;  3QPL A;  3IKT A;  4FAS D;  1J9I A;  4G6D A;  3AAF A;  3A4C A;  1WPK A;  4M3G A;  1GUU A;  5FLM J;  2LTP A;  4C30 A;  2IRF G;  3GTO J;  1B1B A;  3LOC A;  4KIS A;  2HOE A;  4UUS B;  3AG2 H;  4IOA F;  3CLO A;  4H4K C;  1TP4 A;  3A03 A;  1ZAO A;  2RNJ A;  4XN0 A;  1KQ9 A;  4X1E A;  1FJL A;  1OCC H;  1HOM A;  5M5W J;  1XMK A;  2QQ8 A;  4HX8 A;  2CH0 A;  1LB2 A;  3JTH A;  4BGD A;  3LA7 A;  3FXO A;  3K7A J;  4OIQ F;  3ELK A;  1XCV A;  4KYW A;  2E71 A;  3WTZ A;  2IBD A;  3C2H A;  4CHU A;  5E1W A;  2IGM A;  4L9T A;  5EGO B;  5BQT A;  4HQE A;  4I09 A;  2TRT A;  4N4O B;  2E1M C;  2IW5 A;  2QKM B;  2V4J C;  3FMR A;  1G8X A;  4CA0 A;  1OCT C;  1ENH A;  4BXX J;  2JSC A;  4BL0 B;  4AWX B;  4YFX F;  4Q48 A;  1KZH A;  3D5R C;  2XPW A;  2KJB A;  3T8R A;  3GWZ A;  4XLC A;  3UKG A;  3Q9S A;  1SFU A;  3RYR A;  4XKC A;  3G3Z A;  3OS0 A;  1R4N B;  5LRR A;  2E7W A;  4P9F A;  3BT9 A;  4L5E A;  3ZQC A;  4CCM A;  3G6E I;  2YU3 A;  4AID A;  1T08 B;  4F55 A;  2EV5 A;  2GOX B;  4OOI A;  1W7P D;  2ZJQ F;  2ETH A;  3A02 A;  1PVE A;  2PMU A;  3FXL A;  4IXA A;  4L0Z B;  3MKZ A;  3WG7 H;  3PIO F;  3GZ5 A;  1TT5 B;  3KEQ A;  2HKX A;  2KIQ A;  1DGR M;  2MD5 A;  1R6R A;  3J80 K;  4GGG A;  2X1E A;  3ZN1 A;  4ENJ A;  4XRS A;  2QYO A;  2MYS A;  3AG4 H;  4PSX A;  1HXD A;  4YEL A;  3T1B A;  3CCJ I;  5DCM B;  2HDC A;  4GYG A;  2ZXI A;  2CO5 A;  2GA1 A;  2Z1D A;  5CYV A;  1Y6I A;  4HRI A;  1Y56 A;  2MC3 A;  3VSL A;  1ZRC A;  1LE8 B;  2VC1 A;  1JUP A;  4B4C A;  3OV8 A;  2ME0 A;  1I5Z A;  3CUQ A;  4HF2 A;  1XTA A;  3MWM A;  2N8G A;  1S7O A;  4BQQ A;  4BHC A;  1DUX C;  4RAY A;  3OS2 A;  4IHX A;  1FT9 A;  3NAU A;  2CGP A;  1MNM C;  3JTG A;  1QQI A;  4XOT A;  4IRI A;  2DMU A;  4XLA A;  2MH2 A;  3W3C A;  4G6Q A;  2C6Y A;  1Z7L A;  4C3J J;  2DAO A;  4M73 A;  1GDT A;  2EIL H;  2DI3 A;  2X51 A;  4JQF A;  3R6S A;  3J7Z I;  3DU5 A;  1OMI A;  1SVM A;  2MA3 A;  1T0F C;  2OCC H;  3TO9 A;  5ED4 A;  4U88 A;  4DQ2 A;  2HVQ A;  1X1C A;  2Y2Z A;  1Z3X A;  1J0R A;  2Q2E A;  2FQ4 A;  5DCF A;  4L0Y B;  2IGN A;  4AUX A;  2R93 J;  3PNT A;  4BU2 A;  3T0Y A;  1IDY A;  2QA4 I;  3BG3 A;  3GZ6 A;  3J80 Z;  3GTM J;  4IKF A;  1O3T A;  1OCP A;  4CCK A;  3N05 A;  4BE0 A;  1RZ4 A;  5F04 A;  2E2H J;  1TWH J;  2YR2 A;  2Z5U A;  3PNV A;  1KQ8 A;  1ZGJ A;  2PFB A;  1ULY A;  2VBW A;  4EJV A;  4EM0 B;  2VIX A;  1TQP A;  2M3A A;  4LK1 F;  5CKT A;  3S17 J;  4EEF G;  2H6C A;  2K27 A;  3JRG A;  4ITV A;  3HOZ J;  1R4M B;  2DN0 A;  3BG5 A;  1HW5 A;  1T38 A;  3EYY A;  1MGT A;  4E4H A;  5FD6 A;  4BDZ A;  2R7O A;  3FK6 A;  4Y17 A;  4I6Z A;  3K0L A;  1S5L C;  4FET A;  3PO2 J;  4A0X A;  4EM1 A;  3ONQ A;  1P4X A;  4NC7 A;  3I9V 2;  1PP8 F;  3COA C;  1TNT A;  2P4W A;  3HOS A;  4ESJ A;  1T0F A;  1W5S A;  3BOQ A;  1IN4 A;  4I2O A;  5H2F C;  3H36 A;  2R7U A;  2O9L A;  3KIO A;  1BJZ A;  1FMV A;  3BZC A;  4MQV A;  2FOK A;  3DEE A;  4PJ0 C;  5AON A;  2A68 F;  2NVX J;  5F0F A;  1MNE A;  2DOF A;  3WU0 A;  4H0E A;  1VQ6 I;  3IH2 A;  1SAN A;  1S72 I;  4WXH A;  3MEX A;  1SAX A;  3KX2 A;  1OCR H;  2EFP A;  2HNH A;  2XVC A;  4IHV A;  2V7F A;  1SVL A;  3F6V A;  1UG0 A;  4HPQ A;  2VT3 A;  4A0Z A;  1GV2 A;  3C1D A;  4ZDO A;  2R7Q A;  2W24 A;  2I8D A;  3A01 A;  4OIR F;  2VJ4 A;  2ZSI B;  3QU3 A;  4HNU A;  3H5R A;  4C9Y A;  2A5W A;  4C2U A;  3WGI A;  1SD4 A;  3S2W A;  3WTY C;  3S15 J;  3LSH A;  1ON2 A;  4HA8 A;  2R7Z J;  5E3L A;  5M3M J;  4CCN A;  1AKH A;  3BTL A;  3H1C A;  4G8X A;  2KRF A;  5TIS C;  5ILV A;  4A3L J;  1N25 A;  2DOA A;  2EH3 A;  2QQB A;  1Y0N A;  5CVI A;  3NQO A;  2GBY A;  2HYG D;  3RKW A;  1FYM A;  4RLQ A;  3QPT A;  4FCY A;  1BI1 A;  1RNL A;  2JK3 A;  1PUF B;  2K9Q A;  2CJJ A;  1WRJ A;  2QBY A;  3HXL A;  3LWF A;  2QVO A;  2R7F A;  3HIF A;  1FP2 A;  2Q8K A;  3VSK A;  1K4S A;  2P7V B;  2VJJ A;  4B44 A;  4JX6 A;  3FZV A;  5L3B A;  4XID A;  3ABM H;  2XAS A;  2YUS A;  2A61 A;  1QRY A;  3MVP A;  2K4B A;  1HKT A;  3IRR A;  1FSE A;  3K4L A;  2WAF A;  2FSW A;  2KIS A;  1K79 A;  2LBF A;  5IYC J;  4NC6 A;  5LD2 C;  2XAG A;  3CC4 I;  4UVA A;  4RB2 C;  5AIP A;  3GLL A;  4F52 A;  3LSK A;  1FYK A;  3WG9 A;  3OYI A;  5ILS A;  1UST A;  3ECO A;  2F6C A;  2KJC A;  4KIF A;  4B8X A;  1IXC A;  3TQN A;  3SZP A;  3FBN B;  5B3S H;  3DKW A;  1MSF C;  2IEK A;  2WV1 A;  3G1M A;  3I59 A;  3I58 A;  2B63 J;  3HHH A;  2ID3 A;  1G59 A;  4JX5 A;  2XGE A;  1VQO I;  4ZTJ A;  1FLI A;  4XOP A;  3BRO A;  4A0Y A;  1H8A C;  1E3P A;  4RM3 A;  1IGN A;  5HNH A;  3JW4 A;  3HOX J;  4ZYE A;  1ZGW A;  2HTS A;  4S0H B;  2GIZ A;  4HDU A;  1ZK8 A;  2CQ7 A;  1I1S A;  4W97 A;  3S3O A;  4BEH A;  1BI2 A;  3G1L A;  3HOV J;  3E6C C;  3GTL J;  4DOZ A;  4OIP F;  5IT3 A;  3OMY A;  1X4P A;  2R7S A;  3CF2 A;  1JKR C;  3HGG A;  5F0C A;  4DYR A;  4MHG A;  3KP5 A;  1UZC A;  4BJ5 C;  3OIO A;  4PZJ A;  4JYK A;  2RAE A;  2JVH A;  4OIO F;  3OYK A;  5DM7 F;  3S1R J;  3BG9 A;  2ISZ A;  4KUM A;  1FOX A;  2VLA A;  2NS0 A;  5L3C A;  2STW A;  3RPQ A;  2GM4 A;  4ZYD A;  2IA1 A;  2WAD A;  2XKP A;  5A2Q Z;  3OYM A;  2COB A;  2A07 F;  2DA1 A;  2ZC2 A;  3F72 A;  3O8H A;  5JLX A;  2G7H A;  2VUM J;  3R0A A;  4S05 A;  1LEB A;  5FD5 A;  2VBY A;  4IHW A;  4PJM A;  3IH3 A;  2M8E A;  4HAM A;  1YX5 A;  2JRM A;  4I98 B;  4N0B A;  1DPR A;  1IJW C;  3TBI A;  1AWC A;  1N78 A;  2BBY A;  3RIR A;  1X1B A;  1XSD A;  2VKD A;  2O3F A;  4MTD A;  2W48 A;  4XLH A;  3AFH A;  3MAJ A;  4EV0 A;  5K1Y A;  3NEU A;  1D0Z A;  3H0G J;  3PSF A;  1FIA A;  2QM3 A;  2M0C A;  2JA2 A;  1W36 D;  4LLL A;  4UY8 I;  4CYD A;  2XUB A;  5K7H A;  3J7A O;  2IPQ X;  2RQQ A;  1WVR A;  3DTI A;  4JX4 A;  1EKE A;  1S9H A;  1XC5 A;  1N75 A;  1Y8Q B;  2FF4 A;  1XGN A;  2F5E A;  2ZCW A;  5TRD A;  3ZQQ A;  3DBH B;  2I5U A;  3L7W A;  2X4H A;  4Y52 J; 
#chains in the Genus database with same CATH homology
 3MN2 A;  2XRL A;  1AKH B;  2XPV A;  3HBL A;  5HOD A;  2LR8 A;  1IG7 A;  3ZQG A;  2Y30 A;  3L1P A;  1Q1V A;  5FKN A;  1TWG J;  2NS7 A;  2JWT A;  3FIS A;  4DZP A;  1PUF A;  3I4M J;  4DW6 A;  1G2H A;  4RBO A;  2M8G X;  2XGD A;  2WB1 N;  1T56 A;  1TWA J;  2YU9 J;  1WCM J;  5E3O A;  4BY7 J;  3S1Q J;  2DA5 A;  5FJ8 J;  1GVD A;  1BA5 A;  3S2D J;  4C3H J;  1F43 A;  3S1M J;  1VND A;  3BR6 A;  3BTI A;  3HOW J;  2XGC A;  2OF7 A;  3LSR A;  3JRC A;  1U78 A;  3JRH A;  3JRE A;  1WH5 A;  2VKV A;  3O8G A;  2HOT A;  2LKX A;  5C3E J;  3I4N J;  4XRS G;  3ZQL A;  2HI3 A;  5C4X J;  2Y0S N;  1U9N A;  1MBG A;  5E3M A;  2L9R A;  1FIP A;  1IC8 A;  2O8K A;  5F1J A;  3IH4 A;  1RPW A;  1BL0 A;  3MKL A;  1QVU A;  1NK3 P;  5EYR A;  4A69 C;  1TC3 C;  2M2E A;  5JLW A;  2R5Z B;  1WH7 A;  4A3F J;  3M4O J;  5IYB J;  5M3F J;  1VFC A;  3CQZ J;  1WGX A;  4QTR A;  5M5Y J;  1NTC A;  1MBJ A;  1Y1W J;  1MH3 A;  4MFE A;  2ZB9 A;  2DMP A;  1JTX A;  2JA7 J;  1JJ8 C;  5EZH A;  2K9S A;  3TW7 A;  4D5C A;  3GTJ J;  1X2N A;  2CQQ A;  3JRB A;  1ZKG A;  3QPL A;  3BR0 A;  1TWC J;  3WHC A;  2CQX A;  1U8B A;  1ETK A;  1WPK A;  4M3G A;  2MGQ A;  1GUU A;  5FLM J;  2LTP A;  3JRD A;  3GTO J;  1FTT A;  3LOC A;  4DYQ A;  5C44 J;  3VPR A;  4UUS B;  4AC0 A;  3GBG A;  3A03 A;  1IV6 A;  4X1E A;  5IOY A;  1FJL A;  1HOM A;  3E7L A;  1LFB A;  5M5W J;  1RKW A;  3HOY J;  1RES A;  1MSE C;  1B8I A;  1X58 A;  1Z0X A;  3K7A J;  2E1O A;  5DS9 A;  1E3O C;  2LP0 A;  4HNV A;  4V2F A;  2DA6 A;  2IBD A;  2Y9Z A;  5EGO B;  5K7Z A;  4G12 A;  1GV5 A;  4XRM A;  4A93 J;  2AO9 A;  4C2M J;  3TW6 A;  2TRT A;  1OCT C;  1ENH A;  4BXX J;  3BR5 A;  3OSF A;  2CUE A;  2EQR A;  3Q3S A;  1HLV A;  4BY1 J;  1H89 C;  2E19 A;  3CCY A;  1IRZ A;  2XPW A;  4M6V A;  3UKG A;  3DEW A;  2NS8 A;  3G1O A;  4GFB A;  2VI6 A;  3HOU J;  1FTZ A;  3BT9 A;  4L5E A;  3ZQC A;  3FKI J;  2K9N A;  2QF7 A;  2FJ1 A;  2DA7 A;  3HDD A;  3LSP A;  1F36 A;  3SDG A;  4B3A A;  2FD5 A;  4M3B A;  3Q0V A;  4M3D A;  3A02 A;  5FKL A;  2EBI A;  2QCO A;  1IUF A;  1O4X A;  1K61 A;  5EG0 A;  4IHY A;  2HYJ A;  2XB0 X;  1JTY A;  4XRS A;  2X48 A;  2ID6 A;  3HM5 A;  5EEA A;  1NK2 P;  5FKM A;  2R0Q C;  3SFI A;  3LSG A;  3IV5 A;  4BBR J;  1HDD C;  4CYC B;  3S16 J;  1LE8 B;  1JUP A;  2KT0 A;  1ETQ A;  4B4C A;  1ETO A;  2HDD A;  1K83 J;  2LVS A;  2ME0 A;  2CRG A;  1P7J A;  1S7E A;  1Y1V J;  2L7M P;  2N8G A;  4QIW N;  3BR2 A;  5F27 A;  1QVT A;  4B1R A;  4MFD A;  4IHX A;  3NAU A;  1MBE A;  5C4J J;  3LSJ A;  2X9D A;  1MNM C;  1WI3 A;  2H8R A;  2DMU A;  3GTQ J;  4MO7 A;  2HOA A;  2I10 A;  3WHB A;  1H88 C;  4C3J J;  3S2H J;  1UG2 A;  1GDT A;  4XIC A;  2NOG A;  5DTD A;  3RZD J;  2DMT A;  4A3B J;  1MBH A;  2DA3 A;  2LLK A;  4BKX A;  4LOC A;  3TP3 A;  3HEF A;  2X6O A;  2Y2Z A;  1D5Y A;  5K7F A;  1A6I A;  2FQ4 A;  5IOZ A;  2R5Z A;  4AUX A;  2R93 J;  4J19 A;  2OPT A;  2EZL A;  3QPS A;  3TED A;  5J1R A;  1IDY A;  4A3G J;  3BG3 A;  4DZJ A;  3GTM J;  1B72 A;  1OCP A;  4FE4 A;  1GT0 C;  5F04 A;  1QPI A;  2E2H J;  1TWH J;  5M5X J;  3PM1 A;  3BQY A;  4A3J J;  4IEJ A;  1HDP A;  5IYD J;  1JKP C;  3RQI A;  3HB9 A;  3ZQH A;  3S17 J;  4EEF G;  2NVY J;  3JRG A;  3NAR A;  3HOZ J;  3W6V A;  2DN0 A;  5GPC A;  3BG5 A;  1DU6 A;  1XG1 A;  3JR9 A;  2HXI A;  3FK6 A;  4M3F A;  1ZQ3 P;  4I6Z A;  3PO2 J;  4Y7N J;  1BW5 A;  4A3D J;  1B8I B;  3ZQF A;  4I76 A;  2JA5 J;  1JKO C;  4MLO A;  1RET A;  1UHS A;  1W0U A;  2O9L A;  2DJN A;  3CDL A;  2ME6 A;  2M9H A;  2EZH A;  3DCF A;  1BJZ A;  1SFO J;  2D5V A;  1TWF J;  3BTJ A;  3JRF A;  2NVX J;  5F0F A;  3GTG J;  1MH4 A;  3IH2 A;  1SAN A;  1YRN B;  1AU7 A;  1JGG A;  1JT6 A;  1HF0 A;  3S1N J;  5GPA A;  4IHV A;  4Y52 J;  2R5Y A;  4C3I J;  2DA4 A;  1GV2 A;  3A01 A;  2JMW A;  1T33 A;  3S14 J;  1RKT A;  2P81 A;  2H1K A;  1CQT A;  3S15 J;  2IAI A;  2VKE A;  3Q0W A;  2R7Z J;  2EZK A;  5E3L A;  5M3M J;  1DU0 A;  4M3E A;  1AKH A;  4MIM A;  4X6A J;  3BTL A;  4A3I J;  2L0K A;  4A3L J;  3Q0U A;  2EH3 A;  4D7N A;  5EG0 B;  1W0T A;  1I50 J;  4A3M J;  1JT0 A;  4QSH A;  1Z77 A;  4FTH A;  4BBS J;  2GBY A;  5EDN A;  3FK7 A;  2HOS A;  4FCY A;  1PUF B;  2JK3 A;  2JA8 J;  4ABZ A;  1ETY A;  2K9Q A;  2MW8 A;  2CJJ A;  4V2G A;  3OSG A;  1VF9 A;  2YS9 A;  4JX6 A;  5F08 A;  2FX0 A;  4XID A;  4CYC A;  3LNQ A;  2YUS A;  1QRY A;  3MVP A;  3JRI A;  1LE8 A;  5IYC J;  2CU7 A;  3OOU A;  5J3L A;  1P7I A;  3ZQI A;  2K40 A;  4D5F A;  4FIS A;  3CMY A;  5BNG A;  3C2B A;  2GLO A;  4NDL A;  3BR1 A;  3FIW A;  2DA2 A;  5F0H A;  1MSF C;  2AHQ A;  2LY9 A;  3PO3 J;  2ECB A;  2IEK A;  2WV1 A;  3G1M A;  5IP7 J;  5J1Y A;  2B63 J;  2ID3 A;  1OFC X;  4JX5 A;  1JKQ C;  3SJM A;  1VI0 A;  2DTZ A;  1BW6 A;  2XGE A;  3GTP J;  2JA6 J;  1ETW A;  3BTC A;  1EF4 A;  3TP0 A;  3RKQ A;  1H8A C;  1RR7 A;  5GP9 A;  1IGN A;  3HOX J;  3GTK J;  2JN6 A;  3BR3 A;  4RDU A;  1ZGW A;  4S0H B;  2NVQ J;  3JRA A;  1ZK8 A;  1U9O A;  2HQ5 A;  4W97 A;  1ITY A;  5IPA A;  5FLV A;  3G1L A;  2LK2 A;  1I3Q J;  2DMQ A;  1B72 B;  3HOV J;  1I6H J;  3GTL J;  4JP0 A;  2LD5 A;  2ECC A;  4D7M A;  3M3Y J;  2MSY A;  3B6C A;  3K2A A;  2E2J J;  2DMN A;  4UUS A;  3HGY A;  5FKK A;  3H3V K;  1MBF A;  1JKR C;  3HGG A;  3QQA A;  5F0C A;  2MG4 A;  4DYR A;  4A3E J;  2R92 J;  5J1U A;  1R9T J;  5IP9 J;  3OIO A;  4JYK A;  2RAE A;  1UMQ A;  2L7F P;  3S1R J;  2LFB A;  3BG9 A;  2VPR A;  2HXO A;  1HCR A;  2GM4 A;  2EZI A;  5EZG A;  2COB A;  2DA1 A;  5JLX A;  1JJ6 C;  2O7O A;  3O8H A;  5EGO A;  3HKZ N;  1POG A;  2VUM J;  2KDZ A;  1LFU P;  2Y31 A;  1A5J A;  1MBK A;  4DYC A;  9ANT A;  5E3N A;  4IHW A;  3D1N I;  2G0E A;  1ZR4 A;  2TCT A;  3IH3 A;  4FE7 A;  1IJW C;  3BQZ A;  1IDZ A;  1ZTR A;  2NVT J;  1X2M A;  4W1U A;  5EF6 A;  3RZO J;  2CUF A;  2M34 A;  2XB5 A;  2W48 A;  5IP6 A;  2ELK A;  2WAQ N;  2XPU A;  1AHD P;  3H0G J;  1XS9 A;  1YRN A;  1FIA A;  1JUS A;  2Y9Y A;  2M0C A;  5FKO A;  2L7Z A;  2R5Y B;  3B6A A;  4UUT A;  4A3C J;  5K7H A;  4AYB N;  1FEX A;  2XSD C;  1ORK A;  1OJL A;  4JX4 A;  3A01 B;  3ZOB A;  2E2I J;  4XK4 A;  1XC5 A;  1APL C;  1ETX A;  2JJ7 A;  1JUM A;  4A3K J;  1ETV A;  1ZR2 A;  3F0C A;  2PMZ N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...