1LEZA

Crystal structure of map kinase p38 complexed to the docking site on its activator mkk3b
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
350
structure length
343
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of MAP kinase p38 complexed to the docking sites on its nuclear substrate MEF2A and activator MKK3b.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
total genus 110
structure length 343
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1lezA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1lezA01
2PK9A 1ZOHA 5HCZA 1CDKA 3VUTA 1H8FA 3WZJA 2Z60A 1ERKA 3SG9A 4BVUA 2PVRA 3TZ7A 3FL4A 2JDOA 3GU5A 2UZUE 3QLFA 5AUWA 4BCKA 4QP4A 2XYUA 5T6KA 3N4UA 2WELA 3OY3A 3VS1A 4G31A 3O71A 3DAEA 4BC6A 2J0LA 2R5TA 4WRSA 1REKA 1ZYJA 5GZ9A 3ERKA 2I6LA 2UUEA 5B2LA 1U5RA 3GT8A 5EW8A 2W9ZB 4LUEA 4FIJA 3QRUA 4OTGA 4EOSA 4OTPA 2YWPA 2J6MA 4MXYA 2QD9A 3EN5A 3HX4A 4DGGA 3NWWA 4MX9A 4W8EA 2GS7A 2OIDA 3G0FA 4JQ7A 4YJQA 4R3RA 4NKAA 3SAYA 3T9IA 4TWOA 1R78A 2GNLA 3D4QA 1YHVA 3MA3A 4IVAA 4PDSA 5DG5A 5HD7A 4L68A 5M57A 1IA9A 5B7VA 2I7QA 2WMAA 1RJBA 2FSMX 2CPKE 1YWNA 2X1NA 4FF8A 4NSTA 2GSFA 3DY7A 1W82A 5IZFA 2FSLX 3FC1X 2XK4A 5JKGA 3NUNA 3UQFA 5HNBA 3FQHA 1CSNA 3WYYA 1J1BA 2ITXA 4RIYB 5HORA 4FEQA 4BKYA 4KIPA 5KMOA 3DLSA 4O7NA 4WG4A 3EZRA 3FY2A 3NVKI 4FKRA 4RVMA 4DFYA 5HBHA 5AA9A 1E1XA 1OIQA 4I41A 1WBPA 2BROA 3UNZA 3OW3A 4BCFA 5LJJA 5FXQA 4PMPA 3KREA 2ONLC 4I3ZA 4FZ7A 4FV4A 5AP3A 3VUDA 3PPKA 4EUTA 1CMKE 2BZHB 1P4FA 3QTZA 5KKRB 3ZUVA 1S9IA 2CKOA 4IWQA 4BTFA 4AT3A 4B7TA 5IA2A 3KRRA 5EG3A 3S2PA 3VC4A 3QD4A 5H8GA 3QRTA 1R0PA 3NUUA 3PPJA 3BYVA 5M08A 2WFYA 1PF8A 3OBJA 1H0VA 4MWHA 4O0TA 3EIDA 3RPRA 3U51A 3NX8A 1WFCA 3MGYA 4FKVA 2WD1A 4CLIA 3G15A 3NUYA 2W5AA 5HGIA 4PQNA 5HLNA 3FAAA 3HRBA 1Q97A 2WMBA 4ZLZA 5AR5A 3C4XA 3ORTA 2JKOA 2VWIA 3CY2A 4HZSA 3HECA 3DBQA 2JLDA 5CTPA 3C5IA 2RFEA 1IG1A 2O5KA 5CAPA 2WMTA 4OBPA 4YSMA 4EBWA 1P5EA 2HK5A 3HRFA 3I5NA 4IB1A 4YHTA 1KOAA 3C1XA 3R1QA 5TO8A 5JRSA 1H01A 3Q6WA 4QTBA 1PKGA 4FV9A 4EH7A 4G2FA 2O63A 3R8PA 3WF9A 4BCQA 4F7LA 3FE3A 2W9FB 2X4ZA 2P4IA 5M53A 4RLLA 3T3UA 4EOPA 2OIQA 3A7GA 3R1NA 4FX3A 4O7TA 3UG1A 5LMAA 5LARA 3EQBA 3PIYA 2VWXA 3A4PA 1OPLA 1ZZLA 4DYMA 4MNEB 1ZWSA 2QU6A 3GC7A 3PA3A 5E8ZA 4QMMA 3SDJA 3TT0A 4BL1A 4Z7GA 4CVAA 4HGSA 1KE5A 5L3AA 2XKCA 4J71A 3DB8A 2W7XA 3KA0A 4V04A 5C27A 5HCXA 1BKXA 3D15A 1VR2A 4JIKA 3F6XA 2P2HA 1QMZA 2SRCA 2XIXA 3R01A 4Z9LA 4I6HA 4AAAA 4D4VA 3MVMA 4ZY5A 3E3PA 5AR8A 5AX9A 4X2KA 5J1WA 5HO6A 3UJGA 3MJ1A 2WQMA 1QPCA 5EQPA 4CQGA 3C4CA 1ZZ2A 2ESMA 4XHKB 5EM6A 2UW3A 5EDPA 5EQYA 5CT7A 1XBCA 4YJPA 4I0TA 4JG7A 2GNGA 4GK3A 3L8VA 4YJTA 3EKKA 4I5MA 3RJCA 4EQUA 3P1AA 5HE3A 5HO7A 1HOWA 2A19B 4QP1A 3TUBA 4GCJA 2NRYA 3R7EA 3TKIA 3WIKA 1SZMA 4QYHA 5IISA 4NEUA 2E9NA 2W0JA 3UVQA 3MH2A 4E93A 3D0EA 3NNWA 3HMMA 5LXMA 5JFSA 1SVEA 1TKIA 2OBJA 3A61A 2XKFA 4BTKA 2YCSA 4O7ZA 3F3UA 4D5KA 4YJRA 3QCQA 4JVGA 3S00A 5AA8A 1HCLA 3QC9A 5AEPA 3F7ZA 3AT3A 2HWPA 4E5AX 4TNBA 1YOMA 3A8WA 3DJ5A 3DKFA 2F4JA 1U54A 3EQHA 4QMPA 4RJ5A 2W1FA 5JH6A 4E8AA 2WU6A 3BLRA 4K8AA 2ZJWA 4NT4A 4KIKB 4AZWA 5KX8A 2GNIA 5EW3A 2W06A 4A4XA 4BZDA 2RFSA 3U6JA 5AR2A 4O1OA 2BDFA 2VN9A 2CHLA 4A9YA 4D2TA 3VIDA 3KXZA 3OC1A 4C8BA 4DEGA 5H8BA 4FL1A 4KNBA 4JBQA 3D83A 3OTUA 3FXXA 3EQDA 3POZA 4ZJJA 3W10A 2IG7A 2AC3A 4L3JA 3NGAA 5FUTA 2PMNX 3V5LA 1PHKA 2XK3A 2ETRA 5IQIA 4QTAA 2PVMA 2QKWB 2Z2WA 3TN8A 3EQPA 4YZMA 4GVAA 2BHEA 4GYIA 5EI2A 2R3KA 3NW6A 4B4LA 2OFUA 4FZDB 4D2PA 3NLBA 3PSDA 1WVYA 3ZLXA 4C33A 5IF1A 3ORZA 1Q24A 2ZDUA 1WBWA 4BCOA 4M13A 2YIWA 4J8NA 3AC5A 3PG3A 5HLWA 5CX9A 3ENMA 4XH6A 5M4UA 2VU3A 4BTMA 3GP0A 1BYGA 3LXNA 3R22A 3UIUA 2QKRA 3B8RA 3ZBXA 5AIKA 3K2LA 5L8LA 2X2MA 4FGBA 4HVHA 2BILB 4M3QA 4I92A 3VW8A 4AW5A 5IQAA 2GQSA 4F9WA 3CJFA 1YW2A 3F5PA 4YBKA 3DB6A 4G5PA 3V51A 3V6SA 3EQFA 4EL9A 2OG8A 3R8MA 5K4IA 4L46A 4OTRA 4AW0A 3DKCA 4ONAA 2C68A 3BLHA 4CG8A 2H6DA 2B52A 4LOQA 4IJ9A 3RNIA 3S95A 1U46A 4BWXA 2PVFA 4HCVA 5IH5A 4FT0A 4QQCA 5J9ZA 3D5UA 5A4TA 3CD3A 4FYOA 3CE3A 4HGTA 1J7LA 4BICA 2XCKA 4RWKA 3QTUA 3AMAA 5I9VA 3CD8A 3DGKA 4UWBA 4V01A 4JT3A 3NSZA 3LJ0A 5LQFA 2W05A 1DAWA 3BEGA 2ITVA 5FLFA 5HEZA 4IC7A 2WQBA 4XLVA 3GFEA 3ZO4A 3HV6A 4D5HA 3RGFA 5AUUA 2JDRA 2B53A 3DU8A 4FZAB 2FUMA 3NS9A 5D7AA 2W1IA 4TY1A 3RPYA 2PE2A 4KS7A 2HIWA 2QOHA 4EJ7A 4RZVA 5AMNA 5FTOA 1QPEA 3ZUUA 3Q4UA 2PVLA 5FDPA 2CCIA 4C4HA 2GMXA 4GT5A 5KMNA 2WOUA 2ITYA 2XJ1A 4FTMA 2EXEA 1JSTA 4CMTA 1KOBA 3ID6C 5AFVA 4UMTA 4CYJA 4Y5HA 1WAKA 3FLZA 2J0JA 4FSRA 1UA2A 3ZRKA 3WARA 1OUKA 4PPCA 2R64A 2G2HA 4KKHA 3GQLA 4DH7A 3HRCA 5LVLA 5JQ8A 4O86A 4EC9A 4I22A 2PWLA 5CAOA 4FL2A 3LE6A 5FTQA 3LMIA 1OKZA 3PJ8A 3TNQB 1H1PA 2C4GA 2R3MA 3HKOA 3DNEA 4QT1A 3NPCA 3RK7A 4DITA 4BBFA 5LWNA 3VJOA 3U4WA 2F7XE 4FVRA 4FV8A 5K5NA 1V0OA 3R83A 4CLJA 4RMZA 4OAUC 5K0KA 4HZRA 3EZVA 4QYFA 4NM5A 2FSTX 4XOYA 4YNOA 4HJOA 4MBIA 3TZ8A 4FE2A 2WIHA 4BDCA 4RIYA 5A6OA 3QUPA 3QD0A 5C1QB 4FV7A 4PPBA 1LUFA 4ANSA 5JFWA 5CF8A 4NCTC 4FSTA 4RC3A 1W7HA 4GUBA 4RVKA 4CTBA 3SXSA 2GFCA 4I20A 4MK0A 2XNPA 3FJQE 3HAVA 4BY9E 3PLSA 3QD3A 2JKMA 3VHEA 4NTSA 3QQLA 2GPHA 3MI9A 4C2WA 4GU9A 4D1XA 1H27A 4DEEA 2B9FA 4JG8A 3VS4A 3UVPA 3JUHA 4XG2A 4EJNA 3QAME 1L8TA 2RL5A 3TZ9A 3VS2A 2C69A 2XYNA 4ACCA 4P7EA 4RJ8A 3FMMA 3F66A 2VAGA 3MJ2A 3ZU7A 2X8DA 4DFXE 2YAAA 4NW5A 3QGYA 4WKQA 5DT4A 2FYSA 3F2AA 4R7BA 4RFYA 4M97A 4S31A 3LW0A 5D10A 3ZDUA 1PW2A 3HMIA 4LG4A 4RVTA 5CEPA 3D14A 3BBTB 4LGGA 3TEIA 5CNNA 5HOAA 2OJ9A 3QQHA 4X21A 2FO0A 2B54A 4TKSA 4HYUA 4DG3E 4YHJA 2X9EA 3TDVA 4GW8A 3DKGA 3VF8A 4YZCA 3I60A 5M44A 4GG5A 1Z9XA 4J96A 3MIAA 3KVXA 3I4BA 4RBLA 2JDSA 3R02A 4R1YA 5KUPA 2OFVA 4K1BA 4QYYA 3KVWA 1G8AA 4LUDA 1OECA 5FM2A 4IAFA 4IM2A 3GI3A 3UC4A 4C34A 3AC3A 5EYCA 5JSMA 3U6IA 3BQRA 1VEBA 3UC3A 2OI4X 5J79A 3ZM9A 3DPKA 2HW6A 4JQEA 1PMEA 3KF7A 2EUFB 4IADA 4LYNA 3E7OA 4BWKA 5DEYA 4EEVA 3FHRA 2JGZA 3C51A 3KQ7A 3AG9A 4C36A 3LXPA 5AJQA 4H1JA 4KKEA 3AQVA 2WIPA 5IH6A 2C6IA 4BGQA 5TKDA 3CGOA 5E8WA 4TPTA 4IQ6A 4X6QC 4I93A 5IQFA 2HENA 1OITA 4RC2A 2W4KA 1JSVA 3UODA 3LM5A 4EKKA 4EOOA 3BHTA 4U40A 4ZLOA 3SV0A 4QMZA 3PFQA 4DCAA 1H28A 2XF0A 3R8LA 3FMLA 4CNHA 4S34A 2OF4A 4XYFA 1Q41A 3VUGA 2PZIA 4A4OA 4D0XA 5DH3A 4EUUA 4I6QA 4N0SA 5HG7A 5CEQA 3R6XA 3A7FA 2BDWA 2HWOA 4KIKA 5DNRA 1XHAA 5IH4A 5E8XA 1NT2A 1ZMWA 2PL0A 2PVJA 2VWUA 1OM1A 1APME 2XIYA 2OXXA 1O9UA 2C6EA 2EXMA 4OTQA 3P4KA 3WBLA 2VTMA 4C37A 4RX5A 4TYEA 2IJMA 4PP7A 4A06A 1DAYA 2GNFA 5EOLA 1Y57A 2C47A 5K9IA 3D7TB 5JZJA 2ZYBA 3F7WA 2XA4A 4MCVA 4F0IA 2B9HA 3D2IA 1M7NA 2GU8A 3BHHA 4G1WA 2W4OA 1I09A 2UZNA 4GG7A 4RJ6A 4ZP5A 5K3YA 4QTEA 2C1AA 4XG6A 5CZIA 4CMOA 4NKSA 2C3IB 4MD8E 5E4HA 2IVVA 5AP4A 4AOIA 3VS7A 4PPAA 1OKVA 3CEKA 3IDPA 4WNPA 1ND4A 2GCDA 4EK4A 2W1GA 3I1AA 4G16A 3BQCA 2YERA 2BAQA 5ANEA 4R6VA 3KGAA 5IU2A 1JKKA 5FXRA 2BFYA 1B38A 3U87A 4JS8A 5CEKA 4O0VA 3OOMA 1TQIA 1XQZA 1XH6A 1SMHA 4AW2A 3LFQA 2XNGA 2Y4IC 5GIPE 5I0BA 4IZ7A 3GCQA 3MY1A 2PHKA 3F82A 2H96A 2F57A 4KA3A 3JY9A 3QKLA 3UG2A 3VS0A 1PXLA 4CMUA 4ZSAA 5JT2A 3BGPA 4K18A 4RWLA 3UZTA 3AC2A 3NAXA 4FKGA 4AT4A 4EOJA 3C7QA 3OP5A 5CLPA 4ZEGA 3FZOA 3ZFYA 3WI6A 4IEBA 3MB6A 4EK8A 3AD4A 3Q3BA 1KUTA 3DXNA 3QXOA 4NH1A 4RFZA 2OLCA 1NY3A 1OBGA 4FKJA 3HV5A 3TKUA 2W1CA 1RW8A 3U8WA 4L7FA 1CM8A 2J50A 3PPZA 2C5NA 3VBXA 4U0IA 4FMQA 5AX3A 3WZDA 1H25A 3D5VA 2HY81 4FKWA 2C5OA 4FTIA 3LMHA 4FSUA 3N51A 3EN6A 4IM3A 1IEPA 1W0XC 2VZ6A 1YWVA 3ALNA 3BI6A 4QTCA 4G9RA 2P3GX 3FBVA 2R3LA 3IECA 2R3GA 2VWYA 3TNHA 2VWVA 1PXJA 5CU3A 5FBOA 1KE6A 2CGWA 4KD1A 4ZIMA 4X3FB 3K5UA 3ORXA 4AZEA 5M09A 3VRZA 4WUAA 2W17A 2OWBA 4ZZMA 1AGWA 2W1HA 2YAKA 4OLIA 4QMUA 5HIBA 3QFVA 5BYLA 4L00A 3P5KA 3U54A 3OCSA 3PJ1A 3OZ6A 3EN9A 2XNEA 4FUXA 4KAOA 4RZWA 1SVHA 2VTJA 3QCXA 3U9CA 2QONA 4QMYA 3PVGA 1M14A 3QYWA 4F9BA 2A4LA 4FL3A 4XP2A 3EN4A 4G6OA 3O2MA 5CQWA 2VWZA 3W33A 4CFWA 5ICPA 5J9YA 4FG9A 4XRJA 3KRLA 3ZMMA 3HDNA 3S4QA 3B2TA 5CAQA 1WBTA 2FGIA 4HYSA 3WF7A 4CYIA 4D9UA 3DBCA 4AE6A 5AUYA 1M17A 2ERZE 4EH6A 1GAGA 3TV4A 4MEDA 4ACGA 5HQ0A 3ZHPC 3UQGA 4UYNA 3R71A 1UU8A 3MFUA 4OTHA 4EORA 3GFWA 2W5HA 2GS6A 3HZTA 3TKHA 2J0IA 2ZV7A 2VTNA 3E64A 3LCDA 3KXNA 2Y8OA 4MXCA 3PXZA 5GJFA 3RM7A 4F1OA 4YTFA 2WOTA 2Y0AA 5AV0A 1CTPE 5HG5A 3QZGA 5HNGA 5CSPA 3UGCA 1YHWA 4FZ6A 4J99A 4LI5A 3HP5A 2H8HA 1FBNA 3NYVA 4RX8A 4USFA 4BI2A 3O17A 2BAKA 4EZ5A 1H1WA 5JK3A 3QQUA 2VV9A 2YACA 4IDTA 4IFCA 3PZHA 2JAVA 3NCGA 3KB7A 2F2CB 4RJ7A 2WTKB 4D28A 5GJGA 3CPBA 5IUIA 2XRWA 1JLUE 3FLNC 4C58A 4E5BA 4M0YA 3W2SA 3HMOA 4Q5EA 5KKRC 4FT7A 3OWJA 5A3XA 3AGLA 3H30A 4IVDA 2RFNA 4APCA 3Q2MA 3IQ7A 3SOCA 3LCOA 4KB8A 3GENA 2YIYA 3RZFA 3UOJA 4WA9A 3NYNA 4OGRA 5AUVA 2GHGA 4DGNA 4O7YA 3HMPA 4FTQA 4R5SA 3NUPA 5IDPA 5LCJA 4FSMA 4AE9A 4W4XA 4D58A 3KY2A 4FGRA 4ALVA 4QNAA 3UTOA 2JFLA 2UW8A 4YJUA 4BI1A 5C8KA 3UQCA 4OT6A 3LJ2A 4FSQA 3QTIA 1RDQE 4WOVA 4H39A 4ID7A 3V8WA 3OCGA 5LMKC 4UN0C 3DK6A 3VULA 3PY3A 3PY1A 4L8MA 4OTIA 1OVEA 3MIYA 2JBPA 4LM5A 2BRGA 4U81A 4YO4A 5E9EA 1JOWB 3UPZA 4QP8A 2BRBA 4Q9SA 3KF4A 2B7AA 2DWBA 3VNTA 5H8EA 2UZEA 3IO7A 2OJIA 5AP7A 3A7JA 4NU1A 3DQXA 5DHJA 3DA6A 4U45A 3UVRA 3MN3A 3PE1A 5F95A 3WE8A 3RK9A 3ZYAA 5IQDA 2YM6A 1OL7A 5EYMA 2XK6A 3LXKA 1SM2A 4IAIA 4GYGA 5AR7A 3BIZA 3VUIA 3OOGA 2Z8CA 1PXKA 5FEQA 5CXZA 3VUMA 4DEDA 2BZKB 3KK8A 3VO3A 5IPJA 5KMMA 3KMMA 4WUNA 2B55A 4LV5A 3TACA 1J7IA 4CZTA 3JR1A 4BB4A 3NCZA 2VO3A 2E2BA 4EYJA 4BTJA 1GOLA 2P2IA 1BLXA 5I3OA 2J9MA 3MDYA 4H36A 4QYEA 4WG5A 3RPOA 2NPQA 4AT5A 4F6UA 4Q5HA 4JBVA 3UP2A 2JKKA 3OEFX 4GFMA 4NM3A 1GZKA 5DIAA 3C4ZA 5CU6A 5DT0A 4U9AA 5AAEA 4O7RA 4I94A 1Z57A 4J52A 5HBJA 3Q4CA 4FNZA 4TWPA 3F2RA 4AWIA 1OL2A 4EK6A 5TR6A 2ZMCA 2UV2A 3PVWA 1FPUA 3NZ0A 2EXCX 3Q9XA 4G3CA 4TW9A 4A4LA 3QC4A 4IWPA 2V0DA 3VBVA 4AX8A 4HYHA 3UIMA 3HLLA 3PG1A 2O2UA 1WVXA 4WSQA 2Y6MA 3O23A 3V5WA 4ZTMA 3QUDA 3II5A 4K6ZA 2IZRA 1BI7A 3BRBA 4A7CA 3N4VA 4Z3VA 2W1DA 3MTLA 3ZC5A 5CSXA 4TTHB 3T9TA 4I21A 3UNJA 3AOXA 2J4ZA 4U97A 2R3PA 2P33A 3PXQA 3KKVA 2ITPA 3MFSA 4U42A 3FYKX 5LMBA 5CWZA 5BVWA 4GFOA 4ASXA 4ERKA 2PE1A 3VJNA 3Q9ZA 2BKZA 3C9WA 2V55A 2XNMA 2UZDA 4GT3A 2ZAZA 1LR4A 3ZONA 3QX2A 5F94A 4P5QA 3IG7A 2OJGA 2WB8A 1H00A 5TT7A 1MRVA 2XMYA 4EHZA 3OF0A 1OL6A 1SNXA 4G34A 4BCIA 1KE7A 2X81A 3AT2A 3NRMA 5DLSA 3RBWA 3HA8A 4KABA 1YXSA 1ZY5A 3ETAA 3SXRA 2R3JA 3ROYA 3ZM4A 5JGAA 4ANLA 4UB7A 4YZBA 4ANNA 3W2PA 3CCNA 4M84A 3I81A 3PWYA 1PMVA 2J2IB 3BBWA 3MH0A 3A8XA 4M7IA 4BCJA 4M12A 3WILA 3PXRA 4YO6A 5ANJA 4I5PA 5TE0A 3R9HA 3C4EA 4FSWA 5IQEA 2HZ4A 3VN9A 4F7SA 2WMQA 2C6LA 3BU3A 1ZY4A 4ZJVA 2FVDA 4WBOA 1PMUA 4TT7A 4BN1A 4NWMA 2QOCA 4A9TA 3LFBA 4BDHA 2PZPA 4A9SA 4C0TA 2VGPA 4GK2A 3QD2B 4F9CA 3FI2A 2WTDA 3AC4A 5EH0A 4HVGA 1FQ1B 1VZOA 3QZFA 3NUXA 4AA4A 4YLJA 3P78A 5HVYA 3IDBA 2C5XA 4ITJA 3D7ZA 3EH9A 4IM0A 4JG6A 5B2MA 3ZFXA 1U54B 4S30A 3ZSGA 1W83A 4L53A 3R7IA 4BDDA 2Z7LA 3OXZA 4PNIA 5D12A 2WO6A 4RX7A 3DXQA 3FLSA 1A9UA 1ZARA 4YJOA 3V5QA 2XNBA 1UNHA 3HDMA 2XM8A 2I0EA 3LFSA 4FNYA 4N6YA 4NFMA 3DBEA 4U80A 5CNOA 1PXMA 4AN9A 4PWNA 4FIHA 3LFNA 1GZOA 1VJYA 4NJDA 3F9NA 4LOPA 2IZTA 2YJSA 4TRLA 5J7BA 5K0XA 4CV8A 1DM2A 4MF0A 4FTRA 3SX9A 4IE9A 3WYXA 4DEBA 5AP2A 2J5EA 4NW6A 4YLLA 2ITNA 3CXWA 3A62A 1QL6A 4DF3A 1AQ1A 3DBDA 3QLGA 4HVSA 1ZLTA 1W84A 3A60A 2ITWA 2X0GA 4O2ZA 5IUHA 3VBQA 4D4RA 3KULB 4MHAA 5KBQA 4AGWA 3EFKA 2H34A 4Y83A 1YI3A 3NNVA 4JI9A 4DEHA 1REJA 3V8TA 2J90A 3WIGA 1B39A 4L7SA 4EH5A 4EZ3A 5IEYA 1PY5A 3COIA 5IQBA 2RSVA 1YDTE 4WBBB 3IPHA 4R77A 2J5FA 4FIGA 5HLPA 3W2CA 3DJ7A 4JRNA 4C62A 5HHWA 1M52A 4S32A 3VBYA 4F99A 1OKWA 1BX6A 3D2KA 3FI8A 2GS2A 2DUVA 2JIUA 3G51A 2BZJA 2PVYA 3RWPA 2J7TA 5CYIA 2YWVA 2CKQA 4O7VA 4JLCA 4YC6A 2VTAA 3E8DA 4MNEA 3FLYA 3AT4A 4E4NA 3LFAA 3LM0A 1H4LA 3Q53A 2Q0NA 1J7UA 2JFMA 4NJ3A 3BWFA 1MP8A 4JBPA 5CVFA 3MS9A 2R3IA 3ELJA 1T45A 4M15A 2BR1A 3WZUA 3R63A 4RG0A 2W5BA 4DH3A 4FVPA 3COMA 3TDWA 4ASDA 4F70A 5A4LA 5CU2A 3GCPA 3R00A 3ZFMA 2YITA 5AADA 5IUGA 4ANQA 3CQUA 3UE4A 2QHNA 2YM7A 2EB3A 4QPAA 3WF5A 2BCJA 2WMUA 4GJ2A 2BALA 3SRVB 2PY3A 3BEAA 2VO7A 3BU6A 3WOWA 3EYGA 2AYPA 1XJDA 4QOXA 5LCKA 4ANMA 2WHBA 2PVNA 2YZLA 2R7BA 4EH4A 4XX9A 5ANIA 2BUJA 5GZ8A 5L2WA 5AUXA 2R3OA 5KE0A 4LGHA 2XKDA 4P4CA 3L9LA 2HXQA 4W9WA 3FZRA 1FMOE 3QWJA 4RIOA 1G5SA 3FYJX 4IZ5A 4FNXA 3UOLA 4DCEA 3OCBA 3KXHA 3ZO3A 1UNGA 1XH9A 2QOQA 4G6LA 3AD6A 2IVSA 1K3AA 4IX4A 3A2CA 3NW7A 4BCMA 4I0RA 3ORNA 2XB7A 4IZYA 1H24A 1VYZA 3LKMA 3DJ6A 4EQMA 3MVLA 4JAJA 1NVSA 3ANQA 4APPA 3KK9A 3UO6A 3I79A 4F7JA 2CKPA 4QRCA 3ORKA 4ZOGA 4YP8A 4F64A 4RX9A 1OBDA 2VD5A 5BYZA 3SD0A 2QR7A 4DEIA 4QMNA 4YTIA 4CKRA 1IRKA 3R2YA 3WZKA 5I9YA 3LLAA 2WMWA 2R2PA 3L9NA 4O38A 3JY0A 5CU4A 4NIFB 5L6PA 3L9PA 4USEA 5L6OA 4XMOA 4F1TA 1TVOA 4HGEA 3Q4ZA 3QCSA 5C26A 3LFEA 5CENA 4W4VA 1H07A 3EFLA 4GIIA 1XH8A 3WZEA 1NA7A 1WZYA 3CS9A 4JIAA 2Z7SA 3TJCA 2YM8A 3F5GA 3FMNA 3QHRA 5EHYA 4IFGA 4KBCA 4EWHA 3LCTA 4F6SA 3EJ1A 3DDPA 5J1VA 1ZYSA 4FVQA 3R9NA 4LV8A 5ANOA 5L8JA 4DTKA 3RAKA 5BX0A 1XH5A 2HCKA 4X2NA 4CT2A 2IW6A 4UV0A 4YLKA 4ITIA 3E8NA 4M67A 4AN2A 3W32A 1CKIA 3GCSA 4GRBA 3RAHA 3E63A 3FLWA 4QP7A 4AN3A 4FR4A 2WZJA 3HVCA 3LZBA 4X2JA 3VUHA 5HTCA 4AXAA 3A7IA 4XRLA 4FTNA 2ZV9A 4WRGA 5E8SA 5C9CA 4E6DA 3M2WA 4K33A 4DHFA 1G8SA 3ZLWA 4M0ZA 4R5YA 3VVHA 4ZLYA 2BRMA 5BVFA 5IEVA 1NXKA 4RA4A 2BIKB 3ZZEA 4BDGA 5I3RA 4PRJA 2UVXA 4OR5A 3ACKA 1XO2B 1Y8YA 2XVDA 2C0TA 1LP4A 4BDIA 2I0YA 4DA5A 2FSOX 4EZ7A 2C5VA 4UALA 4USDA 4ENXA 1M2RA 3U9NA 4D55A 3V8SA 2BHHA 2XIZA 3FXZA 3CY3A 1BI8A 2NRUA 2WXVA 3P9JA 2XIRA 3FQEA 3KC3A 2QG7A 4ZS4A 4BCGA 3BKBA 3O7LB 3QXPA 3RAWA 5IG1A 2PE0A 5JFVA 3IGOA 1RE8A 3I7BA 4LRJA 3E8CA 1H0WA 3S1HA 4J1RA 2CMWA 4RSSA 3DBFA 3PP0A 3G2FA 4UXQA 5LVOA 2OU7A 2EB2A 4ZJIA 1OUYA 3P7BA 5M4IA 4QNYA 3AC1A 4PL4A 3SOAA 3OUNB 2WMSA 3E93A 3IW4A 4MXZA 5TF9A 5ANDA 2GTNA 3KRXA 2OF2A 4WD5A 3GU8A 2PYWA 5DEWA 4YNEA 4AA5A 2GNJA 4F63A 1H1RA 4I5CA 1PXOA 3G6GA 3DOGA 1R1WA 3FMHA 4GV1A 3GOKA 3QRIA 3QBNA 2PMLX 3F69A 3LQ5A 4YHFA 2YDKA 3ANRA 2HAKA 4S2ZA 3ZH8A 3ZOSA 3R1SA 4I4EA 4JDKA 4F1MA 3G9NA 3DQWA 1JBPE 2HZ0A 3OWKA 5DN3A 5BMSA 2OKRA 4I1ZA 5I5ZA 2PUNA 3LLTA 1U4DA 4AGCA 3R7YA 4OBQA 3RKBA 4M68A 1K2PA 4QMWA 4R7HA 2ITUA 5FRIA 3EL7A 2GQGA 5I9ZA 2V62A 2G01A 3BHUA 3RTPA 3V04A 4E73A 4DFLA 4D2SA 3TTJA 4GKHA 4FYNA 2C3KA 5CSWA 2B9IA 3BYMA 1PMNA 3H4JA 3R7OA 3FUPA 1FMKA 3D9VA 4P90A 5HI2A 3TIZA 4B8LA 2X7GA 1Q62A 3E92A 3MV5A 3TNWA 4X2FA 5BPYA 2EWAA 1YOLA 3E87A 3ODYX 3I6WA 3GC8A 3L1SA 4U79A 4AW1A 3FDNA 4C4IA 1O6LA 4BHZA 3EQIA 3S3IA 2QI8A 3R28A 5DRDA 4K0YA 4U7ZA 1W98A 3AMBA 4YJNA 2RF9A 2Z7RA 4PNKA 2GNHA 5CALA 4FTLA 3BX5A 4FNWA 5FEEA 1PXIA 1KE8A 1FVVA 3VWAA 2RIOA 3C0HA 3DXPA 1LEWA 3R9RA 1YI6A 4FZFB 3SLSA 3GU4A 3EB0A 1GIJA 5IA0A 4TWNA 3ZXZA 3BHYA 5C4LA 3DFAA 3MH3A 4CFMA 4D1SA 3UO5A 3ZTXA 5EHOA 1UKHA 4EH9A 5D41A 4YMJA 3C4FA 3TI1A 2OK1A 4FEWA 4FKPA 1BL6A 3ET7A 3QTQA 4EOKA 3Q96A 1XH7A 4JR7A 4MBJA 1K9AA 3C5UA 4RRVA 4U5JA 3SQQA 3N4TA 4I24A 1OGUA 3PIXA 4OTWA 4BDJA 4EOLA 3DT1A 2GQRA 2ERKA 3IKAA 3QZIA 5CEOA 2HELA 4PL5A 2ITQA 2ZOQA 1OZ1A 3UP7A 3QQGA 4QQJA 4TNDA 2HYYA 3HP2A 3RPVA 2B0QA 2ZV2A 3ULIA 4ORKA 1I44A 4FKLA 3MESA 3TM0A 2IZUA 2VX0A 4XV1A 4DBXA 4KBKA 3FI3A 3RVGA 3MPMA 4IX6A 4QTDA 3OEZA 3CR0A 1ATPE 2I0VA 4G3GA 3VS3A 3P08A 4QMVA 1Q8YA 4EOQA 4NM0A 2QNJA 3MA6A 4ZSEA 2LAVA 4J97A 2X7FA 4IWDA 5HG8A 3HV4A 4J98A 5B2KA 4C4JA 4CFVA 5E1EA 3IW6A 1R0EA 4FOBA 3O8PA 5IA5A 3ZSHA 5GNKA 2A27A 3DAKA 4RA5A 3HMNA 3BELA 5ANGA 3TV6A 4CSVA 3HUBA 4OTFA 4HW7A 3MH1A 5HKMA 4DFUA 4D4YA 4V0GA 4GIHA 4AA0A 5A9UA 5DT3A 1DS5A 2WTJA 3BV3A 2WMRA 2QOOA 2UZBA 2FB8A 3RHXA 4DN5A 3OFMA 2PUPA 4IC8A 2YIQA 2YM3A 3H9RA 4OW8A 5JN2A 3C0GA 3BCEA 4QP9A 3QCYA 4E7WA 4K9YA 2VNYA 4JDJA 4F7NA 4HYIA 4XG8A 3ZO1A 2BZIB 3TJDA 3P79A 5J87A 2WMVA 5BVNA 4G5JA 5BYYA 3FV8A 4FSNA 4XP3A 4V05A 4E26A 1GZNA 3MY5A 3R8UA 4H05A 4DTAA 4KS8A 5GINE 3AD5A 3FMEA 1A06A 5KO1A 3O0GA 4D1ZA 2R0IA 3EHAA 4I0SA 5I9WA 4TXCA 3SC1A 4EOMA 1WBSA 5JQ5A 2C6DA 4DGLC 4B6LA 3DZOA 4HNIA 4DGOA 1CKJA 1FGKA 1QCFA 2QHMA 4GJ3A 3W18A 1FINA 3NNXA 4G3DA 2YIRA 3Q9WA 3OVVA 3RK5A 4CXAA 5AP0A 4JAIA 5L2SA 3BYSA 5FDXA 5HZNA 3R30A 4I23A 3O8TA 3SKCA 3CSVA 3QQJA 4F09A 1P4OA 3LFDA 3NIEA 3G9LX 4IHPA 4O7SA 5ETAA 4BFMA 5CI6A 4FBXA 3GQIA 4BKZA 1Y6AA 2CDZA 3JYAA 5E92A 4BZNA 2IVTA 3TCPA 4JJRA 1FGIA 3H3CA 5KMKA 5CANA 2OJFE 4X0MA 4UYAA 2JAMA 5C8MA 4PUZA 2BTSA 1JKTA 2UW0A 4XG9A 5LVPA 5A46A 4QMOA 4XUFA 5EFQA 2YCRA 1YHSA 2VWWA 4IAAA 5HTBA 1ZYDA 4GFGA 4F6WA 2QLUA 3UIBA 2JDVA 2Y4IB 2RKUA 3LPBA 1W8CA 3EQGA 1HCKA 3QTRA 4JDHA 3R2BA 4FK6A 5CU0A 2E9PA 4BDBA 5I9XA 3H0YA 4ASEA 2BIYA 3G5DA 1NW1A 4IX3A 4FV2A 4K11A 2XBAA 2XK8A 2JBOA 4YGAA 2O0UA 3V5PA 4FKOA 2ZDTA 1STCE 2IVUA 3QTXA 3UIXA 3RWQA 5KCVA 4BIDA 3IOKA 4GUEA 2UW4A 4DFBA 5F4NA 5LWMA 4M8TA 1F5QA 2OSCA 4O0SA 4XEYA 3CKXA 2YA9A 3K3JA 4FIIA 2QOBA 4RIWB 3TXOA 5BVOA 3NVMB 5GIOE 3W8QA 2B4SB 2DYLA 4RJ3A 3UO4A 1Q3WA 1OPJA 2QOKA 1GIIA 4XBRA 3E3BX 4AQCA 4M66A 4R8QA 4TWCA 4WNKA 5D9HA 1BL7A 3R0TA 2EVAA 4QPMA 3TUDA 5AAFA 2VX1A 4IX5A 2C5YA 3NYOA 3PVUA 4MF1A 1L3RE 3KEXA 5J5TA 4N57A 5IQHA 1PYXA 2VTHA 5AP5A 4RIWA 5T3QA 3ZSIA 5IKWA 1Z5MA 3DK7A 5C8NA 4WIHA 1OB3A 5HESA 5K4JA 2XK9A 3F3VA 3B2WA 4WHZA 3ZDIA 4D2VA 2Y6OA 2A2AA 4L45A 4BCPA 3LVPA 4XLIA 4YTHA 4BDAA 3EL8A 2QOLA 3KXGA 4O27B 3O50A 4E6CA 2H9VA 4Y95A 3K3IA 1E9HA 1ZYCA 3DK3A 1XBBA 2ITTA 4EHGA 3LJ1A 1ZMUA 4FSYA 3OXTA 2OICA 4MWIA 3DV3A 4CGAA 4KRDA 1ZMVA 5C01A 2G9XA 3CGFA 1DI8A 3MFRA 4UWCA 2C0IA 1JKSA 4U44A 3RCJA 2G15A 4DLIA 3WF6A 2JIVA 1FVTA 4TZRA 4PDPA 3AXWA 3MFTA 5M55A 4CCUA 4DH1A 1EH4A 1GIHA 2CLXA 5JGDA 2Z7QA 2OIBA 5CS6A 4BBEA 4QMSA 5L6WL 1ZXEA 2HXLA 3FWQA 4PMTA 2IZSA 4CD0A 3MW1A 4OT5A 1YKRA 1ZOGA 3FY0A 3VF9A 4L01A 5CASA 1OKYA 4QQTA 2XEYA 4JOAA 4WNMA 5KZIA 5A14A 2XJ0A 3R21A 3I5ZA 3PLAE 4KSPA 4KUJA 4KIQA 4R3CA 4RT7A 3ATTA 2DS1A 3OROA 3D94A 4MNFA 4MXAA 4ZMFA 1WBVA 2HW7A 2BPMA 2HY0A 3FZPA 2C6MA 4XNEA 4G9CA 5DR9A 2ZVAA 3M1SA 3P0MA 4FT9A 4O0RA 1YDSE 3TNIA 5AAGA 4BHNA 2R9SA 4EONA 4O7LA 4FG7A 1Y8GA 3G0EA 2WEIA 4CT1A 1NVQA 3PJ2A 2PVHA 3IONA 3OT3A 3QHWA 2QODA 5EM5A 3BYOA 4JNWA 1E1VA 4Z55A 3R9OA 4JDIA 4IAKA 4BDKA 2XM9A 3PSBA 4LGDA 4IAYA 1V0PA 5J5SA 2EU9A 1Y91A 5M4CA 2X2LA 3TV7A 1URCA 4A9UA 5M51A 2VUWA 4Y46A 4L52A 4UX9A 3OXIA 4XG7A 3NUSA 4DINA 3A99A 5FWKK 5AV4A 3QTWA 4Q2AA 3TUCA 4WT6A 4K77A 2WAJA 3AGMA 3D5WA 4TYIA 2XBJA 3DNDA 5AP1A 5AUTA 3UNKA 2YLFA 4QYGA 5HU3A 2CN5A 1UVRA 4L43A 4FKTA 4YZNA 3FEGA 2AUHA 3OT8A 3DKOA 4ALWA 3R8ZA 4CFXA 3PA5A 5LVNA 1UV5A 2W4JA 3TG1A 1XR1A 4Y8DA 3L8SA 3GXLA 5E91A 5ETCA 3FMDA 2BTRA 4PTEA 4BF2A 1YDRE 4O1PA 4FEUA 4FEXA 4H3BA 1YXVA 2QO2A 2LGCA 3Q5IA 4RLKA 1MUOA 4L9IA 4D0WA 4DLJA 2NO3A 2ZV8A 5DOSA 5DYJA 4QP6A 2RG6A 4ARKA 2PZYA 4FV3A 4O96A 3NIZA 4W8DA 4Z16A 5IA4A 3FSKA 4ZXTA 3MY0A 4AP7A 2PPQA 1B6CB 3P7CA 3F3WA 4GT4A 4ACDA 1GY3A 5BVEA 4AGDA 3PE2A 4IH8A 1T46A 2ZMDA 3OWLA 1OIUA 3KN6A 3Q5ZA 5CVGA 4EHEA 2VRXA 2IW9A 3SGCA 2YJRA 3BGQA 2V5QA 3HV3A 2UVZA 3QU0A 3GOPA 5FP5A 4HCTA 1XBAA 4FKIA 4ZTLA 2R3FA 4DG2E 1GJOA 3HA6A 2QU5A 3EN7A 4UEUA 4E1ZA 1A48A 5I9UA 1OMWA 4IB0A 4MD7E 5BVKA 3ROCA 2REIA 5BUIA 2YDIA 5AR3A 4UMQA 2R3HA 3MPAA 4Y5QA 3OWPA 2R7IA 4BIEA 5DMZA 2OO8X 5D7VA 2X4FA 4FV6A 4E6AA 1XKKA 4CZYB 2VTSA 4G17A 4ENYA 5AV1A 1MQBA 4BDFA 3U6HA 2BFXA 3GCVA 3COKA 3KCFA 2WNTA 4PDOA 3O7LD 2Y9QA 4O91A 2QVSE 4Q9ZA 5JGBA 4X3FC 4CKJA 4NTTA 5A4CA 5KNJA 4UZHA 3ITZA 5G6VA 3RZBA 3SW7A 5J9LA 4FV1A 3UZPA 5M06A 1QPJA 2VTQA 4IAZA 3RCDA 4GH2A 4H1MA 3UMWA 3KULA 4JBOA 4KRCA 4MBLA 2QURA 3W16A 5DA3A 1MQ4A 4YC3A 3ZLYA 3A7HA 4OUCA 2J0MB 2YFXA 4OTDA 4LFIA 2R4BA 5DPVA 4C4GA 4C02A 3ULZA 4R7IA 2UW5A 5A4QA 5DWRA 4YPSA 4FIFA 2YN8A 3JVSA 4O22A 2CSNA 5E8YA 3NDMA 3QRKA 4D2RA 4I6FA 3ZEPA 3C50A 3QYZA 4R1VA 3DTWA 3R7VA 3O8UA 5L2IA 4B8MA 2WPAA 5K5XA 5DRBA 2PVKA 4GSBA 4MKCA 4QO9A 1JWHA 3IOPA 3LQ3A 3FPQA 2R3NA 1UU9A 4FT3A 2WU7A 4YUQA 4L44A 2IPXA 4FUYA 4CTCA 2C6KA 2B1PA 4C35A 2XKEA 4FSZA 5F1ZA 1JQHA 5HG9A 1KSWA 3BPRA 5BMMA 3PJ3A 4EK3A 4C38A 2W96B 3FKLA 5LMKA 2KTYA 1XH4A 2O3PA 3CLYA 4U43A 4O81A 3ZRMA 1H26A 4LRKA 3V01A 3FHIA 2XEZA 4IZAA 2FH9A 3LHJA 2HZNA 3WE4A 4WSYA 3PRFA 4N70A 4DFNA 3MSSA 5EW9A 5KBRA 1JKLA 3GU7A 2JKQA 4N6ZA 4AU8A 4QMLA 2PZRA 4LMUA 4U3ZA 4AFJA 4EH3A 2NP8A 5M4FA 3LOKA 4CCBA 1PXNA 5CEIA 2ZB1A 2YABA 2WTCA 4IB5A 3EQRA 3RAIA 5C4KA 3ORMA 4FKUA 1YXXA 4O2PA 4QMTA 1YOJA 1GZ8A 4YZ9A 4C3FA 1O6KA 4E5WA 2A0CX 4CG9A 4U8ZA 2PZ5A 4UMUA 4H3PA 5EM7A 1M2QA 2R3RA 4YURA 3E62A 2YLEA 2JEDA 4BZOA 2PULA 3SVVA 2YZAA 2XCHA 5A6NA 2Q0BA 2QOIA 3VQUA 4K2RA 4QP3A 3VW6A 3DZQA 1YXUA 3ZS5A 5BUEA 1PRYA 1YXTA 1VYWA 4YSJA 3F3TA 2OXYA 5AP6A 3KRJA 4IB3A 1QPDA 1R3CA 3PTGA 3NMUF 1UWHA 3FC2A 5CEMA 4O0WA 2CNQA 1JSUA 3I0QA 1IAHA 3QQFA 5I4NA 2YCQA 4CQEA 4JX7A 2F2UA 1WCCA 4IACA 3SRVA 5L4QA 3SHEA 3ZCLA 4AGUA 1OL1A 4RIXA 4CZUA 5DE2A 2F49A 3GU6A 4BYJA 1FOTA 2JIIA 4ZAUA 4ZSJA 2XRUA 4M69A 2Y4PA 4NK9A 3GVUA 1YI4A 2GTMA 3GC9A 5FEDA 1V0BA 3H9FA 1ZYLA 1S9JA 3W2OA 3HUCA 2CGVA 4UZDA 2XZSA 4MAOA 4Y72A 3CIKA 4MXXA 3EYHA 3GEQA 3N9XA 3SXFA 4AZSA 4F9AA 4RJ4A 5DGZA 5J7HA 4F08A 3PZEA 2WEVA 2ITOA 3FMKA 3POOA 4AOJA 3R73A 5HX8A 4F4PA 3OCTA 4HOKA 5EKOA 2WTIA 2PMIA 1NVRA 3EMGA 3AC8A 2BRNA 4FTJA 4P2KA 4BCNA 2YCFA 3EWHA 4YJSA 4N4SA 3UBDA 2E9OA 3A4OX 4AUAA 2GHLA 4RVLA 5HCYA 5EI6A 3UZRA 4DEAA 5D11A 1M7QA 3LAUA 1PKDA 2VTTA 4GU6A 4DBNA 3NUAA 4FTOA 4FTUA 4C61A 3G6HA 3PXYA 5BVDA 3KMWA 5KMLA 3VHKA 3VUKA 2QG5A 2OZAB 5EKNA 4QMXA 3UYSA 5EQEA 2C30A 4JQ8A 3L8PA 4GL9A 4GKIA 4PY1A 4D4SA 4YPDA 4TL0A 5F20A 3MBLA 4XG4A 3W55A 5IDNA 2CNUA 3R8VA 2YM5A 2QQ7A 2UW6A 5CY3A 2PSQA 4LL0A 2W1ZA 4WNOA 3I7CA 2CGUA 5EDRA 3NR9A 2I40A 4J95A 4HGLA 2VO6A 4FI1A 3K5VA 4MVFA 3TNPC 4DC2A 3JVRA 3MYGA 2C3LA 3OD6X 3LMGA 4FICA 3CKWA 4WO5A 4KINA 4C4FA 3H9OA 3V5JA 4YJVA 4E4MA 4QD6A 2O8YA 3ZBFA 5KMIA 2CJMA 4R3PA 2ETKA 2X6DA 3BU5A 4XV9A 3FKOA 4TN6A 2NNWB 2E9VA 3P7AA 1MRYA 3G33A 3NNUA 2WGJA 4G6NA 4EYMA 2ZM3A 4U3YA 4UMPA 2OH0E 1ZRZA 5LOHA 4FKSA 2C6TA 2XNNA 3PSCA 1H08A 2UZOA 4ZK5A 3ORPA 4XS2A 4RIXB 4W4YA 4YC8A 4PMMA 5EI8A 4O7WA 4I4FA 5FTGA 5E90A 3DCVA 5DFPA 3E7VA 5IA3A 3PY0A 1UU3A 4C4EA 4MH7A 5JEBA 4RQVA 3VBWA 4ZY4A 4O6LA 2WQEA 4M14A 4AZVA 2KULA 5HD4A 3F88A 4QQ5A 2WTVA 2BRHA 2CCHA 4RFMA 2XH5A 3V3VA 3JXWA 4LRMA 3QL8A 4YBJA 3RNYA 3UPXA 5HVKA 4F0FA 3Q60A 3G90X 3IW7A 3RPSA 5L8KA 3OHTA 2OGVA 4PP9A 4C3PA 1BUHA 3IDCA 3COHA 3GUBA 5EYDA 2B9JA 4UMRA 5HNIX 3Q2JA 1PXPA 4MQ1A 5CVHA 3L9MA 2YHVA 3NYXA 1J3HA 2X2KA 3P86A 3RI1A 4CEGA 1U5QA 4EQCA 3SA0A 1H1QA 2DQ7X 1Q8WA 4IMYA 5CXHA 4EI4A 3ODZX 4S33A 2QLQA 3BZ3A 4Y73A 4C59A 3U55A 3Q04A 2BMCA 4MTAA 2UZWE 3PIZA 4TYHA 2W1EA 5H2UA 3OBGA 3FI4A 3MB7A 4UBAA 5GHVA 2FA2A 5IEXA 4DT9A 2JD5A 3GGFA 4IVBA 4KSQA 2WTWA 3UOKA 1UNLA 3CBLA 3MWUA 1MRUA 5L2TA 4FTCA 2PMOX 2CNVA 3UMXA 3ZEWA 4G3EA 3KU2A 4ZMEA 1O6YA 3DS6A 4ANBA 2JC6A 2X6EA 4JL9A 4CKIA 5M56A 3T8OA 1OI9A 3NEWA 4U41A 5AM6A 4AZFA 1M2PA 4AACA 5GZAA 3PRIA 5CQUA 5CF5A 1X8BA 2ZM1A 2J0KA 2VWBA 4PF4A 5HE2A 1KV2A 4X3FA 4II5A 3BWJA 4X3JA 1OPKA 2XK7A 2PTKA 1G3NA 3DAJA 2X8IA 4AS0A 2OJJA 2XIKA 3U4UA 4C3RA 3L8XA 1UU7A 4IW0A 3DFCB 1WBNA 5M07A 2PU8A 4BGHA 2WQOA 3MTFA 3W2QA 3JPVA 3OTVA 3S0OA 3AMYA 2IWIA 1Q5KA 3PA4A 4ZTNA 2GFSA 3QQKA 4FC0A 4FT5A 1J1CA 2WTKC 5H3QA 3R7UA 3SW4A 3QA8A 4UWYA 1Q8TA 5BUJA 3F2NA 5ETIA 4RC4A 3RALA 4XOZA 4O0UA 3BHVA 3FQSA 5KZ0A 3VS5A 1Q8ZA 3LXLA 4NIFA 1URWA 3LCKA 3Q32A 5IMEA 4AFEA 5ANKA 3MVHA 4L6QA 4U6RA 4WG3A 4DTBA 3BGZA 4E20A 2Y7JA 4C2VA 2ZM4A 4NL0A 4DH5A 2RGPA 3O51A 4BBMA 4O83A 1P14A 4FA2A 2XJ2A 2WQNA 2XP2A 4MD9E 5DBXA 3HYHA 4BGGA 1IA8A 2UVYA 4IANA 2UZLA 2YDJA 5CF4A 3V5TA 2V22A 4HNFA 1R39A 4GEOA 4I6BA 4KBAA 4QMQA 2OW3A 2HOGA 4RPVA 5A4EA 4ACHA 3IGGA 3W8LA 2GHMA 4FODA 4ZZOA 4ZSGA 3ZUTA 2PUIA 3KN5A 4FV0A 4PTGA 3E5AA 3ENHA 2J51A 2RG5A 1LPUA 4FKQA 4RWJA 2IO6A 4H58A 4I5HA 3RP9A 3UOHA 2R3QA 5FD2A 3BE2A 3CP9A 4GVJA 4ZTQA 4ZTHA 4BRXA 5FM3A 3D7TA 3PDTA 3VAPA 3VBTA 3FKNA 2JDTA 2VTOA 1JNKA 1AD5A 2CLQA 3EQCA 3GNIB 5JZNA 4BI0A 4IBMA 3HNGA 3GB2A 3PXKA 3QA0A 2RFDA 5HU9A 3R9DA 1GNGA 5CT0A 3PYYA 3Q4TA 1ZAOA 3C13A 3CC6A 1KWPA 3TIYA 4V0GB 2BKKA 4IWOA 4QPSA 1PYEA 3CQEA 4JR3A 3QKKA 4L67A 5DVRA 3EFWA 2I1MA 2QR8A 3O96A 4KKGA 5HICA 3TZMA 4EC8A 4L3LA 2VNWA 4NFNA 2VTPA 1PJKA 4JXFA 3PVBA 2XUUA 4ITHA 5FXSA 3TTIA 3V6RA 5L2QA 4PMSA 3ATSA 3LFCA 4NM7A 4QP2A 5ETFA 4CFFA 4G3FA 1Q61A 3P23A 1Q8UA 5CZHA 4L42A 4A07A 4NYEA 5EM8A 4ZSLA 2BDJA 2X8EA 3IW8A 3C0IA 3H0ZA 4LOOA 5E7RA 1YVJA 2X9FA 3WF8A 5BQ0A 1BMKA 5KHWA 2V7AA 1Q3DA 2XS0A 3NW5A 2ONLA 4AZTA 2C3JA 5CAUA 3KMUA 3I6UA 5LVMA 3OY1A 4X7QA 4OBOA 4FIEA 4J8MA 4JRVA 1OL5A 3DTCA 4BCHA 1WVWA 1YWRA 2YISA 5G1XA 3BV2A 5CSVA 4DGMA 2I0HA 3ALOA 4CFNA 1JPAA 2VO0A 2WMXA 5FP6A 5E8UA 4P5ZA 2HZIA 3ORLA 2OZOA 1IR3A 4PV0A 3HL7A 4E4LA 2ETMA 4YTCA 5JFXA 3FLQA 4B9DA 2OZAA 2QO9A 1Q4LA 1UWJA 3B8QA 3FZ1A 3LFFA 1TQMA 3VQHA 4W9XA 1WBOA 5JRQA 4XG3A 3HAMA 2BVAA 3F61A 4IDVA 1KE9A 2OXDA 2GDOA 1LEZA 3ZLSA 5DR6A 3KCKA 3OMVA 3TWJA 4AF3A 4XP0A 1UKIA 3UYTA 3PXFA 4O82A 5IQCA 1JAMA 3QGWA 3MPTA 1SNUA 3ORIA 5EHLA 3R7GA 4FEVA 3OW4A 4D2WA 3Q9YA 4RWIA 1P2AA 4XV2A 3W1FA 3LIJA 3KRWA 3QZHA 2C0OA 4ASZA 4EOIA 4UXLA 4CV9A 4EHVA 4EH8A 4PX6A 3IK3A 2AC5A 3PWDA 1F0QA 5FGKA 4EH2A 4F9YA 4O0XA 5JMSA 4DT8A 5CAVA 2VTIA 4GMYA 2O64A 2UW7A 4IJPA 4KIOA 3PUPA 4MXOA 4ACMA 5HVJA 4ZZNA 3KXXA 4C7TA 3FXWA 4LL5A 4LQMA 3CTQA 4M69B 3ZC6A 4F65A 4FTAA 3C4WA 4PTCA 4B0GA 4E3CA 5F9EA 5IA1A 5FG8A 3DDQA 2QOFA 2OH4A 2WKMA 5CF6A 1F3MC 5E1SA 4CRLA 2V7OA 2ZB0A 5EYKA 4HPUE 5HO8A 5J8IA 4KWPA 5HBEA 4UY9A 4A9RA 4PDYA 1CKPA 4HPTE 4ERWA 3QALE 1KV1A 5AR4A 3ZRLA 5HE1A 4B99A 2C1BA 2VTRA 4PL3A 4J53A 5E8TA 4F0GA 4AOTA 4BDEA 4ZTRA 2Q83A 1OIYA 2QCSA 3EFJA 4AG8A 5FBNC 3Q52A 4ZTSA 5TOZA 3JS2A 4O0YA 4BYIA 3F5UA 3CJGA 3QKMA 3DLZA 4O21A 4RQKA 5KHXA 2VX3A 2UW9A 3EOCA 3OG7A 3Q6UA 4NUSA 1RQQA 2G2FA 3FSFA 4ANOA 4BIBA 1Q99A 3BLQA 3IW5A 1WMKA 5J95A 3CPCA 5H9BA 4FK3A 1Y6BA 5FQDC 5AV2A 3KL8A 5AIRA 3LQ8A 5DR2A 5T68A 4DG0E 2ITZA 1IASA 3LCSA 3QX4A 4TYJA 4XV3A 5AUZA 2UZTA 1U59A 1JVPP 4IIRA 1H1SA 3ACJA 4TYHB 3ZZWA 1DI9A 3UDBA 4O84A 5HIDA 4GS6A 3M42A 2O65A 2QC6A 1J91A 1SVGA 3FPMA 3QF9A 3R04A 2A1AB 3OUKA 2QO7A 4C57A 3REPA 4EBVA 5HIEA 3GCUA 4DAWA 5CI7A 4BKJA 3F5XA 3PP1A 2F9GA 3E8EA 2X7OA 1SYKA 1ZOEA 4W4WA 5HTIA 2VTLA 4ZY6A 4ALUA 4EKLA 4FG8A 2P0CA 3QUEA 5AV3A 4D9TA 5CSHA 1OIRA 4FTKA 3SG8A 1V1KA 3M11A 4FTTA 4IXPA 3VRYA 2G2IA 2CGXA 3BE9A 3RMFA 4BR3A 2YEXA 4X2GA 5E8VA 3F3ZA 3RINA 4DFZE 2Z02A 1YRPA 3EKNA 1IAJA 4E6QA 2F7ZE 2F7EE 2P55A 3MVJA 5IQGA 3T3VA 3HV7A 2YIXA 2ACXA 2G1TA 4BWPA 3K54A 4CRSA 4H3QA 3QRJA 4MQ2A 5BNJA 3QTSA 4YZDA 2XNOA 3THBA 3W2RA 2BAJA 4ZS0A 4GK4A 4MYGA 2PUUA 2CKEA 2X39A 3NAYA 4DE4A 3FL5A 5GJDA 4HVDA 2IN6A 1YQJA 3KXMA 4TYGA 4Y85A 4LMNA 4FV5A 3GBZA 5KMJA 3BYUA 3CTHA 3FZSA 4IVCA 1XWSA 4O6EA 4XBUA 4XJ0A 2IW8A 2E9UA 4X6RA 5B0XA 3TL8A 3CTJA 4EK5A 2UZVA 3E88A 4NZWB 5DI1A 3I0OA 4L3PA 5EDQA 3HEGA 4YU2A 4JX3A 4XCUA 2C6OA 4Z7HA 3QWKA 4RGJA 4HVIA 5ACKA 3RM6A 3HGKA 5HX6A 3OS3A 4DH8A 3FZTA 1FVRA 4OAVB 3IS5A 5C03A 4E4XA 4HCUA 3VS6A 2VGOA 4EWQA 2W99B 3H10A 3FMJA 4CFUA 5ITAA 3R1YA 3GC0A 2YM4A 4YR8A 5EOBA 3KFAA 3PJCA 4FOCA 4NCTA 4R78A 2CN8A 2JITA 2R0UA 3ZO2A 5ACBC 3RHKA 5D1JA 1TQPA 5AWMA 5A54A 3CQWA 5HE0A 3ZXTA 3D5XA 5EK7A 5IMXA 4J7BA 5AM7A
chains in the Genus database with same CATH superfamily
2PK9A 1ZOHA 5HCZA 1CDKA 3VUTA 1H8FA 3WZJA 2Z60A 1ERKA 3SG9A 4BVUA 2PVRA 3TZ7A 3FL4A 2JDOA 3GU5A 2UZUE 3QLFA 5AUWA 4BCKA 4QP4A 2XYUA 5T6KA 3N4UA 2WELA 3OY3A 3VS1A 4G31A 3O71A 3DAEA 4BC6A 2J0LA 2R5TA 4WRSA 1REKA 1ZYJA 1ST4A 5GZ9A 3ERKA 2I6LA 2UUEA 5B2LA 1U5RA 3GT8A 5EW8A 2W9ZB 4LUEA 4FIJA 3QRUA 4OTGA 4EOSA 4OTPA 2YWPA 2J6MA 4MXYA 2QD9A 3EN5A 3HX4A 4DGGA 4F78A 3NWWA 4MX9A 4W8EA 2GS7A 2OIDA 3G0FA 4JQ7A 4YJQA 4R3RA 4NKAA 3SAYA 3T9IA 4TWOA 1R78A 2GNLA 3D4QA 1YHVA 3MA3A 4IVAA 4PDSA 5DG5A 5HD7A 4L68A 5M57A 1IA9A 5B7VA 2I7QA 2WMAA 1RJBA 2FSMX 2CPKE 1YWNA 2X1NA 4FF8A 4NSTA 2GSFA 3DY7A 1W82A 5IZFA 2FSLX 3FC1X 2XK4A 5JKGA 3NUNA 3UQFA 5HNBA 3FQHA 1CSNA 3WYYA 1J1BA 2ITXA 4RIYB 5HORA 4FEQA 4BKYA 4KIPA 5KMOA 3DLSA 4O7NA 4WG4A 3EZRA 3FY2A 3NVKI 4FKRA 4RVMA 4DFYA 5HBHA 5AA9A 1E1XA 1OIQA 4I41A 1WBPA 2BROA 3UNZA 3OW3A 4BCFA 5LJJA 5FXQA 4PMPA 3KREA 2ONLC 4I3ZA 4FZ7A 4FV4A 5AP3A 3VUDA 3PPKA 4EUTA 1CMKE 2BZHB 1P4FA 3QTZA 5KKRB 3ZUVA 2XAOA 1S9IA 2CKOA 4IWQA 4BTFA 4AT3A 4B7TA 5IA2A 3KRRA 5EG3A 3S2PA 3VC4A 3QD4A 5H8GA 3QRTA 1R0PA 3NUUA 3PPJA 3BYVA 5M08A 2WFYA 1PF8A 3OBJA 1H0VA 4MWHA 4O0TA 3EIDA 3RPRA 3U51A 3NX8A 1WFCA 3MGYA 4FKVA 2WD1A 4CLIA 3G15A 3NUYA 2W5AA 5HGIA 4PQNA 5HLNA 3FAAA 3HRBA 1Q97A 2WMBA 4ZLZA 4O4CA 5AR5A 3C4XA 3ORTA 2JKOA 2VWIA 3CY2A 4HZSA 3HECA 3DBQA 2JLDA 5CTPA 3C5IA 2RFEA 1IG1A 2O5KA 5CAPA 2WMTA 4OBPA 4YSMA 4EBWA 1P5EA 2HK5A 3HRFA 3I5NA 4IB1A 4YHTA 1KOAA 3C1XA 3R1QA 5TO8A 5JRSA 1H01A 3Q6WA 4QTBA 1PKGA 4FV9A 4EH7A 4G2FA 2O63A 3R8PA 3WF9A 4BCQA 4F7LA 3FE3A 2W9FB 2X4ZA 2P4IA 5M53A 4RLLA 3T3UA 4EOPA 4FJVA 2OIQA 3A7GA 3R1NA 3UDSA 4FX3A 4O7TA 3UG1A 5LMAA 5LARA 3EQBA 3PIYA 2VWXA 3A4PA 1OPLA 1ZZLA 4DYMA 4MNEB 1ZWSA 2QU6A 3GC7A 3PA3A 5E8ZA 4QMMA 3SDJA 3TT0A 4BL1A 4Z7GA 4CVAA 4HGSA 1KE5A 5L3AA 2XKCA 4J71A 3DB8A 2W7XA 3KA0A 4V04A 5C27A 5HCXA 1BKXA 3D15A 1VR2A 4JIKA 3F6XA 2P2HA 1QMZA 2SRCA 2XIXA 3R01A 4Z9LA 4I6HA 4AAAA 4D4VA 3MVMA 4ZY5A 3E3PA 5AR8A 4AXEA 5AX9A 4X2KA 4DHJA 5J1WA 5HO6A 3UJGA 3MJ1A 2WQMA 1QPCA 5EQPA 4CQGA 3C4CA 1ZZ2A 2ESMA 4XHKB 5EM6A 2UW3A 5EDPA 5EQYA 5CT7A 1XBCA 4YJPA 4I0TA 4JG7A 2GNGA 4GK3A 3L8VA 4YJTA 3EKKA 4I5MA 3RJCA 4EQUA 3P1AA 5HE3A 5HO7A 1HOWA 2A19B 4QP1A 3TUBA 4GCJA 2NRYA 3R7EA 3TKIA 3WIKA 1SZMA 4QYHA 5IISA 4NEUA 2E9NA 2W0JA 3UVQA 3MH2A 4E93A 3D0EA 3NNWA 3HMMA 5LXMA 5JFSA 1SVEA 1TKIA 2OBJA 3A61A 3AKJA 2XKFA 4BTKA 2YCSA 4O7ZA 3F3UA 4D5KA 4YJRA 3QCQA 4JVGA 3S00A 5AA8A 1HCLA 3QC9A 5AEPA 3F7ZA 3AT3A 2HWPA 4E5AX 4TNBA 1YOMA 3A8WA 3DJ5A 3DKFA 2F4JA 1U54A 3EQHA 4QMPA 4RJ5A 2W1FA 5JH6A 4E8AA 2WU6A 3BLRA 4K8AA 2ZJWA 4NT4A 4KIKB 4AZWA 5KX8A 2GNIA 5EW3A 2W06A 4A4XA 4BZDA 2RFSA 3U6JA 5AR2A 4O1OA 2BDFA 2VN9A 2CHLA 4A9YA 4D2TA 3VIDA 3KXZA 3OC1A 4C8BA 4DEGA 5H8BA 4FL1A 4KNBA 4JBQA 3D83A 3OTUA 3FXXA 3EQDA 3POZA 4ZJJA 3W10A 2IG7A 2AC3A 4L3JA 3NGAA 5FUTA 2PMNX 3V5LA 1PHKA 2XK3A 2ETRA 5IQIA 4QTAA 2PVMA 2QKWB 2Z2WA 3TN8A 3EQPA 4YZMA 4GVAA 2BHEA 4GYIA 5EI2A 2R3KA 3NW6A 4B4LA 2OFUA 4FZDB 4D2PA 3NLBA 3PSDA 1WVYA 3ZLXA 4C33A 5IF1A 3ORZA 1Q24A 3NFFB 2ZDUA 1WBWA 4BCOA 4M13A 2YIWA 4J8NA 3AC5A 3PG3A 5HLWA 5CX9A 3ENMA 4XH6A 5M4UA 2VU3A 4BTMA 3GP0A 1BYGA 3LXNA 3R22A 3UIUA 2QKRA 3B8RA 3ZBXA 5AIKA 3K2LA 5L8LA 2X2MA 4FGBA 4HVHA 2BILB 4M3QA 4I92A 3VW8A 4AW5A 2ZFYA 4QDVA 5IQAA 2GQSA 4F9WA 3CJFA 1YW2A 3F5PA 4YBKA 3DB6A 4G5PA 3V51A 3V6SA 3EQFA 4EL9A 2OG8A 3R8MA 5K4IA 4L46A 4OTRA 4AW0A 3DKCA 4ONAA 2C68A 3BLHA 4CG8A 2H6DA 2B52A 4LOQA 4IJ9A 3RNIA 3S95A 1U46A 4BWXA 2PVFA 4HCVA 5IH5A 4FT0A 4QQCA 5J9ZA 3D5UA 5A4TA 3CD3A 4FYOA 3CE3A 4HGTA 1J7LA 4BICA 2XCKA 4RWKA 3QTUA 3AMAA 5I9VA 3CD8A 3DGKA 4UWBA 4V01A 4JT3A 3NSZA 3LJ0A 5LQFA 2W05A 1DAWA 3BEGA 2ITVA 5FLFA 5HEZA 4IC7A 2WQBA 4XLVA 3GFEA 3ZO4A 3HV6A 4D5HA 3RGFA 5AUUA 2JDRA 2B53A 3DU8A 4FZAB 2FUMA 3NS9A 5D7AA 2W1IA 4TY1A 3RPYA 2PE2A 4KS7A 2HIWA 2QOHA 4EJ7A 4RZVA 5AMNA 5FTOA 1QPEA 3ZUUA 3Q4UA 2PVLA 5FDPA 2CCIA 4C4HA 2GMXA 4GT5A 5KMNA 2WOUA 2ITYA 2XJ1A 2XARA 4FTMA 2EXEA 1JSTA 1ST0A 4CMTA 1KOBA 3ID6C 3ML1A 5AFVA 4UMTA 4CYJA 4Y5HA 1WAKA 3FLZA 2J0JA 4FSRA 1UA2A 3ZRKA 3WARA 1OUKA 4PPCA 2R64A 2G2HA 4KKHA 3GQLA 4DH7A 3HRCA 5LVLA 5JQ8A 4O86A 4EC9A 4I22A 2PWLA 5CAOA 4FL2A 3LE6A 5FTQA 3LMIA 1OKZA 3PJ8A 3TNQB 1H1PA 2C4GA 2R3MA 3HKOA 3DNEA 4QT1A 3NPCA 3RK7A 4DITA 4BBFA 5LWNA 3VJOA 3U4WA 2F7XE 4FVRA 4FV8A 5K5NA 1V0OA 3R83A 4CLJA 4RMZA 4OAUC 5K0KA 4HZRA 3EZVA 4QYFA 4NM5A 2FSTX 4XOYA 4YNOA 4HJOA 4MBIA 3TZ8A 4FE2A 2WIHA 4BDCA 4RIYA 5A6OA 3QUPA 3UDTA 3QD0A 5C1QB 4FV7A 4PPBA 1LUFA 4ANSA 5JFWA 5CF8A 4NCTC 4FSTA 4RC3A 1W7HA 4GUBA 4RVKA 4CTBA 3SXSA 2GFCA 4I20A 4MK0A 2XNPA 3FJQE 3HAVA 4BY9E 3PLSA 3QD3A 2JKMA 3VHEA 4NTSA 3QQLA 2GPHA 3MI9A 4C2WA 4GU9A 4D1XA 1H27A 4DEEA 2B9FA 4JG8A 3VS4A 3UVPA 3JUHA 4XG2A 4EJNA 3QAME 1L8TA 2RL5A 3TZ9A 3VS2A 2C69A 2XYNA 4ACCA 4P7EA 4RJ8A 3FMMA 3F66A 2VAGA 3MJ2A 3ZU7A 2X8DA 4DFXE 2YAAA 4NW5A 3QGYA 4WKQA 5DT4A 2FYSA 3F2AA 4R7BA 4RFYA 4M97A 4S31A 3LW0A 5D10A 3ZDUA 1PW2A 3HMIA 4LG4A 4RVTA 5CEPA 3D14A 3BBTB 4LGGA 3TEIA 5CNNA 5HOAA 2OJ9A 3QQHA 4X21A 2FO0A 2B54A 4TKSA 4HYUA 4DG3E 4YHJA 2X9EA 3TDVA 4GW8A 3DKGA 3VF8A 4YZCA 3I60A 5M44A 4GG5A 1Z9XA 4J96A 3MIAA 3KVXA 3I4BA 4RBLA 2JDSA 3R02A 4R1YA 5KUPA 2OFVA 4K1BA 4QYYA 3KVWA 1G8AA 4LUDA 1OECA 5FM2A 4IAFA 3NFGB 4IM2A 3GI3A 3UC4A 4C34A 3AC3A 5EYCA 5JSMA 3U6IA 3BQRA 1VEBA 3UC3A 2OI4X 5J79A 3ZM9A 3DPKA 2HW6A 4JQEA 1PMEA 3KF7A 2EUFB 4IADA 4LYNA 3E7OA 4BWKA 5DEYA 4EEVA 3FHRA 2JGZA 3C51A 3KQ7A 3AG9A 4C36A 3LXPA 5AJQA 4H1JA 4KKEA 3AQVA 2WIPA 5IH6A 2C6IA 4BGQA 5TKDA 3CGOA 5E8WA 4TPTA 4IQ6A 4X6QC 4I93A 5IQFA 2HENA 1OITA 4RC2A 2W4KA 1JSVA 3UODA 3LM5A 4EKKA 4EOOA 3BHTA 4U40A 4ZLOA 3SV0A 4QMZA 3PFQA 4DCAA 1H28A 2XF0A 3R8LA 3FMLA 4CNHA 4S34A 2OF4A 4XYFA 1Q41A 3VUGA 2PZIA 4A4OA 4D0XA 5DH3A 4EUUA 4I6QA 4N0SA 5HG7A 5CEQA 3R6XA 3A7FA 2BDWA 2HWOA 4KIKA 5DNRA 1XHAA 5IH4A 5E8XA 1NT2A 1ZMWA 2PL0A 2PVJA 2VWUA 1OM1A 1APME 2XIYA 2OXXA 1O9UA 2C6EA 2EXMA 4OTQA 3P4KA 3WBLA 2VTMA 4C37A 4RX5A 4TYEA 2IJMA 4PP7A 4A06A 1DAYA 2GNFA 5EOLA 1Y57A 2C47A 5K9IA 3D7TB 5JZJA 2ZYBA 3F7WA 2XA4A 4MCVA 4F0IA 2B9HA 3D2IA 1M7NA 2GU8A 3BHHA 4G1WA 2W4OA 1I09A 2UZNA 4GG7A 4RJ6A 4ZP5A 5K3YA 4QTEA 2C1AA 4XG6A 5CZIA 4CMOA 4NKSA 2C3IB 4MD8E 5E4HA 2IVVA 5AP4A 4I6LA 4AOIA 3VS7A 4PPAA 1OKVA 3CEKA 3IDPA 4WNPA 1ND4A 2GCDA 4EK4A 2W1GA 3I1AA 4G16A 3W0MA 3BQCA 2YERA 2BAQA 5ANEA 4R6VA 3KGAA 5IU2A 1JKKA 5FXRA 2BFYA 1B38A 3U87A 4JS8A 5CEKA 3W0SA 4O0VA 3OOMA 1TQIA 1XQZA 1XH6A 1SMHA 4AW2A 3LFQA 2XNGA 2Y4IC 5GIPE 5I0BA 4IZ7A 3GCQA 3MY1A 2PHKA 3F82A 2H96A 2F57A 4KA3A 4BJJA 3JY9A 3QKLA 3UG2A 3VS0A 1PXLA 4CMUA 4ZSAA 5JT2A 3BGPA 4K18A 4RWLA 3UZTA 3AC2A 3NAXA 4FKGA 4AT4A 4EOJA 3C7QA 3OP5A 5CLPA 4ZEGA 3FZOA 3ZFYA 3WI6A 4IEBA 3MB6A 4EK8A 3AD4A 3Q3BA 1KUTA 3DXNA 3QXOA 4NH1A 4RFZA 2OLCA 1NY3A 1OBGA 4FKJA 3HV5A 3TKUA 2W1CA 1RW8A 3U8WA 4L7FA 1CM8A 2J50A 3PPZA 2C5NA 3VBXA 4U0IA 4FMQA 5AX3A 3WZDA 1H25A 3D5VA 2HY81 4FKWA 2C5OA 4FTIA 3LMHA 4FSUA 3N51A 3EN6A 4IM3A 1IEPA 1W0XC 2VZ6A 1YWVA 3ALNA 3AKLA 3BI6A 4QTCA 4G9RA 2P3GX 3FBVA 2R3LA 3IECA 2R3GA 2VWYA 3TNHA 2VWVA 1PXJA 5CU3A 5FBOA 1KE6A 2CGWA 4KD1A 4ZIMA 4X3FB 3K5UA 3ORXA 4AZEA 5M09A 3VRZA 4WUAA 2W17A 2OWBA 4ZZMA 1AGWA 2W1HA 2YAKA 4OLIA 4QMUA 5HIBA 3QFVA 5BYLA 4L00A 3P5KA 3U54A 3OCSA 3PJ1A 3OZ6A 3EN9A 2XNEA 4FUXA 4KAOA 4RZWA 1SVHA 2VTJA 3QCXA 3U9CA 2QONA 4QMYA 3PVGA 1M14A 3QYWA 4F9BA 2A4LA 2IEWA 4FL3A 4XP2A 3EN4A 4G6OA 3O2MA 5CQWA 2VWZA 3W33A 4CFWA 5ICPA 5J9YA 4FG9A 4XRJA 3KRLA 3ZMMA 3HDNA 3S4QA 3B2TA 5CAQA 1WBTA 2FGIA 4HYSA 3WF7A 4CYIA 4D9UA 3DBCA 4AE6A 5AUYA 1M17A 2ERZE 4EH6A 1GAGA 3TV4A 4MEDA 2NYAA 4ACGA 5HQ0A 3ZHPC 3UQGA 4UYNA 3R71A 1UU8A 3MFUA 4OTHA 4EORA 3GFWA 2W5HA 2GS6A 3HZTA 3TKHA 2J0IA 2ZV7A 2VTNA 3E64A 3LCDA 3KXNA 2Y8OA 4MXCA 3PXZA 5GJFA 3RM7A 4F1OA 4YTFA 2WOTA 2Y0AA 2A98A 5AV0A 1CTPE 5HG5A 3QZGA 5HNGA 5CSPA 3UGCA 1YHWA 4FZ6A 4J99A 4LI5A 3HP5A 2H8HA 1FBNA 3NYVA 4RX8A 4USFA 4BI2A 3O17A 2BAKA 4EZ5A 1H1WA 5JK3A 3QQUA 2VV9A 2YACA 4IDTA 4IFCA 1G8KA 3PZHA 2JAVA 1W2FA 3NCGA 3KB7A 2F2CB 4RJ7A 2WTKB 4D28A 5GJGA 3CPBA 5IUIA 2XRWA 1JLUE 3FLNC 4C58A 4E5BA 4M0YA 3W2SA 3HMOA 4Q5EA 5KKRC 4FT7A 3OWJA 5A3XA 3AGLA 3H30A 4IVDA 2RFNA 4APCA 3Q2MA 3IQ7A 5BV3A 3SOCA 3LCOA 4KB8A 3GENA 2YIYA 3RZFA 3UOJA 4WA9A 3NYNA 4OGRA 5AUVA 2GHGA 4DGNA 4O7YA 3HMPA 4FTQA 4R5SA 3NUPA 5IDPA 5LCJA 4FSMA 4AE9A 4W4XA 4D58A 3KY2A 4FGRA 4ALVA 4QNAA 3UTOA 2JFLA 2UW8A 4YJUA 4BI1A 5C8KA 3UQCA 4OT6A 3LJ2A 4FSQA 3QTIA 1RDQE 4WOVA 4H39A 4ID7A 3V8WA 3OCGA 5LMKC 4UN0C 3DK6A 3VULA 3PY3A 3PY1A 4L8MA 4OTIA 1OVEA 3MIYA 2JBPA 4LM5A 2BRGA 4U81A 4YO4A 5E9EA 1JOWB 3UPZA 4QP8A 2BRBA 4Q9SA 3KF4A 2B7AA 2DWBA 3VNTA 5H8EA 2UZEA 3IO7A 2OJIA 5AP7A 3W0RA 3A7JA 4NU1A 3DQXA 5DHJA 3DA6A 4U45A 3UVRA 3MN3A 3PE1A 5F95A 3WE8A 3RK9A 3ZYAA 5IQDA 2YM6A 1OL7A 5EYMA 2XK6A 3LXKA 1SM2A 4IAIA 4GYGA 5AR7A 3BIZA 3VUIA 3OOGA 2Z8CA 1PXKA 5FEQA 5CXZA 3VUMA 4DEDA 2BZKB 3KK8A 3UDZA 3VO3A 5IPJA 5KMMA 3KMMA 4WUNA 2B55A 4LV5A 3TACA 1J7IA 4CZTA 3JR1A 4BB4A 3NCZA 2VO3A 2E2BA 4EYJA 4BTJA 1GOLA 2P2IA 1BLXA 5I3OA 2J9MA 3MDYA 4H36A 4QYEA 4WG5A 3RPOA 2NPQA 4AT5A 4F6UA 4Q5HA 4JBVA 3UP2A 2JKKA 3OEFX 4GFMA 4NM3A 1GZKA 5DIAA 3C4ZA 5CU6A 5DT0A 4U9AA 5AAEA 4O7RA 4I94A 1Z57A 4J52A 5HBJA 3Q4CA 4FNZA 4TWPA 3F2RA 4AWIA 1OL2A 4EK6A 5TR6A 2ZMCA 2UV2A 3PVWA 1FPUA 3NZ0A 2EXCX 3Q9XA 4G3CA 4TW9A 4A4LA 3QC4A 4IWPA 2V0DA 3VBVA 4AX8A 4HYHA 3UIMA 3HLLA 3PG1A 2O2UA 2AEGA 1WVXA 4WSQA 2Y6MA 3O23A 3V5WA 1TZDA 4ZTMA 3QUDA 3II5A 4K6ZA 2IZRA 1BI7A 3BRBA 4A7CA 3N4VA 4Z3VA 2W1DA 3MTLA 3ZC5A 5CSXA 4TTHB 3T9TA 4I21A 3UNJA 3AOXA 2J4ZA 4U97A 3BL7A 2R3PA 2P33A 3PXQA 3KKVA 2ITPA 3MFSA 4U42A 3FYKX 5LMBA 5CWZA 5BVWA 4GFOA 4ASXA 4ERKA 2PE1A 3VJNA 3Q9ZA 2BKZA 3C9WA 2V55A 2XNMA 2UZDA 4GT3A 2ZAZA 1LR4A 3ZONA 3QX2A 5F94A 4P5QA 3IG7A 2OJGA 2WB8A 1H00A 5TT7A 1MRVA 2XMYA 4EHZA 3OF0A 1OL6A 1SNXA 4G34A 4BCIA 1KE7A 2X81A 3AT2A 3NRMA 5DLSA 3RBWA 3HA8A 4KABA 1YXSA 1ZY5A 3ETAA 3SXRA 2R3JA 3ROYA 3ZM4A 5JGAA 4ANLA 4UB7A 4YZBA 4ANNA 3W2PA 3CCNA 4M84A 3I81A 3PWYA 1PMVA 2J2IB 3BBWA 3MH0A 3A8XA 4M7IA 4BCJA 4M12A 3WILA 3PXRA 4YO6A 5ANJA 4I5PA 5TE0A 3R9HA 3C4EA 4FSWA 5IQEA 2HZ4A 3VN9A 4F7SA 2WMQA 2C6LA 3BU3A 1ZY4A 4ZJVA 2FVDA 4WBOA 1PMUA 4TT7A 4BN1A 4NWMA 2QOCA 4A9TA 3LFBA 4BDHA 2PZPA 4A9SA 4C0TA 2VGPA 4GK2A 3QD2B 4F9CA 3FI2A 2WTDA 3AC4A 5EH0A 4HVGA 1FQ1B 1VZOA 3QZFA 3NUXA 4AA4A 4YLJA 3P78A 5HVYA 3IDBA 2C5XA 4ITJA 3D7ZA 3EH9A 4IM0A 4JG6A 5B2MA 3ZFXA 1U54B 4S30A 3ZSGA 1W83A 4L53A 3R7IA 4BDDA 2Z7LA 4QEBA 3OXZA 4PNIA 5D12A 2WO6A 4RX7A 3DXQA 3FLSA 1A9UA 1ZARA 4YJOA 3V5QA 2XNBA 1UNHA 3HDMA 2XM8A 2I0EA 3LFSA 4FNYA 4N6YA 4NFMA 3DBEA 4U80A 5CNOA 1PXMA 4AN9A 4PWNA 4FIHA 3LFNA 1GZOA 1VJYA 4NJDA 2IF8A 3F9NA 4LOPA 2IZTA 2YJSA 4TRLA 5J7BA 5K0XA 4CV8A 1DM2A 4MF0A 4FTRA 3SX9A 4IE9A 3WYXA 4DEBA 5AP2A 2J5EA 4NW6A 4YLLA 2ITNA 3CXWA 3A62A 1QL6A 4DF3A 1AQ1A 3DBDA 3QLGA 4HVSA 1ZLTA 1W84A 3A60A 2ITWA 2X0GA 4O2ZA 5IUHA 3VBQA 4D4RA 3KULB 4MHAA 5KBQA 4AGWA 3EFKA 2H34A 4Y83A 1YI3A 3NNVA 4JI9A 4DEHA 1REJA 3V8TA 2J90A 3WIGA 1B39A 4L7SA 4EH5A 4EZ3A 5IEYA 1PY5A 3COIA 3BLAA 2RSVA 5IQBA 1YDTE 4WBBB 3IPHA 4R77A 2J5FA 4FIGA 5HLPA 3W2CA 3DJ7A 4JRNA 4C62A 5HHWA 1M52A 4S32A 3VBYA 4F99A 1OKWA 1BX6A 3D2KA 3FI8A 2GS2A 2DUVA 2JIUA 3G51A 2BZJA 2PVYA 3RWPA 2J7TA 5CYIA 2YWVA 2CKQA 4O7VA 4JLCA 4YC6A 2VTAA 3E8DA 4MNEA 3FLYA 3AT4A 4E4NA 3LFAA 3LM0A 1H4LA 3Q53A 2Q0NA 1J7UA 2JFMA 4NJ3A 3BWFA 1MP8A 4JBPA 5CVFA 3MS9A 2R3IA 3ELJA 1T45A 4M15A 2BR1A 3WZUA 3R63A 4RG0A 2W5BA 4DH3A 4FVPA 3COMA 3TDWA 4ASDA 4F70A 5A4LA 5CU2A 3GCPA 3R00A 3ZFMA 2YITA 5AADA 5IUGA 4ANQA 3CQUA 3UE4A 2QHNA 2YM7A 2EB3A 4QPAA 3WF5A 2BCJA 2WMUA 4GJ2A 2BALA 3SRVB 2PY3A 3BEAA 2VO7A 3BU6A 3WOWA 3EYGA 2AYPA 1XJDA 4QOXA 5LCKA 4ANMA 2WHBA 2PVNA 2YZLA 2R7BA 4EH4A 4XX9A 5ANIA 2BUJA 5GZ8A 5L2WA 4AXCA 5AUXA 2R3OA 5KE0A 4LGHA 2XKDA 4P4CA 3L9LA 2HXQA 4W9WA 3FZRA 1FMOE 3QWJA 4RIOA 1G5SA 3FYJX 4IZ5A 4FNXA 3UOLA 4DCEA 3OCBA 3KXHA 3ZO3A 1UNGA 1XH9A 2QOQA 4G6LA 3AD6A 2IVSA 1K3AA 4IX4A 3A2CA 3NW7A 4BCMA 4I0RA 3ORNA 2XB7A 4IZYA 1H24A 1VYZA 3LKMA 3DJ6A 4EQMA 3MVLA 4JAJA 1NVSA 3ANQA 4APPA 3KK9A 3UO6A 3I79A 4F7JA 2CKPA 4QRCA 3ORKA 4ZOGA 4YP8A 4F64A 4RX9A 1OBDA 2VD5A 5BYZA 3SD0A 2QR7A 4DEIA 4QMNA 4YTIA 4CKRA 1IRKA 3R2YA 3WZKA 5I9YA 3LLAA 2WMWA 2R2PA 3L9NA 4O38A 3JY0A 5CU4A 4NIFB 5L6PA 3L9PA 4USEA 5L6OA 4XMOA 4F1TA 3KIOC 1TVOA 4HGEA 3Q4ZA 3QCSA 5C26A 3LFEA 5CENA 4W4VA 1H07A 3EFLA 4GIIA 1XH8A 3WZEA 1NA7A 1WZYA 3CS9A 4JIAA 2Z7SA 3TJCA 2YM8A 3F5GA 3FMNA 3QHRA 5EHYA 4IFGA 4KBCA 4EWHA 3LCTA 4F6SA 3EJ1A 3DDPA 5J1VA 1ZYSA 4FVQA 3R9NA 4LV8A 5ANOA 5L8JA 4DTKA 3RAKA 5BX0A 3BL9A 1XH5A 2HCKA 1VLRA 4X2NA 4CT2A 2IW6A 4UV0A 4YLKA 4ITIA 3E8NA 4M67A 2AQXA 4AN2A 3W32A 1CKIA 3GCSA 4GRBA 3RAHA 3E63A 3FLWA 4QP7A 4AN3A 4FR4A 2WZJA 3HVCA 3LZBA 4X2JA 3VUHA 5HTCA 4AXAA 3A7IA 4XRLA 4FTNA 2ZV9A 4WRGA 5E8SA 5C9CA 4E6DA 3M2WA 4K33A 4DHFA 1G8SA 3ZLWA 4M0ZA 4R5YA 3VVHA 4ZLYA 2BRMA 5BVFA 5IEVA 1NXKA 4RA4A 2BIKB 3ZZEA 4BDGA 5I3RA 4PRJA 2UVXA 4OR5A 3ACKA 1XO2B 1Y8YA 2XVDA 2C0TA 1LP4A 4BDIA 2I0YA 4DA5A 2FSOX 4EZ7A 2C5VA 4UALA 4USDA 4ENXA 1M2RA 3U9NA 4D55A 3V8SA 2BHHA 2XIZA 3FXZA 3CY3A 1BI8A 2NRUA 2WXVA 3P9JA 2XIRA 3FQEA 3KC3A 2QG7A 4ZS4A 4BCGA 3BKBA 3O7LB 3QXPA 3RAWA 5IG1A 2PE0A 5JFVA 3IGOA 1RE8A 4AXFA 3I7BA 4LRJA 3E8CA 1H0WA 3S1HA 4J1RA 2CMWA 4RSSA 3DBFA 3PP0A 3G2FA 4UXQA 5LVOA 2OU7A 2EB2A 4ZJIA 1OUYA 3P7BA 5M4IA 4QNYA 3AC1A 4PL4A 3SOAA 3OUNB 2WMSA 3E93A 3IW4A 4MXZA 5TF9A 5ANDA 2GTNA 3KRXA 2OF2A 4WD5A 3GU8A 3W0QA 2PYWA 5DEWA 4YNEA 4AA5A 2GNJA 4F63A 1H1RA 4I5CA 1PXOA 3G6GA 3DOGA 1R1WA 3FMHA 4GV1A 3GOKA 3QRIA 3QBNA 2PMLX 3F69A 3LQ5A 4YHFA 2YDKA 3ANRA 2HAKA 4S2ZA 3ZH8A 3ZOSA 3R1SA 4I4EA 4JDKA 4F1MA 3G9NA 3DQWA 1JBPE 2HZ0A 3OWKA 5DN3A 5BMSA 2OKRA 4I1ZA 5I5ZA 2PUNA 3LLTA 1U4DA