1LEMA

The monosaccharide binding site of lentil lectin: an x-ray and molecular modelling study
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
181
structure length
181
Chain Sequence
TETTSFSITKFSPDQQNLIFQGDGYTTKGKLTLTKAVKSTVGRALYSTPIHIWDRDTGNVANFVTSFTFVIDAPSSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKEYDKTSQTVAVEFDTFYNAAWDPSNKERHIGIDVNSIKSVNTKSWNLQNGERANVVIAFNAATNVLTVTLTYPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The monosaccharide binding site of lentil lectin: an X-ray and molecular modelling study.
pubmed doi rcsb
source organism Lens culinaris
molecule tags Lectin
molecule keywords LECTIN
total genus 25
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 1993-11-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lemA00
3AJYA 1J1TA 4BM8A 3B00A 2ZGQA 1LOFC 1LODA 4D69A 4F83A 1GANA 4R9AA 3PJQA 5FRAA 2JD4A 2JJ6A 2CY6A 2W68A 2WSVA 3POSA 4PBOA 1KRIA 5JLVA 3AYCA 3M2MA 4YFWA 1VIWB 1QGLA 2YMZA 1KITA 1SCRA 1V6IA 5CA6A 1QOOA 3ILFA 5JOYA 3INAA 1ENSA 4XBNA 4FP3A 3T2TA 3JUUA 4LBOA 5GZDA 3PVEA 3WG3A 3VKFC 3WUCA 4YGDA 3HN1A 3WHUA 1OKQA 1WUVA 4Y1UA 3RMXA 4DPNA 4YZ1A 2A6YA 3FLTA 1C1LA 3V64A 4LBQA 4PQ9A 1GYKA 3VKMA 2GN7A 4LBMA 4DQAA 5EYYA 5DZGA 1CN1A 4GKYA 4YG0A 4GWNA 1LHVA 4U36A 4L8QA 1LOGA 3AJZA 2ES3A 1DBNA 2Z42A 2WKKA 1WW4A 1QKQA 1CIWA 3C2UA 4XXAA 1LCLA 2D6PA 3ENRA 2CL2A 3IMNA 2ZMKA 4U2AA 5IUQA 3WDTA 3HMYA 4GALA 2PHRA 2WT2A 1N47A 4SLIA 1QNWA 3ZXFA 5T55A 1B09A 1YO8A 5DUUA 3M3CA 3UK9A 1GBGA 3OYWB 1WD4A 4FOVA 4WZFA 4Y1XA 4ATEA 3AZXA 3ZXEA 3CNAA 5SV8A 3ZSKA 1Q8PA 4XJWA 1GNZA 1MS5A 2ZMNA 3T1LA 3DUIA 2P3JA 4R9DA 4YFZA 4M01A 3V0AB 3WLUA 2P3IA 2C5DA 4BOWA 3AP5A 2ARXA 3AZZA 3O0WA 2D6LX 1RITA 2NMOA 1U0AA 4XJZA 1ENRA 2A5ZA 3ZYRA 4ITCA 4IQPA 4OZXA 1YI7A 2DVDA 2VW2A 1Q8VA 1JW6A 1UX6A 4LBQB 3ZSMA 5IK5A 3B9CA 2NM1A 3WDXA 2LALA 3QCWA 5GZCA 2WT1A 2R0HA 3A4UA 2XG3A 1RINA 2NZ9A 2D3SA 2GNTA 5DZEA 2NP0A 4RL7A 4YW1A 1MZ6A 1EPWA 1WW7A 3O0VA 3W58A 3OYWA 3RQ0A 1DQ5A 1W6QB 1OQ1A 1D2SA 1JBCA 2NN8A 4DS0A 2DV9A 1MVEA 3IKWA 1LJ7A 1FAYA 4FOYA 2OUJA 4UW4A 4BQ1A 2OVUA 4XILA 1SCSA 1UZYA 4AGRA 4XMIA 5GJ6A 4AVTA 2ZGSA 5CB7A 2DVAA 4TZDA 2GALA 4NOTA 2PELA 5EXOA 2GNDA 1A78A 3WDWA 5DUXA 2VU9A 3IPVB 4JCKA 1BKZA 2PHFA 1I1EA 4YM2A 1V00A 3OY8A 1S0DA 4AVVA 1N3OA 1LGBA 2DUPA 2DUQA 2EF6A 2DTYA 1WLCA 3U4XA 3B69A 1ULDA 2ZHKA 3WHTA 4DRRA 1SBFA 1Q56A 2VXRA 1W6PB 1W0PA 3WOGA 5JOWA 1FATA 1S0FA 4LBLA 4XYXA 4YM1A 1GNHA 2CTVA 3WZ1A 5IT6A 1G9CA 1BQPA 4I30A 4H55A 4ZKTB 5T54A 3V0BA 1W6NA 1DIWA 1R1ZA 1GZCA 2AENA 2PHWA 1G86A 1KDMA 1JHNA 5GLVA 1CPNA 3MEPA 4PF5A 4C1XA 4HL0A 2ZHMA 1AXKA 5F9TA 2A6XA 2VH9A 2ZHLA 1W6QA 1GICA 2V5YA 4FPKA 5IK4A 4XMAA 4XJAA 4ISRA 4XDQA 1FYUA 1LOBA 3N7KA 2ZGLA 3FUOA 1H9PA 1DHKB 3USUB 4WVWA 1W0OA 3OPZA 4Q1PA 5FREA 1SACA 1UMZA 3POWA 3M3QA 4FQ4A 1F5FA 3FLPA 2YV8A 3NV4A 5LK5A 1ULCA 5JMCA 2YXSA 2DTWA 3ZSJA 2YZ4A 1JUIA 2PHXA 3IM0A 3TB0A 2R16A 3M3EA 3PVOA 4RA0A 2P3KA 2E53A 1KJLA 3B01A 1MS0A 1WBLA 1N1TA 1MVQA 3N36A 5H9SA 5T52A 2TEPA 4YW4A 1BJQA 1URXA 1CJPA 1KDKA 1S0IA 1VALA 3D6EA 4FPHA 1C57A 2ZAAA 1SLCA 1GLHA 2E7TA 3SH3A 4DRVA 1SLAA 4YLZA 2W39A 3AYAA 2EXKA 4YZ4A 1YXWA 1MS1A 1XQNA 1LTEA 3ASIA 1SFYA 5CNAA 4YGBA 1KJRA 1HKDA 1DQ4A 1ULEA 4K1ZA 5GM0A 4P9YA 4P9WA 3ZXJA 1ONAA 2ZA9A 5KXCA 3GNEA 3AP6A 2UWCA 1Q8SA 2RHPA 2A75A 1G9FA 2ZKNA 4YGCA 4P14A 1QDCA 1I3HA 2A71A 5GLZA 1N3QA 2P2KA 5BYNA 1FNYA 1LOCA 1N1SA 1KQRA 1N1VA 4AYUA 1WBFA 1N1YA 2A6ZA 3ILNA 1MS8A 1PZ8A 1LOFA 4Y1ZA 1LHWA 2W52A 2E6VA 2VY0A 1S1AA 4XZPA 1APNA 5H9RA 1VAVA 2WQZC 1ZM1A 1Y7BA 4GA9A 3Q9OA 4BMBA 2PHUA 2EXHA 3MW3A 2D3RA 2A6VA 4Y1YA 2WNEA 3OJBA 2ZABA 1NXD1 1S0EA 5JVVA 1Q8QA 3T1MA 3I4IA 5EWSA 2AREA 3M3OA 1CVNA 4XIOA 1DZQA 1DFQA 3UJQA 1SLIA 4GWMA 4FPEA 1W6OA 2D3PA 2DU1A 3BIWE 4JC1A 5DXDA 2GMPA 2UU8A 1ENQA 1LECA 3FBYA 4BMEA 5GALA 1LESA 1LEMA 1S0JA 2ZGOA 4LBNA 2Q5TA 1DYPA 3N35A 4XE9A 4YM0A 4C1WA 1YYNA 4LBQD 1UKGA 2YY1A 1W6OB 4AWDA 1NLSA 2CWMA 2D43A 1WCSA 4HANA 4YW3A 2D7FA 1AZDA 1QOSA 2R1DA 5GLTA 1RIRA 1QDOA 3O12A 4LBJA 2G4IA 1LGNA 5DG1A 5GZGA 3TAYA 2D6NA 1AX2A 1F31A 2DWRA 5HCAA 2A7AA 1V6LA 2ZACA 1SBEA 4FPGA 3APBA 1OFSA 1VLNA 1IOAA 2EALA 2HYKA 3NWKA 4FPJA 2OW4A 4YGEA 4M00A 2JE9A 4FPCA 2ZGTA 1LHNA 3SITA 3MW4A 3ZSLA 3AX4A 1GKBA 2PHTA 3ZPYA 4K20A 4Y22B 2FMDA 5T5OA 3D5OA 2UWBA 1FV3A 2EXIA 2GNBA 1O4ZA 2P34A 5CBLA 1GSLA 1UN1A 1FX5A 3AP7A 1HDKA 5KXDA 1AJOA 2WSUA 4P9XA 1S0BA 1IKPA 1G9DA 2C9AA 3AYEA 4FQZA 4Q1RA 5DUWA 3OGGA 4XHBA 1MS4A 3V65A 2FHRA 3ZYPA 2ENRA 2SBAA 3LCPA 1CR7A 3AYDA 2P37A 4XOGA 1IS5A 4Q26A 3O5SA 3OBRA 4XBLA 4YW2A 1CESA 3VKLA 3WDVA 1LGCA 3WVJA 4K1YA 1CONA 4FP2A 2ZBJA 1LOAA 3I8TA 1TEIA 2DVBA 5T5JA 1ZA4A 3AZVA 3FLRA 1G7YA 2YROA 1AVBA 1PZ7A 2EAKA 3KM5A 2ZGUA 3UL2A 2R0FA 1QU0A 3NV3A 3ZXKA 1YIFA 2ARBA 5T50A 1Q8OA 4MYEA 4Q8LA 5HCFA 3WDYA 3BTAA 5HCBA 1HQLA 3W59A 2DYCA 2AR6A 4GXLA 2GNMA 3WG2A 2EXJA 4UW6A 3SH5A 2A6WA 3B3QE 1SLBA 2W08A 1A3KA 4WV8A 4ASMB 5KXBA 4XIKA 3R4UA 3WV6A 1MZ5A 1Z0HA 4UW5A 1X50A 2JKBA 2R49A 3NV1A 5T5PA 3WUDA 1IS6A 1DQ0A 1MR5A 2VW1A 1JYCA 1V6JA 2H0BA 3AXEA 3PVNA 4YZ3A 2DUOA 4LBKA 3AP9A 1JOJA 2ZMLA 3GALA 2JECA 3MPPG 4XJ9A 1WD3A 4CRQA 1JN2P 1BYHA 4JRAA 2AYHA 1GZ9A 2KM2A 1SLTA 2VUAA 4NO4A 1IKQA 1DQ2A 2E7QA 2AUYA 2GDFA 4Y24A 5E88A 2BQPA 3WG1A 4ATFA 1LU1A 3R05A 3HR9A 3IPVA 2WLQA 1ULGA 2E51A 4R9CA 5T5LA 3QLQA 3SH4A 3VV1A 1W6MA 2LTNA 3N7MA 3SISA 1IS4A 4AGGA 5JOXA 3BODA 4YG3A 3WCRA 1LENA 3M1HA 2AGSA 3FFZA 1IS3A 3ATGA 3V0BB 1CQ9A 2I2SA 4M3CA 1V6KA 1SLLA 4Y26A 3ZVXA 4FPLA 4DFSA 1QNYA 2A3YA 1O4YA 2JDZA 1D0HA 2NYYA 3AFKA 1GZWB 3NV2A 5AVAA 4UW3A 3OBTA 5GLWA 2DU0A 1VAMA 1MACA 4PCRA 4R9BA 5E89A 1LULA 3A0NA 1DGLA 1GZWA 4Y1VA 3R4SA 2XB6C 1FV2A 5F5QA 1S0CA 2CNAA 2CWSA 1HLCA 1LHOA 1LHUA 1A8DA 4TYSA 2JE7A 3RMYA 4Q8KA 1AXZA 2UURA 3N7JA 4YZ2A 5CAZA 2GN3A 3AK0A 5EYXA 1UPSA 1SBDA 3OY8B 5IK8A 2SLIA 4FPYA 1AX1A 4Q2FA 4FVVA 3WDUA 4FOWA 2DVGA 2ZHNA 1H30A 2ZGRA 2UWAA 1CPMA 1LOEA 1W6MB 2GMMA 3AXDA 3H0OA 3V0AA 2ERFA 1HQWA 2EIGA 4XXPA 5GZFA 1DQ6A 3ZXLA 3RRDA 1UZZA 4PBPA 3UJOA 1BZWA 2A70A 4XJUA 1AF9A 1AXYA 1W6PA 1JXNA 1WW6A 4XBQA 4XTPA 3SNMA 4AGVA 3LSDA 4GKXA 4Q27A 4WVVA 4FPFA 1MS9A 5KXEA 1DYKA 2D6MA 3VKNA 4BPZA 1G9AA 1WLDA 2AH2A 2VW0A 1QF3A 4K21A 2ZGKA 3WNXA 4Y20B 2ZGMA 5L73A 1WLWA 3A0KA 3LSEA 1LEDA 5JOZA 1S0GA 1C4RA 3MW2A 2CYFA 1AJKA 2WJSA 4CTEA 5DG2A 3PMEA 1BXHA 5H9QA 3ILRA 1ULFA 4CZSA 1G9BA 3RG0A 1N3PA 5IK7A 3JU9A 1JYIA 3BOPA 4XHXA 4XTMA 1UAIA 2R1BA 2WT0A 3AZYA 3USUA 5DZFA 4YW5A 5H9PA 1WW5A 3FUQA 4BLJA 1MS3A 4XJ8A 2D6KA 3AP4A 1V6MA 1H9WA 1DLLA 2DURA 2OUHA 3RS6A 3WG4A 2ZZJA 3RSJA 3VUOA 1FNZA 2D6OX 4FOQA 1F9KA 1G8WA 1DQ1A 2B7YA 4Y20A 3SLIA 3VKOA 2D44A 4AVSA 2A3XA 4YM3A 2NMNA 4M3CF 4ZXKA 3IN9A 3L2YA 4Y22A 4YG6A 5DUVA 2DVFA 1QMJA 3N3HA 4ISQA 4KBBA 1C1FA 2V73A 1AX0A 4M3CE 5GZEA 1GV9A 1LU2A 3D4KA 1V6NA 2GMEA 1PZ9A 2ZGNA 4M3CB 4Z8BA 3AZWA 1Z78A 5JDBA 2A3WA 2ZGPA 3POYA 3DGTA 3WCSA 1V6OA 4W65A 4FPOB 4BLIA 4YZ5A 3KQRA 3N7LA 1W6NB 5E8AA 1YRZA 5GLUA 1UL9A 1QOTA 3O0XA
chains in the Genus database with same CATH superfamily
3AJYA 1J1TA 2FZ2A 3J8F2 1DZTA 2W91A 4G4FA 4NUBA 1P8JA 1LOFC 5A33A 4OQ8A 2Q8OA 2IXLA 4YVSB 1PGW2 3PJQA 4R9AA 4L97A 1AR62 3VBUC 2ZCWA 1HB2A 1KRIA 5IVCA 4A3ZA 5JLVA 4HN1A 3M2MA 2BJSA 1OD5A 3LEGA 1SCRA 4GAZA 4I02A 4CEYA 3NSTA 3M4FA 3WP3A 1MQTB 1UIKA 1NE4A 3POJA 2WRAA 1T6BX 1X8MA 4LBOA 4AHWA 4JKLA 3T08A 2WNVA 5CG9A 3WHUA 1OKQA 1W05A 1WUVA 3RMXA 3S5AA 1W8TA 2HYXA 3VBFA 3KWVA 1VB4A 5IW0A 4PQ9A 4RSUA 4DQAA 2GN7A 4YG0A 5J48A 1LHVA 1LOGA 4HKLA 1RUG1 1VBD3 2RR12 2OYZA 1GZTA 2YU2A 4XABA 1H6YA 1UIJA 4S2DA 1TMF3 4ZZ8A 1WW4A 5LY1A 1QKQA 2KA3A 4WZCA 4QPYA 4XXAA 4BQXA 4U2AA 3I3EA 2ZXQA 4GALA 4CDUA 3POIA 4ZU5A 3LE0A 2QNKA 2WT2A 4OUMA 1QNWA 2WS92 5FMOL 1BBT3 1GOFA 1HQNA 3ZXFA 4RGKA 5HPOA 1AYM2 4JV4A 4CDUB 2JKXA 3M3CA 2ZOEB 1HXS1 3OYWB 4FOVA 1JU3A 4LMFA 3NL1A 5DAVA 4Y1XA 4A7ZA 5AFEA 4L0PA 1QJX1 2O8QA 3ZXEA 5A70A 1Q8PA 4XJWA 1QJY2 3ZM8A 1VMJA 1RHI1 2PQQA 4LE4A 5FAXA 5ISLA 4GB32 5FZ6A 4M01A 5LA0A 3KT7A 4B1MA 4BYYA 5A6QA 3JD73 2NMOA 4FCAA 1RC6A 3T2PA 1H1AA 3OUJA 3BI3A 2ZZQA 4LLOA 4URTA 5E1RA 4IQPA 4META 4OZXA 3I3MA 3GZTB 4C91A 1UX6A 2BBAA 2QQKA 3WDXA 2WT1A 5FXVA 1W9FA 2XG3A 2DBIA 3H1MA 2D3SA 2QJVA 5CEHA 3UGGA 1MZ6A 2VCCA 4Q4Y3 3ZFEA 1QQP2 3VBHC 3T09A 2XDVA 3O0VA 3W58A 2MPFA 3RQ0A 5CFDB 1VR3A 4PI2A 2BV4A 5LA2A 1W6QB 3VBHB 4XCAA 1D2SA 3N9NA 3PTYA 4BA6A 4QMAA 4RHV3 4ZS2A 2OQ6A 1MVEA 4CDXA 5BNOA 2JDAA 1PVC3 2OUJA 2WLPA 1Z7S3 2OVUA 1H8TB 4XILA 1NKGA 2BP6A 2RM21 5GJ6A 1LR5A 5CB7A 1ND2B 2DVAA 2QDRA 1RUG3 4AVTA 1VBE3 3BTYA 2BPA2 1XBFA 1BLZA 3THDA 5FO8B 2GNDA 1A78A 1V0AA 4MHRA 3IPVB 4JCKA 3GYDA 1BKZA 2PHFA 1I1EA 4YM2A 2OIIA 4HPKB 1JOPA 3HJRA 2YC2A 2DUQA 1TG7A 4DEVA 4QB2A 2FBEA 4CP9B 1W2AX 5FLHA 2DTYA 3LA7A 4AG4A 4N9IA 2ZPXA 2VQ0A 3CDZB 4IW3A 4Z07A 4D7TA 5I93A 2ZHKA 1FI2A 2RV9A 4NE9A 4YSFA 1YIPA 4ZS3A 3D0SA 2LRPA 4DRRA 1SBFA 2PAKA 1Q56A 4ZHNA 1IPJA 1W0PA 5FP4A 3J7NA 2GC3A 1S0FA 5I91A 5JOWA 5FLJA 4BWOA 2Q30A 2FDKA 2CTVA 2XWBB 1G9CA 5LRRA 1BQPA 1T6GC 3LA3A 1R081 3DEMA 3HWJA 2CHHA 4W8JA 4H55A 4ZKTB 3MO4A 1DIWA 2Y0OA 5KC6A 2AENA 3OBAA 1G86A 3MIFA 4GWIA 1LRHA 3MEPA 4PT6A 1STMA 5ACA1 4I01A 2IC1A 4HL0A 4V2WA 1AXKA 5FY5A 1QY4A 2A6XA 2ZHLA 3PU3A 3HPNA 5CKQA 1AR61 1JYVA 1QQP3 5A1AA 5IK4A 4FPKA 1KS4A 5IVVA 4UT5A 4NHMA 2VMGA 2CU5A 2ZGLA 3F2ZA 4GIQA 3USUB 2HWD1 3OPZA 4P9GA 5FREA 4LPLA 1PO12 4IERA 4FQ4A 3FLPA 1M06G 2YV8A 2C24A 2HLEA 3PMSA 4Q4X2 2R072 2YXSA 5JMCA 2XHNA 3VD5A 1CWPA 1JUIA 2PHXA 3NJZA 3UYJA 4WM7C 1YFUA 4LUKA 2P3KA 1KJLA 2YBKA 1YQ8A 1J83A 1HRI2 4DXRA 3KHBA 5T52A 2TEPA 4E2SA 2HWB2 1W8FA 2WWSA 3G7DA 1JZ4A 1VBB1 1UYYA 2RJ2A 3H3UA 1O91A 1POV0 1GLHA 4KG0A 3SH3A 2AEZA 3AYAA 2EXKA 2NQYA 1YXWA 2W47A 3IB3A 2Y0IA 1WCUA 1XQNA 3NNLA 4RS5B 5FZHA 1LTEA 3ASIA 2JG9B 2WNVC 2FDFA 1RUH1 1Y9GA 1FMD1 1HKDA 4K1ZA 4COVA 3VZMA 1MPXA 4JQRA 1ONAA 5KXCA 1R64A 4NIGA 5A3PA 1R093 1XNBA 2H6BA 5K9YA 1RUC1 2LROA 3B9IA 1HRI3 3JBG1 4P14A 1ZZ8A 4IGQA 5FY7A 2A71A 4CDQC 4XF9A 5I8SA 1PM7A 4IE4A 4JHZA 3VBOC 1K5JA 4DMIA 4FI9A 5BYNA 1WBFA 5FZ8A 1GFF2 1LOFA 3O1TA 1NCRC 5H9RA 1S1AA 1ZZBA 4XZPA 4M4PA 3VDCA 1H8VA 4CP2A 4JQTA 5EQUA 2XGXA 1ZM1A 1Y7BA 4FXKB 4GA9A 5A3LA 3MHZA 2PHUA 2EXHA 2WC2A 4LQRA 3EJKA 2A6VA 3OJBA 1NCRA 4OUSA 1HV1A 1IGOA 1NXD1 1OMIA 1S0EA 3LD8A 5FOJB 4DUXA 1IHMA 3ACFA 2UYAA 2AREA 1EP0A 2HEVF 3M3OA 5FYBA 2K2SA 5BY5A 4JDOA 2XLFA 4GMP0 1DFQA 2JB4A 1WCQA 3DCQA 1SLIA 4GWMA 2DU1A 4HONA 1X36A 3VN4A 3DV8A 3AMHA 1KFUL 4CA9A 5GALA 4C1WA 1S0JA 4S2HA 3JQWA 1OPOA 1ZBE2 3ZPOA 5IFTA 1W6OB 2RS32 4I09A 2VAUA 2XJSA 3DPRB 2RJKA 4XACA 2Q1FA 1C3HA 3EB7A 1W8UA 3I2JA 3IDEA 4QKNA 2CDOA 1UYXA 4Q4V1 4TLFA 2VJXA 2WFPA 2V72A 2VZ1A 2E33A 3EHKA 2PLV3 3RZLA 1PGL2 1TE1B 1F31A 4GH4C 2DWRA 5HCAA 1UOGA 2WA3A 3RZHA 4GMP3 3T3YA 2OW4A 2J1SA 4YGEA 4Y3OA 4HVQA 1LHNA 4Q4W3 4ZXEA 4LKSA 4KWLA 1LAJA 3ES1A 3AX4A 1QJX2 4GWJA 1C28A 3QH6A 2V09A 3OB8A 1D4VB 1JYWA 3VD7A 1WGPA 1ZX5A 5T5OA 2UWBA 1FV3A 1O4ZA 1TME3 1GSLA 1FX5A 3AP7A 5BNPA 4HVOA 2Y33A 4P9XA 1Z7S2 4AEKA 1IKPA 2Y6GA 1VAKA 4RD7A 4JGYA 5F39A 4IXLA 2P6HA 4AEJA 1ZVFA 5ABJB 5HBAA 3K3NA 4UXAA 5BXXA 4AQ6A 1RUC2 2YC0A 4RS5A 3S6PA 4JGZA 4COUA 1H8TA 3LCPA 4LHNA 4ARYA 3AYDA 3VZOA 3UGHA 3ECQA 3VL8A 4JGZB 3KV9A 2OZJA 3OBRA 4XBLA 3KF3A 4HK9A 5IVYA 2WNVB 4XFIA 5LK7B 1XRUA 5JXHA 4K1YA 4YRDA 4NVPA 2R32A 3I2OA 1R091 4Q0SA 3TEWA 1ODMA 3AZVA 3KM5A 1G7YA 2YROA 3LAGA 3UL2A 1OSGA 5A7QA 1H2KA 4O9GA 3Q8CA 3IDCB 1UZ0A 3NV3A 1YEWA 3AKSA 1VBA2 4AFBA 4NAMA 2ZAHA 5HCFA 4IV3B 5F8PA 1NZCA 4G3YC 3RNSA 4AVAA 4GXLA 3H8RA 2HEYF 2GNMA 1AR82 5FMOS 4D6RA 5C3PA 1RTVA 1RXGA 1VBB3 1RHI3 2A6WA 5JUVA 3B3QE 4HMZA 1FOD2 2W08A 1NCQB 2VL4A 2Z2SB 4AF9A 2VVFA 4ASMB 4XIKA 5KXBA 3BALA 2Z69A 3U1XA 5JSOA 2O0OA 3LIHA 4UW5A 2DCJA 4W6XA 3KHCA 1X50A 1VB2A 4IE0A 2P3YA 1JHJA 3WUDA 1RUF2 3ZIXA 4N8MA 3ZN5A 3M3IA 1OI6A 1JYCA 2BNMA 3GALA 3CIHA 1J1LA 2WO1A 5C9AA 5FO7B 4DXSA 4AEDA 1BYHA 4IDZA 5CZKA 3NNGA 4EWAA 3VGIA 4YYOA 2XHKA 2GC2A 4QM8A 5BNNC 3O1PA 3W5NA 4NO4A 3HOBA 5FV3A 5LZ6A 4XUTA 4N43A 2B8MA 1VP6A 2E7QA 2W1UA 4V2VA 4Y24A 1L7QA 3R05A 3HR9A 1OVPA 2HBTA 1ULGA 3SH4A 4LIVA 3VV1A 3I2KA 4ZU7A 1PX3A 4ZPIA 2VCMA 5JOXA 3BODA 3FHAA 3M1HA 3PLQA 1GWLA 1HB4A 4HVRA 3E6CC 5I0DA 5ANQA 2I2SA 1O3QA 1V6KA 4CUAA 4W4ZA 5F2SA 4FPLA 1VPHA 3I2GA 4P9JA 2DCZA 5D1IA 3J4UH 5FJHA 3NNJA 4XF0A 2VOKA 1F35A 3GBFA 1RHI2 4J25A 3PHMA 1LULA 1CZTA 1GZWA 1NE6A 1ALYA 1XOYA 4QQHA 3WF2A 4CUCA 1S0CA 4CDUC 2CWSA 1HLCA 3MIDA 1GUIA 1LKNA 1MEC3 3GBWA 4Q8KA 4YZ2A 1AXZA 3ZFFC 2QE3A 5IK8A 3ZMNA 1AR72 3DL3A 2SLIA 3VHRA 5C4WC 4Q2FA 3P5BA 3AMPA 1SFPA 2DVGA 2OT7A 1YWKA 5A1LA 1LOEA 4OHYA 2WYFA 1W3VA 3V0AA 1V9U1 2EIGA 2JX9A 4OHWA 3UT0A 1OA2A 1XNAA 3K75B 4PBPA 2VPVA 5CVRA 2A70A 4XJUA 1W6PA 2MEV3 1WW6A 1VE0A 3NAPC 2X5IB 2WZR2 3LSDA 3KMHA 2CSGA 2G9FA 4WVVA 1YQ6A 4MXWA 2QQUA 1DYKA 3K3OA 4FT8A 5FZ9A 4CCLA 3MIEA 5KXEA 2OS2A 3SCFA 2BYVE 2AH2A 5LA9A 3WNXA 4AFCA 3AL5A 4AHYA 1UXXX 5FP8A 1WLWA 5FZ4A 1AL22 3LSEA 3MW2A 1C4RA 2VR4A 1OT5A 2CYFA 5ACA2 4RHV1 4WM8C 5H9QA 3WNPA 4AAXA 1UKRA 2J1RA 1SFNA 3ILRA 2D97A 4RGAA 1N3PA 5IK7A 1O3TA 3ME2A 1UAIA 2WT0A 5FZEA 3KCXA 5ERLA 5H9PA 2F4LA 5CADA 1F2NA 1RMU3 4MGZE 1MS3A 5GKAC 1EV11 3N9PA 4PDWC 1L7RA 1PX4A 3ZXDA 4LLFA 3FL7A 3AVRA 1LB2A 4QPGB 1TNFA 1DLLA 3CU7A 5IVBA 1IQDC 3OGRA 4A6SA 4CSWA 3IAPA 3LDKA 4XQ4A 3RJ2X 2OUHA 3WG4A 3RSJA 4JAAA 5FP7A 5M0TA 4IEPA 3VUOA 3GF6A 3P3NA 1G8WA 1DQ1A 1NQJA 2B7YA 2YB7A 2L9LA 4CUGA 4NAOA 4QAWA 3ZDVA 3B5LB 3EQEA 4H14A 3IN9A 4R4ZA 4YG6A 4ZXKA 2ZEXA 4EN9B 5DUVA 4QKFA 3S7IA 1C1FA 2YYOA 1JOBA 2J1TA 1XU2A 3BPZA 5FYIA 2OPWA 4LE3A 1J84A 2V73A 5GZEA 1MZFA 4M3CE 1PK6A 3I54A 2PAEA 1OUXA 3IT8A 2DCYA 3CKHA 3VBRC 3D4KA 2BDRA 2ZGNA 2ZGPA 1UZVA 5IATA 2FZ1A 2R071 1AR93 4BLIA 1ZBE3 4YZ5A 5CKNA 2WAOA 3JZVA 5F5AA 4FXGB 3A22A 3JB8A 1D2QA 3H3ZA 4R8HA 1WMEA 3JBG2 4RQPC 1POQA 5L9VA 5LB6A 1EV12 4YVSC 3F95A 1LODA 4D69A 4F83A 1O3RA 4CCOA 3ZX7A 1GANA 2Q1MA 1B35C 4P5YA 5FPAA 1DZRA 2CY6A 2QZ2A 2WSVA 2YHJA 3AYCA 3QACA 4SBVA 1PO22 1E5IA 4MGTA 1V6IA 2D93A 4Y5SA 5FTTC 3I3BA 5CA6A 2OXBA 1JYNA 3GBGA 1WWYA 4XBNA 2ET1A 1CZVA 3JUUA 3WG3A 1K45A 4NRMA 1VBB2 3HN1A 4MO3M 2R6QA 5I8TA 2HWC3 2V5DA 4E4ZA 5A7SA 3BCWA 2OZ6A 1GYKA 3LEIA 3VKMA 3TNQA 5LBEA 1CN1A 4GKYA 4FAGA 4U36A 4YWAA 1EV13 1SG3A 3AJZA 3JBG3 1DBNA 3E1F1 4UFMA 4WBBA 1Y43B 3ST7A 4FSJA 1ZRFA 2ARCA 5FBJA 2XLGA 1XJAA 3C2UA 3MDPA 1LCLA 2D6PA 3IMNA 3WDTA 4AAPA 5IUQA 3LGRA 5FYZA 3IIIA 4QT6A 1W2UA 2PHRA 2XMLA 4NROA 5BNPB 4TXWA 5K7PA 5A3NA 1N47A 2PXJA 3CLPA 3HD8B 4BB3A 4C0HA 4XFHA 2JDKA 2ATFA 4XFFA 4C90A 4XQDA 3Q8FA 4CEYB 1UCXA 4WZFA 4LHSA 3ZFFB 3DXTA 2HWC2 5SV8A 2VUJA 4K6BA 3RZZA 4K9SA 1MS5A 1TME1 1BHGA 5FLIA 1O3SA 3MF9A 3T1LA 1VBC3 2RJLA 1AL23 2OX0A 1CAVA 3GZUC 4NPLA 1K3IA 2VZTA 5EJZB 3PUAA 2JDMA 2C5DA 3PUSA 2WZEA 3AP5A 2ARXA 2WL1A 3AZZA 3O0WA 1RITA 4CEWC 1OA4A 1U0AA 5DDJ1 1TQ5A 1ND2A 4GQ7A 2XL9A 4XETA 2A5ZA 3SKJE 4IV1C 1OQEA 2HWC1 4L2NA 2QKDA 4K40A 1O5UA 4LK6A 5FUIA 1PGW1 2JG9C 3LEMA 2VQTA 1HN0A 2VW2A 4JKMA 1Q8VA 3B7MA 1ZBA3 3CL1A 3FX3A 2YUEA 3B9CA 3T0BA 2BOJA 5IK5A 3NO8A 3QCWA 5GZCA 3ACLA 2R0HA 5E6HA 3A4UA 5FO9B 1QJZA 5IFPA 4NWVA 2H0VA 1U5YA 2XWJB 2GNTA 2NP0A 4YW1A 3TNPB 5EJ1B 1QXPA 3SQOA 3VDDA 2JICA 1EPWA 3C3VA 2D98A 1GP5A 3O7OA 1PNGA 1RUI1 1HW5A 1HN1A 5FWEA 2J1VA 2FDHA 2B9VA 2YBSA 4MOAA 3SC7X 1CX1A 3U4SA 2XBO3 3GHMA 4HN0A 4DS0A 5C71A 3MUY1 3IKWA 4KH9A 1ASJ2 1A8MA 1ZYBA 1IPKA 1RVF3 1XE7A 4XDOA 5A32A 4P5HA 2QQJA 1W3XA 4LR4A 3RZMA 1NX9A 1KS5A 1XYOA 2WZR3 4TZDA 1V70A 4OMDA 5HCHA 4Q4W2 5EXOA 1QQP1 5F6LB 4BJ0A 2IVIB 2X29A 1JZ3A 1V00A 4AVVA 3HQRA 1OOPB 3BN6A 3B94A 1AR81 3B69A 3ZYBA 4UFJA 3QBQA 1R083 4QB6A 1OOPA 1SZBA 2P17A 2QQIA 3VBSB 2JDUA 3CJIC 5FYVA 3UKNA 1QWRA 2TNFA 1XSRA 3V56A 3VHNA 3WF3A 1EY2A 3WOGA 4E8DA 3Q8EA 4LBLA 4XC9A 4XYXA 1GNHA 3VL9A 3WXPA 2R30A 4AI2A 1FPN3 1OH4A 3UKVA 4EN8B 4I30A 4OZOA 1ND3C 3JQXA 3V0BA 1AHSA 2JG9A 4RN5A 1W6NA 1PO23 4IE7A 2PHWA 3UETA 5CU1A 4BCUA 4XVHA 2WZPP 3DKWA 2JG8A 2ZX1A 3SCGA 1CD3G 2VH9A 1W6QA 1A6CA 1W2NA 1UY4A 2V5YA 2Y60A 4CCMA 5KWRA 5EFUA 4QPIB 4XJAA 3RYKA 1BEV1 5C3SA 4ISRA 4XDQA 1FYUA 3A21A 5FMBA 3KZ4C 5KHHA 2C9KA 3RWNA 4OHZA 3T30A 2PQSA 1DHKB 4Q1PA 4FFFA 1J3PA 5LW9A 1QH7A 1TNRA 2V4AA 1EYBA 5FYMA 1F5FA 2JDYA 1GP6A 4HBNA 5D8AA 4UBGA 2Z79A 2VMDA 2PTMA 4YVWB 1OKOA 2DTWA 2WFF2 4FTEA 4LXLA 3AL6A 2HWD2 3IM0A 3TB0A 4E27A 1UQXA 1AR83 4RA0A 4Z82A 1VMFA 1MVQA 3N36A 3DPRC 1UPIA 2QTWB 1W8OA 4XUNA 4IEOA 4MXWB 4BQYA 2F4PA 4FPHA 4AQSA 2ZAAA 3AKRA 2E7TA 3DF0A 4L11A 2RS11 1H2LA 4UF0B 4CCKA 4AL9A 1UNBA 1MS1A 2IZWA 3OUIA 3TBDA 1SFYA 5CNAA 4YGBA 5FYCA 5J96B 2HWF3 4P9YA 4P9WA 2VZ3A 3T2OA 5CFDC 2E63A 1NUKA 2XJTA 2RS53 3GNEA 1IZ3A 2UWCA 1PIV2 2RHPA 4OLLA 5KHKA 4YGCA 4TLGA 3E5UA 4XFCA 5J36A 2W1SA 4AEDB 1DCSA 1N3QA 1QHDA 4L92A 4A4AA 3GGLA 2PN5A 3VD9A 3OGSA 3VBOB 2E6VA 4E4SA 1VAVA 5CKMA 5J7MA 4Z2WA 4XUQA 1JZ5A 1W2OA 2X53S 3Q9OA 4P00B 4QHZA 1W99A 2GH8A 2GU9A 5E16A 2Q8EA 4HT1T 5DAXA 2BGCA 1HXS3 3ELNA 4N90A 2IXIA 2WNEA 4ES9A 5EPAA 2P5BA 4OUEA 5FPZA 1Q8QA 3NNMA 1DYOA 1E57A 5EWSA 2BWAA 2B42B 1CJDA 1DZQA 3OBZA 5J09A 1US2A 2AEYA 4JC1A 3BIWE 4LA2A 4LIUA 5CFDA 5BNQA 1JZ6A 5DXDA 2GMPA 2CGPA 1NT0A 5FXWA 5FZ0A 1LESA 1VRH2 1DYPA 2VBDA 1SDDB 2UY9A 2VM9A 2YG0A 3FHQA 1I5ZA 3N35A 4QGNA 5DAQA 5IVJA 1F4HA 4QPGA 1NLSA 3I49A 3RWKX 4HANA 2D7FA 1AZDA 1QOSA 5DG1A 2G4IA 1DGRN 1LGNA 5GZGA 4QDSA 2D6NA 1AX2A 2XUEA 3ZDSA 2PA7A 2VOVA 2A7AA 1V6LA 2ZACA 1SBEA 5CIRA 4BK5A 4CE8A 1VLNA 2EALA 2HYKA 3NWKA 1JZ8A 1ZBA2 2I45A 3I7DA 3LA2A 2JE9A 4FPCA 4QXCA 1QJX3 5FKBA 4LO8A 4AXOA 4QX8A 1PMIA 3H50A 4OI2A 2C0ZA 3MW4A 1GKBA 1JS9A 4LA3A 5L7OA 3ZPYA 4MXVA 4DNYA 3K2OA 4EJRA 1MQTC 4O9EA 3C7FA 4UAPA 4WM8A 2WQ4A 5K8SA 5FZ7A 4Y4RA 4MX3A 3PIJA 2GNBA 4NRPA 4Y5TA 5G05L 4CDWC 2HWF1 4O65A 1G9DA 2C9AA 4UF0A 4AVCA 4MGQA 3KLSA 3CF6E 1UD1A 4XURA 1ULOA 5A3WA 5DMYA 2JG8C 3JCIA 1XYNA 4XHBA 2WYSA 3ZYPA 3PUIA 3CBNA 3EMRA 2SBAA 3HEIA 2VMFA 1CR7A 1JUHA 1AYN2 3ACIA 4XOGA 3VZLA 3OEBA 1GWMA 2CAUA 4QQPA 3O5SA 5F2WA 2RMU2 4KL1A 1CESA 1JMUB 3KSCA 2JENA 3VKLA 5FZKA 2VBPA 3K48A 1CONA 4FP2A 4M0HA 2ZBJA 3RI8A 5FKCA 5I0RA 1OOPC 3I8TA 2DVBA 3RYRA 4AQ2A 3ES4A 4E8CA 5T5JA 3FLRA 5C9AB 1PZ7A 2ZTNA 2EAKA 1XXNA 2VTFA 1CZSA 2ZGUA 3NRUA 3H1YA 1YQCA 4Q4V2 3T4HB 3M70A 4MYEA 4Q8LA 2R073 1ZZCA 4HFSA 4LOTA 5HCBA 1VBA3 3J8F1 2DYCA 3ZN4A 3WG2A 3RPQA 3ZIWA 5HI0A 2B9UA 3SH5A 4EN7B 5FP3A 2WO2A 4WV8A 3GCWA 2QZ3A 2GP3A 3H8UA 4JTNA 3R4UA 3WV6A 1NLRA 3ZYFA 1Z0HA 4QQLA 3ZFGB 1RYYA 2O8OA 4MLOA 2W2IA 1RUJ1 1UMIA 5EZWA 5ABJA 5T5PA 4AEMA 1DQ0A 2VW1A 2BGPA 3OGJA 2DUOA 4KGGA 1EAH3 5BNNA 1QH6A 2JECA 4NHYA 1HXS2 2WR9A 1VRBA 1WD3A 4OHVA 4B1LA 1JN2P 1K12A 4AEDC 4A7YA 2J1UA 5D8AB 4I2OA 4JRAA 5C9AC 1GQHA 4AHZA 3KGLA 4XFGA 2AYHA 4PIZA 4OULA 3WINE 2J42A 2ZX2A 3FZ3A 2ORXA 2GDFA 5E88A 3MYXA 3T2QA 4ATFA 2GP5A 3I59B 1VRH3 5J98B 1ND2C 3QLQA 2YGLA 2LTNA 1NA1B 3AM2A 3NKGA 1IS4A 4P9IA 4AGGA 4YG3A 1ZREA 1V9U3 5AVPA 3WQ0A 5FZOA 4CUBA 1IS3A 1CAUA 5DPNA 4EROA 4Y26A 3ZVXA 4DFSA 2KXLA 5F37A 1O4YA 1OXCA 3AFKA 4UW3A 4QX1A 3C7HA 5GLWA 4GB31 4JDNA 3UV9A 1OH3A 1Y9MA 3OPTA 1VAMA 1MACA 1NXMA 1VBE2 4LKFA 4PCRA 3ZYIB 5K0UB 4R9BA 5E89A 3A0NA 4Y1VA 3R4SA 5FY9A 1FV2A 3G6JB 5F5QA 4YVWC 4H2AA 3O1VA 1AYN1 2JE7A 2JG8B 2QDNA 3A7QA 3AK0A 5CAZA 1UPSA 3WF4A 4BE3A 4G9SB 3BKZA 1AX1A 2KD7A 5KC5A 2ARAA 1FPN1 4E2QA 1U5IA 5IVEA 3MBWA 1RUNA 2UWAA 2WFF3 1W6MB 1W9YA 2QQVA 1J59A 3VDBA 2QQWA 4Q4V3 4KWKA 4ZY9A 3RRDA 4JGZC 1NQDA 2ET7A 4DO0A 3SNMA 1JYXA 1AF9A 4RS5C 4IE5A 4XTPA 1YNAA 1RUG2 1YUDA 1WKYA 2RR11 3DYPA 4Q27A 3UKTA 1YJLA 4FPFA 1MS9A 4X8NA 2D6MA 4BPZA 2W5FA 3PNAA 2IXKA 2VO5A 3KT4A 2VW0A 2DCTA 4J1XA 2PFWA 4BQ5A 4Y20B 4Y5Z0 3W9AA 3MI8A 5A7WB 2ZGMA 1L7LA 1Y3TA 3I3QA 3E6BA 4Q0QA 5AFBA 5JOZA 1QJY3 3BVCA 3PMEA 3UESA 3CJIB 4DUWA 3N9OA 4OVEA 1EAH1 1KGYA 4GB33 2Q8CA 4XAEA 1G9BA 2WZ8A 3WW1A 3VD4A 3O1SA 3H8OA 4RQPA 4IETA 3ABZA 5D21A 2R062 4UYBA 4XTMA 2W1WA 5DZFA 4YW5A 1PIV3 1X9PA 1CAWA 2Y6LA 2BEOA 5LEJA 5SV5A 4MG2A 4GH4A 3AP4A 1GWKA 3HNBM 1TVGA 3KV5A 4GJZA 3U0ZA 1OC1A 1V6MA 3OD0A 1UZWA 1PK6C 1VRH1 3U78A 2WN2A 1SPPB 3T0DA 4AZZA 1O8SA 1XE8A 4FOQA 1ENXA 4J1WA 3IZOA 4D6QA 4YM3A 1Q43A 1QJFA 2A3XA 2N7GA 2RR13 4QX7A 2NMNA 3WQ1A 1RUOA 2XQRA 1UYPA 3BGAA 3JD72 1UU5A 2WO3A 4NR1A 2DVFA 2W92A 3LZZA 4KBBA 1MZEA 2W95A 2V4VA 3VBSA 3K77A 2XJRA 4AI0A 3KVBA 1WZXA 2I07B 1LU2A 3ZR6A 1JU4A 1V6NA 1PZ9A 4PDWA 5JIAA 2BUKA 4Z8BA 3ZXGA 3IDBB 1RUI2 1XNTA 3DGTA 4A41A 4W65A 5FZAA 2WNUA 2XVGA 5L9RA 3FFQA 2GZWA 5E8AA 5GLUA 4AI9A 5FZ3A 5GLVA 2BVVA 1ZZ6A 4EYUA 1D4M3 3P1IA 4QX2A 3B00A 3AMMA 3KD4A 3WT3A 5DAWA 5LA1A 2RDSA 2RS31 2VTXA 1EPZA 2LS6A 2ZEZA 3J7HA 3VBOA 2JD4A 3PUQA 2JJ6A 3D0JA 4B7KA 2W68A 4K3UA 1YQ5A 5CG8A 4YFWA 1QGLA 2YMZA 3WNLA 1W8ZA 1AYN3 3INAA 2TUNA 1ENSA 1ULPA 4FP3A 3T2TA 3WUCA 2G1MA 3PVEA 4QKBA 3VKFC 1PHMA 4YGDA 4CU9A 4DPNA 1ODNA 2RDNA 1OLRA 3DKQA 4B8EA 4CCEA 5C5TA 2A6YA 5J1XA 2JDPA 4N53C 4RFT0 4HKWA 2YGMA 5EYYA 1UXZA 5DZGA 3FC0A 5IAXA 3VBFB 4GWNA 1G6NA 4QU2A 1NY71 2ES3A 1W03A 2WKKA 4O61A 2VOWA 4RR3A 1CIWA 2BWCA 2VCBA 2VZUA 4S2FA 1B35B 1WMFA 3ENRA 4AR2A 2ZMKA 4KMQA 3ORJA 4COZA 3HMYA 1JZ2A 3KGZA 4LORA 4BH9A 3NQHA 3KV6A 3CJXA 5T55A 1B09A 4MZUA 5C8CC 1W8NA 1XNCA 1PGSA 5DUUA 2FDJA 2K9ZA 1QJU3 1GBGA 1W8HA 1W90A 1W9WA 5HV0A 4ATEA 1SDWA 5FXZA 3POFA 4X8PA 2X05A 1VBC2 2QBXA 3BU7A 3ZSKA 1GNZA 4QGLA 1H6XA 2OKXA 2YC4A 4BXFA 4KWUA 4R9DA 4YFZA 3LWCA 2BFUS 3V0AB 3WLUA 1MEC2 1OD3A 1SPPA 2P3IA 5EJ3A 4ASKA 4BOWA 4RHV2 3OF1A 4CU8A 5FWJA 4KBZA 4OQ9A 1TME2 4XJZA 4IGPA 2IXCA 1ENRA 3ZYRA 4Q4X3 5F7UA 1HRV2 4N43C 1YI7A 2DVDA 3ETQA 1BMV1 1JW6A 4N43B 4LBQB 4R4XA 2GSYA 2FCTA 4FFGA 3VLBB 3X29B 1ZRDA 2LALA 2Q1ZB 1X8EA 1XYPA 5EHDA 3KCYA 3LQCA 1RINA 2NZ9A 3DXUA 4A42A 2EIDA 4JKKA 1GP4A 2JWPA 2RG4A 4NHXA 1WW7A 3ZYHA 4PJYA 3BYWA 4J6GA 1H2NA 5ACA3 1JBCA 1RUH3 4LKDA 1HB3A 2DV9A 1PMHX 1LJ7A 2UYBA 2VNVA 5A33B 4EN6B 3WNOA 1IQAA 5F32A 1UZYA 4XMIA 4TTGA 1BBT2 5BNOB 4BQ4A 1UY0A 2GALA 2WS91 2PELA 4CEWB 3D8CA 4R52A 4K7JA 3WDWA 1REDA 1S4CA 2VU9A 5DUXA 4CPBD 3WNNA 3JB4C 1J3QA 4AE2A 3NVCA 5KHGA 1N3OA 1LGBA 2DUPA 1D4M2 2EF6A 3HVDA 4DUVA 1WCKA 3GHNA 1ULDA 5FFOC 1L3JA 2PHDA 2JEMA 1QEXA 2VOXA 3VDAA 3RZKA 4IEYA 3VDDB 1VBA1 3WHTA 4QD2A 4I0WB 2QFEA 1W6PB 5T3NA 1FATA 1RUH2 5JCTA 4NHKA 4YM1A 1HX6A 1PVC2 3AC0A 3R6SA 2VC9A 5IT6A 3PU8A 1W04A 1XU1A 2ZEWA 2ADEA 1CAUB 5T54A 1R1ZA 1RVF1 2E31A 5LWBA 4C1XA 2EVXA 1WLTA 2C6SA 1JHNA 1TZOA 2OA2A 3OCPA 4PF5A 4W6YA 5IVFA 5KR7A 3BIEA 3NAPB 5FK7A 3LPFA 3WQ7A 5F9TA 2ILMA 1GICA 5FQ0B 4BQ2A 4XMAA 2G9GA 4AHXA 5LBBA 1TMF2 3ZLIA 1RJ8A 5C3OA 2QQLA 1YI9A 3FUOA 4WVWA 1UY3A 1UMZA 3POWA 1WA4A 2W94A 5FYYA 1ACCA 4AFAA 1I6XA 5LK5A 3JXSA 1W06A 4OI4A 4RYDA 2W0XA 4AQTA 1JTZX 3K46A 3MLJA 3SCHA 2VECA 1RUJ3 2JDNA 2E53A 2NLRA 2R043 3CMGA 1D7PM 1WBLA 1N1TA 3C7GA 4GMP1 5H9SA 2G19A 4YW4A 2RS51 3PIGA 5FJKA 3FBMA 5FY8A 1CJPA 4RR3C 3OG2A 1KDKA 3D6EA 4IV1B 1CX4A 1VBE1 2BVBA 4GD4A 4O7XA 4H3WA 4OCTA 2VVDA 3FJSA 4JGYB 2W39A 4Q4Y1 1UO9A 1R082 2WWJA 5J37A 4YZ4A 1YFXA 4N53A 4W50A 2VBBA 4IEWA 1GMMA 2JIJA 2RDQA 2ZX3A 3EYPA 2WNOA 3I2IA 1ZRCA 5B2GB 1KJRA 1DQ4A 3LFMA 1GNYA 3MLLA 1QXJA 2CGNA 5I8YA 2VNRA 2ZA9A 4F3JA 3VHOA 3J7LA 4CEYC 5JXJA 1EUTA 3TEYA 3IMMA 3AP6A 2A75A 1G9FA 5BNNB 2XLAA 1QDCA 3I2DA 4B7EA 4BHPA 3QD6A 3C7EA 4LNVA 3WW3A 3VBUA 4LO7A 2P2KA 1LOCA 1N1SA 3FE5A 1N1VA 1YFWA 1N1YA 2A6ZA 4Y1ZA 1MS8A 1PZ8A 2BGOA 2W52A 4IV3C 2VY0A 4ASLA 4NMIA 1RMU1 2ZEYA 4Q4Y2 4AW7A 2IUWA 3BPSA 2WQZC 3IDAA 4LTAA 5CFCC 2AACA 4BMBA 1BEV2 3NJXA 1C5IA 5A6ZA 2D3RA 3DYOA 3N9MA 4IV3A 2W1QA 1DGWX 2HWB1 1NLQA 3CHXA 2VTXJ 3U14A 5JVVA 3HT1A 4I3PA 4IEQA 3T1MA 5BV6A 4CDQA 3I4IA 3GZAA 4XIOA 1CVNA 2ORZA 3OEAA 3VBSC 5C7GA 4DY3A 2J1AA 3SKVA 2JB8A 3HBKA 4FPEA 1W6OA 4OFGA 1PVC1 4WM8B 4D7SA 3J9SA 2UU8A 1ENQA 2XOMA 4BMEA 4XE9A 1LEMA 4DINB 4FAHA 1I9RA 4PLMA 1UKGA 4BQWA 3QOPA 4AWDA 1ND3B 3VBRB 2CWMA 3DN7A 4YW3A 1WCSA 2R1DA 1RIRA 5CFCB 2P6CA 3ITQA 4LBJA 4BIFA 2I74A 1ZBE1 2EIEA 4TSVA 5F3EA 5FYUA 4GZ9A 2RM23 2PMWB 2HWD3 5FPBA 2Y6FA 2K46A 2WS93 2VZOA 3WSOA 2A73B 2AZ5A 1OFSA 4HSLA 4LO4B 4UOJA 1EAH2 1R092 2FCUA 4FPJA 5F5CA 3UGFA 4XPVA 2ZGTA 4XFAA 3SITA 3CZJA 3H7YA 5JI7A 3OGVA 3GZEA 1COV3 3W20A 3ZSLA 4WM7A 1VBC1 3WD5A 1U5XA 2PHTA 4QGMA 5CYYA 1ST8A 5D2AA 3TN91 1AR92 4UI9L 1JH5A 4K20A 5HXMA 4D7YA 1AL0G 2FMDA 3ZN6A 3D5OA 4AK3A 4QHOA 2P34A 2EXIA 5CBLA 1O4TA 3MGUA 2QQNA 5LRSA 3KS7A 5G04L 5KXDA 3N4MA 2J7MA 2WSUA 4XAAA 2VZRA 4FQZA 2MHFA 4NN0A 4RR3B 3OGGA 3TEXA 5FMDA 1NOVA 1SQ4A 1XB9A 4KG8A 1X7NA 5FZFA 5TSWA 1GOGA 3THPA 5LATA 1IG3A 1OQDA 2DFCA 2P37A 1IS5A 2RMU3 2QQMA 4D0QA 2NPIA 2HWE2 1RB8G 1UWWA 2VUDA 2PLV1 1COV2 1HV0A 1O5LA 4YW2A 3WR0A 3WP4A 4CP1A 5EP9A 4XDPA 4IEZA 2C4XA 5JPNB 3N9LA 1C8M1 2H6CA 5K0UC 2WWUA 4YVWA 1OF4A 1RUF3 1PO21 5DABA 1TEIA 2Q0AA 4B4RA 4URAA 5JSPA 1ZA4A 4FTBA 1AVBA 1XPWA 4JX0A 5FZ1A 1K42A 4QQ2A 1PGL1 3M7AA 3LPGA 2JD9A 3ZXKA 1YIFA 3WW4A 4PQQA 1FXZA 5JIUA 3ZOIA 1Q8OA 3MIHA 1UU6A 4QQOA 3DECA 5FZLA 1HQLA 2AR6A 4KQ7A 1VBD1 1O8PA 2DCKA 2EXJA 3EBRA 3I59A 2BTVC 3H7JA 1D4M1 2DF7A 1SLBA 3OD4A 4QX0A 1A3KA 1Z7S1 4JTOA 4IEUA 3FN9A 4C0BA 5BNOC 4CDXC 4QX5A 2XJVA 1SMVA 1AR71 3R0RA 1NCQA 2JKBA 5FY1A 2W46A 5FY4A 1IS6A 2VNOA 2FMYA 1MR5A 4EV0A 2PLV2 3W5MA 1V6JA 2FDGA 1WA6X 3VBHA 4LBKA 4PIXA 1JOJA 3ZFEC 5A6XA 4YW7A 4BXSV 1HRI1 2R063 3IIAA 1E5HA 1RVF2 5JI9A 2QQOA 1RMU2 5FZMA 1GZ9A 4CCCA 2X8KA 2GC1A 2KM2A 4IE6A 3TN93 1OLME 2W3JA 1IKQA 5FCCA 5L9BA 1DQ2A 4M0NA 4ARXA 4QDQA 2BQPA 3WG1A 4QKDA 3LEKA 1LU1A 3SXWA 3IPVA 3ACHA 4HG6B 2Y8KA 2E51A 4RGGA 5T5LA 3T0AA 1S2KA 1W6MA 1ZA7A 4OHXA 3N7MA 3SISA 2BFUL 4BZ4A 4LO5B 1LENA 1X82A 1AR91 1PK6B 4LHKA 4QM9A 5C6CA 2PAMA 3FFZA 1DP0A 3ATGA 3V0BB 1CQ9A 4M3CA 1S55A 4E2GA 1KD7A 2A3YA 4K8FA 4WVZA 2JDZA 1NAEA 1D0HA 2NYYA 3NV2A 1GZWB 5AVAA 3OBTA 2OPKA 1U5ZA 2DU0A 5C8CA 4I0AA 4NIIA 3H1WA 4COWA 1BVP1 2VULA 5EIYB 2XB6C 3CEWA 1Q3EA 5I0TA 5F3CA 5A7OA 1LHOA 3PUHA 1A8DA 3RMYA 3IWZA 3T4VA 3N7JA 2Y38A 1NZIA 4HPKA 3ZXAC 3RJRA 5FIXA 1OF3A 4FVVA 4PHZA 3WDUA 3LIGA 4CU6A 4MGSA 2ZHNA 1H30A 2CV6A 5FZGA 4AI3A 1CPMA 4XF3A 2GMMA 3AXDA 3LKJA 2ERFA 4XXPA 1DQ6A 5F3IA 3ZXLA 2HWF2 3NNFA 1UZZA 4AOCA 3UJOA 4EWEA 1AXYA 1WMXA 2VG9A 2Y34A 3E5QA 3I3DA 3VBFC 4AGVA 2Y64A 1W8WA 3H8XA 5LCWL 5F6KA 4A3XA 1OBNA 1DDLA 4D6SA 1G9AA 4KWJA 4K21A 3S7EA 5JZGA 2ZGKA 4Q0VA 4CXWA 3A0KA 4QX3A 5BPXA 5K4LA 4DXZA 3N9QA 1S0GA 2KR2A 3TRSB 4FO9A 5F3GA 3LF7A 1AJKA 1PNFA 2WJSA 5JZGB 5AC93 5DG2A 3URFA 1BXHA 4CZSA 1ULFA 5A3MA 4CVUA 5L7OC 1O6UA 4QU1A 3L2HA 1O59A 2YDEA 1AR73 3GXUA 3RG0A 4NWWA 1DGWA 4XUOA 5CISA 2R1BA 4L9BA 2YFZA 2HWE1 3E5XA 3KCCA 3A23A 4UFKA 3USUA 4CXXA 1OPMA 2K0GA 2WNUC 4DOUA 1WW5A 4CDXB 4F8AA 3FUQA 4BLJA 5FP9A 1WMDA 4XJ8A 2EIBA 1CIYA 2D6KA 1J58A 1X9TA 1RJ7A 1REEA 3U10A 4NIAA 4BU2A 1H9WA 3NJYA 1CAVB 5A7NA 2BNNA 2Y26A 4YNIA 5FYSA 4N7UA 4EQVA 1DU3D 2XPJA 1OHFA 3BTZA 1H4GA 3BOWA 4HKOA 4QXBA 2ZZJA 3RS6A 2X5IC 1KFXL 2X09A 3K51A 4K8RB 1F9KA 4Y20A 3MZHA 3SLIA 1F5JA 2VCAA 2DDUA 1POV3 4M3CF 1I5PA 1QJY1 3L2YA 4FBFA 3WEZA 3O1RA 2E26A 4B3NA 3HIFA 4ISQA 4Y33A 1YJKA 2BOIA 1ASJ1 3H3LA 1X33A 1E5RA 1ZZ7A 2VMHA 4IESA 2IFRA 4N53B 1AX0A 3VZJA 1RUC3 1Q5OA 1GV9A 2WBKA 2LM3A 4CCDA 2J1EA 4LUMA 2XJQA 2GMEA 2LUWA 3OTFA 5L7OB 4M3CB 2IXHA 5JDBA 3AZWA 4P9LA 3VD3A 1V6OA 2XJPA 4FPOB 4YPJA 3ZFGA 2XH6A 4QWNA 1RGSA 2WN3A 3WX5A 1UL9A 3LB9A 4OI0A 3O0XA 5FDBA 3GDBA 1K5MA 3NW4A 4BM8A 2ZGQA 4XZUG 4ORFA 1XNKA 3J8F3 4GJYA 2DBNA 5FRAA 1UY1A 3LOIA 1C5HA 2YU1A 2XVKA 4X6QB 3C7OA 1UU4A 3POSA 4PBOA 3MLKA 1VIWB 2IVJA 1KITA 1UF2C 4ZU4A 5FMCA 3FWEA 1MEC1 1QOOA 3ILFA 5JOYA 1C8M2 4AVBA 1GOHA 1IG0A 4HK8A 5GZDA 2XKPA 2R7EB 3O14A 2MEV1 3BB6A 2JDHA 4Y1UA 4YZ1A 1RL3A 3E97A 1NA1A 1C1LA 3FLTA 3V64A 4LBQA 4QXKA 4LBMA 4NPRA 5AC92 2RS33 1C8NA 3J7MA 4L8QA 4M4RA 4QPIC 4EN0A 2WZR1 1BK0A 3SHRA 2Z42A 4XF1A 1OLQA 1UOBA 3AB0A 5APAA 3DPRA 1V9U2 1DF0A 2CL2A 2P1BA 2VZVA 4H7LA 5KHIA 5FOBB 2B39A 2XR4A 4SLIA 4BIOA 4ES8A 2VE1A 3TWIA 4KU7A 4NHLA 4HZFA 3OUHA 1YO8A 1UOJA 2Q4SA 4N7IA 3UK9A 4OYUA 2Z4FA 3RZJA 1WD4A 4F7ZA 3RZGA 3TN92 4CDWB 2F17A 1FMD2 3CO2A 3AZXA 3CNAA 1W2TA 2HH9A 3I97A 2IFWA 2ZMNA 5DDJ2 3WP6A 3DUIA 3HAGA 2E7AA 2P3JA 4QDRA 4UFLA 4WM7B 2BNOA 3RYPA 4LULA 2RS12 2P4EA 1PM4A 5FY0A 3AKPA 3ZKUA 2D6LX 3KV4A 3QH7A 1JYTA 3GM8A 3OSDA 1H2MA 2XVLA 4XCBA 1COV1 4NJ4A 5C3QA 4ITCA 2RS52 5FBZA 2ZX4A 3RFRA 1QJEA 2WINB 5A3TA 3KF5A 3ZSMA 4BISA 1UYZA 2NM1A 3S57A 3ACGA 5FPXA 1R1A2 1FOD3 4FFIA 4CU7A 2DFBA 2B4KA 5DZEA 4RFRB 2HWE3 4RL7A 3CJIA 4B4PA 2W9XA 3ZMOA 3OYWA 3O1UA 3MFCA 1DQ5A 4LKEA 5FZOB 3VB9A 1CAXB 4XF4A 5ABJC 1OQ1A 3Q8BA 4NIHA 2NN8A 2RM22 2VVEA 1HB1A 1AUYA 2BERA 1HJFA 2RS13 4LEJA 1FAYA 4FOYA 4UW4A 4BQ1A 4V1PA 3JD71 5A7PA 3FMGA 2Q8DA 4D3WA 1SCSA 4AGRA 4D8MA 1QIQA 4EWDA 2ZX0A 5HV4A 3BUCA 2ZGSA 4DIQA 2O14A 4AI8A 4NOTA 1RUE3 2ZS6B 5LY2A 5A32B 3L9JT 2WDBA 2ZKLA 2HBUA 2VMEA 1A34A 4NIDA 1Y9QA 3OY8A 5C5UA 1S0DA 4CYDA 4MV2A 2VD7A 1WLCA 5C3RA 3WW2A 1VBD2 4PLOA 3U4XA 2RVAA 2WIIB 2BU9A 5FPLA 3ZYJB 3AMQA 3GJBA 4KNCA 5A6YA 4PF1A 3ZFEB 1BK1A 2VXRA 5I0SA 2PHLA 3LDRA 3OPWA 4INDA 4GULA 1LNSA 3WZ1A 5FYTA 3C8XA 1W9TA 4QB1A 3SMHA 2WNUB 2RDRA 5FUPA 3P6BA 3GJAA 1GZCA 3WNKA 1KDMA 4IV1A 1CPNA 1JI6A 3TEZA 2ZHMA 4CEWA 4MSVA 4Q0UA 2UY8A 2XKOA 3PDQA 4CDWA 1LOBA 1GU3A 3MIGA 3N7KA 4PLNA 2AC1A 2WUHA 1H9PA 1KEXA 3K4AA 4XQWA 1W0OA 2XQXA 4QHBA 1SACA 3ON7A 3CZUA 3M3QA 2C1FA 3KB5A 4I3GA 2VGDA 1MQTA 4BQ3A 3NV4A 1ULCA 1SHWB 4JRLA 2WAAA 4NPMA 5JSRA 3ZSJA 5A1FA 1FPN2 1OURA 2YZ4A 4LT5A 3IAQA 2R16A 3M3EA 1NCRB 3PVOA 1ZNPA 3B01A 1W9SA 2OQ7A 4C8DA 1MS0A 2HKXA 3HBZA 5IWFA 5AC91 3S0MA 5JMOA 3H9AA 2E32A 1BJQA 1URXA 5DDJ3 2HJIA 3Q8AA 1US3A 2VZQA 3EO6A 2FDIA 1S0IA 1UY2A 1FMD3 1VALA 4D94A 1C57A 5FR3A 5JXGA 1SLCA 4UFIA 4JDMA 4JVAA 4LJHA 4RQPB 2VQAA 4DRVA 1SLAA 2CDPA 2LW8A 4YLZA 4ZONA 3THCA 4XW3A 4DXTA 3AFGA 1H1IA 4QPGC 1FOD1 5JXIA 3LDBA 4LK7A 1ULEA 5GM0A 3ZXJA 3LFIA 2Y6KA 3WY6A 1YHFA 4AFDA 3WF1A 1Q8SA 2ZKNA 1OVSA 4Z1VA 4A6OA 1I3HA 1NG0A 5GLZA 3HT2A 4UBHA 4DZGA 1FNYA 4LITA 4PI0A 1GQPA 1KQRA 4MADA 4AYUA 4XFBA 1QJU1 4EZHA 3ILNA 1LHWA 4YVSA 5FZDA 1H4HA 2IWGB 1XSQA 4NRQA 1APNA 5JWPA 5KBFA 1HIXA 1VMHA 2VOTA 2G9ZA 1UW8A 5F1RA 2JXAA 5L36A 3MW3A 4Y1YA 2ZABA 1PVXA 4DB5A 3MFAA 3U11A 2FD8A 2HEWF 2YPDA 2D40A 4A2UA 2WO7A 1HRV3 4UWDA 4LO6B 3MUZ1 5LBCA 4IEXA 2VMCA 5IJRA 3UJQA 2D3PA 4IUGA 3KVAA 4FFHA 2HWB3 1RUI3 1DLCA 1LECA 3E6DA 3FBYA 2ZGOA 5DAPA 4LBNA 2Q5TA 4MVTA 3R4DB 4YM0A 4W6WA 1YYNA 4LBQD 2YY1A 4Y4YA 3POGA 3TYJA 5C8CB 2D43A 1DGRA 1RUD1 4P02B 1UOFA 3IBMA 1JODA 5GLTA 1VJ2A 1QDOA 3O12A 2O1QA 3TAYA 5FZIA 4KI5M 3RGBA 4KU8A 2F6BA 1QXRA 1ZZ9A 2EAAA 3MPBA 4FPGA 2VZSA 3APBA 1IOAA 2Y6HA 4ET7A 1XC6A 1AYM3 4M00A 1R1A3 4MGIE 2J22A 4UFHA 3ZKYA 3FHIB 3D3AA 1UMHA 5JAXA 3W21A 3MF6A 4MH0E 3U07A 2BBVA 1RUF1 5D8AC 4Y22B 4CCJA 3M8LA 3O1OA 4XUPA 5FK8A 3OOXA 2ETEA 2B45X 3PJYA 1OUSA 1UN1A 2XBO2 3O1MA 3VHPA 1HDKA 1AJOA 1K5MB 5JZGC 3EXUA 3LOBA 1S0BA 2XXZA 3AYEA 2QCSB 4Q1RA 5DUWA 2RE9A 4E4HA 4MHUA 4Q4W1 3NAPA 4LHLA 1MS4A 3THTA 3V65A 5IYYA 1S2EA 2FHRA 2ENRA 2ID4A 1C8M3 1TMF1 5C4WB 3I2FA 4Q29A 3J26N 1ND3A 2XUMA 4Q26A 1ZRIA 2Y6JA 4COYA 5C4WA 3HQUA 1YQ2A 3BU0A 3WDVA 1LGCA 1S2BA 4IL7A 3WVJA 3ZFFA 4Z92B 2ZJCA 3AKQA 1ZBA1 1LOAA 2XJUA 1ASJ3 4H7MA 4BDVB 2MNGA 3ZO0B 2R0FA 1QU0A 3WP5A 1OA3A 4HXCA 2FCVA 2ARBA 1W28A 5T50A 5A80A 5LEKA 4I0BA 3KQ4B 2BZDA 3WDYA 3BTAA 5A7WA 1H1MA 1D0GA 2CAVA 3RDIA 3MIBA 2R042 3W59A 4CP9A 1HRV1 2IXJA 4UW6A 5J3UA 3KT1A 5FXXA 3NMBA 5B4XA 4N9HA 1UX7A 1XE0A 1MZ5A 2TBVA 1KXGA 1PMJX 4PIYA 2B46X 2R49A 4QPWA 3NV1A 4A45A 2X10A 1AL21 1J3RA 4XEZA 1YFYA 2H0BA 3B93A 3AXEA 1RXFA 2XONA 3PVNA 2GC0A 3AP9A 4HLTA 4YZ3A 2ZMLA 3MPPG 3SEPA 3VDDC 4EE2A 3VZNA 4XJ9A 3SEEA 2MEV2 3K4ZA 4CRQA 3VBUB 3HNMA 3VZKA 2GH2A 4IEVA 4CXYA 2D5HA 1RUD3 4WVMB 3HN3A 4EZ4A 1W0NA 5JR7B 2WQ8A 3BTXA 2WFF1 4AFMA 1SLTA 2VUAA 1O7FA 1HJGA 2QQPA 1ZRRA 3AVSA 2AUYA 1NCQC 1PO11 2JE8A 1YC61 2GAUA 1DG6A 2Z5WA 2WLQA 2XBO1 4MGKE 3AKTA 4P08A 1PIV1 2R041 4R9CA 5LBFA 3PVBB 1E5SA 3WCRA 4YARA 4BK4A 4B29A 2AGSA 5C8WA 5FPUA 3ETPA 2R061 5FPVA 1CAXA 4PDWB 2VXJA 1SLLA 5C70A 4TN7A 1OLMA 1QNYA 2CGOA 4IGOA 2JIGA 4ONUA 3I2HA 4E4DX 3ZR5A 5DN2A 2BRTA 3MICA 2W87A 3PL0A 1RUE2 1YCIA 3S5QA 2EICA 4AI1A 3HQXA 5ANNA 3PURA 1DGLA 4HOOA 1OFNA 1GQGA 2CNAA 4JZRA 3U37A 1LHUA 4TYSA 3CQOA 5K0UA 1GR3A 2UURA 1AYM1 5LASA 3WQBA 2GN3A 4JHTA 3OY8B 1SBDA 1REFA 3NKTA 5EYXA 3S30A 5KHJA 4TWTA 3ALQA 4FPYA 4FOWA 3H42B 2YFUA 1NYWA 4QPIA 4FTSA 1T2XA 2ZGRA 2E9QA 3TOJA 1AR63 3B02A 3H0OA 4LOSA 5FZBA 1HQWA 5DQ0A 2WA4A 5GZFA 3WF0A 1H8TC 3PTRB 1BZWA 1NA1C 1R1A1 2VUCA 4A44A 1JXNA 1SEFA 1Y4WA 2YPJA 3DYMA 3K4DA 4XBQA 1NY72 5F5IA 4GKXA 4A7KA 5A3UA 5JR2A 1F8VA 3VKNA 2XL7A 4JGYC 2YBPA 1WLDA 1QF3A 3ZN6B 3ZSEA 2QVSB 2VNGA 3AMNA 5BNPC 4CP0A 5L73A 3POEA 4OI1A 2ADDA 1U12A 1LEDA 1F4AA 3GCXA 1B35A 1RUE1 4CTEA 2C26A 3ROUA 1BEV3 5IHRA 3POBA 4S2GA 4HETA 1K5MC 1EUUA 3JU9A 3USSA 1JYIA 3BOPA 4XHXA 1POV1 2WABA 1PO13 5FZCA 5A3OA 5B4NA 3AZYA 4GH4B 2A1XA 1IPSA 3ZFGC 4Q0PA 4MUVA 1RUD2 5L19A 1BMV2 5EV7A 4Z2AA 2B5HA 2PYTA 4L99A 4X6RB 5IAVA 3NJVA 5FQ0A 3UNPA 5I0UA 4B4QA 1CAWB 1H0BA 1W39A 3VBRA 1M4WA 1JZ7A 4Q4X1 5JPMB 3P3PA 5C33A 4WVMA 2DURA 5BUVA 4DEQA 3MV01 4YW6A 3RVHA 2EA7A 1FNZA 2D6OX 4CCNA 1CGPA 3VKOA 1BBT1 2D44A 4AVSA 1XNDA 1YLLA 1BCXA 4Q5OA 2VQUA 3D82A 4MGYE 4Y22A 3HNYM 4DY5A 4CDQB 2RMU1 5FYHA 2X5IA 5HXVA 1QMJA 2BW8A 3N3HA 3U75A 3ZYGA 2D5FA 2QUOA 4QXHA 4OMCA 1F15A 4E9KA 1WCDJ 1RUJ2 4KGQA 4CPBA 2VMIA 1Z78A 2A3WA 3POYA 3WCSA 3RI9A 1QJU2 3WNMA 3MV11 4ZZ5A 3KQRA 4HSJA 1FT9A 3N7LA 1W6NB 1BVVA 1YRZA 5FUNA 2FQPA 2VZPA 5CFCA 1QOTA
chains in the Genus database with same CATH topology
3AJYA 1J1TA 2FZ2A 3J8F2 1DZTA 4G4FA 5A33A 1LOFC 2Q8OA 2IXLA 4YVSB 1PGW2 3PJQA 4R9AA 4L97A 1AR62 3VBUC 2ZCWA 1KRIA 5JLVA 4HN1A 3M2MA 1OD5A 1SCRA 4I02A 4CEYA 3NSTA 3M4FA 3WP3A 1MQTB 1UIKA 1NE4A 1X8MA 4LBOA 4AHWA 2WNVA 5CG9A 3WHUA 1OKQA 1WUVA 3RMXA 3VBFA 1VB4A 4PQ9A 4RSUA 4DQAA 2GN7A 4YG0A 5J48A 1LHVA 1LOGA 4HKLA 1RUG1 1VBD3 2RR12 2OYZA 4S2DA 1UIJA 1TMF3 1WW4A 1QKQA 2KA3A 4WZCA 4QPYA 4XXAA 4U2AA 4GALA 4CDUA 4ZU5A 2QNKA 2WT2A 4OUMA 1QNWA 2WS92 5FMOL 1BBT3 1HQNA 3ZXFA 1AYM2 4JV4A 4CDUB 3M3CA 2ZOEB 1HXS1 3OYWB 4FOVA 3NL1A 4Y1XA 4A7ZA 5AFEA 1QJX1 2O8QA 3ZXEA 1Q8PA 4XJWA 1QJY2 1RHI1 2PQQA 4LE4A 5FAXA 4GB32 4M01A 3KT7A 4BYYA 3JD73 2NMOA 4FCAA 1RC6A 1H1AA 2ZZQA 4LLOA 4URTA 5E1RA 4IQPA 4META 4OZXA 3GZTB 4C91A 1UX6A 3WDXA 2WT1A 2XG3A 3H1MA 2D3SA 2QJVA 1MZ6A 4Q4Y3 3ZFEA 1QQP2 3VBHC 3O0VA 3W58A 2MPFA 3RQ0A 5CFDB 1VR3A 3VBHB 1W6QB 1D2SA 3PTYA 4BA6A 4QMAA 4RHV3 1MVEA 4CDXA 5BNOA 1PVC3 2OUJA 2WLPA 1Z7S3 2OVUA 1H8TB 4XILA 5GJ6A 2RM21 4AVTA 1LR5A 5CB7A 1ND2B 2DVAA 2QDRA 1RUG3 1VBE3 2BPA2 5FO8B 2GNDA 1A78A 3IPVB 4JCKA 3GYDA 1BKZA 2PHFA 1I1EA 4YM2A 2OIIA 4HPKB 2DUQA 2FBEA 5FLHA 2DTYA 3LA7A 4AG4A 4N9IA 2ZPXA 2VQ0A 5I93A 4Z07A 4D7TA 2ZHKA 1FI2A 4YSFA 1YIPA 3D0SA 4DRRA 1SBFA 2PAKA 1Q56A 1IPJA 1W0PA 5JOWA 2GC3A 1S0FA 5I91A 5FLJA 4BWOA 2Q30A 2CTVA 2XWBB 1G9CA 5LRRA 1BQPA 1T6GC 3LA3A 1R081 3HWJA 4H55A 4ZKTB 1DIWA 2Y0OA 5KC6A 2AENA 1G86A 3MIFA 5ACA1 1LRHA 3MEPA 4I01A 2IC1A 4HL0A 1AXKA 1QY4A 2A6XA 2ZHLA 1AR61 1QQP3 5IK4A 4FPKA 1KS4A 4NHMA 2VMGA 2ZGLA 4GIQA 3USUB 2HWD1 3OPZA 4P9GA 5FREA 1PO12 4IERA 4FQ4A 3FLPA 1M06G 2YV8A 4Q4X2 3PMSA 2R072 2YXSA 5JMCA 1JUIA 2PHXA 3NJZA 4WM7C 1YFUA 4LUKA 2P3KA 1KJLA 1HRI2 5T52A 2TEPA 4E2SA 2HWB2 2WWSA 3G7DA 1VBB1 3H3UA 1O91A 1POV0 1GLHA 4KG0A 3SH3A 3AYAA 2EXKA 2NQYA 1YXWA 2Y0IA 1XQNA 4RS5B 1LTEA 3ASIA 2JG9B 2WNVC 1RUH1 1FMD1 1HKDA 4K1ZA 4COVA 3VZMA 4JQRA 1ONAA 5KXCA 1R093 1XNBA 2H6BA 5K9YA 1RUC1 3B9IA 4P14A 1HRI3 3JBG1 1ZZ8A 2A71A 4CDQC 4XF9A 5I8SA 1PM7A 3VBOC 4DMIA 5BYNA 1WBFA 1GFF2 1LOFA 1NCRC 5H9RA 1S1AA 1ZZBA 4XZPA 4CP2A 1H8VA 2XGXA 1ZM1A 1Y7BA 4FXKB 4GA9A 5A3LA 2PHUA 2EXHA 2WC2A 3EJKA 2A6VA 3OJBA 1NCRA 4OUSA 1HV1A 1IGOA 1NXD1 1OMIA 1S0EA 5FOJB 1IHMA 2UYAA 2AREA 1EP0A 2HEVF 3M3OA 5BY5A 2K2SA 4JDOA 2XLFA 4GMP0 1DFQA 1SLIA 4GWMA 2DU1A 1X36A 3VN4A 3DV8A 3AMHA 1KFUL 5GALA 4C1WA 1S0JA 4S2HA 3JQWA 1OPOA 1ZBE2 1W6OB 2RS32 4I09A 2XJSA 3DPRB 2RJKA 1C3HA 3IDEA 4Q4V1 4TLFA 2WFPA 1PGL2 3EHKA 2PLV3 1TE1B 1F31A 4GH4C 2DWRA 5HCAA 2WA3A 4GMP3 2OW4A 4YGEA 4HVQA 1LHNA 4Q4W3 4KWLA 3ES1A 3AX4A 1QJX2 1C28A 3QH6A 2V09A 1D4VB 1WGPA 1ZX5A 5T5OA 2UWBA 1FV3A 1O4ZA 1TME3 1GSLA 1FX5A 3AP7A 5BNPA 4HVOA 4P9XA 1Z7S2 4AEKA 1IKPA 4AEJA 1VAKA 4RD7A 4JGYA 4IXLA 1ZVFA 5ABJB 5HBAA 4UXAA 5BXXA 4AQ6A 1RUC2 2YC0A 4RS5A 3S6PA 4JGZA 4COUA 1H8TA 3LCPA 4LHNA 3AYDA 3VZOA 3ECQA 3VL8A 4JGZB 3OBRA 2OZJA 4XBLA 4HK9A 2WNVB 4XFIA 5LK7B 1XRUA 4K1YA 4YRDA 4NVPA 2R32A 1R091 4Q0SA 3AZVA 3KM5A 1G7YA 2YROA 3LAGA 3UL2A 1OSGA 1H2KA 4O9GA 3IDCB 3NV3A 3AKSA 4AFBA 1VBA2 2ZAHA 5HCFA 4IV3B 1NZCA 4G3YC 3RNSA 4AVAA 4GXLA 2HEYF 2GNMA 1AR82 5FMOS 1RTVA 1VBB3 1RHI3 2A6WA 3B3QE 4HMZA 1FOD2 2W08A 1NCQB 2Z2SB 4AF9A 4ASMB 2VVFA 5KXBA 4XIKA 3BALA 2Z69A 5JSOA 2O0OA 4UW5A 2DCJA 4W6XA 1X50A 1VB2A 3WUDA 1RUF2 3ZIXA 3ZN5A 3M3IA 1OI6A 1JYCA 2BNMA 3GALA 1J1LA 5C9AA 5FO7B 4AEDA 1BYHA 4EWAA 3VGIA 4YYOA 2XHKA 2GC2A 4QM8A 5BNNC 4NO4A 4N43A 2B8MA 1VP6A 2E7QA 4Y24A 3R05A 3HR9A 1ULGA 3SH4A 3VV1A 4ZU7A 5JOXA 3BODA 3PLQA 3M1HA 4HVRA 3E6CC 2I2SA 1O3QA 1V6KA 4FPLA 4P9JA 2DCZA 5D1IA 3J4UH 4XF0A 2VOKA 3GBFA 1RHI2 3PHMA 1LULA 1GZWA 1NE6A 1ALYA 4QQHA 1S0CA 4CDUC 2CWSA 1HLCA 3MIDA 1LKNA 1MEC3 3GBWA 4Q8KA 4YZ2A 1AXZA 3ZFFC 2QE3A 5IK8A 3ZMNA 1AR72 3DL3A 2SLIA 3VHRA 5C4WC 4Q2FA 3AMPA 2DVGA 1YWKA 1LOEA 4OHYA 3V0AA 1V9U1 2EIGA 2JX9A 4OHWA 1OA2A 4PBPA 2VPVA 5CVRA 2A70A 4XJUA 1W6PA 2MEV3 1WW6A 3NAPC 2X5IB 2WZR2 3LSDA 3KMHA 2G9FA 4WVVA 4MXWA 4FT8A 1DYKA 5KXEA 3MIEA 3SCFA 4AHYA 2BYVE 2AH2A 3WNXA 4AFCA 1WLWA 1AL22 3LSEA 3MW2A 1C4RA 2CYFA 5ACA2 4RHV1 4WM8C 5H9QA 1UKRA 1SFNA 3ILRA 2D97A 4RGAA 1N3PA 5IK7A 1O3TA 3ME2A 1UAIA 2WT0A 3KCXA 5H9PA 5CADA 1F2NA 1RMU3 4MGZE 1MS3A 5GKAC 1EV11 4PDWC 3ZXDA 4LLFA 1LB2A 4QPGB 1TNFA 1DLLA 3CU7A 4XQ4A 3RJ2X 2OUHA 3WG4A 3RSJA 4JAAA 3VUOA 4IEPA 3GF6A 3P3NA 1G8WA 1DQ1A 1NQJA 2B7YA 3B5LB 3EQEA 4H14A 3IN9A 4R4ZA 4YG6A 4ZXKA 4EN9B 5DUVA 3S7IA 1C1FA 2YYOA 3BPZA 1XU2A 4LE3A 2V73A 5GZEA 1MZFA 4M3CE 1PK6A 3I54A 2PAEA 3VBRC 3IT8A 2DCYA 3D4KA 2ZGNA 2ZGPA 2FZ1A 2R071 1AR93 4BLIA 1ZBE3 4YZ5A 3JZVA 4FXGB 3JB8A 1D2QA 3H3ZA 4R8HA 1WMEA 3JBG2 4RQPC 1EV12 4YVSC 1LODA 4D69A 4F83A 1O3RA 3ZX7A 1GANA 2Q1MA 1B35C 1DZRA 2CY6A 2QZ2A 2WSVA 2YHJA 3AYCA 3QACA 4SBVA 1PO22 1V6IA 2D93A 5CA6A 5FTTC 3GBGA 4XBNA 2ET1A 3JUUA 3WG3A 1VBB2 3HN1A 2R6QA 5I8TA 2HWC3 4E4ZA 3BCWA 2OZ6A 1GYKA 3VKMA 3TNQA 1CN1A 4GKYA 4FAGA 4U36A 1EV13 3AJZA 3JBG3 1DBNA 4WBBA 3ST7A 1Y43B 4FSJA 1ZRFA 2XLGA 3C2UA 3MDPA 1LCLA 2D6PA 3IMNA 3WDTA 5IUQA 3LGRA 4QT6A 1W2UA 2PHRA 5BNPB 5K7PA 1N47A 3CLPA 3HD8B 4C0HA 4XFHA 2ATFA 4XFFA 4C90A 4XQDA 4CEYB 1UCXA 4WZFA 3ZFFB 2HWC2 5SV8A 2VUJA 4K6BA 3RZZA 4K9SA 1MS5A 1TME1 5FLIA 1O3SA 3MF9A 3T1LA 1VBC3 2RJLA 1AL23 3GZUC 1CAVA 2C5DA 3AP5A 2ARXA 2WL1A 3AZZA 3O0WA 1RITA 4CEWC 1OA4A 1U0AA 5DDJ1 1TQ5A 1ND2A 4GQ7A 2XL9A 4XETA 2A5ZA 4IV1C 1OQEA 2HWC1 4L2NA 2QKDA 4K40A 1O5UA 1PGW1 2JG9C 2VW2A 1Q8VA 3B7MA 1ZBA3 3CL1A 3FX3A 2YUEA 3B9CA 5IK5A 3NO8A 3QCWA 5GZCA 3ACLA 2R0HA 5FO9B 3A4UA 1QJZA 4NWVA 2H0VA 1U5YA 2XWJB 2GNTA 2NP0A 4YW1A 3TNPB 1QXPA 3VDDA 2JICA 1EPWA 3C3VA 2D98A 3O7OA 1PNGA 1RUI1 1HW5A 2XBO3 3GHMA 4HN0A 4DS0A 3IKWA 4KH9A 1ASJ2 1A8MA 1ZYBA 1IPKA 1RVF3 1XE7A 5A32A 4P5HA 4LR4A 2WZR3 1KS5A 1XYOA 4TZDA 1V70A 4Q4W2 5EXOA 1QQP1 5F6LB 2X29A 1V00A 4AVVA 1OOPB 3B94A 1AR81 3B69A 3QBQA 1R083 1OOPA 2P17A 3VBSB 3CJIC 3UKNA 1QWRA 2TNFA 3V56A 3VHNA 1EY2A 3WOGA 4LBLA 4XYXA 1GNHA 3VL9A 3WXPA 2R30A 4AI2A 1FPN3 3UKVA 4EN8B 4I30A 1ND3C 3JQXA 3V0BA 1AHSA 2JG9A 1W6NA 1PO23 2PHWA 5CU1A 4BCUA 2WZPP 3DKWA 2JG8A 2ZX1A 3SCGA 1CD3G 2VH9A 1W6QA 1A6CA 2V5YA 5KWRA 5EFUA 4QPIB 4XJAA 3RYKA 1BEV1 4ISRA 4XDQA 1FYUA 3RWNA 3KZ4C 5KHHA 4OHZA 1DHKB 4Q1PA 1J3PA 1QH7A 1TNRA 1EYBA 1F5FA 5D8AA 4HBNA 4UBGA 2Z79A 4YVWB 2PTMA 2WFF2 2DTWA 4FTEA 2HWD2 3IM0A 3TB0A 4E27A 1AR83 4RA0A 4Z82A 1MVQA 3N36A 3DPRC 1UPIA 4IEOA 4MXWB 2F4PA 4FPHA 4AQSA 3AKRA 2ZAAA 2E7TA 3DF0A 4L11A 2RS11 1H2LA 1MS1A 2IZWA 3TBDA 1SFYA 5CNAA 4YGBA 5J96B 2HWF3 4P9YA 4P9WA 5CFDC 2E63A 2XJTA 2RS53 3GNEA 1IZ3A 2UWCA 1PIV2 2RHPA 4OLLA 5KHKA 4YGCA 3E5UA 4XFCA 5J36A 4AEDB 1N3QA 1QHDA 4L92A 2PN5A 3VBOB 2E6VA 4E4SA 1VAVA 5J7MA 4Z2WA 2X53S 3Q9OA 2GH8A 2GU9A 5E16A 4HT1T 2BGCA 1HXS3 3ELNA 4N90A 2IXIA 2WNEA 4ES9A 5FPZA 1Q8QA 1E57A 5EWSA 2BWAA 2B42B 1CJDA 1DZQA 5J09A 4JC1A 3BIWE 4LA2A 5BNQA 5CFDA 5DXDA 2GMPA 2CGPA 1LESA 1VRH2 1DYPA 3N35A 2UY9A 1I5ZA 4QGNA 4QPGA 1NLSA 4HANA 2D7FA 1AZDA 1QOSA 5DG1A 2G4IA 1DGRN 1LGNA 5GZGA 2D6NA 1AX2A 3ZDSA 2VOVA 2PA7A 2A7AA 1V6LA 2ZACA 1SBEA 5CIRA 1VLNA 2EALA 2HYKA 3NWKA 1ZBA2 2I45A 3I7DA 3LA2A 2JE9A 4FPCA 1QJX3 4LO8A 4AXOA 1PMIA 3H50A 4OI2A 2C0ZA 3MW4A 1GKBA 4LA3A 5L7OA 3ZPYA 4MXVA 4DNYA 4EJRA 1MQTC 4O9EA 4WM8A 2WQ4A 5K8SA 4MX3A 2GNBA 4CDWC 2HWF1 1G9DA 2C9AA 4AVCA 3KLSA 3CF6E 1UD1A 2JG8C 3JCIA 1XYNA 4XHBA 3ZYPA 2SBAA 1CR7A 1JUHA 1AYN2 4XOGA 3VZLA 2CAUA 4QQPA 3O5SA 2RMU2 4KL1A 1CESA 3KSCA 2JENA 3VKLA 3K48A 1CONA 4FP2A 4M0HA 2ZBJA 3RI8A 5I0RA 1OOPC 3I8TA 2DVBA 3RYRA 4AQ2A 3ES4A 5C9AB 5T5JA 3FLRA 1PZ7A 2ZTNA 2EAKA 1XXNA 2ZGUA 3H1YA 4Q4V2 3M70A 4MYEA 4Q8LA 2R073 1ZZCA 4HFSA 5HCBA 1VBA3 3J8F1 2DYCA 3ZN4A 3WG2A 3RPQA 3ZIWA 5HI0A 2B9UA 3SH5A 4EN7B 4WV8A 2QZ3A 4JTNA 3H8UA 3R4UA 3WV6A 1NLRA 1Z0HA 4QQLA 3ZFGB 2O8OA 4MLOA 5EZWA 1RUJ1 5ABJA 5T5PA 4AEMA 1DQ0A 2VW1A 3OGJA 2DUOA 4KGGA