1LEGA

Crystal structure of h-2kb bound to the dev8 peptide
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
274
structure length
273
Chain Sequence
b'GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
publication title Structural comparison of allogeneic and syngeneic T cell receptor-peptide-major histocompatibility complex complexes: a buried alloreactive mutation subtly alters peptide presentation substantially increasing V(beta) Interactions.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 77
structure length 273
sequence length 274
ec nomenclature
pdb deposition date 2002-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1legA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 1legA01
2DIJA 3OKMB 2C4XA 3VXMA 4U0QB 1NJ9B 2B39A 2HKHL 2NNAB 4HJGB 1HZHH 2FZ3A 1NGYA 3G6JE 4KHTL 1T4KA 2E9BA 4NUGL 1Q1JL 5CIPB 5EOTB 4JY5L 1ZT1B 3KWWA 3JV6B 4Y8DC 4ETYA 1I9RH 3JTTA 5HGDB 1UQSB 1NUDA 2W0KA 4JAMA 3CLFL 4POUB 1LP9F 1KTLA 2AJ3A 5HYFA 4L8CB 3D0LA 5BZWA 2XKSA 1PQZB 1MNUH 2R2CA 3WEXB 3QWRD 5FA3B 1VEOA 3HAEG 3V52H 3GIZL 2D4DA 2CPCA 1ONQB 5GHWH 3BE1L 4P23C 2ZUUA 2EYSB 2FD6L 5FF6A 4D9RD 3ARGC 4UILH 2SEBB 1T3FB 3GUTB 4WW1A 4OZ4A 3UDWC 3QI9A 3LAFA 3EDFA 4H5SA 4PP8C 1RQ5A 4JRYD 3TH3T 5ENWA 5FA4B 2G75B 2VC2L 5M94B 2Q20A 2OR8A 3CSYB 1CF8H 4GBXC 5C0BE 5B3JE 3RHWK 4KRMB 5FK9B 2FWOA 5E8NA 5HDOA 2O26U 1LQVA 3MRFB 5IW6A 4UB0H 2ITCB 4NPYB 4DEPC 1A2YA 4OLWL 2EIEA 3UJJL 4F58H 5E08H 4L3CB 1DDHA 4NSKB 3CFCL 2NY3D 3RIAK 4I48B 5F3HA 3QRGH 4TTDD 1K6QL 2FR4B 4FABL 2FX9L 4JFYA 4CL7A 3GBNH 4I77L 1I3GL 1OP9A 5D1ZD 5D4QA 5GJTL 3GSOB 4LQFH 4CVXA 1NAKL 2YUZA 3GKZA 2AV7A 1T89C 1PZ5B 1G7PB 2BHUA 4MX7A 3S35H 5HHPB 4X80L 4DZ8A 3GO1H 1INEL 5F7LB 4UIMA 2X4PB 3T0EB 1KIPA 2BNUB 4LU5L 3KLHD 2ADGB 2Q8BL 3BVNA 2WAHA 1WEJH 3CFEB 4U1LB 5IVXB 4OLZH 3VA2C 4PRNA 4A2MA 1R5IB 2AEQL 4GW4A 3C5JB 4RIRA 3MOAH 1JNHB 1HHIB 4PJIE 3SKJL 5EO1A 5GS1B 1ZANL 3CZJA 4EIGB 3NVQA 2APBA 1G1CA 3BPOB 5FV2A 3U9UA 5MERB 4M7ZC 4PJGA 5F6HI 5DQ9B 5LAXA 4OD3L 4PV9A 4CJ1A 1A7QH 1T21B 2CK0L 3K1DA 4L4VB 3WD5H 1VEPA 5INCA 1EGJH 1FNGA 2BSRB 4RGOL 4U1GC 1BVZA 4RRPA 1MCWW 2MQCA 2XFXB 5C0CD 1SY6L 5E4EC 4YNYA 2UWEF 3MJ9L 3KPOA 2VLKE 3HUJF 5K9QI 1YC8A 1EO8L 3KPLA 2VKXA 2V7NB 2YWZA 1KCUH 3WMSA 3N1MC 5EZJB 3UMTA 2Z91B 5ERWA 3QJHA 4HEPG 1M7DA 3M8OH 4YXHH 4Y88A 1BJ1H 1BF2A 1Z0NA 4LSVL 4M5YL 1PGRB 3SQBA 2D7NA 5J4MA 1K85A 3DGGA 4Z7WE 3VGBA 3T1FB 5GS0C 2ZUQB 1EFQA 2CMRH 3BEVA 1T0NB 3NIDF 4PUBH 2FIKB 1L7TL 3ZT7A 1U8QB 1IM3A 4IJ3C 1A3RL 4PJBB 3DI2B 5DTFA 3I50H 3PWUB 1ZVSB 2XKUA 3BP5A 4J3OC 1R3JA 5IMLA 4WUUB 4S2SB 4FTVB 1AQDB 3TCLB 1MCHA 2DIBA 3MJ7A 1XZ0B 2ADFH 3VFPA 2PO6D 2M1KA 4PG9A 2JCCE 4N0CA 3HC3H 4U7KA 5IK3B 2DRUA 1AGCB 3JUYA 2BVYA 2HRPH 4HWBH 3SE3A 1KN4L 5IESL 5J0BA 1UG9A 4OCNC 4GRWE 3DTXB 5C09D 4KDTA 1KLGB 4YX2H 4HH9A 3BPNB 4OAWB 2P42B 2ZOKB 4I5BB 1JRHH 4MVBC 1FZKB 5EU6D 4G8GB 3U36A 5JXAH 2IQ9L 4POZC 3QEUB 3BT2H 1Z0MA 4XBGB 3JWDH 3DPBA 3X17A 5H2BB 3TIDB 1G6RL 2OTUB 1VFBA 3GMNB 4BJLA 3BQUC 2FJFA 5SV3A 5GGVL 1WIUA 3BUTA 1MJJA 4I0PA 3QBTB 4AM0A 4PJ7B 5HDLA 4WW2B 3WYRA 3UTZA 5DVLA 3KXFA 4G5ZH 1A7NL 3BI9X 5JIHA 1WCBB 2RFXA 1KFAL 2V17L 1LDSA 3IDIB 4XMLH 3GMOB 4PJHF 4LCCA 3MNWA 3AGVA 1HCVA 3G9AB 1LHZA 5JW4R 4WFGE 2D31A 4M00A 4G8FA 4HQQH 4JGMA 3WJJC 5HHOD 5I17A 5B22A 4U7MA 2XWBA 1WAAA 2YXMA 2A9NL 5CCKH 2KQMA 1FBIH 3MRLB 4ZSOB 1F45A 4F7CA 1NLBH 1TJIH 5C3TA 4NKQB 1A1OB 4DN3L 6FABH 3TGXA 2C26A 3NZ8A 2W9EL 3GSNB 3FFCE 1QEWA 1BFVL 5IMOA 5DD6A 1GPOH 3EJYC 2ICWJ 2APXA 4N9GB 2P5WE 2DI8A 4K8RC 2AQ2A 1QRND 1GZQA 5CWSB 5IW3A 3QUMA 2ZSWB 3QEQA 5GRYA 4YBQC 3ZTNL 1DQDL 1J86A 4D8PB 1A6PA 5B8CC 1X5AA 4K23L 2OQJA 2YN3A 1B0RB 4EKXA 4H0GA 3AXLB 4JZJB 5D71L 4Z95L 5LG1A 1OP5H 4NNYA 1FG2A 2ORBL 5HVWA 1ED3A 3A0OA 4D0CB 4LNVA 1H8SA 1LP9A 1C7TA 4FNLH 1RIUH 2ATPB 5GGQH 1FVCA 3TBVA 3LS5H 1MFAL 5ISZE 2M2DA 1HHJB 2J4WL 2QBWA 3B8SA 3QH3B 3BFOA 5FKAB 3UTSB 3QT2A 1LEGB 4QHKI 2XN9A 3VI3F 3ULUH 2ZOLB 4LVNB 1TDQA 5HHNB 3D2UD 4HIEB 3RWJA 3QIBD 4RGNC 1MH5B 1AP2A 2HG5B 1CE1H 3KPRD 4I3RL 3ARBD 1K8IB 2HT3C 2YPLD 4XMKH 4U1HB 1TENA 1C5CH 3L5WA 4BQ8A 3HNSL 5KVDH 3PNWB 15C8H 4F3FA 4XNXH 2QEJA 1A4JA 4AEFA 3SJVB 2AKRA 2X70B 5A16B 3PG2A 3C87A 2VQUA 2WLZA 1NFKA 1F13A 1BVLA 4WWKB 3GMLA 3NH7H 4D9LL 2VN7A 4U31A 4U1IA 1MIMH 1NFIB 2NLJB 1CGSL 5D2LE 3SPVA 3V6FB 4GJTB 2EO9A 2OSLA 4ZUWB 1FC1A 3T4AB 2GITB 4N8PA 3NFSL 1J7VR 1UZ6E 1B0WA 4QRUA 1T20A 1EUTA 4YDVA 4KXZI 5GGRA 2EKSB 1N5AA 4OZGB 4XGZA 4Y2DB 1EFXA 4X99B 3D3VA 4L9LB 3PWNA 3VFOB 2Y36L 1EZVX 4JHZA 1UJTA 4MLIA 1YC7A 4PJEB 3WFDL 1AC0A 4LVHB 5C0ND 1NCAL 5E8EA 3FONA 1L0YA 2RR3A 5ECJE 5MEPB 3TZVB 3IVKB 2LTQC 3V7AG 4K7PY 1QLRA 5JIIA 4WV1B 4LMQE 2Q7YA 5SX5K 1W72H 4WI6A 3PGFH 4KU1A 2DOCA 1D5ZA 4YEFA 1GGUA 1Q0YH 1OY3B 4HFUL 4M7LL 3VG9B 5T33H 4NCDA 3O0RL 4OZHB 4CMMB 5LGJB 1OL0A 2VLMD 4DKFL 4KK8D 4R90H 4GAFB 4KQ4H 3MLVL 5EC1A 5J06A 5JMOC 1KJ3H 1UB6B 4PRAA 1BFOB 2KZ1B 4LOUD 1T7WA 1EJ6A 5A43C 1TETH 4HBCH 4Z7VF 4M8QB 5GZNC 1YDPB 2R8SH 5FO8B 1FRGL 2XZQH 4M5ZH 4ZPTB 2ID5A 3ULUD 3FQXA 2A6KB 1KUMA 3UCRA 4WTZA 4JO4L 4TNVK 3WS6C 1CGTA 4WCYH 5DUML 2UWEA 5FUCE 3RVXC 1Z3GH 4L8SB 2ADIA 4O00A 1X5YA 5I66A 5IB2A 4KI1A 3KYMB 1NCTA 3HUJA 1LEKB 4YEEA 2DM2A 2ZNXA 2AXFA 2EH8H 4XCYB 3L5XH 2VTFA 4I2XE 4GS7C 5KAQF 3UYRH 4HUWB 4CVZB 4PB9L 4KZDH 4NRXA 4ZFZB 3LQAC 1QHPA 2FLBT 4RCAA 3H7BA 5IHUH 2K1MA 2MHAA 4NOBA 1WLHA 4N0FA 4WU7A 1F11B 4MD4B 5F21B 5I8OL 4MHHG 4ENED 4KRPD 4XCNB 1M7IA 1XH3B 4HIIA 1IGYB 3KLAA 2EDHA 1YJDC 4KVNL 4BQ9A 2OMBA 1CD8A 3S6CA 2WUCH 3OV6A 4I18B 3JV4A 2J6EA 1SYVB 4GXVH 2D3VA 4U6VH 5IBLD 4QCIA 2HAZA 1NBQA 5EUKA 4HIJA 1FFOA 1IGFH 1FYTE 3IFLH 2X89A 4NZTL 1BAFL 4OQTA 4NQCA 5DMKA 3VFSB 4J6RH 3GSUB 4AJ0A 5FCUL 1RK0A 3AY4A 3QP3A 3OAYK 1X4YA 4NKIH 1WK0A 5JZ7C 1BEYH 1MAMH 3C60A 4PP1D 1SJEA 4FQLH 5LWYH 2VITB 4I9WD 2WBJD 4JR9H 1BJ1J 2A6JB 5MHSE 2XICA 3NA9L 2HMID 2FO1A 2O61A 4LSTH 2VL5A 2HJFB 5D93C 5JUEL 2EDWA 1G9MC 1NMCB 1TTFA 3EO9H 3ZDYF 2BVQB 1GGBH 2NY0B 3EJZC 3JWOC 5KVFL 5D7JA 4I3SH 5FO7A 2VXQH 3S8WA 3QUMH 3IAPA 4QLRA 1QA9A 4RFNB 3QFJB 4G43B 1WWBX 1LD9B 8FABB 5I1JL 4PJHA 3U4EA 1OAQL 3TO4C 3U4AA 4JFPA 5C0RH 3CXDL 4HZLB 4LCYB 1KCSL 1EMTH 3VW3L 5F71A 3HE6A 5D1ZB 2I9TB 1EA9C 3OKKA 3MLRL 2X9XA 1UC6A 3M45A 3SY0B 1IFHH 2IAMC 1AQKL 4JFFE 4K2UH 3WIFA 2YOCA 5JPNA 1CDBA 4P99A 2IH3B 1HSBB 3BXNB 4L1DA 1EZVY 4G3YH 2KH2B 4O4YL 4JFEA 2KL6A 4XP5H 3EFDL 3B6SB 5K33A 1OTSC 4NM8H 3RWHB 2D7OA 4RRPG 4UT7L 1S7QA 3VFNB 3WHE1 4LLAA 4LLMA 1I3VA 3FFDA 3SDCC 4JPVL 1MCNA 4IS6B 5EZIL 3EGSA 5T1LA 5DMYA 3KXFD 1I4FA 4MJIA 1NMAH 4M43H 1X6LA 3QDGB 2X6MA 4AENA 4H8WC 5T3XE 4ODUB 4E41E 4WY7H 3MYZA 4XVSH 3RVVC 1KIRA 5E8OB 1DSFH 2H26B 2Y06H 4MCZB 1BM3L 3OSKA 2J2ZA 3ZKMD 1DVFA 1N3NA 1P53A 2P8MB 3HC0B 4QHUA 4UUJA 4LGPB 5EZOH 4BK5A 1AIFA 1C12A 1I9JH 3EYVA 4J3VA 5GRVL 1N0XH 5EORL 3H9SD 3VWJB 5K59F 1A6VL 4E5XB 3MRJB 1XF5B 4JHAH 4NDMB 4NFDA 2FYYA 3HMWL 2R29H 3AU1A 3QZWG 4XAWL 3UBXI 3MOBH 4JO3L 4Y19D 1GC1C 4ELME 1JUFA 3DARA 1OAKH 3FT4A 1RZJL 1HH9A 3DXAE 3DECA 3QEQD 3V6ZB 4LSUH 4OCSL 1RULH 3KJ4B 2CRMA 3OAUL 1YY9D 4MXWL 1CK0L 5FGBC 1JJUA 5EU3B 5GISH 3P4OA 4M61B 4GG8A 3E2HA 1QYGH 2PO6B 3I02A 3MA9L 3UO1H 2W9LA 5TDOB 2J3SA 3ZHKA 2BSSA 1QVOA 3MGAA 4MCYB 3MJGX 3O6LL 4PRHA 4KMTH 3S96A 2A83B 5C09B 4MNGA 4CMHB 5A2JH 2NY5L 4KAQH 1HYSC 2Y4SA 1U92B 4FXLA 5IGXL 2VLLB 1PG7X 1RHHB 2LV4A 2VDRL 3SKMA 1J0ZA 1EXUB 1OWWA 3CMGA 2XN9D 2CO7B 5I6XC 1L0XA 4BKLA 2CLZB 3BPCB 1WV7T 4OGXH 4ODWB 4JREC 4GRLC 4OI8A 4ZOCA 3AREA 4Z7UE 5AG9A 5FYLH 3QHFL 2FL5B 4NJ9L 4L4TE 4NQSA 1OGTA 3X3FH 4U6YA 2VNCA 2IANE 2C3VB 1CTNA 3S34H 3Q6FB 4HC1L 3RY5A 1AC6A 3QUXA 5F7NC 3SDYH 3VDCA 4DOHE 4IIQA 4QRRB 4C57C 5E2TL 4GUPB 1CICA 4ISVA 4MA1C 5F8RC 2R1YB 4RWYL 4QRPB 4HX1A 3RVWD 3MRIB 4QRQA 4PG2C 1RFDL 3MGTA 1D5BA 5HHOB 1ZGLP 1U42A 1HQ4B 4AEHL 5GQBA 1U6AH 2J6EH 3PL6D 4XZUB 2R1XA 1PG7W 2A2QT 4JN1H 4R7NB 3NIFF 3BO8B 4BFIA 4EEEA 3BN9D 4YHKL 1FO0L 4CVUA 3CSGA 3RIFK 4RMWA 1EFXD 4OQTH 2EDNA 3U4BH 1F4YH 1CR9L 3LIZL 5DRXB 5EZLA 2X42A 3V95A 2ADJA 2GJJA 4R4ND 1ZHBB 1BOGA 2IWGA 2VIRA 4K9EC 1N2RB 2IALB 5CLWA 2F74B 1SM3H 5C0DA 1HEZA 2R0LH 3P11H 2H2SC 4XT1C 5BVJA 1C1EH 5I73B 2OMNA 3QDMB 4IRJB 1NC2A 4YUEL 3C8DA 3DVNB 4Z8FH 4WFED 3CVHB 3UTTA 1RZ8A 1IC5H 2OM5A 4GFTB 3RGVB 3GMPA 3CC5A 1V3JA 4MS8A 4LKXB 4JY4A 5HHMA 4OGAC 1PX3A 4NNXB 1WSST 4KKLD 1CFQA 4BSWB 2GK2A 2WUBH 4M6ML 1ZKAA 2P4AB 1QSED 5JNYB 4F2MA 1PAMA 2IJ0C 1DL7H 4LF3A 3JSSA 1KJ2B 5FUZL 3LVEA 4PR5A 2WWMC 4CNIA 1MLBB 5J13C 3MYJB 1DR9A 3VXQA 3D2UB 1KLUB 3DURA 4LSSH 5F7FA 5FYLD 4YDLB 2DM3A 3HZVB 2ZPKL 3KPRB 3BIKA 4FXGB 2GSIB 2MSPA 1J8HA 3S3JA 3C6LD 4L4VE 3IKCB 4TN9A 4HUKB 4MWFB 3WL9A 4JFOA 1BJ8A 2D0GA 1F02I 4WO4D 3GMQA 3VRJA 2X4QA 3LPGA 3IU3A 1I3RB 1EVUA 1UXWB 4LPWA 4RNRA 2CKBB 4Y4HA 3LEXA 1L0QA 1NC4D 5DQJB 2IBBA 2X4RA 2X09A 1G7HA 4ZD3H 3BKCL 3QEGH 4WHTB 4TSCL 1G7LA 3T0EC 2EDQA 4YDJB 4JANA 1MFBH 1DQQA 5J1TC 4TOYL 1TPXB 2X89D 4JZNA 1FGNH 3O3AA 4NQCD 2HN7A 5T3XL 1AE6L 4HHAB 3O4LD 4RFOH 3PJSB 3M07A 3QA3B 2O5XH 1MCEA 5F89B 4KI5D 3TEUA 4UU9A 2Q8AL 2FO4A 4JLRB 1A4KB 1EPFA 1Q0XH 3QULA 3IDNB 4Z76B 4WTZG 1ZLUH 1FFNB 2EIBA 3QO0A 3OF6A 3VH8B 3F5WB 3C8KB 1RZIA 5IJVA 4ZXBA 3H3PL 5IR1A 1KENL 3MCKA 5KN5B 2BCKA 3F12A 1MI5E 3RVUC 3T3ME 5DT1L 2D7QA 3RPIA 3LKOA 4C56D 2GEEA 1NGZA 3N9GH 4NQEA 3O3BB 2JJSC 3D69B 2GFBA 1MFEH 1F58H 3NMEA 3RUGF 1P5UA 3ARDA 1JFQL 2OYPA 3HE6D 2B4CL 3ZTJG 3PWLB 4WI7A 1YA5A 3TV3H 3TBYB 2ZJSL 4PJ7E 3O2VL 3SCMD 1N6QH 5K93A 5ICXB 1TCRB 4JEGB 4OZIF 1BD2D 3TBTA 1XGUB 2IQAB 2EYRA 5HI5D 2PUQT 1HI6A 3CVIH 1D5IL 2F53D 5D5MF 3CH8A 3S97C 1U8LB 1JGVH 1QR1B 3F7QA 4JPKH 3TT3L 1D6EA 4ZOBA 2RAMA 1DN2A 4A6YB 1S7SA 5D8JL 4OGYL 4XP6H 4U1NB 4NN5B 5GIRB 5JXEC 1B2WH 4DQOL 3X14A 5DD1H 4IOIB 3FHQA 3T2OA 3G5YB 1OW0A 5DD0L 3KYOA 4ONFH 3OR7A 4M9OA 4YAQB 1I8IB 5LQBH 5DHVA 1U8PB 4QOKA 4B53A 4KUCD 3MLYH 3C5ZB 4XBEH 3VWKA 1C8PA 4XMPH 1J5OH 2DJ4A 1I8KA 4XB8A 2IH1A 5GRJL 1L9MA 1AXTH 1ZT7B 1FZJB 1D6VL 1DVFD 1W72B 2Y7QA 1T5XA 2WBJB 5JPMA 1UB5B 1NGWB 1MIEH 4H26B 1GZPA 5ERWB 4UV4H 2CLRA 1NQBA 2FATH 5DRZB 2APVA 3NCCB 4R4FL 4XI5D 3K4DA 3L3DB 1OP3H 1S7TA 2GT9B 1XMWA 5C08E 3W0WA 1TNMA 3N85L 2R2HB 2XRAL 4DFHA 1T0PB 2R1WA 4X7SL 1I1FA 4KDWA 4LCUB 3B9KC 1WBXB 1FPTL 3AM8C 5DA4A 1NBYA 1YN6B 2ED7A 2HFGH 3HHRB 2E9IA 3MZGB 3ES6A 4C54A 3NIGE 3LEYL 1XGYH 4LSRL 4LKCB 3TBSA 4MXQD 5L0QB 3EO1B 2A1WH 3CFKB 1G7QA 1CGXA 4XPTL 5L7XH 1M7XA 1INQB 1CDCA 3GSVA 1D7FA 2BY1A 3CK0L 5ACZB 5IF0B 3X11B 1JWSA 4IMLB 1F8TH 2XY1A 4PRHD 3RBGA 1W0VA 5DJDB 1BLNB 1NCDH 3GRWH 1I7UA 4PJ9A 5EN2B 3BGFC 3W2DL 3WXWH 5L88L 4OZFB 5CJOH 1ZA3B 5LBSH 4WNQB 3MA7B 1U58B 1C7SA 3RU8H 4U1KB 5FUOL 2EDOA 2HLFD 4U1JB 4XTRC 3NCFB 1CDJA 4HIHA 4JDVA 1TVHB 5DMGD 4R7DA 5DZLA 5TF0A 3GGWB 3H3KA 1IAOA 2H2PC 1P9MC 4FZ8L 1JWMB 3QUXD 3ESUF 4HUXB 5IP4A 4JFDA 3UPRA 1ZLWK 2ENYA 1CICD 4AMKL 3BH8B 1YEHH 1HWGB 3MXVL 3LS4H 4BYHA 5I2IA 1ORQA 2GUOA 3OKDB 2QKIA 5EOQL 3NZHL 4FFZH 4G42A 5C0AE 1S7RB 1LE9A 5DJ0A 3MJ8A 3G9VA 5I76B 4JDTL 4P3WA 5DJ2B 3EDJA 3TM6A 3GSXA 5B39B 3NN8A 5CUSL 5EULV 4ZFOA 1JV5A 3H9SB 1U8MA 2JB5H 3UTOA 3FRPG 5T1MB 2F54A 3QHTC 2AK1H 3VGHA 2DQEH 1WUNT 4M48H 4DGYL 3V0WL 3ZO0A 3GMMA 4Y19B 1NCCL 5CBEB 5HI3D 2GK0B 4P2RD 4OF8A 2R2BB 1C16A 3I6KA 2DD8H 4LSQL 1NC2D 5BVPL 5IB4A 2VQ1A 1S7VA 4BH8B 3UTTD 4KVCH 5IJKA 4NM4H 3UC0H 2XXCB 4MS8D 2HLAB 3QCUH 2D7MA 4JQIH 5HHQA 1S7WA 3RWCB 1DANT 3OHXB 4KJWD 4WV1C 3MBEC 1TJHH 3V5KA 1Q72L 4ZFGL 3WFBL 1IAKA 3VGEA 2W0FA 1MWAA 2GI7A 4FMKA 1INDH 4Y5YB 4WGWB 3DRTB 1K4CB 1T7VA 3VG9C 3MACH 5B38B 3EYUL 4U6HB 1A6TB 4LSPH 3FQWA 1EEUA 1S9XB 2F5BL 3ULVH 3I75A 3MNZB 2V2WB 1MLCB 3E3QE 3HG1D 5T1KB 5A2FA 4X6FA 1J8HD 4P9HL 4YR6A 3NFNB 4ZQKA 3TA3B 3HMXA 3P9MA 1WJ3A 4NC0B 5DC0A 2IFFL 1OAYL 5HI4C 4PJ8A 1MHEA 4EBQL 3BGMB 3IDXL 5KBNC 2UY7A 2Y07L 3D6GA 5HY9B 4D9RE 1N7ML 4YLQT 3UDWA 2H45A 1G6VK 4EUPH 1WZ1H 3G5VA 1EX0A 1P6AB 4L8SC 2DLIA 4PJCF 5CMAB 3U7WH 1W0YT 4ZTPL 1XR8B 3BAEL 5HDQL 4JRYE 3F6LA 4UINH 3UTQB 1U8KA 4JPWH 2BRRL 5KAQG 2Z9TA 4JG1L 2NZ9C 2JKXA 5J9PB 4MAYD 1GVIA 1AGEB 2B0SH 5HYJE 2DYPD 3PL6B 4XC3H 3HN3A 3RUGA 2HKHH 5DHVH 3DETC 3WHXB 4G59A 2AJXL 2ITDA 4BZ1L 5IHZA 1PLGL 1NAMB 3OKYA 1ORSB 3MV8D 2BMKB 3OXRA 1I1AA 4G7YL 2ZUSA 5FKPA 3WN5B 3AMLA 3GDBA 4HKJB 4NQTA 4OZIA 1LE5B 3QQ9D 3DX9B 5KSBB 1QLRB 4YO0A 3DV6B 5ICYB 4YXKL 3S37L 4HGWA 5T5FL 5D5MA 4ODHL 4PLOB 2OR9H 2X4NB 4Z7OE 1UA6H 3PV6B 2GJZA 2FD6H 3P0VL 3UYPA 1DQLL 2YKLL 5ID0B 3EO0A 4P48A 4YHNA 2PTTA 3L6FB 1FFPA 2FECL 3TN0B 1U93B 2KBGA 5I1LB 4OD2A 4LRIA 1BZ7A 5I1HL 5IBUB 1CXKA 3E0GA 4NHUA 1T2QL 1QSEB 4NQED 4P5KB 3BP6B 4U1MA 1P1ZB 5HYSA 1OHQA 4NP4L 5IG7B 2HFFB 3NGBC 1U8HA 5IV2B 2UYLA 4O2CA 4JG0L 2I24N 4QXGH 2P48B 3IFOA 3ULVD 5KS9B 3OGOE 2E6JA 4KJYB 4QHLB 4OM1H 3IS1X 1EEYA 4OLWH 4HWNA 1HXMB 4X6CB 5D2LF 3UJJH 4YHZL 3KPNA 1HE7A 2GJ6A 4QTHB 3C6LB 4RMVA 4FFWC 4RFNC 5CSZB 4NWUH 1FIEA 5HGGS 1ZXQA 4WO4B 5I9QC 1P7KB 5IB5A 4HT1H 4IRSA 3VE0A 1BPVA 1I3GH 5C0CE 4NQVA 1AGFA 3M1BB 4PJFE 5DO2C 5ETUB 3TF7C 1A1NA 2HTLD 3ZE1E 3CZFB 3JTSB 4LLUA 5CEXB 1NC4B 4QNPF 4Y7MA 1MJ7L 1DBKH 2DL9A 4PJXF 5F9JB 4S1RL 1QFWL 5C9JA 3B83A 3O6FC 4OBRA 2WQRA 3QIUB 5BZDB 4LU5H 4GKOA 4OLUL 3STZA 1F42A 1ZT4B 1FC2D 3PGDA 4U1SB 1G7MA 4EIZC 4XWOC 4RBPH 4NQCB 3VWKD 2CIKB 4U6XB 4JDZB 1ZGLB 3O4LB 1X7QB 1M6OB 4PJIA 4BUGA 4YGAB 1QKZL 1QHOA 5D70H 4ORZC 1TIUA 3ARFB 5IMMA 4U6TA 1EO5A 3CD4A 4QGYA 3VXNB 3QWOA 4LGSB 3DMMA 4G6ML 2ZCLH 3LH2H 3GK8L 5ESQA 4U3HA 5EWIL 1VHPA 3DV4B 1KPVB 1VSCA 3VFWA 4BQ6A 2PTUA 1YUHA 1S9KC 5J7CC 1YEEL 1NH6A 3R8QA 1NKRA 3T4YB 2XA8L 4I0KA 5C0GA 4P5TC 2GSGB 3MRGA 2IBZX 4GSDH 5BJTB 4C56B 1KCVH 1ZHNB 1KTRL 1Q38A 5AUMA 3REVA 2VQTA 2G2RB 4UIKH 4R3SB 1CFNB 5FOBA 5EU6E 4W6XB 1FCGA 2UV3A 3GSQB 3MO1A 5E5UB 1FJ1B 1YECL 3S5LA 1TZIA 3V5HB 5IT2L 3N1QC 2WWKT 4NWTL 5F7MC 3BW9A 4WEBL 1GGIL 4C58B 1NGXB 3ZYOA 2RBLA 1LO4H 1MJ8L 3PWVA 1S5IH 3SCMB 3MUGA 2VXSL 3WCYA 1HINL 3HRZB 1OF2B 4X5XA 1BD2B 1A7PH 5K9QG 1BGXL 1MEXL 2JJVA 1H5BC 2Q3AA 1NEZB 2BNRB 1D5XB 2W60A 2Z35B 2F53B 1MWAH 1ZLUK 3RWEA 4LVOC 4L5FH 4UTBH 3ZLQC 2I9LA 2EDDA 5F1OB 4ZODA 1RMFL 3V4UL 1SYSA 4XVUC 3TJHC 3NACH 3GJEB 4LPYA 3WO4B 4E42A 5HVHC 5HHOE 1HH6B 2QQNH 5D6CA 1KN4H 4Q9BA 5CBAB 1F90L 3DBXB 4OSUH 3HMXH 3S35X 4NKMB 3TJEH 4EI5C 4JFDD 4L9DA 1FG9C 3OWEA 2GAZA 4P57A 3V4PH 2CDFB 4LARL 3AS3A 5JW4M 4JPIA 4ZS6C 3HC4H 1QRNE 4Q6IB 2HT2D 1B6UA 1MREL 1QBLL 5DVMA 2YD1A 2VXTL 3INUL 3QFDB 5I30L 2XOTA 5KANI 3RY6A 1FV1B 3UBXA 4P46A 1RUKL 4AIZA 1IC7H 4G9FA 4OLEA 4MSWB 4YFDB 2Z93B 4RAVB 4Y16C 2B2XH 2YA0A 1MFCH 1YEDA 4DGVL 2VDNL 5EBMB 1QFWI 3VXSD 2X40A 3P4LA 3OBAA 2BNQB 4K7PL 3D0VA 4PTUA 4Y4FC 1XR9B 2HKFL 2Z4QB 3VXRA 4F57H 4TTGA 1MHPH 4R26L 4LDOB 3ARTA 3HAEB 3BHBB 3LKQA 4JM4H 4D0DB 4U3XA 2BOBB 3FFCA 2PR4L 5DMIH 1XIWD 4OUUA 5KOMC 3GHEH 5ADPH 1KEMH 1OAZH 4PJCA 3QDJA 4LBEA 2COQA 3S7GA 4FQXD 2YPLE 5L8LB 5BQ7A 1J1XL 1N26A 1SBBA 2EEAA 3HI6L 5JW4Q 5D72H 5D7LA 2R9HC 1JI2A 1KTKE 1QO3A 4ZAKC 5IFHH 3VXME 2JJTC 1HZHL 1YN7B 1CG9B 5GJSH 4APQC 4CGTA 1HILA 2ESVA 5C0EB 3LOWA 5E1AA 1I9RL 3VFTA 4YHYC 2F9BT 4QWWC 4MZ2A 4OFPA 1JK8B 1OP3K 2VMFA 3RGVC 3BMWA 1LVEA 3OKOB 3QJFB 2V2XB 3CCHB 2DLTA 1MNUL 4HK3N 3A6CH 1MFAH 1RZJC 4Y5VC 3IDMA 2Q76A 3P4MA 3V52L 3ECBA 4FQQB 1Z9OA 4P23D 3W11C 2VR9A 4RAUA 3ARGD 4UNTA 4HS8H 5GHWL 4MDJB 1GOGA 5TF1H 4UILL 1XF2A 3FO2B 4OFYA 1P7QA 5TGBB 2YEZA 4YE4H 3OX8A 2Y5TB 4XVJH 2CD0A 3GSRB 3QG7H 4K3EH 4YDLC 1JPTH 3D39A 1CF8L 3OJMB 2DL2A 4QEGA 1M05B 2YR3A 3SKOB 4KV5E 4Z7VB 4FFEX 1NSNH 1S8DB 2LE9A 2ZKHH 3FO0H 4XPBH 3BISA 2NY5C 5SWQA 3HRPA 3PWPA 1HIMH 2VLME 5EU4A 4UB0L 5GS0H 1KPUA 1DTUA 4JY6B 3PIQA 4YHOH 4D9LH 3HPJA 5E03A 5A3ID 5FB8A 5KSUB 5EZLB 3L7FB 4KH2A 1VERA 5FUCC 3WDJA 5DJCB 3HZKA 2ICWB 5D2LA 3B5HA 4F58L 3SDDC 5E08L 1F6FB 1DBBH 1SBSL 3U46B 2BHZA 1MHCA 2NW2A 1K4DA 5C0DB 3U9PH 3DUSA 1IZJA 3QRGL 3V0AC 4P2RB 4KKBD 2WBWB 4HH8A 3HS0A 1VACA 3ULUE 2DI9A 1JHKH 3BGAA 3TFKC 3GBNL 3O6KH 4MNQD 3IGAB 4LQFL 3BEWA 2V9RA 4HV8A 2XTJE 4N8VG 3RL2A 1E4KA 2DJSA 1FVEB 3S35L 3UZQA 2BP3A 5DUBB 2YZ1A 5E2UH 3GO1L 5C6PB 1RZ7L 4PJXA 2B5IB 4TVPD 3LPWA 2NTFA 4X7CC 5JR1H 3DX6B 1T83C 2B20A 2ZUWA 4LAQH 4JJ5B 1UWEL 1WEJL 5ACLA 1R5VB 1RI8A 1I7ZB 4OLZL 4Z5RA 4LLQB 4X4MA 4HFUH 4NKDB 1RJYB 5C07B 1HNGA 1U36A 3MOAL 1I7RA 4I13B 4LHJB 4DKFH 5GXBB 4YBLB 1CVSC 3SE9H 1J1OH 2JTDA 1KJVB 1FAKT 1K3ZA 4HKXB 4L8BB 3HTLX 3CMOL 3CUPA 3HG1B 2FH6A 2MKWA 3GM0A 1CD1B 1A7QL 4EQ2A 4IDJH 3OMZA 3FB5A 4JRWA 3WD5L 4OBSA 1EGJL 1ZWIB 4YHPA 3I9GH 3F6IA 4WTXA 3E6FB 3G04B 3HB3C 4LLYA 4IRSD 1BREA 4N9OB 2VB5A 4FXKB 4PJ5A 2HWZL 3O9WA 2BSTB 5AG8A 1Q9KA 4MJ6B 1A8JH 3BDBA 2L7JA 3W39A 1KCUL 5E6IC 4HS6A 4ODVH 3LQZA 4I9WE 2WINB 4I2XA 1EDQA 2X4SB 5I75B 5IMKB 4P2YA 3RQ3A 1O0VA 4MD5B 5D2NB 2NY2C 4KHXH 4MAYB 5BW7A 2ZCHL 3L1OH 2DYPB 1JTOA 4LCWB 3ROOB 4N5EA 2VDQH 1EEZA 1R3HA 5GS0D 3ZKXC 5CZXC 3L5IA 1RPQA 4K8RH 4M7KH 2CMRL 2YPKA 5FAAA 3MV8B 1DP0A 3O81A 4PUBL 1KB9J 1ZVHA 4ELKB 1RAMA 1JPFA 1ES0A 3QIWC 1PYWB 5DJXB 3I50L 3TO4A 2IG2H 1FYTA 3THMH 4NQDD 5IVXF 1MUJA 1BAFH 3BDYH 4URTB 4XPFH 3C5ZC 3HC3L 3DSFH 1B90A 2DKMA 4LHUG 4X8JB 3VFGH 2IC2A 4HWBL 5J12B 2VLJD 2EO1A 3NTCH 4DN4H 1UM4L 3OKEB 2RGSA 4HULB 4IRZH 4YX2L 3KNBB 3Q48A 4MVBD 1FZMA 2DKUA 4YFEA 4POZD 2Z8VC 2VISA 1JRHL 3CDGA 2ICES 4MNHB 2Q86A 1VESA 5CP7B 5JXAL 1H9VA 3QYCA 3BT2L 4F9LC 1HXYA 3JWDL 1ODAA 1JPGB 2OI9C 4XBPB 1UM5H 3AFLA 3SDCA 5FGRA 4OT1H 4XWGH 2EDBA 5CSGA 4DVRH 4QHKJ 4HFWB 1WQVT 5LCVH 4ZPVA 4L29B 1EHAA 4G5ZL 2CSPA 3KXFE 1T1XA 6CGTA 5IIEA 3V0VA 3MRKA 4XMLL 3BZEB 4K07A 1LQSR 5I1JH 4C59B 3F58H 2CIIB 1T04B 2H8PB 3C6SA 4JRXB 2DICA 1KCSH 3QXUA 1OTUC 4EUPB 1H15B 2C7UB 1S7SB 3QXDB 1RVFH 3MLRH 4HQQL 4P2QB 4ZUUB 3TVMA 3TPUA 1KCRH 3WNKA 5HPOA 1FNAA 3ROLA 4PJBF 5CCKL 4JQVA 1FBIL 2QSCH 3QUYC 4NO3B 5EC2A 4Y1AD 1TJIL 1CT8A 2R2EA 4JFHE 6FABL 3OKLB 5TFSH 4M93B 2K3TA 1XGQB 3TO2B 3EJYD 1GPOL 4K8RD 3WUWA 1OB1A 4OIBA 2Y23A 4N68A 2B4CC 1T2JA 5IUSA 1Z9LA 5CD3A 4Y19E 1DBML 2Y72A 3O3UN 4P4RB 4UDTA 4YBQD 1WIPA 3BKJH 1H3VA 3QEQE 2AEWA 4QF1B 3H7LA 2AK4A 5FEBA 3RDTC 4PRPD 1UENA 1T80A 1VADB 4BSVA 4C83A 3SEPA 3RL1B 1RJZA 1AHWA 5KSVA 1F3DJ 2F8OA 1WZKA 4S0UC 2E9WA 3SE8H 1NCWH 1IGTA 1RIUL 5D7KD 1LP9E 4MQTB 2ZUVA 4PJ7F 5GGQL 4WW2F 4R0LA 1MCOH 3LS5L 2X4OA 4N5UA 5J11B 3CDYA 2ICCA 1UWXK 4AY0A 1KTDB 3RWDA 1E27A 3LN4B 4YGVA 2P7TB 4XB7A 4E9LA 3ULUL 5DA0B 2R39A 4I4WB 3ES6B 2XN9E 4GRLA 4O2EB 4RGND 1MCRA 5EBLA 1G7JA 3OZ9H 4RBPK 3TNNB 5IW1B 5HD8C 3PXHA 1J0HA 3P4NA 1HHKA 4XMKL 2AABH 1C5CL 2CRZA 2MFNA 5KVDL 15C8L 3RWIA 4XNXL 4NZRH 2OR7A 1W0VB 5AAWA 5D7LD 5BS0A 5CJQH 1KB9K 2WIMA 3WFEH 1CBVH 4OCSH 2NTSP 4GMSH 2YHGA 1K8DA 4FQHB 2ESVD 4PY8I 4A6YL 5F1KC 1TFHA 3BMVA 1FL6B 3MRBB 4WJ5B 1MIML 1JRHI 1YJDH 4J4PC 1GAFH 4DVBA 1T1ZA 1RUQH 4HKZB 1YNTB 2BVUA 1G7IB 3OKMA 3PWJB 5JW4N 1HOCB 3FQTB 2NNAA 4HJGA 3S3SA 4F7PB 2OTWB 1A9BB 5CIPA 2FBJH 5EOTA 2AVGA 1ZT1A 2XI9A 3VRLF 3JV6A 4GQPH 3SQOL 4Y5YC 5HGDA 4OFYD 1P7QD 3S98A 3R0NA 3ME0A 1IKNA 4PRID 5IB1A 4MB3A 5D6DC 4L8CA 1T1YB 4K71C 3MRHB 1ZHLA 1P4LB 4F33B 5IHBA 1PQZA 5I16B 5KSBE 3WEXA 1W72L 3D39D 5FA3A 3F7YB 5EOCL 5GGUB 5INDB 1Q0YL 1ONQA 3GSXB 5T33L 2EYSA 4MYWB 4WFEE 4R90L 4KQ4L 2SEBA 1HHHB 1T3FA 3GUTA 3VXSB 2PETA 5DDHB 3VI4F 1CE6B 4H20H 1KJ3L 4HLJA 5HGBB 1LEIB 5DK2B 2CLVB 5CHNB 5FA4A 5GZND 2G75A 1YPZB 1D5MB 3CSYA 1TETL 4HBCL 5FYJH 5IEHB 3ZE0F 1CDUA 3LKSB 1QSEE 4AEHH 5GRUH 3L3OB 2AW2A 5FK9A 2XZQL 4M5ZL 3MRFA 5CZKA 2NXYC 4WCYL 1E4JA 2ITCA 1TQCC 3IDUA 3N50A 1Z3GL 4EXKA 4NPYA 2C3GA 3PHOB 5B4MD 1XIWB 1V3MA 5FYLE 5D7IB 4IEFB 1BJMA 3HUJE 4X6CE 4FQXB 4GMTH 4L3CA 4O2FB 1Y6MR 3L5XL 4NSKA 4OLXH 1JGUH 1OAXH 4I48A 3UYRL 4ORGB 4OCLC 4OIAA 1TNNA 2FR4A 4KZDL 1VGKB 2AV1B 4OZGF 4V3EB 5IHUL 1NBVH 3GSOA 1PZ5A 1G7PA 3HLAB 5GZOC 3QNZB 2H1PH 4WU5B 5HHPA 4PJEF 1KELH 4NUJB 2P8LB 1KXVC 2X4PA 1B9ZA 2VAJA 3NIDE 3T0EA 2WUCL 5AWNH 2BNUA 1VENA 1CN4A 1KG0B 2ADGA 4GXVL 4U6VL 3QQ4B 4P3CH 1SEBB 1RY7B 3QO1B 3CFEA 1IGFL 3IFLL 4U1LA 5IVXA 3BKMH 5DHYB 5CJXA 4P23B 4H8WH 4J6RL 4WVRA 3ARGB 1R5IA 4NQCE 4OZHF 3C5JA 2UVEA 2X10A 3S36L 5CFHA 1SJVA 3O4LE 5JZ7D 3C08H 2DQGH 1AGBB 1JNHA 1HHIA 4PGCB 5GS1A 2NPLX 4NKIL 3ZKQD 2EDTA 5D1XB 1MAML 2XNAB 3EYQC 2P1YA 4FQLL 5LWYL 1Z5LB 2Z8RA 4K94C 4UQ2B 5DMJB 5MERA 4GBXB 5DQ9A 4W81A 4OCXH 1T21A 4L4VA 5TE4H 4JR9L 5FXCH 3BP4B 4S0SD 4HAGA 4W68A 4UNUA 1FAIH 4M8VA 4Y5XC 5DR5H 3IETB 2BSRA 3J8F7 2F5AH 5E2JA 1Q8MA 3EOBB 5IVZB 1WZMA 1AJ7H 2XFXA 4HUUB 5FYJU 4DEPB 1EVTC 4UBDC 2UY6A 3EO9L 2ZCKH 1GGBL 2V7NA 4MAUH 4ZUVB 5FYJD 4NC1E 4C56E 4M3JA 1AH1A 3MV7B 5EZJA 2Z91A 1TCMA 3IAQA 4MA3B 5DSCB 3O41B 4Q2ZB 2HTKC 3TO4D 1A47A 1MY7A 3QIUC 4NQXB 5C0RL 4PJHE 5DFWH 1C5BH 5T1DH 1I1YB 5DGQA 2J5LB 1EMTL 2AJVH 4MNQB 1A7BA 3LD8C 3T1FA 2NY1C 4NBZB 1IARB 3NCYS 3SDXB 2IAMD 1Y0LB 3K2MC 4KK5C 1T0NA 1IFHL 2FIKA 4K2UL 2YPVH 4GQ9H 4NZJA 3S88H 1U8QA 3EYOB 4CN6A 4PJBA 1BD2E 4G3YL 3PWUA 1OGAD 1ZVSA 2Q8AH 3MZTA 1OTSD 4XNMB 4WUUA 1BX2B 5JO5B 5KVMC 2XZCH 4KROC 4JFEE 4FTVA 4S2SA 4XP5L 2WK2A 1AQDA 5EFIB 3TCLA 4NM8L 2F53E 1HKLH 3VA6A 7FABH 1XZ0A 1OQXA 4YHMH 4CN4A 4Y8AA 5SX4I 3SDCD 3H3PH 3ARSA 5IK3A 4RA3A 2BVOB 2W92A 3B9DA 2EDEA 1AGCA 1A14H 4OUOA 3T8XB 5B3NA 3QZWB 4M7ZB 1CXLA 3DTXA 4NO0B 1KLGA 5J6HB 4LIQH 5A1AA 4OAWA 3FCTB 2ZOKA 4I5BA 4JGUA 1FORH 4XCFH 1NMAL 2C4FU 3GZKA 3LY6A 4AL8H 1FZKA 4MJIE 5FM4A 4G8GA 1PKQB 2B8OT 3QEUA 4XBGA 2PXYC 4U1GB 5H2BA 3TIDA 2OTUA 3DUUB 3GMNA 43CAB 1KBGH 4WY7L 5E4EB 4XVSL 4ODSH 3IDJB 5EA0H 1DSFL 4NQVB 2Y06L 3FO9B 4PJ7A 4N0YH 4WW2A 2PW2B 4KJQC 4WGVB 1UJ3C 5EZOL 1WCBA 3F7VB 4HGMA 1I9JL 2LU4A 3IDIA 4HLZH 4L3EB 3GMOA 3AAZB 3GB7B 1N0XL 5DGRA 2FB4H 3D25B 4XNUH 1D5IH 3VI3E 5CIPH 4JHAL 4ZUSB 1JTTA 2R29L 2E9JA 3IU4H 3MOBL 5JHDB 3U0TB 4OGYH 3U2SB 3RI5F 5DI8B 2Z31B 4FQPA 1OAKL 1OQOA 2C4FT 4BSJA 1QPXA 5BO1H 4IJ3B 3WO4C 3QHZH 1IRAY 5DD0H 4LSUL 2YD4A 3MRLA 1VDGA 4ZSOA 3IDYC 1ZLSH 2AK4D 4NQDB 3I6LD 1A1OA 5GISL 2JE8A 3GSNA 2QR0B 4AG4H 4QXTB 1VB9A 2ZUXA 1QYGL 4WI5A 5J1AB 2FIRT 3UO1L 4N9GA 1Q94B 4CN1A 1GRWA 5MEQB 4RMSA 5CWSA 2EDRA 2ZSWA 4PJDB 4PRHE 4KMTL 3EKCA 3WXVL 2VLJB 3SKNB 1NUGA 5DXWA 4Q6IC 5C0GB 3L3JA 3B8YA 4LQ1A 4D8PA 4KAQL 4YPGB 1KCGC 3H42H 4MNGE 5D7SH 1B0RA 4TUOB 1JF6A 3AXLA 4JZJA 1ZHKB 2AGJH 4GRLD 1Q9OB 3BQUB 3HE7B 1OVZA 1D9KC 3FOLB 4WUKH 1J05B 3DNKA 5BRZD 1CL7L 4D0CA 4X9HA 5FYLL 2ATPA 3IB4A 4DAGL 3N85H 4TPRH 3X3FL 4X7SH 1HHJA 4KTDH 3QH3A 3S34L 5FKAA 2P24B 3UTSA 3H2WA 2CGRL 5BS0D 1LEGA 4OF6A 2DMKA 3SDYL 1VA9A 2ZOLA 5HHNA 4HIEA 3RTQC 4XVTH 4ZFFB 3WUWG 1MH5A 2HG5A 1K8IA 5CP3A 4MA8H 35C8H 4B50A 1UXSB 3PNWA 2A6IB 2QADC 1U6AL 4Z7VE 2J6EL 3SJVA 1GOFA 2X70A 5A16A 3RKDC 1U3HC 4JN1L 3P9WB 4CVWA 3QNYB 4WWKA 4Y1AB 1DEEB 1CGWA 4OQTL 3HI1B 2AP2A 3U4BL 1F4YL 5IB3B 2BX5A 2WBKA 4NRYB 2ATKB 1N8ZB 5A2IH 2HFEB 4W70A 1NFIA 1MHHB 2NLJA 4TSAL 4C4KT 1FLRL 3V6FA 2H2SD 4WFHD 4ZUWA 3T4AA 1SM3L 2GITA 3P11L 4HKBB 4OFKA 2I07B 5B8CB 2DBLH 3SBWC 3NFPB 4RQQB 2EKSA 5CGYC 3V6OE 4OZGA 4Y2DA 2X41A 4PRPB 5K9KB 2VZSA 4HPOH 3FT3B 5EO9B 4WI8A 4X99A 3EYSH 5TQ0H 4L9LA 3LEVL 3VFOA 2C1PB 5T3ZH 3UTTE 1IC5L 5GRWA 4PJEA 3NCJH 1NDGB 2DLFH 5MEPA 3TZVA 2DQTH 4WV1A 3SO5A 5DVOA 3WNPA 1J8KA 2WUBL 2X1OA 4NO2B 3E3QC 3SE4A 5FO9B 5B21A 3TNMB 1DL7L 2WWMD 1IGJB 1EHXA 5JA8B 4WHYH 4OZHA 2D2OA 4CMMA 1Z9MA 5C86A 5LGJA 3U0PB 3N1GC 4RGNB 3ARRA 4LSSL 1UB6A 1BFOA 3IXAB 1QRKA 3BDXA 4HLZG 3JBG7 1AD0B 4M8QA 1FGVH 5I1IH 1NCCH 1J8HE 1YDPA 2ZG1A 1KT2B 1F5WA 2A74B 5D7LB 5FO8A 32C2B 3MRCB 4ZPTA 5E5MB 4FQ2H 2A6KA 4D3CH 3A67H 2D0HA 1U2CA 4HS3B 4RISL 4L8SA 2ESVB 1AO7B 1VCAA 4JCLA 3KYMA 4GG6B 1LEKA 4ZD3L 1K3IA 3ZDYE 5KW9H 5BV7B 3QEGL 4XCYA 3T0ED 2E7HA 2EE6A 1TVDA 4HUWA 4CVZA 1CL7I 1JNNH 3O2DA 5F1IB 4ZFZA 3GIVB 4Q97A 2A9MH 1FGNL 2KUTA 1I8LA 4HG4K 5J8OA 1F11A 2OCFD 4MD4A 2O5YH 1JZ6A 4RFOL 4XCNA 3EYUH 3LRSB 1XH3A 1QSFD 1IGYA 3ALXA 1YEJH 3KS0J 4JQXC 4PRIB 2O5XL 5DFVC 2LTQB 3LN5B 4I18A 5BCAA 1Z6JT 1SYVA 5DEFB 3BUYB 4XNQA 1AFVH 1Q0XL 4P9HH 1IL1B 4IM8A 2E5EA 1CCZA 1LDPH 1ETZB 3VFSA 3T1WA 3GSUA 2XG4A 2Y1VA 1NFDB 3IDXH 4ALAH 2VDOH 3EYFB 3VD3A 1N7MH 1A6ZB 1N5YH 3PP3H 2YRPA 4UOW0 3LZFH 3Q3GB 3AS1A 2EEDA 2VITA 5HDQH 1TTGA 3SO3C 1U8NB 4JKKA 5E99H 1BF8A 3N9GL 4OI7A 3DLQR 4KC3B 4NQEE 2A6JA 2Y6SC 1MFEL 1F58L 1CDHA 3AS0A 4J3WA 5SWZB 2AJXH 5FGCB 2J7LA 2HJFA 2CUHA 3GSNH 3ULVE 2W38A 1OD7A 4LNRB 4ETQB 2BVQA 1N6QL 1UKSA 4GS7B 4M9PA 1EAPB 3QFJA 4AH2B 3LSOB 1C08B 4G43A 8FABA 1LD9A 3CVIL 1XF4B 4YXKH 2NQCA 4HZLA 4ZG1A 4LCYA 3FB8B 5K59E 1JGVL 4JPKL 2DI7A 5D1ZA 2I9TA 3ARVA 3ARUA 3P0VH 5JXED 3MR9B 1YQ2A 4XP6L 3JVGA 3SY0A 5FHAH 5D96C 3GJFK 1OSPL 1G0DA 1IM9B 1B2WL 3ALWA 5DD1L 2XXMB 1XAUA 1XCQB 2IH3A 1HSBA 3BXNA 1FNSH 4ONFL 5FM5O 3MLSH 1MCLA 5LQBL 4FG6C 3PQYD 3B6SA 4G8GD 3RWHA 3H8NA 5C7XH 4J12A 3MLYL 5LXGH 2V5SA 4XBEL 1MQKH 2LAAA 1KULA 3VFNA 4XMPL 2ZSVB 1J5OL 3T0VA 3CX2A 1PJ9A 3Q5TA 3U30B 4PLNC 4WTWA 5ILTH 4IS6A 4J1UB 2AS5M 5CP3H 1AXTL 1QPPA 3W39B 5IROC 1A64A 1MIEL 1O7VA 3Q0HA 3QDGA 1DUYB 4PJAB 1U95B 2FATL 1AD9B 4ODUA 5T5NG 3WE6B 4XP9H 5FYKH 1LMKA 3DIFB 5D93B 2BDNH 5E8OA 4H0IA 2H26A 4G6KH 3W0WE 3NAAH 4MCZA 3R8BB 3B9KD 2P8MA 3HC0A 2EC9T 4GW1B 3VD7A 1KB5H 1YEFH 1QFWH 2HFGL 1MF2H 3U7YH 3HKFA 3VWJA 1XGYL 1CFTB 2EE2A 4E5XA 3MRJA 2A1WL 4NDMA 4RAHA 2FGWH 5L7XL 2IF7A 3DYMA 3D85D 5CGMA 1RZGB 5E9DD 5GSRB 4Q6YA 2IAMB 5E2VL 4JN2B 3UP1A 1MCWM 3CFIC 3HI5H 1HHGB 1QKZH 5SWSD 2A38A 4JKPH 1NCDL 1A7RH 2A77H 3GRWL 3V6ZA 2W65B 1OGAB 3WXWL 1S78C 4J23A 5CJOL 5LBSL 3K4AA 3JTCA 5EU3A 3VXUB 1Q9WB 5BMFH 3NIFE 4M61A 3RGHA 3WFHB 4XTRD 4K7FB 3RU8L 3VDAA 4Z78B 3I6GB 4OQ1A 5TDOA 1BBJB 4PGEB 5F88B 4XHJC 4MCYA 4ZOAA 5KTEH 4FQJH 4QXUH 1PX4A 1MPAH 1PSKH 2A83A 2H2PD 3MX0A 4JO1H 5C09A 5I0DA 4LEXH 1U92A 1CXIA 4XC1H 3UTSD 3S9DB 5A2LH 2E27H 1T1WB 1RHHA 3TYFB 1IC1A 3CH1B 1EXUA 2MKLC 3I2CH 1YMMD 4JFDE 2CLZA 1XFPA 3BPCA 5IKCB 4ODWA 2J8UB 4HUNB 5ESAB 2CR3A 3LS4L 4PIRF 3S4SG 2FL5A 2QHRH 4TQEH 3WV0A 5F9AC 4HWZB 3WSQH 4H1LB 1J0KA 3ABZA 2C3VA 5FYKU 3Q6FA 3R06B 3SJVD 3T0WA 5KG9B 1A6AB 4QRRA 2R23B 4TULH 3O2DH 5FYKD 4GUPA 2OXHA 3JWDC 5JHLH 2R1YA 2AK1L 4N0RA 4QRPA 4HUVB 2VE6B 2F54E 1PD6A 1JWUB 4M48L 1K2DB 1I1CA 3MRIA 1YPZE 5EIVA 5HHOA 2VLRD 1HQ4A 4TYUA 4KTYA 4ZO6A 5DJAB 3VFRA 1BP3B 4XZUA 2DD8L 4R7NA 3BO8A 3DWTA 3ZDXF 3U1SH 5DRXA 4KVCL 1ZHBA 4NM4L 3V7MA 3UC0L 3EHBC 1N2RA 2IALA 1R5WB 1NCNA 3QCUL 3RNKB 2F74A 2J1KA 4JQIL 5L6YH 3E8UH 4BA8A 2H9GB 1QBLH 4MMZC 3MBED 4GXUM 2F8VA 2VXTH 3MV01 3INUH 3QDMA 4RWHA 1TJHL 2VSDA 3DHJA 4IRJA 3OJ2C 3DVNA 1E4XI 2ICWI 5I6XB 1INDL 4EN3B 3CVHA 1SMOA 2EIDA 3MACL 4JREB 4LSPL 3FRUB 3RGVA 4DGVH 1IVLA 4ONHB 3ULVL 3P9LB 4Y0GA 5BRZB 3K81A 4LKXA 1KIQB 5E70A 5C8JB 4NNXA 5I1KH 3RZCB 1BQHG 4BSWA 4CBPA 2XKNB 4GH7B 4X4ZA 3QI9C 5ICZB 5JNYA 5TDPB 5L2KB 1XGTB 2MQ3A 3GI9L 1KJ2A 4Z0XB 1QOKA 3VGGA 5DJZB 1M71B 1MLBA 3MYJA 4JZOB 4MA1B 3D2UA 4RDQG 1KLUA 2C1OB 2I5YH 1HNFA 2VDMH 3HZVA 3P73B 2EECA 3KPRA 3U7WL 1Q9LB 4FXGA 4UINL 3PDOB 2GSIA 4LFHD 1K5NB 4JPWL 4ZS7H 1JMZA 1BZQK 3MOQA 3IKCA 3WNLA 5H37H 1ACZA 4MWFA 2B0SL 4XC3L 3RUGE 1I3RA 1UXWA 2ARJB 3DO3A 3ULUC 3GMRB 2CKBA 4PB0H 4G8IB 4XXDB 2X4UB 5DQJA 1E4WL 2XTJC 4M1CC 1CZ8H 5IB1B 5FECB 4M03A 4WHTA 3OJVC 4OZIE 1ZHLB 4YDJA 2HYMA 1AI1H 2UUDH 1T0MB 1H0DB 4FMFA 1MRCH 5D5ME 2OR9L 1UA6L 4HHAA 4N1CA 2BY0A 3PJSA 3QG6B 5DLMH 2PW1B 5GGSY 3VD9A 3BD4A 3NA4A 3QA3A 4JFXB 4OGZA 1CI5A 5F89A 5JOEA 1T83A 5D1XC 1I3UA 2D9QB 4KKCC 5HTSA 4OFVA 4JLRA 1A4KA 3IDNA 4NHUE 4Z76A 3AUVA 1FFNA 5IBLC 3VH8A 3F5WA 5J13B 1DQJB 3C8KA 4BZYA 4QXGL 5KN5A 2CXGA 3EDDA 2ZG3A 2NY0D 4OM1L 3CLEH 4L3AA 2I27N 4FFWD 2GJ6E 1SBSH 3FO1B 3QFJD 3O3BA 5IM7B 3D69A 4NWUL 5EPMB 3K46A 1XGPB 1DBJL 3OGCB 1V5JA 4JM2B 3U0WH 4HT1L 5DO2D 3PWLA 3SDAB 2J5LC 3OB8A 2CUMA 5TH2B 5H35B 5IVOA 5F7UA 1JYVA 1WF5A 4YQXH 3TBYA 2BK8A 5DYOB 3FB7B 4G80B 1L6ZA 2CDGB 4PBWD 2P5EB 5ESVB 1DBKL 3VD4A 5ICXA 1TCRA 1RZ7H 5HGHB 1XGUA 2R0ZH 1I7TB 4WWID 2IQAA 5KSBF 1L7IH 3A6BH 3W9EB 1R3LB 1UWEH 4XWOD 2AI0H 1QR1A 1U8LA 4A6YA 3B2UC 3VFUB 3WIHA 1EHLH 2EEBA 1WWCA 4M7LT 4U1NA 5GIRA 3CPLB 1QSFB 4QYOB 2PCPB 3KPMB 1L4IA 4IOIA 5D70L 3G5YA 4EDXB 4N0CC 1FZOB 3BZFB 1PEZA 1J87A 4YAQA 3CMOH 3ULSB 1I8IA 3V2AR 2ZCLL 3LH2L 1U8PA 3SE3C 2HFTA 3QDGD 2O5ZH 3P0GB 4KDTC 5IWLA 2OTPA 1ULVA 3OAZH 3C5ZA 4QHMB 4ZFOL 1URLA 3V8CA 2Q7NA 3CFJB 5KS9F 1DQTA 1ZSDB 5EU7E 3MLUH 2HWZH 2OZ4A 1ZT7A 4X6CF 4GSDL 5D1QB 1FZJA 5EU5B 1KCVL 4KMQA 1W72A 4I0PC 4FQCH 4F9LA 2WBJA 2UZXB 1DZBA 1NGWA 1UB5A 4H26A 2GTZB 4UIKL 4XAKD 3KPQB 2WSKA 4J7RA 3VWJD 1N6VA 5DRZA 2ZCHH 2E7LA 3ZKNC 4P4KB 3RX5A 3RNQB 4ZOEA 1E6OH 2WM0A 3L3DA 5GGSB 2GT9A 2K9UA 2MPAH 2R2HA 1PY4A 3K7UA 1LO4L 3QPXH 4WFGD 4X6BB 1S5IL 4XH2B 4LCUA 4RFEB 1WBXA 2Z31C 4X6EB 3MLZH 1YN6A 1A7PL 5E1HB 1KOAA 1V3KA 3IAGC 2YA1A 3WIIH 2FBOJ 2JB6B 3H9YA 4JCMA 4LKCA 3TYGH 3LKRB 1MWAL 3EO1A 3NCYP 3CFKA 4L5FL 1INQA 4UTBL 4XVUD 3CVHH 4DWHA 3TJHD 3TT1H 5ACZA 3X11A 5IF0A 1EJOH 3NACL 4IMLA 3ARYA 3FMGH 4PY7B 5DJDA 1BLNA 2QQNL 4KI5F 4D94A 1UM4H 1JYWA 2X4TB 5KVGL 5EN2A 2BXYA 2VDPH 2LFGA 4OSUL 4OZFA 5J56B 1RD6A 1ZA3A 3HMXL 4EI5D 3NOIA 2EDFA 3PQYB 3TJEL 4WNQA 1KJ2H 2MQ0A 1U58A 2XPGB 3MA7A 1YYLH 4U1KA 3STLB 2BY2A 1G9NH 4U1JA 4ZS6D 3V4PL 2HVJB 5CJ5A 4M1DH 1HKFA 2D4FA 3HE7C 3HC4L 1JNLH 1CGYA 4P2OB 3K8MA 1TVHA 3VXOB 3O3EB 2NX5D 3O4OC 1EH9A 3BRGC 3GGWA 3X3GH 1TQBC 5DJ6B 4PRPE 1JWMA 1JBJA 1IC7L 4HUXA 4Y16D 2APFA 2C3XA 4QRRD 1FP5A 4G9FE 2B2XL 1MFCL 3BH8A 2YBRB 4H88H 1RHFA 4L4JA 3QWQB 4MD0A 1JI1A 1QP1A 1XF1A 4QRPD 4MA7H 5EDXA 3OKDA 4KMLB 2CKBH 4Y4FD 5HJ3B 1S7RA 3B9KB 2HJLB 5I76A 3WO3B 4L1HA 4B7IA 5DJ2A 2C3WA 4XXCA 3VXRE 1C5DB 4F57L 4Z77B 1MHPL 2R69H 5B39A 3MCLL 4NKOB 4OCWL 2X7LB 3H9SA 3UEZA 4JM4L 4RGNE 1J1PH 1NL0H 5DJYB 3ILPA 5HSFA 3LDBC 5T1MA 5DMIL 4OCMC 3GHEL 2PYED 1GYAA 5ADPL 1KEML 1OAZL 3D85B 4DZBB 5E9DB 4PJCE 3QDJE 4OKVB 4Y19A 5SWSB 2R9HD 1DBMH 5CBEA 2IBGA 5D72L 2GK0A 4TVPL 4J3SA 5I74B 5D7LE 3BGFB 2R2BA 4X6DB 2P43B 3L3JB 4APQD 3QDMD 5IFHL 3W5MA 3GNMH 4IRJD 3PABB 5GJSL 1MCPH 4MHHI 5J57B 2YUVA 1F6AB 3HPLB 1OPGL 4QWWD 1BZ9B 2LU7A 1JE6A 2ESVE 4KUCF 4BH8A 5L8JB 5E8PB 3RGVD 3BN9C 4NT6B 2HLAA 1QSVA 4GKNB 3O11B 3RWCA 3A6CL 1SEQH 3OHXA 4NOFA 1Z9SA 3TIEB 3N0PB 4HS8L 2DQUH 4Y5YA 4MQXC 4LRNH 3DRTA 1K4CA 5TF1L 5B38A 1YMMB 4BQBA 4U6HA 1A6TA 4QRTB 3H9HB 1S9XA 3MNZA 4YE4L 4XVJL 2V2WA 1MLCA 4N8VB 3QG7L 4K3HA 4K3EL 4PV8B 1JPTL 3Q1SH 1MCQA 4Z6AT 5T1KA 2VH5H 3NFNA 4YDKH 1DQMH 5KSAB 3TA3A 3D39E 3VFVB 3C8HA 1NSNL 3W81A 2ZKHL 3FO0L 4XPBL 3BGMA 1ZLVH 2APWA 1IC4H 5HY9A 4F7MB 1HIML 3PWPE 2HH0H 1CLCA 1G6RB 5GS0L 5DD3H 4YHOL 4A6YH 2RHEA 4X8XA 3WIHH 5CMAA 1XR8A 3KJ6H 3UTQA 1KGCD 4TUKH 2BERA 1DBBL 5IOPB 5BV7C 2VLRB 5AAMA 4AT6B 1KB5B 5J9PA 2F19H 1AGEA 3U9PL 4DK3A 3PL6A 3TFKD 1MRDH 2FJGB 1JHKL 4M4RA 3WHXA 3O6KL 4XX1E 4GXUN 1NAMA 2EE9A 4OF5A 2J88H 5A2KH 1FIGH 3G6JB 3QCTH 5FHBH 2YUWA 1ORSA 2BMKA 3SQOH 5E2UL 2ZP0T 2A73B 3WN5A 2BFVH 3SOBH 4DKAA 1S9WB 1T66C 4QNPE 2PYFB 4HKJA 5JR1L 2OZ4H 4MLSA 4PJXE 1LE5A 1EV2E 4DTGH 3DX9A 5KSBA 2GHWB 4LAQL 3DV6A 4HCRA 2F58H 3MBEB 5ICYA 2IADB 4YK4C 3KHQA 1FL5B 5EOCH 1H3WM 1KXQE 2X4NA 3PV6A 4X4ME 5I18H 5DRNB 5HDBF 5ID0A 1JFMA 3BP7B 3L6FA 5I1CL 3SE9L 1J1OL 3TN0A 1U93A 1CWVA 5I1LA 3UPCA 4CU8A 3QQNA 4N0UB 5DURD 2Q1EA 3C60C 2VWEE 4IDJL 1QSEA 5SX4H 4P5KA 3BP6A 3IT8D 1P1ZA 5C0BB 2GTWB 2HFFA 5IG7A 5IV2A 3HB3D 3I9GL 2JLLA 5MHSD 1YNLH 4X98B 3LHPH 5KS9A 1U8IB 2ICEB 2DJUA 4KJYA 4PJ5E 4QHLA 4OB5H 5JA9A 4OCRH 5E6ID 4HWEH 1HXMA 4ONGH 4X6CA 3T0XA 2VAAB 4ODVL 4QTHA 3C6LA 3E6HA 2NY2D 4O58H 3RJDA 4NC1C 5D7JC 4PJAE 3RBSA 5CSZA 4KHXL 3L1OL 1AGDB 4OZFH 3MRNB 1JZ8A 4X9GA 2VDQL 4WO4A 1P7KA 5LGHH 3U6RB 5CZXD 5DK3A 1KV3A 5BXFB 3M1BA 5ETUA 2CDEB 2DQIH 4K8RL 4M7KL 4OD1H 3CZFA 3JTSA 3HE6C 4P3DB 1NC4A 5CEXA 1IEBB 3ALPA 1NDMB 1J0JA 4JFFD 2V5MA 5F9JA 5FYJE 4GAJH 3VXTB 5BZDA 3QIUA 2IG2L 1ZT4A 4XNQB 4U1SA 3BESR 2DQHH 3THML 5L9DH 1WICA 2J12B 3U79A 5HI5C 3C5ZD 3BDYL 2CIKA 1LK3H 4U6XA 4JDZA 4XPFL 3S36H 3ZKSD 1ZGLA 3O4LA 1X7QA 3IJHB 1M6OA 3G08B 3DSFL 1QG3A 3H0TB 2MTPA 3VFGL 3U30C 4DN4L 2LVEA 3NTCL 1E28B 1P5VA 4U7SA 4F7TB 3ARFA 4O5LH 1NGPH 4IRZL 1VPOH 3VXNA 1OGAE 2W91A 1LILA 1DUZB 1OM3H 3NGBB 2OJZL 5EUOB 3PV7A 3DV4A 1W0WB 1KPVA 3KAAA 2AXGB 4IBLT 4X7TB 5T3XD 4R2GC 2YK1H 1UM5L 2EE3A 4E41D 4OT1L 1RUPL 4Q7DA 2VZ1A 4XWGL 4WHDA 4DVRL 4PP2B 4IMKA 5M95B 3T4YA 4HXBH 4LGRB 2GSGA 1S7UB 5LCVL 5BJTA 2VLKB 4C56A 5FIEA 1ZHNA 43C9B 5DF0A 4P59H 2G2RA 4R3SA 1CFNA 1S9VB 2BJMH 1FNEB 2UUDK 3GSQA 1FJ1A 3F58L 5I9QB 3V5HA 4KUZH 1RZFL 5DUPH 1UVQB 5TDNB 4UAOC 3QSKB 2MCG1 3VJ6B 4NFBA 1NGXA 1RVFL 3L95B 4Z7WB 1KCRL 3DX8B 3SCMA 3TPUE 2WQ8A 4PY8J 3HRZA 3O6FB 1OF2A 3QUYD 1YMHB 1BD2A 3IF1A 3MRQB 2QSCL 1A0QH 1NEZA 2BNRA 1D5XA 1QBAA 1IQDB 2Z35A 2F53A 1X9QA 3IJYB 5TFSL 3ORJA 1PEWA 3QPQC 2ILLA 3GJEA 5E94B 5JLZB 2JCCB 1W8NA 3E2HC 1UT9A 3FOMB 3RA7H 1HH6A 3BKJL 2AJYH 5CBAA 3B9AA 3DBXA 4GRWB 4S1SH 4OF0A 2AK4E 2FX8H 1I9EA 4NKMA 3DYOA 1H8OA 4Z7QF 3X12B 3LB6C 1MCJA 4W4NA 1U8JA 1WT5A 4UQ3B 3SE8L 2CDFA 3FHAA 1NCWL 3ULVF 1XF3B 2AAVA 1JF1B 1HK6A 4Q6IA 4P5TB 1N6UA 4L4TD 1MCOL 4DGIH 3QFDA 4WEUD 3AREC 1FV1A 4FN0A 4LPVA 1E6JH 3QDAA 4DW2H 4R4BB 3MRMB 2IAND 1F00I 4MSWA 2Z93A 4RAVA 1UH2A 3C5SB 3KPSD 5DHXB 5EBMA 3K8KA 3QUXC 3OZ9L 1NAMH 2YSSB 2V7HB 4IIQC 1ZS8B 3UJIH 5BRZE 3NBNA 4JHWH 1JHTB 2AABL 5F6IC 1CICC 2BNQA 1MAKA 2AQ3A 1XR9A 3K3QA 4LIQE 3V8OA 4PRDB 4NZRL 2Z4QA 1CS6A 5CJQL 3O6MH 3WFEL 5BS0E 1H5BB 1CBVL 4HCRH 3LQAL 2G60H 4GMSL 3HAEA 4U49A 1GL4B 3BHBA 4U33A 4D0DA 4LVOB 4MXQA 2BOBA 3OAZK 1KC5H 1ADQA 4J4PD 4M6OH 1R3IH 2DM7A 1YJDL 4NZDA 5F93C 1GAFL 5HVHB 4PRBB 4W4OA 2P5WB 4G6JH 1RUQL 4E0RB 3WXVH 1T7YA 4GAYB 1YN7A 1CG9A 3MLPA 1QQDB 4EI5B 2FBJL 5FM5M 3FKUS 1V7MH 5C0EA 1T6WA 1RV6X 3B9EA 4LPCA 1A6UH 4EN3C 3DROB 1VFAB 5E2WH 2MCPH 1JK8A 4NZUH 5GGTA 1CIDA 1WWAX 1CL7H 3OKOA 3QJFA 2V2XA 4K94H 4AQ1B 3CCHA 4DAGH 4WFHE 3SBWA 2DQCH 3EDEA 2NX5B 3T3PF 5T1KD 1U9KA 2E7BA 3RZCC 4MS8C 1SVCP 3TA3D 4WHCA 4FQQA 5ISZB 3PP4H 3QUKB 5ACMA 5K9OB 2CGRH 3WS3B 4POYA 4Y16B 3T2NH 4MDJA 1RZKC 4RZCB 3FO2A 5TGBA 5GSVB 4YWGH 1QNZH 4H20L 2Q6WA 2Y5TA 3CJJA 1RIHH 4KDVA 3U7AA 3GSRA 4EVNB 1PDKA 2DDQH 4Y4FB 3BRFA 1ACYL 4JVWA 4LP4A 5FYJL 5JTWA 5JORB 3CFDB 1M05A 3SKOA 1OAUH 4Z7VA 1WFTA 5GRUL 1S8DA 4LP5A 4OV5B 3VFRB 4Y2OA 2NXYD 4G8EB 4X5WB 3WUZA 1ZGLM 1NCBH 1YEKH 4JY6A 5KSUA 2PYEB 3L7FA 3MREB 4GLRI 5DJCA 3SGKC 2ICWA 5AD0B 4GMTL 5HPMB 3DGCR 2H6PB 3IRPX 4TSAH 1FLRH 2B1AH 5E7FA 4Y4HC 3U46A 4OLXL 4OJFH 1JGUL 1OAXL 4MQ7B 4ZAKB 5EOCJ 4P2RA 4ODTL 5F1SA 1NGQH 4APQB 3V6OA 2Y9RT 4NGHH 1MAJA 1UWGH 1UZ8B 1NBVL 5IQ7H 5DS8B 1R3KB 3IGAA 5B38G 1CLOH 4YHYB 3LEVH 3O2WH 1FVEA 3PHQB 1L8JA 2H1PL 4GAGH 1KELL 4Q9CA 3D18A 5DUBA 1CLYH 3TN0D 1HDMB 5E6ZA 3O8XB 5AWNL 3T0EE 3GRWA 3DX6A 3FQRB 1WBYB 4Y5VB 4P3CL 1DJSA 3VD5A 4JJ5A 5K9JH 5TE7H 1R5VA 4DUVA 1TTUA 4CADB 1I7ZA 3BKML 3PDGA 4H8WL 3BKYH 3GFUA 2NR6C 4LLQA 5IVXE 4NKDA 1RJYA 2EIZB 3L3KB 3OG4B 5C07A 5JDSB 1A9EB 3C08L 2DQGL 4XHQA 1PZUB 4F37F 4GW5B 5JOFB 5ID1B 1BHGA 1QSFE 3BPLC 4ZMAT 1KJVA 4HKXA 4I3GA 4L8BA 4M62H 4ZXBC 2H32B 5EBWB 1YPZF 1CGUA 1I8MB 3HG1A 1M1SA 4NCC2 4OCXL 1CD1A 5TE4L 2XWJB 2FH8A 3LQMA 5E8DH 1ZWIA 5DR5L 1FAIL 4NNPH 2F5AL 4LAJH 1A22B 3QNXB 4GKSB 5HYEA 2FJHB 1MVUB 1AJ7L 3E6FA 3G04A 3UAJC 2YD2A 5T3ZE 4UBDD 4RISH 4JM2C 1Y6KR 4FXKA 4XPGH 3EOTH 2Z8SA 3QXAB 3SDAC 3L7EB 1OP5K 5D7IF 2ZCKL 2BSTA 3ARDC 1QUNA 4MJ6A 4WFFD 1WZLA 4MAUL 3SDDB 1JTPA 1A3LH 2H3NB 2HTKD 2WINA 5DD5H 2X4SA 5IMKA 3VGAC 3QIUD 3AROA 4MD5A 2D0FA 5D2NA 4MAYA 4TRPH 4IOFC 2DYPA 3ROOA 4LCWA 1C5BL 5T1DL 1UKTA 1W8OA 2AJVL 2NY1D 2YWYA 3GJFB 4P5MB 3MV8A 2DTSA 2YPVL 4GQ9L 4KGJA 4KWUA 3RFZC 1N64H 2NYYC 1FCCA 2EH7H 4ELKA 3S88L 5IBUG 3ARFD 1PYWA 5DJXA 4KROD 4PJBE 1NCUA 2XZCL 2BVTA 2EDXA 2HVKB 4WUUE 4FTVE 1HKLL 1ZLVK 7FABL 4ZTOH 4YHML 2EZ0C 1FO0B 5C2UB 4X4YB 4XNZB 3REWB 1A14L 3J7HA 1EHNA 4X8JA 1R24B 4F9PA 3OKEA 5CZVH 3MV9D 5FFLA 3BH9B 4LIQL 3KNBA 3MCG1 2E7CA 4NJAH 5D1QC 1F4XH 1FORL 3L9RB 3MBXH 5GRZA 4XCFL 2PXYD 2R0KH 5DURB 4PJGF 4MNHA 4AL8L 5CP7A 1GXEA 4NFCA 3VRIB 4G8GE 4DKEH 4DCQB 1UEYA 5CD5D 5F1NB 1JN6B 3GM8A 3HAEH 1OTTC 1KBGL 5J3HC 1JPGA 3C9NB 4XBPA 1JP5A 4ODSL 1NANI 4P4KC 4OTXH 5EA0L 1MRFH 1ZMYA 1ADQH 4HFWA 4J8RB 5C08D 4N0YL 4FP8H 3MODL 4JB9H 5C1MB 5E6IB 4L29A 4LLDB 4OF7A 3OXSB 1VKXB 3OG6B 1FLTX 3BZEA 2NY2B 2R0WH 2DTMH 2FB4L 1TJGH 2CIIA 4XNUL 2BNRD 3IFNH 4JHBA 5C3LD 1SHMA 1T04A 2H8PA 4JRXA 3ZKXB 4EUPA 1H15A 2C7UA 4PLJC 4N90D 3SDXF 3IU4L 3QXDA 5DRWB 4ZUUA 4P2QA 4NN7B 3KPPB 4PDCE 5ALBH 3MLTB 4Q0XH 3TWCH 5GGTH 1OSPH 1LO5B 5BO1L 5C6WH 3QHZL 3QIWB 4JFFB 4EZMA 3OR6B 5SX5H 1IAIM 4HMCA 4Z7NE 3B9VA 4Y4KB 4NO3A 1ZLSL 4ZSOE 4CKVX 4X83A 1T03H 2P46B 1IAIH 2A0LC 3OKLA 3MLXH 1BVKB 1XGQA 3TO2A 4PJ9C 2NW3B 1T22B 1KNOB 4AG4L 1JGLL 5JW5B 2QHLA 4P4RA 5SWSE 4D0BB 4KKNA 2QSVA 4P2OC 4QF1A 2KPNA 3H42L 5D7SL 4FHBD 5C0FB 3MPCA 1KN2H 1VADA 1JGEB 5IVNA 4OM0H 1NLDL 3RL1A 1D9KD 2AGJL 4FQIH 4BH7B 4XNYH 3VRLE 5C0JB 2OI9B 5JW3H 4WUKL 2OL3B 2NY7H 3ESVF 3V4VH 4E41B 5F70A 4OFIA 3WJLC 2BNQD 4TPRL 1A6WH 1E4XH 5C0AD 1DE4B 2FEEI 4KTDL 5F44A 1KTDA 2D7PA 2VUYA 3LN4A 4MZ3A 3UTSE 1NEZG 1WFNA 1MSPA 2P7TA 3WKMH 1U8OB 1UCBH 5I19H 4I4WA 4O2EA 4AEIH 5CILH 2JK5B 3Q2CA 4XVTL 2I60H 3TNNA 5IW1A 3G5ZB 3QUZB 5HYQB 3VI4E 4MA8L 35C8L 2QADD 1N4XH 4LK4A 5E2VH 1II4E 3OJDB 2IPKB 3HZYB 3V6BR 3DRQB 4ELMB 3VFMB 4P49A 2BOCB 2NY6B 1U3HD 3RWGB 5IFAH 3ZE0E 4HDIB 3QUYB 3SJVE 4CRPA 1WAAF 3DXAB 1HQRB 5I74C 4KRLB 2R15A 5J6GB 3RVTC 1BFSA 5FYKE 4O51B 4FQHA 2RCSH 4Q9QL 5FV1L 4PD4J 2GCYB 4MJ4A 1FL6A 3MRBA 4WJ5A 1RUAH 1NEUA 3VGDA 3VXPB 3HZMB 2FSEB 2G5BB 3KGRA 1OSZB 4BK4A 4PJDF 3S37X 4HKZA 1YNTA 2VLRE 1G7IA 5IJKC 3B5GA 4PGBB 3PWJA 1HOCA 5CGYD 3FQTA 2DBLL 3RDTB 4F7PA 4JKLA 2OTWA 1A9BA 3LPFA 4HPOL 2BC4B 4QT5B 2V9QA 4OZGE 3EYSL 5TQ0L 5T3ZL 1G1YA 1LNUB 1OWRM 2OP4H 3NCJL 4PJEE 3MTRA 4MD0B 4V2CB 2DLFL 1QFHA 2IGFH 1B88A 1T1YA 2A6DB 3MRHA 2DQTL 4F33A 1P4LA 5MEOB 4NC2B 4Z7UB 4KKAC 5I16A 4L4TB 4QHNB 4L8DB 4LHQB 3F7YA 5KSAC 5GGUA 3D5OF 2IANB 5INDA 1I9IH 2OS7A 1JHLH 2C9AA 3BRDA 4OZHE 2E6PA 4DOHB 3KPSB 5KZCD 1HHHA 1DANU 4PJ8C 3VXSA 5AYQA 5DDHA 3ILPB 1CE6A 5HGBA 1LEIA 4V1DD 1JPSH 5DK2A 2QQLH 1GHFH 2CLVA 5HYIA 5CHNA 3WNNA 1YPZA 1D5MA 4N0UE 1GIGH 5IEHA 5I1IL 1FGVL 4PLKC 3LKSA 3L3OA 1TVBB 1S5HB 5TE6H 4FQ2L 4D3CL 3A67L 5HYJD 1ZOXA 2G9HB 2CRYA 3PHOA 1XIWA 5L2JB 5D7IA 4FQXA 5KW9L 5J89A 4UDUB 4O2FA 3BZ4B 5A3IC 4HXAH 1I1AC 3KYNB 4ORGA 1IQWH 1T5WB 3L3GB 4G7VH 2F8XC 1JNNL 12E8L 1VGKA 2AV1A 1OCWH 2A9ML 4YPJA 4U0RC 1CQKA 4KKBC 3MRDB 2O5YL 3HLAA 4HPYH 5C07D 5AZEH 4XCCH 3QNZA 4WU5A 3HNTH 3I84A 4NUJA 2P8LA 4Q58C 5IBTH 4MDIB 5DFVD 1YEJL 4BQCA 2AJSH 4K71B 5DQDH 1UM6H 3EOAB 3HR6A 1KG0A 4RX4D 1SJHB 2VZVA 3QQ4A 1AFVL 1SEBA 3QO1A 3MGOB 5DC9B 4Z0BH 8CGTA 4LRIC 2JIXD 5DHYA 1FDLH 3GI9H 4P23A 1LDPL 3ARGA 4J3TA 5MP6H 4WI3A 4ALAL 5ITFB 2VDOL 1AGBA 3T2PA 4TNWF 4PGCA 4NBXB 5D1XA 1N5YL 2XNAA 4ZYKB 3U48A 3LZFL 3P2TA 1Z5LA 2EXYC 4UQ2A 3DX7B 4GBXA 2QSQA 3EZ8A 1TXKA 5E99L 3BP4A 2Y6SD 4ACPA 5EUOE 3IETA 3KR3H 3EOBA 5IVZA 4LCWD 3QB7C 2NXYB 2X1WL 2XACC 4HUUA 1WWWX 1TQCB 3LV3B 5DK0B 3B2VH 4EDWH 1PVHA 2XG5A 3GSNL 1QFUH 4Z18A 4GG6F 3OKNB 4IRSC 4PD4K 4ZUVA 1E4WH 1YNKH 3MV7A 2X9YA 4MA3A 5DSCA 3O41A 4Q2ZA 2GIYA 3QFJE 3UROR 1U91B 1F3JB 4NQXA 4ZO7A 1KLFA 3ARWA 4F7EB 1I1YA 4MNQA 1T89A 3SDXA 4JE4B 1Y0LA 3KLSA 4S1QH 5E56A 4F8QA 5FHAL 4ZO9A 3DOSA 2OJEA 3G6AB 3EYOA 1FNSL 1JPST 4FG6D 3MLSL 1ZTXH 4XNMA 1BX2A 5JO5A 3P0YH 5EFIA 2VJXA 5C7XL 1NFDF 5LXGL 3MROB 4LASH 5F7EH 3DMMC 1MQKL 3VG0H 5EIIB 2FX7H 5BOZG 4HAFA 5HHVH 1J0IA 2N7AA 1P6FA 2NXZB 2BVOA 4NRZB 2YA2A 5ILTL 3T8XA 3ILQC 1H3PH 3MUZ1 3HR5B 5I1DB 1MI5B 3QZWA 2ED9A 4NO0A 5EU7C 5J6HA 1P2CB 3FCTA 5IFJB 3HNVH 1X5IA 4IDLA 2VO5A 1PKQA 4Y5XB 3E6HB 1EERB 3QDGE 3BJLA 3DUUA 1DBJH 43CAA 4XP9L 5FYKL 1V8HA 3ZE2F 5F3BA 2XYCA 4JRXD 3IDJA 2BDNL 2Y25A 4K7PX 3MRRB 3MLWH 4G6KL 1A5FH 3NAAL 3FO9A 4P2QD 5DWUH 4UNVA 2HJKB 2PW2A 4H0HB 2B1HH 3F7VA 5CAYB 1KB5L 3GSWB 1LK2B 1YEFL 3KHOA 3BX7C 1MF2L 3BWAB 3EIFA 4L3EA 3AAZA 3U7YL 3GB7A 4DUXA 5E4IA 4XAKE 4XPHL 3D25A 4MJ5B 4ZUSA 3LD8B 2FGWL 2NY1B 1Y6NR 4UOJA 5JHDA 3U0TA 5BOPA 5TQ2H 3U2SA 1EAJA 2J8HA 5DI8A 2Z31A 3HI5L 1U3YA 5E0QA 4JKPL 3S4SB 5FM8A 1A7RL 2A77L 3MXWH 2XIDA 3MRPB 1S78D 4KROB 4B0MM 4NQDA 5BMFL 1HSAB 1P4BH 4QGTA 1JIBA 2QR0A 4KRNA 1BIIB 1MFDH 4QXTA 5J1AA 4XHJD 1Q94A 3MMEB 5MEND 2YS4A 5MEQA 2EICA 2WWKO 5KTEL 4FQJL 4QXUL 5I8KH 4PJDA 3B5TA 3F62A 1BWWA 1AKJD 2VLJA 3SKNA 1MPAL 1PSKL 4JO1L 3MV9B 2XZAH 4YPGA 1UYWH 1AY1H 4LEXL 1FH5H 4HMDA 5C09E 3WNMA 4MVBA 2ZUYA 4XC1L 1WFOA 2PXYB 2E27L 1ZA6B 4PJAF 4KJPD 4TUOA 1F2QA 4ODBD 1ZHKA 1WC7B 2FDBP 3I2CL 4M1GH 3RY6C 1QLEL 1MQ8A 1Q9OA 3TBWB 3BQUA 3HE7A 4P46C 4EUPG 3FOLA 1BWMA 1J05A 2WY3A 3IRZA 4R97B 2X5PA 2QHRL 4TQEL 3MFFB 1PY9A 5C08B 3WSQL 1UJ3B 2NX5E 4OCYH 5H94B 4LLVB 5CEZH 4HF5H 2P24A 3PDDA 4X9IA 3TC9A 1S3KH 3IF1B 4G9DB 4TULL 3O2DL 4QRRE 5DEGA 5H8DA 4ZFFA 4TSBL 5IEKB 4K3JH 5JHLL 1Y18B 4RGMC 2D7TL 1FNLA 4QRPE 2FHCA 3WJJA 4D9QD 1UXSA 2A6IA 2DMCA 2Z92B 4OF3A 4QY8B 4R96B 3WBDA 1AR1D 3DI3B 1M4KA 3EFFB 3HFMH 3IDYB 4MB5A 1BQHB 3BSZH 5KVGH 2AJZB 3QNYA 4Y1AA 3RAJH 3VXMD 1DEEA 3HI1A 3U1SL 5IB3A 5D9SB 4S10A 4NRYA 4KGLA 3ZYIA 2ATKA 3EHBD 1N8ZA 2PYEE 3W9DB 1QD0A 1U8JB 2HFEA 4HUMB 1MHHA 2X1QA 4RMQA 4HK3J 3N1FC 5L6YL 2FGZA 3E8UL 3K1KC 1TZHB 3R4DA 4HKBA 2I07A 5B8CA 1JZ5A 3NFPA 2JELH 4RQQA 3QDME 5K9KA 4PRPA 4LVEA 3FT3A 5EO9A