1LEHA

Leucine dehydrogenase from bacillus sphaericus
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
364
structure length
364
Chain Sequence
MEIFKYMEKYDYEQLVFCQDEASGLKAVIAIHDTTLGPALGGARMWTYNAEEEAIEDALRLARGMTYKNAAAGLNLGGGKTVIIGDPFADKNEDMFRALGRFIQGLNGRYITAEDVGTTVDDMDLIHQETDYVTGISPAFGSSGNPSPVTAYGVYRGMKAAAKEAFGSDSLEGLAVSVQGLGNVAKALCKKLNTEGAKLVVTDVNKAAVSAAVAEEGADAVAPNAIYGVTCDIFAPCALGAVLNDFTIPQLKAKVIAGSADNQLKDPRHGKYLHELGIVYAPDYVINAGGVINVADELYGYNRTRAMKRVDGIYDSIEKIFAISKRDGVPSYVAADRMAEERIAKVAKARSQFLQDQRNILNGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A role for quaternary structure in the substrate specificity of leucine dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords LEUCINE DEHYDROGENASE
total genus 137
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature ec 1.4.1.9: Leucine dehydrogenase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00208 ELFV_dehydrog Glutamate/Leucine/Phenylalanine/Valine dehydrogenase
A PF02812 ELFV_dehydrog_N Glu/Leu/Phe/Val dehydrogenase, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lehA02
3.40.50.10860 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Leucine Dehydrogenase, chain A, domain 1 1lehA01
1NNUA 2QYTA 2DU8A 1TB4A 1VKNA 3DZJA 2JJYA 4PZCA 4JN6B 5G4KA 1J6UA 1YE3A 3E1KA 4FFOA 3PTZA 4CM8B 1QLJA 1RWBA 4BMVA 3PK0A 4EUFA 5KJ6A 1D3AA 5KIAA 1H6CA 2YDXA 4H3VA 2CVOA 2GYYA 4YCAA 4U0KA 5CDUA 3GN2A 1SPXA 2FRDA 3ONFA 4HNGA 4AL4A 4DUPA 4H7PA 2O3SA 3FCOA 1I30A 2A92A 4ONEA 4Y98A 4GVXA 4LVCA 5C7LO 1IE3A 4GL4A 5DNAA 4C4OA 4BL5A 5EQFA 3GF4A 5JS6A 3AU8A 1F17A 2JFFA 4HUJA 1H6BA 5TJ9A 2WDZA 3BMOA 4BGIA 4U8GA 2OUIA 1KC3A 5IDYA 1GYPA 2Y67A 5HTOA 4LCJA 4L9RA 4Z0PA 1ORRA 3EK2A 3GVHA 4OL9A 3L4BA 1PZGA 3HZZA 1U7TA 3GEDA 2PD3A 4RPKA 1O94A 1H6DA 4MVJE 3UKOA 5JDCA 3PZBA 3D5QA 1H6AA 3CINA 3OJOA 1RM0A 5A9TA 2W90A 2AG8A 1ZEJA 1MLDA 1X1EA 5KJ1A 4JJFA 4IDEA 4QSMA 3VOSA 1HDOA 3K9QO 1LTHR 1PJ2A 1Y8QA 1YKFA 1UJMA 1DAOA 1W0CA 3RWBA 2GUGA 5IAAA 3KHUA 1C0KA 4W82A 4JJIA 4CM5A 5B37A 5EESA 3CIFA 2PWZA 9LDTA 3IAHA 3OQBA 1OC4A 4MVJF 4YRAA 3WOHA 4CV0A 1R15A 2P4QA 3DWFA 2HUNA 4F6CA 5LDHA 3TZHA 5JC1A 5K9ZA 1NVGA 1GCUA 3PPIA 1P0CA 1T1RA 4CR7A 4G5HA 3GNQA 3TL2A 1X0XA 4NZ9A 2IXBA 3FSRA 5FWNA 2WMDA 5DBFA 4TRJA 2EIHA 4G65A 4DTIA 4M87A 4J3FA 4WOJA 2WYWA 3TF5A 1EQUA 2CF6A 4B3IA 2GF2A 1ZK4A 4XX0A 4PVCA 1QYWA 5KJFA 1SO8A 1YL5A 2WE7A 4LW8A 3OFSA 5JBIA 4BKOA 3E5RA 1U3WA 4MP8A 3W6UA 4JIGA 2YY7A 3KLMX 4QFDA 3AUTA 4WKGA 5IDWA 3ZHBA 5I7VA 1T2FA 5C5IA 4UUMA 3GAFA 2PZJA 2JCYA 2O23A 1JVBA 1GZ3A 4M55A 3HDJA 1D1TA 4CLRA 4R1SA 1CDOA 2P91A 3UVEA 2VRBA 1I8TA 4PG8A 1M6WA 3FD8A 2HK8A 4YA6A 3JQGB 3WQRA 1WDMA 3CZMA 2YW9A 1B8UA 5JYEA 1AHHA 1U8XX 1ZZEA 3VH4A 3KTDA 2X58A 3RBXA 4CR6A 4KTTE 1Z7BA 3K6JA 3NDIA 4PRLA 4IGFA 4RQUA 1LEHA 1Z82A 1DRWA 3AFMA 1E7MA 1X14A 3BTSA 4N5NA 1T4BA 1U3TA 2WWRA 3A4VA 4BVAA 3TDKA 1BW9B 3RVDA 3WB9A 1DDOA 3DBLB 4HXYA 2PNFA 2OBYA 1I24A 4FFNA 3D64A 2B0JA 3H7AA 1NASA 4NU5A 4EJ0A 5CG1A 4MO2A 3QWBA 3NTRA 5T5QA 3DAGA 3EGOA 4BMNA 4NHEA 4Z0TA 3QY9A 1YDWA 5JY1A 3PP8A 4I5GA 3PDUA 3QHAA 5BT9A 4RVUA 3M1AA 1C0PA 3QW2A 1SOVA 1E1KA 4WLVA 1ADBA 1Q7GA 4MKRA 4WCFC 1HDZA 1LA2A 2EW8A 3F1LA 2SCUA 4UUPA 3O38A 4BNKA 1KYQA 2W8ZA 1Y7TA 1ZK1A 2JHFA 4NJOA 4WECA 1BVUA 4BNVA 2ZK7A 3ZWMA 4WOKA 3KV3O 4IBOA 4OAQA 4YT4A 1IZ9A 3DTTA 4OQZA 4R3NA 3ZWVA 4RJTA 4FS3A 2B4RO 4QEDA 4AJLA 3GA0A 2BKAA 3C1OA 4INAA 1CRWG 1ZMTA 3TRIA 1DSSG 3ZHZA 1K6JA 3WGGA 5DBGA 5KNLA 2Y1GA 4N54A 1I32A 3MJSA 1NQAO 2BF7A 2P4HX 4UEOA 1E3LA 5COBA 2Y0DA 4ZRMA 4LN1A 1HXHA 4URFA 1GL3A 1BXZA 4W99A 4D46A 4R69A 5LCXA 2Z1MA 1PR9A 1EDZA 3P2OA 4ZQGA 4CLOA 3A1NA 5G4LA 2UUPA 5K6AC 3PQEA 1ZJZA 1XQ1A 4OSPA 3ZWYA 1Q2XA 1Q0QA 4LSWA 2RCYA 1DFGA 4RVDA 1VM6A 4J9UE 3WS7A 1LJ8A 4QQRA 5JC8A 3PXXA 1KEVA 1WMBA 3QP9A 1K6XA 3LZ6A 4AFNA 3BMQB 1Q7CA 3B20A 3SBOA 2O7SA 2AEJA 4JGBA 1HE3A 4LRSB 1TT7A 4CM1A 2OOSA 4RPJA 1ZK0A 3U4HA 3UGKA 2X5OA 3ZHXA 3C8MA 4OXYA 4E33A 3KYDA 4Y9DA 2JD1A 2D4AA 5JNLA 3KEOA 1DLJA 4L75A 2D5AA 1ZNQO 4EJMA 4RO0A 3FNEA 1X13A 4Z0HO 3ZWNA 2GDZA 1YOVA 3HDYA 3GGGA 2ZTMA 1IULA 4NFYA 3P2YA 4XR4A 2EKLA 4E5YA 3ONEA 1GYQA 1E3SA 3JD1A 1EE9A 1XHLA 1YO6A 2H1SA 4EUHA 5A3VA 1FF9A 2QQ5A 2JKVA 3VDQA 4CUZA 5BSGA 3IC5A 4FFLA 3B1JA 1UZNA 3I6QA 4E0BA 4BNYA 5L3ZA 1U8FO 5DBIA 5KWEA 5JDIA 2C0CA 3NUGA 3P7MA 5BQFA 2A94A 3JQGA 4DPKA 1QYVA 5JCJD 3F5QA 2NQ8A 3WGYA 1MXFA 5KKCA 3PGXA 4DPMA 3L6OO 1PGNA 3T7EA 3GNTA 3LF1A 4BV9A 4XDZA 3ETGA 4UVEA 1QSGA 1WZIA 1QORA 3GVXA 3S2IA 3SLKA 4BKUA 1J49A 1SZJG 3O26A 4J1QA 2VT3A 4CLOB 3GK3A 1OZAA 1GV1A 4DLAA 5ITWA 3AUAA 1E1LA 3PI7A 4R5MA 4DIFA 2IODA 4YRBA 3IIEA 1I2ZA 1FDUA 1LX6A 2RIRA 3FNFA 2Q49A 1XR3A 4E21A 1NFRA 4KWIA 2PY6A 2X9NA 3IP1A 4PVDA 3GGPA 5DCWA 1HWYA 3MEQA 1A7AA 3V1UA 5JW6A 1D8AA 4YQZA 5A04A 1YVEI 4CPDA 1I3LA 4U6QA 3DMTC 4M54A 2NQTA 4J6FA 5I8WA 4E13A 1PIWA 4R9RA 4II2A 4RORA 1SBYA 3VHRA 2YFHA 1HDGO 3K31A 4QXMA 4I1IA 3OJLA 4P4GA 1GYRA 4WGGA 1B8PA 3GVCA 1EQ2A 3ROPA 3WSWA 3MJVA 3BZUA 4LRTB 1B16A 2HJRA 1F8FA 2G17A 3NTQA 1QV7A 1H9BA 4XRRA 5ADHA 4UEJA 2NTJA 4EBFA 1QKIA 3NDJA 4LMPA 5DCYA 1UUFA 2NU6A 4MKXA 2VWQA 5GZ1A 4ZHSA 1DC3A 4OGWA 1T2DA 2NACA 1CETA 1XKQA 4E5PA 2X5JO 3PIIA 1NFQA 2OGUA 1JU9A 4LMRA 4P8RA 1V9LA 2BGMA 4GPD1 5GZ6A 4B8WA 1VPDA 4PLHA 4D79A 4R3WA 1ENZA 4J7CA 4IMRA 2V6FA 2POQX 3GDGA 4PCVA 1MB4A 5F5LA 1HLDA 3BMQA 4TRMA 3QA9A 1R6DA 3OH8A 1ZUD1 1C0LA 2DFDA 3ANMA 3LDHA 3OIGA 1E6WA 4J2HA 5A9SA 2FWMX 5F1KA 2EJWA 2ZQYA 1FK8A 4B4UA 1RKXA 4IUYA 4DVJA 4I08A 3DMTA 3CH6A 4F3YA 1KY5A 5JLAA 5CEFA 2VNAA 1W4ZA 4N7RA 4OOEA 1YQGA 3I23A 5DF1A 5EJ2A 3W6ZA 4PLGA 2Q2VA 5U9CA 1SOWA 2AE1A 1JVSA 4CL8A 1GADO 4ALNA 3VKVA 1CIVA 4OJNA 3ST7A 1A4IA 2PKRA 1GPJA 2DQ4A 3WYBA 5EL0A 4W7IA 1ONNA 1DHRA 1LC3A 4GX1A 5IZ4A 1RM5A 3NJ8A 2VYND 5HWSA 1EBUA 1IB6A 1NWHA 2Q2WA 1P1JA 2IZ1A 1HEUA 4ZQEA 1AN9A 4YQYA 3NT4A 4PLTA 2B83A 2PKQP 1Z6ZA 3D3WB 2UV8A 2H6EA 3RFXA 4JBIA 1FJHA 5FYDA 1NVMB 4UVIA 4FJ2A 3RKUA 2BHLA 3IP3A 3K2EA 3C85A 3LQFA 3BMCA 5L7YA 3SJUA 2NUAA 3RFTA 1D4FA 3GH3A 4L4SA 4PRKA 4FD3A 3IKTA 3PJEA 5TT1A 4KDFA 2VUTA 2EKQA 3HNPA 3JQ9C 4O0LA 4E2WA 4ALJA 1DC6A 4ALLA 4IQ0A 4GBJA 4N5LA 3O9ZA 4CM9A 1U3VA 1ZK3A 5JAIA 1Y9EA 3G1TA 3ORFA 4CM8A 1B2LA 1PGQA 4F6LA 3U09A 1XEAA 1LRJA 3PHJA 1N2SA 3ZCXA 3C7AA 3WWZA 1LSOA 4BO9A 1G6KA 5CDYA 1EVIA 5ER9A 1VJ1A 3E48A 2FR0A 4WLEA 4E5NA 3WJ7A 4YVFA 4RF2A 1I33A 2ZYGA 3F47A 2VYVA 3AI2A 1XIVA 3LVFO 2VCYA 1PSDA 3JYNA 5FEUA 3DBHB 4MJLA 2EGHA 4H16A 5IDXA 3JYLA 2B4QA 3WFJA 1RM4A 1WDKA 4CQLB 3JYQA 2C07A 1PWZA 1TXGA 1MXHA 4J4HA 3ASUA 4KTVE 1ISJA 1UDBA 4QT0A 4YPOA 4KUEA 1T2CA 5B1YA 2XOXA 3RC7A 4A73A 3JQ8A 1Z74A 2HMWA 3I9JA 3D4NA 5L45A 4HKTA 4Y6RA 3ADPA 3INRA 3JQAD 5AXBA 4BQPA 1GEEA 3M6IA 3OMLA 1J0XO 1K0UA 2V6MA 3JQAA 4ND1A 1B3BA 1EDOA 2YJZA 1EMDA 4NJMB 4YJHB 4R01A 5C3MA 1PR3A 3I9NA 1IY8A 3GT0A 1U4OA 1I2CA 1ARZA 2RAFA 3S8MA 3TOXA 1LUAA 1LQTA 3PYMA 1NTOA 4QX6A 4R4JA 4XJSA 4CLDA 5J23A 2VQ3A 4D44A 3TFQA 5KOIA 1P77A 1DIRA 2H9IA 4NNJA 2A35A 4FIZA 2YQ4A 1VKOA 3B1KA 3I6IA 4DXHA 3U3XA 3WBFA 3DAFA 3VPXA 3E9NA 3GY0A 1DEHA 3NRCA 5AOVA 3WR5A 3I9MA 1KVQA 2EF1A 3AI1A 1DRUA 2HKIA 4ND5A 4PLZA 2D5CA 3QSGA 4GLLA 1UAYA 3MOGA 4YR9A 3WSVA 1PQUA 3CXRA 1TEHA 3AY3A 5T67A 3EZYA 1YBVA 3U5TA 3ZV5A 3IKVA 3DZKA 4BO1A 4CMHA 1FDWA 3GFBA 3AOEA 2BGKA 4IGEA 4BNGA 3NT2A 1O9BA 2ZKLA 3MWDB 5CFZA 1UH5A 4XQGA 1ZW1A 2WD7A 3PLRA 4NFSA 4BO3A 3EYWA 4QUKA 1EK6A 1HDXA 3MTGA 2CZCA 3BXXA 4YJDA 3VPHA 1ISIA 4J91A 3DMYA 4BKQA 4B4VA 1PTJA 4L8VA 1U2GA 1XSEA 5FI5A 1PX0A 4B4WA 5T57A 3HSKA 2IYOA 4TVOA 1CF2O 4YT8A 5JDIC 3RQSA 4XB1A 1DFIA 3ZNOA 1O8CA 4YBZA 3KZVA 1EVYA 3CTMA 1JQBA 2ILTA 5CPFA 3ZNQA 4XWYA 3U4DA 4NJMA 4YJHA 1TLTA 3W4JA 1E1NA 4K6CA 2HCTA 3LK7A 1SCUA 4B7XA 2XXJA 4XA8A 3DXFA 2Q1SA 3AW9A 3VC7A 5I7EA 1NPTO 4W9NA 4CV1A 2BI8A 1EUDA 2BLLA 1Y1PA 1CWUA 5KTKA 1N9GB 2OL4A 3ZU4A 5DP1A 2AQHA 2C7GA 3KYCA 5DP2A 4FGWA 4DIOA 4BMSA 2YHIA 4Q3BA 4U7WA 1U28A 1KS9A 4B79A 1LDBA 4IPTA 1P1FA 1JAYA 2BFOA 1JTVA 5JO0A 4LISA 3PQDA 1PGPA 2YHUA 5BR7A 3WICA 3G49A 3NGLA 4II3A 4CMAA 1YL6A 3E6AA 3CE6A 1Y8RA 1ZMOA 3ZN2A 1A9YA 3ETEA 1Z7EA 1YB4A 1D7OA 3LT4A 3RUEA 4FB5A 3PWSA 4PLCA 4XR9A 4JP2A 3GR6A 2UYYA 3JQ8B 2NM0A 2D0IA 3GRPA 3N74A 3VTZA 4BKRA 1ONOA 4K9DA 3JCZA 1T26A 4L73A 4PLWA 1AHIA 3JQAB 4BNLA 4CMCA 1E6UA 1V0JA 3DHYA 4KDEA 4GI2A 3PHHA 4EYEA 2DTXA 4UVHA 3COSA 5FI3A 3L6DA 4BO8A 3F5SA 3CEAA 2ET6A 1NR7A 1PEDA 2EHDA 3EMKA 2DM6A 2YV2A 3ONDA 2EW2A 2DPHA 3TZKA 1I01A 3OETA 2HDHA 3S55A 1NXQA 1PJTA 3UW3A 4MVJA 2XAAA 3JQ7B 2O7QA 1HT0A 1XLTA 1MFZA 4D3DA 3IMFA 3WDSA 2JFHA 3K5PA 4I8XA 4IY1A 1ZBQA 2WE8A 4XQCA 3AM5A 1NAHA 5DULA 1DOHA 5CPBA 5B4VA 4GX2A 4LCEA 2EERA 4U5QA 1Q7BA 3AY7A 4W4TA 3U4CA 4A26A 4LVUA 3RD5A 4AJNA 3DBVO 3V8BA 2J3HA 1P1HA 4XYEA 4Z9FA 1XGKA 3S2GA 2AW5A 5TSDA 5L40A 3EVTA 4D41A 3U9LA 3ITDA 4RF4A 4IDCA 2Q4EA 4UAGA 1LLDA 4Q9NA 1XA0A 3ENKA 3AUSA 1HZJA 1YH3A 2EG9A 2Q4BA 2OFPA 3D4OA 3ZWBA 2VOEA 3PIDA 1P1RA 4NMHA 3OP4A 3PVZA 1E3IA 2W2LA 1SEPA 3CMMA 4EGFA 1DPGA 1BSVA 1LLQA 2PR2A 3O8QB 1UXJA 1E3JA 3RI3A 1RJWA 3OICA 3UXYA 2JFGA 2OP0A 1DIHA 1UDAA 3BMNA 3RUAA 3UOGA 4DREA 1NM5A 3VPSA 3V2HA 5KJCA 4WCFA 2X6TA 4N18A 1HSZA 5F21A 1C1DA 3RAJA 1QR6A 3JQ9A 3BHIA 3Q3CA 3OIFA 3ITKA 4FFRA 4BO0A 2QYSA 1GPDG 3WGIA 4RDHA 2BRUA 4CM9D 1FXSA 4D42A 1O95A 1ZCJA 4A03A 1M2WA 3LLSA 4FN4A 5CG2A 5H82A 1SAYA 3MJCA 3WLEA 4CUJA 5A02A 2XF8A 4EI2A 2VZ0A 2VYNA 3VVCA 4JBGA 3JSAA 2B5VA 2PGDA 1ZO8A 4BO5A 2W2LD 1I3NA 3WQSB 3HFSA 3NTOA 2Y66A 2X1HA 4RV9A 3PHIA 1PWXA 4AJPA 1WMAA 1C3VA 1YRLA 1PJ3A 2A9FA 2VYVD 4ALMA 4TRNA 3W8FA 1L7DA 2PLAA 4A10A 1X0VA 2Y0CA 2EKPA 1A71A 4J43A 1MX3A 4UVGA 4UREA 3RUFA 3GRKA 4CL3A 1IPFA 2D3TA 3ZW9A 3UCXA 1A7KA 4BQRA 4J7UA 4E2XA 4EJ6A 2VRCA 3GLQA 5DN9A 4IDGA 4PFJA 2ZCVA 2VHXA 2ZATA 2X8LA 1PL6A 3BMCB 5BNIA 1Y8QB 4A7PA 4BNHA 3EZLA 1ULUA 3D1LA 2GN8A 1GFSA 4I9HA 5C7OO 1F8GA 3H3JA 2GN6A 3DONA 3WMWA 1AUPA 3M2TA 3DAPA 3BA1A 3ENNA 5EPOA 4CLXA 2JCXA 3AUUA 1WNTA 3I3OA 3I83A 1HTBA 1W73A 2QIOA 5F5NA 4DIBA 4A5OA 4NBRA 2YHIB 3STHA 3H9JA 3DBRB 4J1TA 3TOZA 5H81A 3ANNA 3RC1A 1WW8A 1P33A 5TNXA 4B4OA 3I4FA 3WGZA 3MJ4A 4BKPA 3QWAA 2VUUA 2J5KA 5K6AA 2C82A 4DC1A 1VL8A 2W2KA 3QWIA 1X1TA 3TWOA 1ISMA 1EVZA 1PS0A 3IJPA 3FRJA 5I8ZA 3RASA 4I9UA 1DJQA 2O50A 4FOOA 1JA9A 4RVHA 3K2BA 4X54A 4TVBA 3ZWCA 1KOLA 2AA3A 2BFPA 4YDRA 3W4IA 4MPDA 5IG2A 1PJCA 2Y05A 3WLFA 5EINA 3UAGA 3IQDB 1B7GO 3R0IA 1K3TA 2JAHA 3AOEC 4FOSA 4Y6PA 2P9CA 4R16A 2VOJA 3GFGA 3OA2A 2FN7A 3OJEA 3C3XA 4TSKA 5TS3A 4P4LA 4PLVA 4A0SA 3F4BA 2ZCUA 1E92A 4ZA2A 1C14A 3UHAA 1RYEA 2IE0A 3QVWA 4M49A 4PLPA 1UZMA 1I0ZA 1LBEA 1HF3A 3P5SA 2Y1CA 4GX0A 2NVUB 3T4XA 3KO8A 5T8KC 1EVJA 4LSMA 4YAEA 2P5UA 1UP7A 1VL6A 4YTEA 4GWGA 2RH8A 5BSFA 1UR5A 3OHSX 3WGHA 4ALKA 1C1XB 4BS9A 4EDFA 2G76A 2VWGA 4HBGA 3ZU5A 4I5EA 1N7HA 3DBLA 4AJEA 2R2GA 4HY3A 3NAQA 5CEEA 3WX0A 5EQDA 2AEFA 2ZB4A 4EW6A 5L4SA 3KBOA 4CM3A 4YAIA 1AE1A 1Y5MA 5IZCC 2YQ5A 3PRJA 3ZV3A 2VHYA 4IS3A 1UP4A 2B36A 3H3FA 4W9NC 3GOHA 3TZCA 1HKUA 4Q3EA 1PJSA 2UUOA 4R1UA 2XXBA 1BHSA 2GNAA 4DYVA 3K8ZA 1E6EA 1LNQA 2X0IA 4CQMB 3PWKA 2ZJ1A 4HADA 3FN4A 2C5EA 7MDHA 4D45A 3A06A 1R4NA 2W2KB 3WYCA 1XCBA 4XGNA 3BTUA 1ZFNA 2FPPA 1G0NA 2X0RA 4U0JA 3MJTA 1ENOA 2J3JA 1MP0A 3DZGA 4J1NA 2DBVO 4CODB 1DBVO 2GZ1A 3KOUA 3ULKA 2O48X 4XZ3A 1JN0A 2VTDA 3F46A 2CY0A 1LDNA 1V3VA 4DYDA 3HN7A 5JE8A 2QRJA 1ID1A 4IDBA 3JQCA 4WE3A 1T2EA 1GAEO 5AVOA 3LC2O 5JAQA 3UFXA 1X7DA 5H83A 3R3JA 2VTEA 2X86A 3QWHA 4JBHA 4Y6SA 2W98A 4K28A 4CMGA 4R68A 1XYGA 4WCFB 4DA9A 5ES3A 1SNYA 3INGA 4CM4B 1EFKA 3FHLA 4XCVA 1VRWA 6ADHA 3RUCA 2CF5A 1TA4A 4IJVA 4YYZA 1WZEA 4GGPA 2HMTA 2E48A 3K73O 4FW8A 2G1UA 2WM3A 1VSUA 3KSUA 1E3EA 4XB2A 7ADHA 3DBRA 4EEZA 2I9PA 1E7YA 3RC9A 2RHRA 4NFHA 3AOGA 4BB5A 3AM4A 4Z9XA 1R0SA 3L9WA 4R5HA 3IUSA 4RGBA 4YAKA 4Z9YA 3KRTA 3GNSA 2NSDA 5HRUA 1YOVB 4WNIA 2HU2A 2OMEA 4DRYA 3NEPX 3QE3A 1WP4A 1K6IA 2HJSA 4PZDA 4I5DA 4Q3DA 4ZRNA 4WEOA 2BMAA 3GMSA 5THKA 4CM7A 5L51A 2NV6A 4OM8A 2CNBA 1YJ8A 2IDZA 3D3EA 2Y1FA 1NP3A 1ISGA 1I10A 1KY4A 4XRGA 3QV1A 2WD7B 3EDMA 3SXPA 5KVQA 2P9EA 1BWSA 3T7CA 4BNMA 1O5IA 3K30A 2NU7A 2O3RA 3Q2KA 2CDBA 4PLYA 3PYLA 4AJHA 1XU7A 1B26A 4NH4A 6LDHA 4RVGA 2Q1UA 3QLJA 2CD9A 2FP4A 4L4RA 3KB6A 1OMOA 4IQ8A 5JFOA 1U3UA 1VL0A 2I66A 4NU6A 4R51A 5CHEA 1B8VA 1IHXA 3HB4X 5EIOA 3TSCA 4PIVA 2OP1A 4XGKA 5ER6A 3LSYA 5K0ZA 4IXTA 1WXDA 3TZQA 5I9MA 4J49A 4CMBA 3Q9NA 1NX6A 2YDYA 3JQ6A 2O3QA 1F06A 3GGOA 1B3RA 2NVBA 2X22A 1L1FA 4J4BA 1XU9A 3AU9A 1S7CA 2JD0A 4QTZA 1P1KA 1ZKMA 1LSJA 5GMOA 4IS2A 4NBVA 3E9MA 1HYEA 3G0OA 1DC5A 2OZPA 2AQ8A 3C7CB 3RSHA 3UN1A 2JL1A 3LC7O 3D5TA 5KVCA 3K92A 5A1TA 4BGVA 1NQ5A 3GUCA 3VZPA 3H65A 5F3RA 3ASVA 2QZ9A 1F14A 3GC6A 1SB8A 1HSOA 1ZXLA 2FR1A 4KUHA 5B12A 1R4NB 1LLCA 2J8ZA 3MJEA 5AQ1A 1NPYA 4DQVA 1O6ZA 4FDAA 4GLOA 1F0YA 4AJIA 5I7FA 4J7XA 2O3TA 4HWKA 2BGLA 3Q9UA 1YJQA 4KOAA 3RIHA 3I4CA 3QIVA 2LDBA 5BSHA 2DBRA 2A4KA 3H9GA 1DIAA 1GV0A 3L77A 1NQOA 3I9LA 4J0FA 2Q1TA 4K26A 3PHLA 1W8DA 2NWQA 4ZVVA 1E5LA 1C0IA 4RCVA 1HYGA 1AGNA 4FQ8A 4WLOA 3PJFA 3QVSA 2O4UX 5JO9A 4OSOA 1E7QA 3V5NA 2GR9A 1YB1A 1KVRA 3OQ1A 1J5PA 1C1XA 1DFHA 3PEFA 4IMPA 2DUWA 5G2OA 2C2XA 4AG3A 1BXGB 3B6ZA 2OXIA 4Q3AA 1GTMA 4YACA 1ZIDA 2YFQA 3GEGA 3U4IA 5AXDA 1NHGA 3LT1A 1MGOA 4WPGA 3QVOA 1JAXA 1E77A 1EZ4A 1CERA 1HE4A 3UH1A 1GQYA 5HA5A 1C1DB 2VNSA 4AJKA 1TI7A 5A9SB 1GDHA 3LT0A 3TNLA 3A9WA 3R3SA 1WAMA 1H2HA 5C7IO 4B7CA 4K6FA 1QYDA 5ENDA 4O63O 5AXCA 2DBZA 2VHVA 2ZYDA 4M89A 5BNTA 2P2SA 2PGJA 5CDGA 3LLVA 3KYDB 4E30A 3DOJA 2BFMA 3E03A 5DOZA 2IEDA 3B1FA 4JK3A 4XDYA 4DPLA 3WWYA 1RPNA 4IDFA 1WDLA 4ESOA 2J5QA 3UF0A 1NPDA 2YUTA 3BTOA 3PFFA 3ZNPA 4TMFA 4DQXA 2TMGA 5THQA 2FPIA 4N5MA 4MIYA 4C7KA 1OFGA 3A28A 4GH5A 1T24A 4TKMA 4CQLA 4PLFA 2CDCA 3Q6IA 4BGUA 1QLHA 2C5AA 1M67A 2G5CA 1HE2A 1R37A 2Y93A 3HDHA 1BDMA 3RROA 4MVJG 4XGIA 4HFMA 3O8QA 3NKLA 2EXXA 4YRDA 3CKYA 5C37A 1EBFA 3M2PA 4JCOA 4JROA 3OEWA 3GZ4A 3Q1LA 1VC2A 1JKJA 3OIDA 1ADGA 4ROSA 2XPCA 4CLHA 3CPSA 4HNHA 4CM4A 3PHGA 4OMUA 3AI3A 2J3IA 1DC4A 5B4TA 1X7GA 5TC4A 2OORA 3H9EO 4XYBA 5A5FA 2ZYAA 2E82A 3H9QA 1JLLA 5IN4A 2Y0EA 1GU7A 1N5DA 4E3ZA 1JKFA 1KETA 3TPCA 2JD2A 3FNGA 1B15A 3H6KA 1S6YA 1PQPA 9LDBA 4E31A 1RYDA 3MWEB 1U9JA 4Y67A 5A5EA 5BNFA 2HK9A 2PK3A 4E32A 1TT5A 4O59O 4F45A 1AXEA 4BNXA 3BYZA 5A9RA 1E3WB 2WJPA 3RCBA 4UVDA 2HQ1A 4CQMD 2HRBA 4ZD6A 1ZEMA 4J90A 4UEKA 2VHWA 1MFPA 8LDHA 5L7WA 3ZU2A 2G82A 4GMGA 4KQWA 1V3UA 2HMVA 4RQTA 1BRMA 1I3KA 4FJ1A 1XG5A 4XIYA 2CUKA 2AXQA 3HG7A 4E2YA 1EFLA 5IDQA 4GSKA 2P5YA 1L7EA 3RJ5A 2NVWA 4YT2A 1QYCA 1NHWA 2BD0A 2ZTUA 1XDWA 5EN4A 1YL7A 1MUUA 4O6VA 5KVSA 1HLPA 5JCXA 1LDMA 4L4XA 2PH3A 1HDYA 3N58A 3I52A 2OHXA 1LDYA 2FMUA 1VJ0A 3RBVA 1J4AA 4YXFA 3IUPA 3DHEA 4PZEA 3TFOA 3RJ9A 3U0BA 5TIIA 2ZB8A 4ND2A 5KCZA 4XKJA 3RC2A 3RU7A 1Y81A 5TX7A 4GVLA 1ZK2A 3WYEA 1O0SA 3ZI0A 5BSEA 3JD4A 1GCOA 3L6EA 3GPDG 3SVTA 1BVRA 4OQYA 1T1SA 1KEUA 1BG6A 4KWHA 1U5AA 5CDSA 1HDRA 2AMFA 2PD4A 1XWFA 1ML3A 4IJUA 1HDCA 1EUZA 3R6DA 3ZU3A 3OEYA 1DHTA 4BNJA 5TLSA 2J3KA 2V7PA 2Y99A 1QMGA 2YV1A 4MDHA 4AJ1A 4BO2A 3WXBA 1N1GA 3HN2A 4BNUA 4G81A 3UICA 3FBTA 3C1TA 2QW8A 3EW7A 5I9NA 3WNQA 1IPEA 3ICCA 2Q50A 5IN5A 2GZ2A 2Q99A 3B70A 4P4NA 1PZEA 3H2ZA 1H5QA 5GY7A 5JY6A 2I5PO 3WG9A 1OOEA 2GGSA 1N7GA 2C29D 2YZ7A 2D59A 1FMCA 3D3WA 3DEYX 1LXCA 3HFGA 2DPGA 1M66A 1DXYA 1OBFO 2YYYA 3U49A 2FY8A 3H8VA 4ZICA 1G1AA 1QV6A 1PL8A 3PLNA 3FI9A 1UAGA 4OXKA 2X9VA 4FC6A 3VPGA 5JAZA 2I76A 4RF5A 4DQUA 2WEKA 5ENVA 4BNWA 4XJTA 1IOLA 4AJ2A 4E5MA 4JLWA 5DCUA 4CLEA 3V2UA 4E12A 2C2YA 2BI7A 4ND4A 3IDSA 4BOYA 1Z75A 3FWNA 4CMKA 5HS4A 3NT5A 2PZMA 4BNIA 2CFCA 1Y6JA 4Z3DA 4MVJM 3KYCB 3DQPA 3ICPA 8ADHA 2PV7A 1WWKA 5TF4A 1W6UA 1AXGA 1X15A 3FPCA 1Z45A 2R00C 1K89A 2AHRA 3W8EA 1ISHA 4FBGA 4HP8A 5JDCC 3W8DA 1F12A 1TVEA 4W7HA 3VPFA 4YJFB 3ZW8A 2NU8A 2DBQA 4O5OA 1D1SA 2O3JA 3FWZA 4WEQA 2HAEA 4O1MA 4MVJI 4ID9A 1T2AA 4OHUA 4BNNA 3BHJA 2D1YA 4RPLA 1HYHA 3DO5A 4S3MA 3GDFA 4KQXA 4LGVA 4BO7A 1E0DA 1HL3A 2IRWA 4J1SA 4CV3A 4IDDA 4IXWA 2X0JA 2ZIZA 4IJKA 4YB8A 3D4PA 3WJAA 3X2FA 5TQVA 1P9LA 3HUDA 2I6TA 2Q45A 5L53A 4CMEC 1IUKA 1ULSA 1H2BA 1VSVA 1GUFA 2EEZA 2EV9A 3QJ5A 4E5KA 3E9QA 1YS4A 3DDNA 1M75A 2C59A 4JX8A 4YEDA 3MZ0A 1P0FA 3ZWOA 4P22A 4RVSA 3BMNB 3W4KA 2RHCA 4GWKA 3KSDO 3IOYA 2VWPA 3GPIA 3VAZA 2DTEA 4NR0A 2O3UA 4R54A 4M86A 4UULA 3V1TC 4XQEA 1CQIA 4ZQFA 1Q0HA 3DFUA 1PL7A 1GZ4A 1MC4A 3FBGA 4WUVA 4DLBA 4NK4A 4P38A 3WGTA 4AICA 2CVZA 5A03A 1E3WA 3DC2A 1R0KA 4ZGWA 4IQGA 1ZJYA 3HADA 4RPGA 4NBUA 3TJRA 3FTPA 1LSSA 4YJFA 2VWHA 4J16A 5MDHA 4XEHA 2E4AA 1A27A 2FSVA 3FTNA 4RDIA 4D0SA 4JNKA 3ZV4A 2YV3A 4Q3CA 3FNHA 3DZIA 2HK7A 2I65A 1ZH8A 1B14A 3JQFC 4U6SA 4Q39A 2DFVA 4YAJA 3F6YA 5IFLA 3I1JA 3GG2A 1JKIA 5EERA 1JDJA 2GPTA 2HLPA 2RH4A 3S1LA 2Y1EA 2WD8A 4BO6A 3W1VA 5JCJA 3UCFA 2Q3EA 1U2DA 2BH9A 3FR8A 3LT2A 4TQGA 5DT9A 3RUHA 3ZWWA 4G2NA 1LSUA 2J6IA 1K5HA 2O2SA 2D2IA 3Q0EA 4NBWA 5FFFA 1U4SA 2Y68A 2B4TO 3TZ6A 5JMPA 5B4UA 2GLXA 3VZSA 2DC1A 3IS3A 3DOOA 1T4DA 4OOFA 1BGVA 3NX4A 4XYGA 4A2CA 4KP7A 1OI7A 4JQCA 3JD2A 3UUWA 5L4LA 5A05A 1FDVA 1BXGA 1GY8A 2V6BA 4XQ9A 5ILGA 3JQDA 2PKQO 4J4TA 4WCDA 1MG0A 4XYLA 4HV4A 4DMLA 3L4BC 4RF3A 1GR0A 1IHYA 1PU2A 3E18A 3LU1A 4R1TA 2X9GA 4DC0A 3T4EA 1QG6A 4M8SA 5L4NA 1H9AA 3H4VA 3LF2A 4L76A 1X7HA 2Q1WA 2J5RA 1ONPA 3H5NA 3H5RA 2V6GA 1CYDA 4QO8A 4MVJH 4NIMA 3ADOA 3CSDA 5JMWA 3OSUA 4K1LA 3DFZA 1YGYA 4Y8VA 1M76A 1ZSYA 3M1LA 4NK5A 4CMJA 3ZWPA 2I99A 3GEMA 5F1OA 4RLSA 3OJFA 1A4UA 3JQFA 1XELA 2PFGA 3NJ4A 3ROQA 4L74A 4AJ4A 5JAMA 3DZHA 3NYWA 1IYZA 1PZFA 1Y5RA 3VZRA 4BO4A 4QO7A 3HB5X 4GX5A 5IZCA 4WLUA 2QRLA 1P74A 2B5WA 3CUKA 2DLDA 1SEVA 2FOIA 4NBTA 3A14A 1DRVA 2PH5A 2RBEA 1ADFA 4UUOA 4GGOA 1YQDA 2EJVA 3BIOA 3H2SA 3FF4A 1ZSVA 3BAZA 3L0DA 5KVVA 4RZIA 1ISFA 1KEPA 4H15A 4XIJA 5CP8A 1U5CA 3MOIA 3AK4A 4IIVA 3ZWAA 4ZU3A 3ROMA 1N1EA 4J0EA 3WIDA 5I9LA 2EP5A 1GQQA 3WTCA 5U1PA 4MVJP 1PJQA 1UDCA 1UP6A 3EY4A 3NGXA 5LDGA 4JJGA 4ZJUA 5CEJA 2UAGA 1DB3A 5IXYA 4OIMA 2E6UX 1DO8A 2VN8A 4R41A 4R9SA 1A5ZA 2GZ3A 1BXKA 1CJCA 2EWMA 2AG5A 3I9KA 1WPQA 3O4RA 1VJTA 3KSZO 1UXGA 1E7WA 2VZ9A 3VH3A 5G0UA 3UCEA 4MP3A 4YT5A 3SJ7A 4WLFA 3WBBA 3DHNA 4Q3NA 1WVGA 4KZPA 4E6PA 2X5KO 3V1YA 2NADA 4EITA 1P31A 1Q1NA 4MIEA 1MG5A 1KEWA 3PQFA 2X0NA 4GKBA 4L0QA 3ZH2A 4BNZA 4C7JA 4XYMA 3N7UA 4CM6A 4IDAA 1RM3A 2CSUA 3Q11A 4BV8A 5T6BA 1MC5A 1LDGA 1I3MA 1DAPA 1A9ZA 3AWDA 4BHTA 3QWFA 2GD1O 2GASA 3BMOB 4FC7A 1FDTA 3DZFA 1N8KA 2DT5A 4RL6A 4EUEA 5CDTA 4FSHA 1NR1A 3OF2A 3ZV6A 5G0SA 4FGSA 3OM9A 1E7SA 4NDNE 2R00A 4D7AA 1PZHA 5TRTA 1EUCA 1GQ2A 4Z3KA 5HM8A 3NV9A 5IJZA 1YQXA 2AE2A 3GVIA 3O03A 4ZQBA 4D3FA 3AJRA 1R16A 4IIUA 1UXIA 2VZ8A 3SLGA 1I5RA 3EUWA 4J2OA 1K2WA 1P1IA 5T64A 2P68A 3FR7A 3S2EA 1PS9A 2NVUA 4DMMA 2PA3A 3HWRA 1QRRA 1T25A 4RPHA 4TZTA 3SC4A 1BMDA 3ZGYA 3LYLA 2B35A 2HRZA 4FFPA 1M6HA 1NFFA 3V2GA 4NQZA 2FR8A 5T8KA 3PJDA 2R6JA 4JXKA 1Z73A 1V35A 3FPLA 4TROA 4OO3A 4WJZA 3DR3A 2DAPA 1YWGO 3HJAA 3SX2A 4DL9A 2O4CA 1LC0A 2FZWA 4IZHA 5DZSA 2I3AA 2Z95A 2F1KA 3OQ6A 3C1AA 3JQBA 2GERA 4PG4A 2NNLD 2BFAA 5HBRA 2PZLA 3HE3A 2X23A 3S2FA 3H5AA 5TGDA 5G0WA 2Z5LA 3QVTA 3GDOA 3D0OA 1R4MB 4FR5A 4PG6A 1E5QA 4BGEA 1XQ6A 2GRAA 1TT5B 4R1NA 4I5FA 2AEMA 4CQMA 2AQKA 3DOCA 3NDRA 4D0RA 3ABIA 1VE9A 5EMHA 3ZWXA 2HO5A 1ZSNA 2PTGA 3KXDA 1Y8RB 1LRLA 1DJNA 3GZNA 3OA0A 3WTBA 1PGOA 2VT2A 2ZQZA 4CUKA 3PDJA 2I3GA 1YDEA 3WGQA 3DZBA 4TRRA 3G17A 4BUCA 4FPXA 1SB9A 1E7RA 5JYDA 3TN7A 1NQTA 4MOWA 1H94A 3WNVA 1NBOA 4YJGA 3U62A 3JD0A 1PQWA 4BNFA 3R1IA 3VZQA 3ZZNA 4OYRA 3DL2A 4EZBA 2GSDA 1DIBA 3L4SO 1ZVMA 4ZQHA 4MIOA 1CEQA 3WQQA 4CMIA 1KVTA 2BELA 5AXAA 4FJ0A 4OKNA 1V8BA 3QRWA 4MKZA 4RLHA 1YXMA 1ENPA 1BW9A 2OO5A 2ZB7A 3EHEA 3G3EA 3JQBC 5TT0A 4FCCA 4IINA 4J9VA 2VHZA 3F9IA 3RU9A 3WMXA 5LC1A 3GHHA 2QRKA 1UXKA 4WLNA 3KEQA 4DBVO 2GO1A 2WYUA 3VH2A 5G4KB 1U1IA 4PG5A 4B8ZA 2F00A 3GG9A 4M1QA 2Q46A 3WFIA 3ZNNA 5FF9A 2HSDA 3DTYA 2I67A 1N92A 2QG4A 5A06A 1HRDA 4TZKA 1NVTA 3ZDFA 1LDEA 4B3HA 2LDXA 1YBAA 3KUXA 3GMDA 3CMCO 2G0TA 3DBHA 4B7UA 1P45A 4ITUA 1BDBA 2PZKA 2Q2QA 3QVXA 4W6ZA 3JYPA 1R12A 2C20A 2FSSA 2E37A 3KLPX 3C24A 2D8AA 3HDQA 4LK3A 3VKUA 4DWVA 4JP3A 1VI2A 1R66A 1YB5A 2FPGA 2Y1OA 5GZ3A 1KVSA 1YBMA 2DUUA 1KIFA 3ZHYA 2B69A 2ZB3A 2PGLA 1H0KA 2NU9A 4WK6A 2C54A 2ZJ0A 1ENYA 5ICMA 1DLIA 3JTMA 2Y1DA 5KJEA 1ZXBA 2UDPA 2C7VA 3I5MA 4IZIA 4DBZA 1E1MA 4GAEA 4GMFA 2X7HA 2GN4A 3VVBA 4HFJA 3PGJA 1B0AA 4DLLA 3D7LA 1JW9B 1GZ6A 1V6AA 3GVPA 2DKNA 4ALIA 4F46A 4E4YA 4KMSA 3ETDA 2IYPA 2P9GA 3F3SA 3KYBA 3PYXA 1NWCA 4WNCA 2QHXA 3GUYA 4OH1A 5ILOA 1PJBA 5IXSA 5JXWA 1CQJA 1GD1O 3L07A 4UUNA 2IZ0A 1SMKA 2OBNA 3RFVA 2QX7A 2E49A 4QFCA 3VH1A 5A3JA 4I9NA 1SC6A 2EP7A 3E8XA 1KVUA 2TMDA 3HQ4O 3KVOA 1Y9AA 1LLUA 4XD2A 4YWJA 3LC1O 5TJHA 5DDIP 3TQHA 4BIIA 3OJ0A 5HS6A 1R0LA 3RUDA 1I36A 3JD3A 4RVFA 1PGJA 1QYXA 3EC7A 3K96A 3AFNA 3ROKA 3GZNB 1OC2A 3JYOA 4GQAA 4WASA 3RUIA 5ICSA 1I2BA 4GSLA 3RBZA 2GN9A 4NI5A 4DGSA 2V65A 5G0TA 1PJLA 5F1PA 1A72A 1LU9A 1H93A 2HMSA 3G79A 4PN3A 1PJ4A 5JSFA 4BB6A 4YJGB 1BTOA 1MV8A 3GHYA 1NYTA 5CAEA 2GCGA 3ON5A 1NAIA 3MCVA 4PG7A 4MP6A 2JAPA 1P44A 1JWAB 3BTVA 4FFMA 4A27A 4Z6KA 1IZ0A 3IL2A 2O2YA 2IZZA 1YONA 1EE2A 3EVNA 3JV7A 1UZLA 3H9UA 2VUSA 1VLLA 1MA0A 2CVQA 1V3TA 4KUGA 2Z1NA 4HFNA 4CMIB 3X2EA 3CZRA 4NG5A 3PZRA 2WSBA 2NTNA 3C7DB 4CR8A 1OAAA 3RKRA 1DIGA 2IXAA 2W4QA 2DVMA 1QP8A 1GEGA 1HE5A 3EAGA 4E2ZA 1KERA 2JCVA 5G0VA 1LQUA 2WYVA 4MVJD 3BHMA 2ZTVA 1HETA 1HZZA 4NPCA 2H5LA 4AJOA 4ZN6A 2EGGA 3F1KA 4ND3A 3AY6A 1ADCA 5COQA 3VTFA 4AVYA 4IM7A 3P19A 3SC6A 3F4LA 4D3SA 1N9GA 5A4DA 1IL0A 5U4QA 3Q2IA 1R4MA 3IJRA 3JQ7A 4HX5A 4OXNA 3E5MA 4B3JA 1P3DA 2B37A 3INTA 3PWZA 4GKVA 4D43A 3PFWO 4MINA 5DOVA 3ANLA 1GUZA 1O89A 3KETA 3GAZA 4CMEA 3OECA 3L9XA 3VDRA 1QXSA 1LRKA 4TKLA 2FZEA 4PGFA 4EEXA 2AQIA 3KM0A 2JHGA 3DB2A 4S1VA 3TL3A 5L95A 5MGBA 5L9AA 4HFRA 3JQEA 3QQPA 4IJWA 2WTBA 3HHPA 4AJJA 4TWRA 1KBZA 3E82A 5JPIA 2QZZA 3AM3A 3G1UA 5AYVA 3MTJA 1UXHA 4OKIA 2X4GA 2DTDA 2CDAA 4YAGA 3I9OA 1U7HA 3PJGA 1Q0LA 4QECA 3WGOA 3GN1A 1WLYA 5ITVA 1PS8A 1GUYA 1EEHA 4BNTA 1JWBB 2VRCD 5I7SA 2FHSA 4CLRB 2NTVA 1FDSA 2UVDA 3OBBA 4ILKA 5COAA 4RZHA 2IEBA 5L7TA 5IF3A 1G0OA 2CMDA 2HMUA 2NLOA 1KC1A 5KKAA 2H63A 4CV2A 3GQVA 3WIEA 4CJXA 1LI4A 2ZTLA 3SEFA 2PD6A 1EK5A
chains in the Genus database with same CATH superfamily
2DU8A 2EQBA 2R7NA 3G68A 2KI5A 3NH9A 3NOXA 5CBPB 4OB6A 3GRUA 1RTTA 3H6GA 5AK0A 4UNIA 1MDFA 3K8YA 4NOKA 3A1UA 1T9BA 1YE3A 2BW0A 1EP3B 5HGJA 3UMFA 3PK0A 4EUFA 5KIAA 1H6CA 3FYTA 4H3VA 5DWDA 2CVOA 1UDWA 2BGIA 3SICE 1AUVA 4C0JA 3RHZA 1SPXA 3ONFA 4J2TA 4YI3A 3WYDA 1AK2A 2Q28A 5FL3A 4EYOA 4DUPA 2QRPA 1QQTA 2WJHA 3FCOA 3VYRB 5BORA 1I30A 1T2VA 1U2ZA 4GVXA 1JQKA 1V71A 4TUYB 4GL4A 1JSCA 4OVKA 1P4SA 4IOMA 2B6HA 3R5TA 3EPJA 4XSHA 2JZNA 5DM0A 1TE2A 2D0DA 1XJCA 1F17A 1J8FA 1R6VA 2AN1A 2XKJE 3GP8A 1JDTA 4BGIA 1LGYA 3BMOA 3CLSC 4X3PA 3EQ9A 3W78A 2TSYB 3F6EX 5JADA 1Y3FE 4PS0A 2H2HA 2WOOA 2G40A 1WU8A 1GYPA 1T9GS 3EB9A 3CQ9A 2BZ1A 1XYVA 1KQOA 3GEDA 4JBXA 2PD3A 1QRUA 1RRGA 1H6DA 1PD0A 3EMBA 2PS0A 3PZBA 4MVJE 1UDRA 1IBSA 1ZJ6A 4RK0A 1PTKA 5LZ7A 3KX2A 3W77A 1JHQA 2E4WA 3CINA 3V7NA 4OJTA 1ZHOA 1K7YA 4NCIA 1RM0A 1Y42X 5A9TA 2AG8A 1ZEJA 2P9JA 1YNSA 5KJ1A 2AFHB 1IRIA 5CX4A 3IALA 2ASVA 1T1IA 4MGHA 2XQFA 3FDIA 1E1CA 4QSMA 4BC1A 5HX7A 2Q5OA 3AP1A 2ZM5A 1NOJA 2I4RA 1Y6RA 2ADMA 1VHTA 1YKFA 5LXTB 5IMSA 4YX9A 3RWBA 4AROA 2PGIA 2GUGA 3NIWA 1G59A 9LDTA 4FBLA 4MVJF 5CFMA 3K9HA 4NVRA 4ESHA 4ZJYA 4N1AA 4OFZA 4YS6A 1O95D 4CV0A 2P4QA 2HUNA 4F6CA 5A6SB 2JPDA 2EP8A 2YHSA 4EHIA 1N77A 1SBTA 1ESCA 3EAQA 3LUAA 4ENVA 4PY2A 1B41A 3GCDA 4UJ5A 4D4HA 1CR6A 4CF7A 5E38A 1CUXA 2IYEA 2HCJB 3KJXA 3PPIA 2V7GA 4I1VA 2GDJA 1P0CA 1T1RA 3E23A 2K7FA 1Q1AA 3I2YX 2I29A 3F3MA 5FADA 3FLBA 3SOZA 1YCDA 2R65A 2EATA 1H69A 4TRJA 4JLBA 3SJBA 4MRPA 2XQGA 3G9ZA 5F7ZA 4DTIA 1INLA 4M87A 4F5YA 2QAGC 4HDSB 4D7AA 2HPZA 3TPFA 1EWQA 1TA0A 2CF6A 4CDNA 5KNCD 4LOLA 1J70A 4WVLA 4YMIA 2WFLA 3UM9A 4B3IA 2R48A 5C2JB 4CTJA 4BNDA 4RNDB 1YL5A 3G5TA 2VPPA 3OFSA 3E3AA 3QBDA 5LYJA 2RI6A 1K7FB 1KDPA 1U3WA 1UMBA 1NMQA 2GD6A 2GFHA 2R9VA 3P9PA 4O4HB 5C34B 3W6UA 1NXOA 5ANRB 5CB4F 4QFDA 1QP4A 1MGPA 1NIJA 2HF2A 4AWBA 1PL0A 3C5WP 3DTVB 4WKGA 4CG3A 4EBBA 2XXAB 4UAJA 3WIOA 5B7QA 5JHHB 4KRFA 4RULA 1YCGA 5CFPA 3SJAA 4TYMA 3GAFA 2PZJA 3LOQA 3O6VA 1L4HA 2O23A 3GWGA 3PFBA 4YMGA 3MJRA 2H4FA 1W59A 2LP4Y 3UOWA 3L7NA 3TXYA 2WIGA 4JSTA 2HNKA 1F0NA 2D7DA 5FJIA 2XUJA 4YA6A 1KI1A 5AW3A 4EA9A 1K7CA 3TZEA 2YW9A 5JYEA 3VC3A 5ALRA 4Q12A 5CCBA 2ZCJA 2C2ZA 2CE7A 2H7XA 1VSTA 2H4ZA 4O4JF 4BMZA 3S8EA 1YZYA 4QA9A 3WDLA 3NDIA 3ZI4A 4CR6A 5IRCD 2ZSDA 1V1MB 4DCSA 1ES9A 4QYIB 1I6LA 1ZNXA 1DRWA 1HPLA 2Z8XA 1U8AA 1WBJB 2W6ZA 3IDQA 2OOKA 5GJVC 5B6JA 2DZDA 4MV5A 3L6UA 4X71A 3HEAA 4MS1B 3WB9A 2DY0A 5I4BA 1DDOA 1V45E 3DBLB 2ESRA 5F35A 2OBYA 4FFNA 1BEEA 3VDXA 3D64A 3OZCA 1KO8A 2B0JA 1NASA 2IIQA 4JUBA 1G55A 2MYPA 4HDQB 3KR2A 4MO2A 3C41J 1PLKA 5T5QA 3DAGA 3OTIA 5LLSA 5SYAA 2DMRA 1OV4A 2Q4TA 1YUBA 3M1YA 4WK4B 3QY9A 3ZLBA 5JY1A 1H05A 5EXTA 4GKKB 4WQMA 3KWLA 3QHAA 1HTTA 3FSGA 5BT9A 3RSZA 3GIWA 2O1SA 1E1KA 1QS0B 3JVIA 3R0XA 3AVYA 4FYVA 2DERA 3IT3A 1QFMA 2I71A 2AFIB 3KYIB 1XLVA 1VI6A 2P75A 3L8CA 3G88A 1L5QA 4AY2A 2H1FA 1P4AA 2A58A 2ZXEA 1BVUA 4WECA 4E94A 5DMHA 4KNWA 1JR2A 1W36B 3DHVA 3C5CA 4NENA 1S02A 1L7RA 5EIWA 2IPNA 4Z4CA 1DUIA 1RQLA 2V7EA 4BVLA 3KNZA 3WAJA 5J3JA 1UK9A 4RJTA 5A3QA 3ONNA 4FS3A 4HH1A 1IXYA 2IDKA 2Q3LA 1Y9DA 4MJ7A 3AEQB 3X1KA 2YWDA 2GOYA 5DNCA 1CRWG 4CEHA 2DE0X 1WF6A 3K16A 3AX6A 2JGDB 4YLYA 1K6JA 1WQ4A 4N54A 4B6RA 5IFKA 1E3LA 1ABBA 2Y0DA 1W47A 1BJRE 2VIIA 3D43A 4ZRMA 5A4FS 2IZ5A 2XB8A 2ZUUA 3EVZA 5FUXA 1HXHA 3C3AA 4URFA 2PVPA 3IT1A 4NFLA 4W99A 1PR0A 4W8HA 4XX1A 5AKIA 4D46A 2AR0A 2EBFX 4M1YA 2Z6AA 2I2BA 5JNSA 1KP9A 4M1EA 5T3UA 3KKOA 1WCV1 2HO4A 2N3ZA 4Z86A 5K6AC 4KH0A 2AF3C 5DYIA 1ZJZA 1WQ1R 4L0DA 3WGMA 3ZQ6A 3ZWYA 4HNVA 5TMPA 1NF9A 2YXBA 1VM6A 2XV1A 4J9UE 1DG9A 1CUJA 5DGIA 1L3BA 5LMZA 1J2UA 1K98A 1LJ8A 1QH1A 3MD0A 4PNEA 2O8BA 4BB0A 2CMKA 3MIIA 3LZ6A 3TDNA 3BMQB 5B2ZA 2Z08A 3B20A 2O7SA 4PO3X 1C41A 1GJRA 1HNZB 2OOSA 3ZUPA 3BJZA 3CZPA 3RRYA 3ZTWA 2IFTA 3GXBA 3AJAA 3U4HA 3UGKA 3ZS8A 2PS3A 1BJTA 3KYDA 1T8RA 4G0VA 2ZRQA 2VBGA 5LP1A 5DHQA 1DLJA 1B76A 2O8DB 1RCUA 4GFDA 1PDOA 1SK8A 3OLXA 4WA7A 1QFJA 3LWNA 1IZYA 1GN8A 3TLGA 3UAOA 2AN4A 2I2CA 2ODEA 2QTZA 1YOVA 1FYEA 3KUKA 4KB5A 3HDYA 4NBKA 4ZVRA 5BV2P 5IM4F 3VMFA 1A0OA 1XVIA 4XR4A 4KXLA 2ZYUX 2VDOB 4K05A 4E5YA 4LYDA 1GYQA 4BCDA 5F12A 4P98A 1QGZA 2AWNA 3JD1A 2R6AA 1YO6A 1NXVA 1XMXA 4L95C 4C7VA 5CM2Z 1BS1A 1RE1A 1BVYF 3JVEA 3I01M 4FFLA 4IIXA 3CYFA 1KKLA 5ALUA 3RIYA 4PZPA 3UC9A 5A4IS 3RANA 4HN2A 1Z5OA 1U8FO 1IAVA 1WRBA 2FW9A 3A31A 2OENG 4G1VA 2WJZB 1SUSA 4MW7A 2PR7A 4G4GA 1J8VA 4MQMA 4NDZA 4DPKA 3TRHA 4G0QA 1QYVA 1S96A 2VF7A 1Z18A 4Q4CA 1GHTA 2VDRB 3WGYA 3PGXA 4DPMA 1VSQA 1PGNA 1EFUA 3L7MA 3T7EA 2VQEB 2YFKA 3CS3A 2OWEA 3T9CA 3LF1A 4BV9A 1QV9A 2I78A 1L5OA 1G21A 1U9IA 2C96A 2GAFA 1Z0JA 2OVFA 5EJ8A 2ZZMA 2VT3A 4CLOB 5EJMA 2A2ZA 1TK9A 1VPVA 3AUAA 1LF0A 1U7ZA 5LD2B 3THXA 2REQA 1LJUA 3F71A 1NY6A 4KEAA 1Z16A 3OY7A 1VPLA 3KEGA 4KQ1A 4E21A 4IILA 3IP1A 4RGVA 2OHIA 1NJ5A 2QTCA 1THTA 4H7JA 2C97A 2Y27A 2WZQA 4RTQA 4Y2TA 1XL1A 4KDCA 1HWYA 4HC4A 3PGVA 5JFGA 3B52X 3LVBA 4ZO7A 1D8AA 2NQ2C 4WY2A 4LF9B 1KDVA 1R6TA 3CX7A 4N03A 4YQZA 4WN9B 1I3LA 4PXSA 3DMTC 1DUSA 5KNCH 4ILEA 2NQTA 2O0JA 1YK1A 3HVUA 4J6FA 2ZSBA 1OIVA 4K40A 4IIFA 4R9RA 4E13A 4II2A 3HJCA 5B1IA 1ZOIA 4B71A 3QUSA 4H4DA 2JI9A 3OLVA 3FOCA 4TKUB 4UU8A 4I1IA 1DUVG 3UHFA 1IY0A 4WGGA 4G0ZA 4A0RA 5LBTA 2BE9A 3RSSA 2ZWOA 3E0QA 3ROPA 2WU8A 2JFVA 4AECA 3MJVA 1G7TA 2ECKA 4LRTB 4ETWA 1NN1A 2GZRA 4GC5A 5C52B 2G17A 5IP5A 1QV7A 4XRRA 3NNSA 3K70D 3HXMA 4GS5A 1KYXA 1UUFA 5AQEA 1H8HA 5GZ1A 1Z08A 1PW7A 3IQXA 3CNOA 4H1WA 1YRBA 3WZLA 3T5AA 1YHYA 4WI1A 5I9SA 3C3YA 1C7IA 1M34E 3W1EA 5JVDB 4RHCA 5FWDA 3GYGA 5KTMA 3EIUA 2NUBA 1JU9A 4LMRA 2X3UA 4Q15A 4XVCA 1FXWA 1EI9A 2I4IA 4B8WA 1VPDA 4PLHA 4D79A 3QKRB 3IP7A 3P9CA 4ALLA 3ACDA 4IMRA 3ETHA 5C53B 4QARA 5KSYA 3B1WA 1FFSA 2EAUA 4BFLA 3ZVKA 2XIJA 3OE1A 3EZ6A 2POQX 2HFJA 4P7FA 2FEMA 4RJJA 1MB4A 4X91A 3CVYA 4ZCQA 4WJLA 3FUTA 1BE6A 3MRXA 3LDHA 4NMWA 1IAQA 4A9AA 5FNVB 3GLUA 1GPUA 1KZGB 2ZBPA 3E1SA 4J2HA 4MUFA 5FBLB 5F1KA 2CFIA 1FRZA 1FK8A 3RDPA 2A7XA 2JFBA 3CH6A 4G9GA 1W1WA 1EWTA 2PZGA 2QUIA 4GZ5A 4LYAA 4YRMA 1XRMA 5JLAA 2SCUB 5CEFA 1OBOA 1RHQA 3UT5B 4DCMA 5JXGA 1W4ZA 4QIHA 1YS1X 2FGKA 3I23A 3PDWA 5DF1A 3UENA 1XAGA 2W93A 1SIWA 2QLNA 5SZHB 1Z7WA 1CY2A 1Y63A 3KXLA 2H5IA 2NV2B 4YROA 5JSYA 4CL8A 4DN6A 5A1JA 2DETA 3MHTA 1XZPA 2CGEA 2QR2A 4OYLA 1D2RA 4OJNA 3CW8X 4LJKA 2IUSA 4W1PA 1NMYA 4W7IA 1SCJA 4IX1A 2ZANA 2G7MC 3D7RA 2QR3A 5ESXA 2ZUFA 1IB6A 4LMBA 2CSXA 2Q2WA 3CWCA 3QELB 3VV3A 2B30A 1I2MA 3OX1A 3AINA 2B83A 3D3WB 2WWIA 2UV8A 3RFXA 3NKFA 5B64A 4JBIA 1FJHA 3IQHX 4OHPA 1NVMB 1ZCZA 4FJ2A 2XBUA 3OQVA 2BHLA 2A8YA 3VR4D 4EDHA 3IP3A 1CT9A 3K2EA 3ZDQA 4M7OA 2A0WA 5EJFA 3BMCA 2QVYX 3FG9A 4KVAA 2J4DA 2NUAA 1D4FA 1TYCA 2PJRA 3FTEA 1Z9BA 3GH3A 3PNBA 2BI4A 1KWGA 1CBUA 3FB4A 4L50A 1XEXB 4ZOLF 4FD3A 4YH1A 3PJEA 1GNVA 3ANYB 1XCGB 3NG1A 2IEGA 1DTWB 3ND5A 3OX2A 4D0NA 1QE3A 2FU5C 4NLLA 4V03A 1G19A 1QANA 5CUQA 5D3ZA 4TS4A 5I9TA 4CM9A 4Y7DA 3CF4A 1Z5ZA 5IUJC 3JZAA 4H4EA 1VJDA 5JAIA 3TKYA 1A2QA 2XX3A 3U3ZA 1DZ3A 3GUHA 1PGQA 3DL7A 4C3ZA 3AR3A 2DR3A 2HWYA 2R1VB 4PSKA 2VL7A 3WHKA 1DQRA 3EFEA 4F6LA 4CGYA 5ICFA 3U09A 3GLGE 2FN3A 3HO8A 2O52A 4EECA 4F0JA 1E2GA 1XZDA 4TLDA 2ZJ5A 1W85A 2FV8A 3HR4A 3ORYA 2HHAA 3N1UA 1WV1A 4WMLA 2HK6A 2PAAA 5CDYA 3O8OA 3PC4A 4CIWA 2CLIB 1VJ1A 5ER9A 4AMZA 2FR0A 3I01A 1ZVJA 4C2TA 2FZLA 3IUMA 3JATA 5FLEX 4E5NA 1F9EA 1NKVA 3FSEA 1SUEA 5L3SB 2QZSA 3AI2A 1XIVA 1W52X 1P81A 4MVYA 2D5BA 1IU9A 3KQVA 1YKGA 1PV2A 1T4MA 2XGSA 4GI1A 4I9FA 5D00A 2WTUA 3H0CA 3H1AA 1A9RA 4URZR 5KSWB 1FY2A 4ER5A 1LFDB 1PWZA 2C07A 1YJAA 4TKVA 4MZXA 4I66A 4X63A 1ISJA 3OESA 4I4TB 1UDBA 2FEXA 4K9RA 4QG7A 4WFIA 3ZDZB 1CUYA 2JVKA 1M6VA 3HSYA 4YRTA 4G24A 3AXTA 2XOXA 4M6WA 1D1PA 3RS5A 3DVAA 4X6XA 5AMXA 3W9SA 3LFHA 2H7CA 3GLFB 3VR3D 4D4IA 1GL7A 2X6RA 1B6RA 3ADPA 1XWWA 3KKQA 4UKDA 5HQ3A 5BPFA 4H7EA 1GEEA 2WVGA 2B98A 1J0XO 4OYHA 1B3BA 2O2ZA 3P96A 3K2QA 1EDOA 1Y4UA 3G8YA 3E3OA 1OFHA 1ZH4A 4P4UA 4U9IS 5EHIA 4ZV7A 1U4OA 3EXAA 3LX4A 1ARZA 1X7WA 3K2IA 3I1YA 3TOXA 2WQ6A 4Y1RA 3T3EA 1RZRD 1JSXA 4D56A 4ETNA 5JOQA 1G5PA 1A77A 3QPWA 1KI6B 4J1TC 1KJIA 1NU6A 3JS5A 2XTJA 1PQYA 2FN9A 1DIRA 1T6BY 2XYQA 2H9IA 4QL3A 3SXUB 2OV3A 3MT7A 4NNJA 1G98A 2A35A 4CE6A 4E5DA 5J4VA 2JGEA 4UTRA 3N53A 3B1KA 4GDMA 4TL6A 5EJ9A 2JKZA 3OO0A 4N39A 3WBFA 4PYIA 4ZAFA 3MUNA 3LPDA 1II8A 2G1AA 2YNMD 4ALMA 4JT9A 3AI1A 4N6OA 1W1IA 2B25A 4GLLA 2OCBA 4G9BA 2FPSA 2FSFA 1QZXA 1PQUA 3CXRA 1FLVA 2MSWA 4JBLA 4TXHA 1DXQA 3AKDA 4CTNA 4EHJA 3VHLB 3O94A 5FUYA 1NZJA 1P7WA 2RGDA 3IKVA 5DTRA 2V6JA 1SXPA 1JS1X 2ZU0C 4O2RA 1L6RA 4CMHA 1RPTA 3ML1A 3ZOZA 5LYJB 1ODJA 3UJPA 3AOEA 3L04A 3GARA 3IDZA 3VPCA 2G70A 2HY7A 4NG4A 5J4HA 4MR8B 3CVOA 4DIDA 1VJGA 5A2GA 3JARA 1S2OA 3C7KA 1UH5A 4G0OA 4AP6A 5F78A 4M46A 4OHZA 2FEWB 4KQEA 2WKQA 3OBIA 3EYWA 3Q3EA 2NU7B 3MGBA 4HWOA 3BREA 1WOYA 4U6NA 5BWBA 1EK6A 2DPMA 5HDQA 1J8QA 3NHAA 2CHVA 2Y4NA 3NWEA 1M2EA 3I2GA 4QTXA 4QWMA 4KHZA 4TV8B 5CCDA 2QLMA 2ZQ5A 3D6NB 1ISIA 3KLBA 3DMYA 3WHLA 2X1VA 4KLCA 4B4VA 3CZ9A 5AHXA 5H1YA 2NPIA 1PX0A 2ZBDA 3HSKA 1PX2A 4B4KA 5GJCA 1CF2O 1PG0A 1YZTA 4M8LA 4AS2A 2I8CA 3KV1A 4R1MA 3ZNOA 4QUEA 3IE2A 4FSDA 4YBZA 3KZVA 1EVYA 3HB1A 2OQ2A 3EEBA 1OGJA 2ILTA 3NHFA 4XEUA 3ZTTA 1TLTA 3QITA 4P1ZA 2PWAA 1SKYB 5KYVA 2HCTA 3DNMA 4LXQA 4NAHA 4PBRA 3LRPA 1ZL2A 2IIBA 2VXOA 2XXJA 1M2OB 2QTHA 2H1HA 2I2FA 2Q1SA 3G89A 2VP2A 4RNCA 1ADJA 1NPTO 3W90A 5BMVB 4HNAA 2HWUA 1EUDA 1L7QA 3EA5A 4Y0NA 2B94A 4Y9UA 1IHPA 1R5OA 3LXXA 3AXSA 3KAKA 1MT0A 3AERA 3L41A 2AQHA 4FFBB 5FBRB 2H7YA 3IV7A 4FGWA 1VJCA 5A7FA 1G8PA 2YHIA 2ZWAA 2WU1A 1L7BA 1U28A 2GKSA 3VKFA 3O2QB 3ZIDA 1ZQ9A 4FE7A 3TQSA 1LDBA 3TM5A 1UWCA 2QN6A 4ARVA 1IDOA 1JTVA 3A4TA 3I12A 1JR3E 3WYAA 3G59A 2RGUA 1WMFA 3UY4A 1AQIA 2IWRA 4QT4A 2YHUA 5FLKA 3IB6A 2CMHA 1YR8A 3BRSA 3D1JA 4HEHA 4CMAA 2X19A 3OZUA 4CU5A 3QE4A 2FB9A 2JATA 3KBBA 1EEXB 5CW1A 3C6QA 3ETEA 3G02A 4NC9A 4HZGA 2GXQA 3KWMA 4LV5B 1UIMA 2CXTA 2FSVC 4H7IA 5JQWA 3MUOA 1U8YA 4JLVA 3LT4A 1D7OA 4I36A 3VR4H 1OV6A 2D1SA 2I62A 3PWSA 5CCXA 2WT4A 2NUPA 2ERYA 2SKDA 3GRPA 5CVJA 4LYFA 3FNRA 1D7AA 3N74A 3R5HA 4YP6A 3STTA 3VTZA 4GVPA 3ZTYA 4BKRA 4EABA 1ID8A 4GOKA 4NBLA 5CAEB 4CN9A 5CB4A 1UAAA 1OVMA 4PLWA 1V37A 4BNLA 1XVTA 2QLBA 4CMCA 1V0JA 1M10A 3FAKA 3BJIC 3VNBA 3RYIB 5ES4B 2CNOA 3F3YA 2ZJOA 3PHHA 3STVA 3RO7A 4P5EA 4Z49A 4MUAA 4WDQA 1EP1B 4FM9A 1MJHA 2XUPA 4GHWA 5ALXA 4BE7B 4XVUA 1GNTA 4LXIA 1E2BA 2MSNA 1GRNA 3EZ2A 5DHFA 5FOSA 4KAJA 2DPHA 1PV1A 1XZNA 2P8SA 2IT1A 2LVBA 4BP8A 4EB3A 5CBPA 2QTMA 1R3UA 3F3KA 1U7DA 4MMYB 1Q0ZA 5HCUA 1RYNA 4GPEA 1DCTA 3IUJA 1XLTA 1MFZA 1M8GA 5LOVF 3FVRA 1OWOA 3QKSA 4MUJA 4D3DA 5KQLA 1QTQA 1JDNA 3TIFA 4A0FA 4ENQA 1SELA 3I8SA 1HK7A 2H9YA 3R0VA 5C51B 3W5AA 3L01A 4XQCA 4PPNA 5IMBA 3AHIA 2Z5GA 1RWQA 1P2DA 1KO1A 4B3RB 5CPBA 1FTWA 1RXUA 2FN8A 4J0QA 4OU4A 3U4AA 2J7KA 1GPKA 2MHCA 2A30A 3UK6A 1Q7BA 4M9CA 1Y3IA 2P1RA 3EFOA 2QI9C 4W4TA 2XCRB 5IBPA 3RD5A 1NXPA 3DBVO 1JJVA 3Q4GA 3FTFA 1P1HA 4JJEA 5AKLA 4NONA 2AW5A 4QASA 3EVTA 3G8BA 4D41A 1DVRA 1UPXA 2CYAA 3AF3A 3U4QB 3M6WA 4IDCA 4Q4JB 3C6KA 1H2ZA 4P3OA 1LLDA 4IWXA 1U0EA 5FL7D 4RTSA 5ELXA 3NVKI 2EG9A 2IHUA 4IKEA 3D4OA 5K0FA 3U3MA 3ZI7A 3DE4X 3OP4A 5DE3A 4V2IA 1NVUQ 4BLUA 1F3LA 4QVIA 1IQRA 4EGFA 2UUBB 5EWJA 3X1XA 1DPGA 1LLQA 1RRPA 3L7YA 1OUMA 4GPIB 3TE6A 4R8SA 3SCZA 4KITB 5A7GA 3LG2A 3R0JA 1DEXA 3PD0A 3KB1A 3QA3E 2JFUA 1YJ5A 2WIBA 2VDLB 3RUAA 2RBKA 5D3MB 2V45A 4EA8A 3S68A 2L19A 4GPBA 2BAGA 4MUBA 4NV0A 5EY5B 4ENWA 2GYUA 4FYYA 2WINI 4WCFA 5GONA 4CDMA 4E7PA 5AUPB 1HSZA 5F21A 1IEVA 3AJ8A 4LX8A 5AM0A 4JVOA 3RAJA 2VZLA 2R6ZA 4BX0A 3ROZA 1WE2A 3BHIA 4BUZA 1HNXB 2B1JA 3N75A 5AHWA 4BO0A 2PX8A 4HH0A 1GPDG 3GLIB 4BUJA 2A5FA 2BRUA 3PNKA 4MWSA 4PC7A 2EKBA 3KOOA 5L6LB 1DP4A 2O0HA 4RIHA 2QQEA 5B7NA 2MWMA 2VDMB 3VOTA 1P1BA 1O6BA 5CG2A 1KI7A 3HCDA 1UC4B 3GEBA 4GYWA 5A02A 4OXIA 2XF8A 2OTCA 3NFRA 4TTQA 4FMBB 3WBJA 5CB0A 1E5DA 4FYHA 4DA8A 2VYNA 3AHCA 2JLYA 1EFPB 5HF8A 1BHJA 2XUZA 3V8PA 4DHWA 5IANA 2V9CA 2W2LD 3DE1X 4AUMA 2Q2NA 3OZGA 3UZUA 2FZCA 3HFSA 1VYHA 1ZGJA 2Q1XA 4X64B 2X1HA 4RV9A 3PHIA 4M2LA 4X3CA 1N8TA 2HA5A 1VE7A 1OF1A 1JZQA 2RGAA 4TRNA 4A10A 1Y0BA 2AYYA 1DQZA 2EKPA 1BQ4A 1MX3A 1VG9B 1OB5A 4UVGA 3G2PA 3GRKA 4R2WA 2D3TA 4BQRA 1A7KA 2WKRA 4J7UA 2K6GA 1SCIA 4ZI3A 4MS3A 2ZJ3A 3LY9A 5JVDA 2A5LA 4Q1DA 4PFJA 3HXKA 1PKEA 4QUBA 1AS3A 5IH3A 1OT5A 1J09A 3QW4B 3AR6A 5JUWA 1I7LA 4HDMB 4BNHA 3D1LA 3BXFA 3PRYA 5AI8A 2XNDD 3T06B 1IH8A 1BU8A 1CUUA 3TBHA 1W0JD 1G20E 3DONA 3WMWA 3M2TA 4FBMA 3O4FA 3JALA 4YLEA 2AFVA 2JCXA 3DV9A 1XDDA 3II6X 2BM1A 2ZSIA 3TLAA 5IM5A 4N12A 3EPLA 5K8IA 2QIOA 5K99A 3QVVA 5DHRA 2CCJA 4NBRA 1QVWA 5D1HA 2HQOA 3B9QA 4J1TA 4C4ZA 3RSLA 3R44A 1KEEA 3KVVA 3ANNA 3X1WA 3EGDA 1F8YA 2J07A 3I6YA 4F3KA 3NB0A 3SMQA 5C81A 1XZLA 4YXWD 2QD3A 1NVXQ 2I2AA 2LKDA 1VL8A 4HYEA 4XX0B 5JH7A 3MS4A 2ZIXA 2AUNA 1ISMA 4Y0VA 2YS6A 3S28A 5ABPA 3GJRA 3FPAA 2CL0X 1FPQA 1LPSA 3OCYA 4ABYA 2DR2A 2O50A 4FOOA 4N3GA 3TL6A 3K2BA 2ZM6B 3W2IA 2ZZKA 2BFPA 1X8KA 4LWOA 1CUGA 1L5WA 2WJAA 3EUAA 1PJCA 4JZYA 4PSVA 2VK1A 4LQCA 2YVQA 2NZUG 3U19A 4KSCA 1DV1A 2JB9A 1M1NA 4OQPA 1FQJA 3U4QA 1GKYA 2ZUWA 4WD3A 1C29B 4FOSA 4Y6PA 1VB3A 2GPJA 5KYWB 3OA2A 5IVIA 5TS3A 1QIKA 5FUWA 2CLSA 1Q0UA 3M49A 2OD9A 2UZ4A 3S2SA 2VK2A 1PP4A 3C1UA 2EJBA 3UHAA 1RYEA 2RCNA 4IDHA 2IE0A 4DBLE 4M49A 4MAAA 5HIMA 3T4XA 2Y1CA 4GX0A 3ECCA 2J41A 5T8KC 2UXBB 1IK6A 1Y34E 2A78A 4KQMA 4MUNA 4ZVQA 4EP1A 4YTEA 4EMSA 1VLZA 4GWGA 1NLUA 2PTHA 4EY4A 1X80B 1Z3IX 1KK3A 4IVPA 1W4RA 4S2EA 3WGHA 3ISVA 1NRIA 2OHOA 3P4UA 4BFSA 4Z7NB 5BWLA 1EUYA 1PWHA 3V8EA 4YI5A 4DMUB 1I6MA 3ZU5A 3WGUA 1S2GA 3D7NA 3P2EA 3AYXB 3QU2A 1XO1A 4FE4A 1ZIOA 2V4MA 1V7CA 2QN1A 2JFZA 3R6TA 4GIBA 3UWSA 4C4SA 3MA0A 4JZKA 5BSUA 1JG4A 1KPHA 3F74A 1YCFA 3KD2A 5BR8B 4EW6A 1L5KA 4LBZA 1Y5MA 3W2GA 4KYTA 2QGNA 3GEEA 1RACA 1PNOA 2P9TA 1HKHA 1KFEB 2B36A 3H3FA 4EA7A 1TZ2A 4N82A 2HQRA 1MX1A 1DKQA 4FDUA 4ZC8A 5JYBA 3HNRA 2BV3A 2UUOA 4YWHA 5TVKA 3RK1A 3T6KA 4C6TA 2UUAB 5TQJA 1FYFA 1E6EA 4Q4LA 3Q8LA 3GBSA 4CQMB 2J0SA 2ZSFA 4TMTA 1P0IA 2C5EA 2NXJA 1SU4A 2W2KB 2C42A 4N0DA 4W5TA 1GZDA 1E2DA 1IHUA 4XGNA 1D4ZA 2YWCA 5EEHA 2JANA 1TMGE 4RA9B 1BFDA 3Q7PA 1ZFNA 2FG6C 1L5FA 4BDTA 4Q6BA 3PFKA 1ODTC 2FLWA 2FZGA 4QHSA 1TTQB 5FCDA 3WLQA 1W36D 1ENOA 4B3CA 1Z2NX 4RD4A 3E9EA 2IHKA 2VF4X 3PRKE 1FUUA 1OROA 4DT1A 1R0YA 1N6KA 2GZ1A 3TXXA 3RG2A 2AD1A 4BMCA 2V7TA 4G1CA 5G02A 1OH6A 5B1SA 4XZ3A 4S1TA 4Q48A 4GW3A 1DOAA 1U63A 1CU1A 1ZRNA 3KJEA 1V3VA 2CDRA 2QIPA 4HXEB 3EJ6A 3HN7A 4ZO8A 2QRJA 1J0CA 3I2JA 4DYDA 5AVOA 1YI1A 1SVNA 1T2EA 5BNZA 1FXWF 4OKSA 3OQJA 5J5VA 3RHFA 2WIKA 5BYBA 2Z83A 3ICQB 1Q6YA 5HKKD 2HWXA 1XC7A 1V47A 4Y2VA 3W1WA 4ICIA 4XM0A 4FOLA 4R68A 1XYGA 1EU1A 5JNVA 3QEAZ 1T8PA 3IKMB 4LV6A 5G3ZA 4ZI7F 1BX3A 1O96B 1PNTA 1KI6A 4K9MA 1QFZA 4B5LA 4WNYA 1Y80A 3B48A 4JY7A 4G5QA 1A5TA 1JSZA 3MRTA 4BEWA 6ADHA 1JDBC 3WJ1A 1TA4A 4YYZA 3HJBA 1C3EA 4GGPA 2E48A 2QR5A 3F73A 2G9ZA 1EZZA 1RLOA 2WM3A 3OT4A 1ZGAA 4UJ3A 2JFNA 3AP3A 4EEZA 2C1EA 1E7YA 3C4VA 3MLAA 2Y9MB 2W6MA 4MUIA 2RHRA 3RC9A 2C5GA 1AKMA 2V7XA 3AOGA 3T1QA 2DFPA 1P19A 3OU7A 4ME6A 4EHFA 1VBFA 3HXQA 2NMVA 2A0XA 4KMMA 4LA4A 4MUMA 1T3TA 2QZ4A 4QG3A 3HUTA 1ESEA 2IOHA 3T3IA 3ZG6A 4R81A 3L2OB 4YAKA 3P0JA 3GNSA 2NSDA 2OSBA 5HVNA 3HKBB 1AUOA 2BR4A 4DLSA 2HJSA 4O4JA 2QYOA 3HXTA 3FJOA 1U80A 3GJSA 5D6NA 3N2IA 3E4DA 4WEOA 3OMXA 1OLOA 4CM7A 1R64A 1U6KA 3PDIA 3TR0A 2KBEA 4XFKA 2CNBA 3JARB 2QLLA 4Q5IA 1Q22A 5FTNA 1IBCA 5DX1A 4PTZA 4BNMA 3BG5A 2P9EA 4N7JA 1YA4A 3Q2KA 2NU7A 2G4VA 2G5PA 4PLYA 2J33A 3PYLA 4NNPA 3NM6B 5F7JA 1NSYA 4NH4A 5KYTA 1XEWX 4FTWA 5LA6F 5EJEA 3M81A 1EPUA 2FP4A 4F2WA 3KB6A 3WRYC 3F7OA 1CRZA 1OMOA 1WOMA 1UBRS 1YMQA 1XK7A 3TTVA 2YJ5A 5JFOA 4OQXA 4MB6A 2GM5A 1VL0A 4JVLA 5KTSA 3COWA 4W7SA 1JQEA 1KR5A 4G0NA 5JXIA 1NDQA 4P34A 3FNBA 1UT6A 1PFKA 2OP1A 5DK6A 3DZ8A 2IBTA 2D62A 2PUVA 1MD9A 5ER6A 4KPFC 5K0ZA 4YRNA 1UKVY 4HGYA 4ZYUA 2BMEA 2YOFA 5KOYA 1TO1E 3BC1A 2F62A 1X8LA 1JYFA 1IK4A 1DADA 2Y0BA 2JGIA 4HOYA 3EVDA 4JR2A 4UCFA 5DHAA 4L16A 5FB3A 1REQB 1F06A 1P5RA 3GGOA 2NVBA 4F2DA 3ND8A 1E5TA 4HNAB 4LTDA 3SNKA 4J4BA 3HACA 1S7CA 1Z0FA 2JD0A 3BE5A 1YE5A 4UTNA 4QTZA 1TRKA 5AI9A 1Y5LA 3NHZA 4IS2A 4NBVA 1E20A 5GMOA 1W4BA 3SGLA 4AY5A 2ONYA 2QXYA 1VGVA 2AQ8A 2OZPA 1BWQA 3RSHA 3UYLA 2G25A 3LC7O 3LYAA 3K92A 4PS1A 1F0KA 4D6XA 4H6PA 1COWD 3H65A 3QPDA 1N3YA 1X7YB 3ISJA 2BRUC 2SKEA 3G5UA 5AJVB 5AM4A 5F3RA 4ZEXA 3TBFA 3L4JA 1I5OA 3ZWDA 3TW8A 5JS2A 5IWCA 3GC6A 4D57A 1JR4A 3GQBA 1L7OA 1HSOA 4TLLB 4C2UA 1FX0A 1LLCA 3MJEA 5HKBA 1CC1S 1NPYA 1X1RA 2JVJA 4DQVA 5HKOA 3A9VA 4FNAA 4GLOA 5I7FA 5KWVA 3ENVA 3FFTA 3WRXC 5LFAA 4ZQIA 5LYJF 1YJQA 4TV9A 2Z6UA 1PK8A 4ZGBA 1N5OX 2LDBA 4FLFA 4P93A 5BSHA 4JENA 4MHTA 1GV0A 3LQ4A 4BJ3A 1E9DA 2I34A 2OO3A 1K4MA 4HBZA 2NXNA 4OFXA 3DCYA 5KX5B 3PHLA 4ZTUB 1VIAA 1W8DA 3AETB 4X61A 2NWQA 4ZVVA 4B9EA 4RCVA 3B13B 3IUEA 4FQ8A 3PJFA 5JO9A 4D9JA 1AHPA 3OQHA 2YMPA 2Z2ZA 4EJ2A 1ESMA 3V5NA 3GCGA 1QKKA 3OQ1A 4C89A 2EFHB 4TS9A 2UU9B 4YAWA 3SVZA 4K6GA 2QW0X 2W6NA 4DDMA 1U31A 3ZCPA 2DUWA 2WNIA 3CZ5A 1JBEA 4AG3A 2W6CX 3MFYA 2IHZA 1LI5A 1Z4LA 2OXIA 3DDWA 4G1EB 1GTMA 2J3QA 3LQKA 5KOJA 4G4SP 4IIJA 4OLJA 3QX9A 2C5FA 2J9RA 2CZGA 3U4IA 4OUKX 1UPBA 2HBZA 3MCTA 3NORA 2I1QA 1JAXA 1E77A 1EZ4A 4RQAA 3UH1A 2BFDA 3O4IA 3SKXA 4DRXA 1HE1C 2ODTX 1YK0A 2VNSA 3IP8A 4KI0A 4UE3S 1JIJA 3HKCB 1AJEA 3AB3A 3MW8A 3A9WA 3THOA 1XMPA 1Y1LA 4BLRA 3BUSA 2ZRJA 4AKSA 4FGKA 1BXRB 3N9IA 4B7CA 4X90A 5JNTA 1QYDA 1IXKA 1OLUA 3BSFA 4O63O 2QE6A 2W2PA 3ILXA 4GE0A 5CFQA 5BNTA 2R8XA 1FU8A 4DFDA 2PGJA 5CDGA 1D03A 4UMEA 1NN0A 5EWLA 1STOA 1WHTB 4J29A 3PJRA 2BFMA 2EL7A 3BZWA 1QBGA 1XCPA 2IEDA 5DOZA 4XDYA 3VSDA 4YV0A 3JR3A 4A8JC 3D8TA 4IDFA 1WDLA 1UBUS 4GBMA 3PA8A 4MJ3A 2UYQA 1G8JA 2YUTA 3BEOA 2JCBA 4EI8A 2ZVDA 1HTWA 3RSGA 3ZNPA 1QVRA 8MHTA 3HCAA 4DQXA 1A3CA 5JI2E 2C78A 2D00A 3Q8KA 2UZAA 3NUZA 5GTDA 1G8YA 4IXDA 1QU3A 3NBUA 5DI9A 2CDCA 3FKSD 4BGUA 2NSJA 3L1KA 1KOFA 3CZ4A 1RQRA 1FMLA 1M67A 2G5CA 3W3AD 4V3BA 4Y2GA 4E11A 2FEAA 3IEIA 3HDHA 4YJ2F 4YP5A 2QRQA 1HA3A 4LOIA 2AG0A 4HFMA 5J2UB 3QFHA 5AVUA 2XRYA 3DVAB 3IOBA 3CKYA 3RVJA 1OXKB 5K51A 4C4PA 1ZP6A 2JAXA 3RYTC 3GZ4A 4ZIRB 5L3RA 4FN5A 1RQXA 4PSDA 2K2WA 4UBOA 5K8UA 1ADGA 3L05A 3OC0A 4HNHA 1PV4A 4MJXA 3PPVA 3EG5A 4EFDA 3AI3A 1DX6A 1U9YA 3KEMA 4Q6WA 4E88A 2JLBA 5B4TA 1ZIYA 2Z1DA 1X7GA 3FIUA 4M7WA 1XDGA 1GP2A 5BY2A 1D2CA 1EJ2A 3VYUB 2XTMA 5FBQB 1CVIA 1X7ZB 5I7UA 2COEA 1F38A 2IEZA 1BMFD 3DMHA 4B6PA 2AXPA 1N5DA 2GA8A 3LY5A 2O2IA 1HX7A 3GEIA 3GW8A 4LY0A 1GNPA 3IPCA 3PFNA 4YXWA 4MW4A 5A2QA 2Q41A 2B2CA 1YA8A 2JFQA 1S6YA 1PQPA 1TM2A 1SA0B 1X1DA 3B1ZA 3O4GA 3Q40A 5G41A 3TO5A 1UJ2A 4LXUA 2NZJA 2CWWA 2ZVPX 5ALWA 7REQB 1S2IA 2J67A 3GT7A 4PQEA 2XUFA 3L49A 4Y6GB 5HJ2A 4DRZA 5KYGA 4MGZR 4B43A 1E3WB 2H1LA 1U4NA 5F2OA 1H5UA 2WJPA 3DLHA 4RGQA 5KDOA 2HQ1A 1OH7A 4DILA 1ZEMA 1NL3A 1JHXA 4L02A 4AYTA 3L0PA 1AURA 4HH4A 3LBNA 4BFXA 4U2FA 3ECAA 3EDYA 1MAAA 1Q1ZA 4GMGA 4J03A 3RNLA 3M3PA 3P9RA 4XWAA 4LDNA 1BIFA 2KS6A 1G8KA 4PICA 1O6CA 4CCAA 3VR2D 4F06A 2CUKA 2AXQA 4E2YA 4AIRA 3FPJA 2QMUA 4JLDA 2VDJA 2WPNA 3OCXA 4I0WB 2XDQA 3KVNA 1X2EA 2IUYA 3DCIA 4KQFA 4C2AA 3ZCUA 1Y89A 4DA4A 4H60A 1TF2A 2YJGA 1B8OA 4MS3B 4FP9A 3RJ5A 4YT2A 1NHWA 4G9EA 4BYMA 2BD0A 4U2GA 2Y2VA 1V26A 4HNRA 4OB7A 3V1KA 3WO1A 1LK7A 5EUCA 1ZD1A 5KVSA 5CHYA 1HLPA 2W58A 4L5JA 5EA2A 2Q0HA 4L4XA 3TTWA 3N58A 5CRIA 1LDYA 3AKCA 1BKDR