1LF6A

Crystal structure of bacterial glucoamylase
Total Genus 242
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
242
sequence length
674
structure length
674
Chain Sequence
SIKIDRFNNISAVNGPGEEDTWASAQKQGVGTANNYVSKVWFTLANGAISEVYYPTIDTADVKEIKFIVTDGKSFVPDETKDAISKVEKFTDKSLGYKLVNTDKKGRYRITKDIFTDVKRNSLIMKAKFEALEGSIHDYKLYLAYDPHIKNQGSYNEGYVIKANNNEMLMAKRDNVYTALSSNIGWKGYSIGYYKVNDIMTDLDENKQMTKHYDSARGNIIEGAEIDLTKNSEFEIVLSFGQSDSEAAKTALETLGEDYNNLKNNYIDEWTKYCNTLNNFNGKANSLYYNSMMILKASEDKTNKGAYIASLSIPWGDGQRDDNTGGYHLVWSRDLYHVANAFIAAGDVDSANRSLDYLAKVVKDNGMIPQNTWISGKPYWTGIQLDEQADPIILSYRLKRYDLYDSLVKPLADFIIKIGPKTGQERWEEIGGYSPATMAAEVAGLTCAAYIAEQNKDYESAQKYQEKADNWQKLIDNLTYTENGPLGNGQYYIRIAGLSDPDADFMINIANGGGVYDQKEIVDPSFLELVRLGVKSADDPKILNTLKVVDSTIKVDTPKGPSWYRYNHDGYGEPSKTELYHGAGKGRLWPLLTGERGMYEIAAGKDATPYVKAMEKFANEGGIISEQVWEDTGLPTDSASPLNWAHAEYVILFASNIEHKVLDMPDIVYKRYVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords glucoamylase
publication title Crystal structure and evolution of prokaryotic glucoamylase
pubmed doi rcsb
molecule tags Hydrolase
total genus 242
structure length 674
sequence length 674
chains with identical sequence B
ec nomenclature ec 3.2.1.3: Glucan 1,4-alpha-glucosidase.
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00723 Glyco_hydro_15 Glycosyl hydrolases family 15
A PF09137 Glucodextran_N Glucodextranase, domain N
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1lf6A02
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1lf6A01
4FUSA 2JJBA 5DGRA 1WZZA 1NSXA 1K72A 3WKGA 4Z4LA 1RQ5A 1AGMA 1MMZA 1L1YA 1FP3A 2HTAA 4RNLA 1GLMA 2WW2A 1K1WA 2DROA 2XHNA 1V7WA 2NVPA 3SEPA 4KTRA 4AYRA 5KKBA 2CQTA 1FAEA 1GA2A 1G9GA 1XWQA 3RENA 1OJOA 1DP0A 1NS0A 2XFGA 1JZ6A 1JYXA 3CIHA 3E73A 1HMUA 2E24A 1X9DA 3J7HA 1FCEA 1OJNA 1JYNA 5M7IA 2FBAA 1NS4A 3MV11 3VD9A 2OKXA 1N7QA 1K1YA 3GZKA 2DRSA 1NSSA 4DODA 1RWFA 2CIQA 3IMHA 2GH4A 1IA7A 3RX7A 3WKFA 4TF4A 2BRWA 1KKTA 1WU6A 3WIRA 3QFYA 4TXTA 3WIQA 3QDEA 3H3KA 3RSYA 1L7JA 3WIWA 4AYPA 4CJ0A 1MN0A 2BRPA 1C82A 3T09A 1OJPA 4L0GA 1NXCA 2WVZA 3MUZ1 1KREA 3OBAA 3WKIA 1HM3A 3QXFA 1TF4A 3A3VA 2FV1A 3RX8A 2AHFA 1NSMA 1XW2A 3IAPA 1WU5A 1JZ4A 1LF9A 3W5MA 1H12A 2RI9A 2JKEA 5E2JA 4AYQA 5CZLA 3VXDA 4JJJA 2GZ6A 1KRFA 3E6UA 2XSGA 1NS8A 2CISA 2D73A 1RWGA 4ZH5A 4EL8A 1XWTA 4J5TA 2D8LA 2RI8A 1JYWA 1H54A 2WW3A 3NJXA 2B4FA 4KTPA 1RWCA 3H2WA 3NJVA 4Q2BA 4DUXA 3NREA 4ZG8A 1F9DA 3ACTA 4BZEA 1YQ2A 5GW7A 4BZGA 3QWTA 1NSVA 3T0BA 1RW9A 3DCDA 1IS9A 3Q1NA 1HN1A 1NS2A 2HTBA 3ANJA 3QG0A 1CLCA 1W3YA 3ANIA 1HM2A 1JZ7A 1OJMA 2CIRA 1CB8A 3QT9A 1SNZA 1FO2A 2JKPA 3VDCA 3S4BA 2EACA 1GAHA 1WU4A 3S4DA 2Z07A 3DYPA 4DUWA 2AHGA 1DL2A 5GY3A 2BRVX 2WDAA 1V7XA 2EADA 2WVYA 5E1QA 1LOHA 5A1AA 1G6IA 1YGAA 2VN4A 1FBWA 3QSPA 1HN0A 1NC5A 2E22A 3E1F1 2ZBLA 3EZ8A 3T2OA 1KS8A 3VDBA 2QNOA 1DOGA 1AYXA 2FV0A 3T2PA 1V5DA 3WKHA 4CJ1A 1H13A 3W7WA 2WZSA 1LF6A 3TF4A 5CD2A 2JG0A 2WW0A 1NSRA 4WU0A 3K11A 3W5NA 4L6XA 1X1HA 1JOVA 3QFZA 3DYOA 3MV01 1V7VA 1MMYA 3ECQA 1JZ2A 1MMUA 1KSDA 4WVAA 4DUVA 3I3BA 1SO0A 5DGQA 3IAQA 1L2AA 2P0VA 2WCOA 3I3EA 1ULVA 2DRQA 5M7YA 3ACSA 3RRSA 3A24A 3QXQA 1EGUA 2Q1FA 1FO3A 3MWXA 1KWFA 1FMIA 4AYOA 2X03A 3PMMA 2WW1A 1PX4A 3H7LA 3VD4A 1VD5A 3MUY1 3VW5A 1G87A 2ZZRA 3S4CA 3T2QA 2RGKA 1FBOA 2ZXQA 1PX3A 3T0DA 1J0NA 3T08A 5CA3A 2FUZA 1J0MA 2VN7A 4DOEA 1HMWA 1X1JA 1N7PA 2CQSA 1V5CA 4CE7A 1H14A 1CEMA 2WVXA 1JYVA 1UG9A 3I3DA 3VDAA 3S4AA 4WVBA 3BGAA 3EQAA 3D3IA 2EABA 1LURA 3K25A 2WVXB 1N7RA 3OB8A 4XUVA 4TTGA 1N7OA 5MEHA 2EAEA 1L7KA 1JZ3A 3QT3A 2JF4A 1K1XA 3GT5A 2D5JA 1Z45A 2A8ZA 1RWAA 3T0AA 1HCUA 4WVCA 3OS7A 1F9GA 1NKGA 3T33A 1X1IA 1GAIA 3QRYA 4BZFA 3WUXA 1F9OA 1JZ8A 1JZ5A 1F1SA 3DYMA 3DECA 1LXMA 3W7TA 3WC3A 2YIKA 2JKAA 3AFJA 1KSCA 1I8QA 3ANKA 3W7XA 2WYNA 1RWHA 1MMXA 2ZQ0A 3VD7A 4Q88A 1N7NA 1IA6A 4Z4JA 3VD5A 1G9JA 3RX5A 3WFAA 1NSZA 1KFGA 1UT9A 3P2CA 1JS4A 3VD3A 2F6DA 1TXKA 1LXKA 2AFAA 3GLYA 1F4HA 3X17A 4BZHA 1NS7A 3W7SA 1NSUA 3ON6A 1F4AA 3W7UA 3CZJA 3QPFA 2DRRA 4AQ0A
chains in the Genus database with same CATH superfamily
3N9HA 2G02A 4FUSA 1N1ZA 2JJBA 1D8DB 4QT9A 4D4BA 5DGRA 1WZZA 1NSXA 3NFVA 1K72A 3WKGA 4Z4LA 1KSIA 1RQ5A 3X40A 1AGMA 3PYBA 1MMZA 1L1YA 3NNBA 1AV4A 1IVWA 1FP3A 1H3BA 3S9VA 4OK2A 4YCRA 2HTAA 4RNLA 1GLMA 5DHKA 3X3ZA 2WW2A 1K1WA 2DROA 2XHNA 1V7WA 4BOKA 2ZIRB 2NVPA 1HXAA 3SEPA 4KTRA 3PZ4B 2B39A 3DX2A 4AYRA 1X81B 5KKBA 2CQTA 1FAEA 1HWWA 1JCSB 1O1RB 5FOBB 3E80A 1GA2A 2PNCA 1G9GA 1XWQA 3T0UA 1OJOA 3RENA 4M76A 1H3AA 4OJZA 2PN5A 1DP0A 1NS0A 2WINB 3BUPA 2XFGA 1JZ6A 1O1SB 1JYXA 2V3PA 3CIHA 4K35A 1LVNA 4V1RA 2F7PA 3E73A 3M7LA 3KSLB 5IK6A 1HMUA 5EASA 2E24A 4L9PB 1SPUA 1X9DA 1LD8B 3J7HA 3LVTA 3CZNA 3X42A 1FCEA 1QWNA 1OJNA 1HZFA 1N4PB 1JYNA 3BUIA 4E1YA 2F18A 3NBBA 5M7IA 3EJSA 1QBQB 2FBAA 3OXUA 3EU5B 2H6FB 3D51A 1NS4A 2WOFA 2WYHA 3DX1A 1TNOB 3MV11 3MPHA 1FT2B 3VD9A 3EU8A 3DX0A 3E7JA 1N9AB 2OKXA 1N7QA 1TN7B 3SX1A 1IQYA 4FNPA 1K1YA 3GZKA 2DRSA 1W5ZA 2WGQA 1NSSA 4DODA 1W2ZA 1RWFA 4D4CA 3PZ2B 2CIQA 1GHQA 3IMHA 3PZ3B 2GH4A 1D6UA 1IA7A 1H3CA 4FJQA 1LD7B 1OACA 3BVWA 4KFEA 3RX7A 3WKFA 4TF4A 3P5PA 3D52A 4K3AA 2BRWA 1KKTA 1WU6A 1W6KA 1NI1B 3WIRA 3QFYA 4TXTA 3WIQA 3QDEA 5FO9B 3H3KA 3DRAB 3RSYA 1L7JA 3WIWA 4AYPA 4YDEB 4CJ0A 1MN0A 4F10A 3TY1A 5IKAA 2BRPA 4FNRA 2F7RA 1C82A 3T09A 1OJPA 3BVXA 4L0GA 3Q7FB 1NXCA 4ZRQA 2WVZA 1D6ZA 3CU7A 2OOVC 3WA3A 3MI6A 3BUDA 4F13A 2ZL8A 2FUQA 1RJOA 1SA4B 1HXKA 3WVFA 1IVUA 2NOJA 3MUZ1 3HXBB 1LTXB 5FO7B 1KREA 3N0GA 3OBAA 3WKIA 3KSQB 1HM3A 3QXFA 1TF4A 3PGBA 3A3VA 4BTXA 5IK0A 5DHIA 5ILKA 1HX9A 2FV1A 5IL8A 3RX8A 4C1SA 1JRQA 1D8EB 2AHFA 2J5CA 2C11A 1NSMA 5JPNB 3SDQA 1XW2A 2W0QA 3IAPA 1WU5A 1JZ4A 1LF9A 3Q79B 3W5MA 2C10A 1H12A 2RI9A 5JPMB 5E2JA 1O5MB 2ONGA 2JKEA 4AYQA 5CZLA 3VXDA 3BUQA 1KZOB 4JJJA 2GZ6A 3DSXB 1KRFA 3E6UA 1N1BA 4GTMB 2XSGA 1NS8A 2OQEA 4OZWA 3M71A 3DDFA 2CISA 2D73A 4GTPB 2ONHA 1RWGA 1O7DD 5C05A 1EKMA 4ZH5A 3LZ9A 1IU7A 4EL8A 1XWTA 5EAUA 3VSMA 4J5TA 2D8LA 2RI8A 2F0YB 4BOJA 1WMPA 1H54A 1JYWA 3EJQA 2WW3A 4KFDA 3NJXA 2ALWA 2B4FA 4KTPA 1RWCA 1N94B 3H2WA 1O6HA 1TN6B 4Q2BA 3NJVA 4DUXA 3NREA 1R34A 3CV5A 1TQUA 4ZG8A 1SA5B 5JMFA 1C3DA 5ILZA 1F9DA 3ACTA 1PS3A 4EHMB 4FNQA 1YQ2A 3HXDB 5GW7A 4BZGA 3EJUA 4GAXA 1TQWA 3HIGA 4BZEA 3QWTA 3BLBA 4BTWA 4LNGB 4DI5A 2WOHA 1NSVA 3T0BA 1RW9A 1IVXA 3DCDA 2V8KA 1IS9A 3Q73B 1HN1A 3Q1NA 3D5RA 2CG1A 1NS2A 2HTBA 1W6JA 5ILDA 2FUTA 3ANJA 5GZKA 1QALA 3KN4A 3VSNA 3PZ1B 2BBCA 3QG0A 3SAEA 2Y73A 2G0DA 1CLCA 1W3YA 1HM2A 3ANIA 2XWBB 1JZ7A 1JCQB 1HV6A 2E2UA 1OJMA 3M78A 2CIRA 4KKJA 4RNQA 1CB8A 3PYAA 3QT9A 1SNZA 1FO2A 2JKPA 3VDCA 3S4BA 2V8IA 2EACA 2F1BA 1GAHA 3HI7A 1WU4A 1N4SB 3S4DA 2Z07A 2YFNA 3DYPA 3LOYA 1MZCB 4DUWA 2AHGA 2H6HB 1DL2A 1PU4A 2RDYA 5GY3A 2BRVX 3SFYB 2WDAA 1V7XA 5KBPA 2EADA 2CFLA 3EUVB 4LIXA 3NBJA 1W7CA 2E2TA 1N22A 5IM1A 2WVYA 5E1QA 3BUBA 1TQSA 3AFLA 1LOHA 1QAFA 4UFCA 5A1AA 1G6IA 1YGAA 3E32B 2VN4A 2YFOA 3G4FA 1FBWA 3QSPA 1N9EA 1HN0A 2WIIB 4GTVB 1TN8B 1NC5A 2V8JA 2E22A 3E1F1 2V3NA 2ZBLA 3EZ8A 3T2OA 3SDTA 3BVUA 1HXCA 1KS8A 3HXFB 3VDBA 2QNOA 1DOGA 1AYXA 3M02A 3DSWB 1WMOA 2FV0A 3T2PA 2Y74A 4GTRB 1V5DA 3WKHA 4CJ1A 1H13A 3W7WA 2WO0A 1QAZA 2WZSA 1LF6A 5ILYA 3TF4A 5CD2A 1GXMA 2JG0A 3M7CA 3ALAA 2WW0A 1NSRA 3M01A 1SIIA 2BT3A 4WU0A 3K11A 3W5NA 4L6XA 3DX3A 1X1HA 3M7BA 3SDUA 1JOVA 2OOVA 4KFFA 3QFZA 1QWUA 3DYOA 3MV01 3D50A 1N21A 1V7VA 3BLCA 1SIHA 1MMYA 4LNBB 1N20A 5AGDA 3ECQA 3BVTA 1R76A 1JZ2A 4BTYA 1AVLA 4GTQB 2OW7A 1MMUA 1KSDA 1UMPA 3DSSB 5EATA 4WVAA 3M74A 4DUVA 1QAKA 5IK9A 4GL3A 3I3BA 1SO0A 5ILHA 3DSVB 1TQVA 1DYUA 5DGQA 2ZISB 3EJPA 1L2AA 2P0VA 2WCOA 3I3EA 1ULVA 3IAQA 4ZH1A 2YX9A 1TNZB 3P5RA 3KQ4A 2DRQA 2R2LB 5M7YA 3ACSA 3RRSA 3A24A 3M7EA 1W6GA 1KZPB 3D4YA 3QXQA 1EGUA 2Q1FA 1GSZA 2XQWA 1FO3A 3X3YA 3N0FA 3MWXA 1KWFA 1FMIA 2X03A 4AYOA 3K7XA 3PMMA 4EV5A 2WY8A 2WW1A 2CWTA 1PX4A 2XWJB 3H7LA 3VD4A 2A73B 1VD5A 3MUY1 3VW5A 5ILJA 1G87A 1N24A 3K5TA 2H6GB 1A2VA 2ZZRA 3S4CA 3E37B 5JMDA 3T2QA 2RGKA 2OW6A 1TNBB 3E30B 1FBOA 3RJ3A 2BB5A 4GTOB 3E33B 2BEDB 2PMVA 4NEIA 2ZXQA 1PX3A 1UI7A 3T0DA 3HXCB 1J0NA 3M76A 3M73A 4OZVA 3T08A 5CA3A 1IVVA 2FUZA 3Q75B 1WMNA 3M00A 1J0MA 3M75A 4FNTA 2VN7A 4D4DA 4DOEA 3KLSA 3X41A 1HMWA 1X1JA 1N7PA 3SDRA 2CQSA 1V5CA 3BS6A 4CE7A 3SXXA 3SQCA 4LNVA 4D4AA 1H14A 1H37A 2IEJB 3M72A 3C72B 1CEMA 2WVXA 1JYVA 3X3XA 1H35A 1UG9A 5IKHA 3I3DA 1FPPB 3VDAA 3S4AA 2E2VA 1HXGA 3HXEB 4WVBA 3AMOA 3BGAA 1SQCA 3EQAA 2H6IB 3DX4A 4MBGB 1W4NA 1TU5A 1QSJA 1O6QA 3D3IA 1NL4B 4ZRPA 2EABA 1LURA 3K25A 4FNVA 2CFGA 2WVXB 3DSTB 1N7RA 3OB8A 4XUVA 5IL3A 1US1A 4TTGA 3AMOB 1S63B 3QPFA 1N7OA 5ILIA 2XN1A 5MEHA 1FT1B 4YDOB 4AQ0A 2EAEA 1L7KA 4FXGB 1JZ3A 3QT3A 2JF4A 2D1WA 1RKYA 1K1XA 1GXOA 3GT5A 2D5JA 1Z45A 3HIIA 3DPYB 1RWAA 2A8ZA 3A0OA 1AVKA 3E34B 3T0AA 1HCUA 3Q78B 1O6RA 4WVCA 3OS7A 1GXNA 3G4DA 1F9GA 1NKGA 1X1IA 3T33A 2CFWA 1GAIA 3QRYA 1N95B 2GOXA 3CZSA 3EJRA 3WUXA 4BZFA 1F9OA 1TNYB 1JZ8A 2CG0A 1JZ5A 1F1SA 3DYMA 4EV2A 3M77A 3DECA 1LXMA 1D6YA 2SQCA 3W7TA 4FNSA 4MMIA 3KIIA 3WC3A 2CWUA 4MU9A 2YIKA 2JKAA 3OEDA 3AFJA 2FYVA 4MMHA 1N23A 1KSCA 1TNUB 1W6CA 1I8QA 1DCEB 3ANKA 4V1SA 3W7XA 3EJTA 2WYNA 1RWHA 1HTYA 1MMXA 4FXKB 2F7OA 2ZQ0A 3VD7A 4Q88A 1S64B 2XN0A 1N7NA 4OK4A 1IA6A 4Z4JA 2F1AA 3VD5A 1G9JA 3BVVA 3RX5A 4ONTA 1UI8A 3DSUB 2WYIA 2WY7A 1NSZA 3WFAA 1JCRB 1KFGA 1UT9A 3SFXB 4D94A 2XN2A 4FNUA 1N4RB 1O1TB 3P2CA 1JS4A 1R33A 3VD3A 2CWVA 3Q7AB 2F6DA 5FO8B 1TXKA 2CFDA 3G6JB 1LXKA 2AFAA 4GTSB 3GLYA 1F4HA 2BB6A 1TQTA 3WA2X 1H36A 2CFKA 2I07B 3X17A 1IQXA 3SDVA 4BZHA 1NS7A 2OQEC 3D5SA 4KKIA 1O79A 3W7SA 3D4ZA 3DDGA 1NSUA 1H39A 1N4QB 3ON6A 1F4AA 3W7UA 2F7QA 3CZJA 1QQFA 2DRRA 4GTTB 1QX1A
chains in the Genus database with same CATH topology
2G02A 4FUSA 2JJBA 1D8DB 4QT9A 4D4BA 5DGRA 1WZZA 1NSXA 1K72A 3WKGA 4Z4LA 1RQ5A 1AGMA 3PYBA 1MMZA 1L1YA 1FP3A 1H3BA 3S9VA 4YCRA 2HTAA 4OK2A 4RNLA 1GLMA 2WW2A 1K1WA 2DROA 2XHNA 1V7WA 4BOKA 2ZIRB 2NVPA 3SEPA 4KTRA 3PZ4B 2B39A 4AYRA 1X81B 5KKBA 2CQTA 1FAEA 1JCSB 1O1RB 5FOBB 3E80A 1GA2A 1G9GA 1XWQA 3RENA 1OJOA 4M76A 1H3AA 4OJZA 2PN5A 1DP0A 1NS0A 2WINB 2XFGA 1JZ6A 1O1SB 1JYXA 2V3PA 3CIHA 4V1RA 3E73A 3M7LA 3KSLB 1HMUA 4L9PB 2E24A 1X9DA 1LD8B 3J7HA 1FCEA 1OJNA 1N4PB 1HZFA 1JYNA 5M7IA 1QBQB 2FBAA 3OXUA 3EU5B 2H6FB 1NS4A 1TNOB 3MV11 1FT2B 3VD9A 3EU8A 3E7JA 1N9AB 2OKXA 1N7QA 1TN7B 1K1YA 3GZKA 2DRSA 1NSSA 4DODA 1RWFA 4D4CA 3PZ2B 2CIQA 1QQFA 1GHQA 3IMHA 3PZ3B 2GH4A 1IA7A 1H3CA 1LD7B 3RX7A 3WKFA 4TF4A 3P5PA 2BRWA 1KKTA 1WU6A 1W6KA 1NI1B 3WIRA 3QFYA 4TXTA 3WIQA 3QDEA 5FO9B 3H3KA 3DRAB 3RSYA 1L7JA 3WIWA 4AYPA 4YDEB 4CJ0A 1MN0A 3TY1A 2BRPA 1C82A 3T09A 1OJPA 4L0GA 3Q7FB 1NXCA 4ZRQA 2WVZA 3CU7A 2FUQA 1SA4B 3WVFA 2NOJA 3MUZ1 3HXBB 1LTXB 5FO7B 1KREA 3OBAA 3WKIA 3KSQB 1HM3A 3QXFA 1TF4A 3A3VA 2FV1A 3RX8A 4C1SA 1D8EB 2AHFA 1NSMA 5JPNB 3SDQA 1XW2A 3IAPA 1WU5A 1JZ4A 1LF9A 3Q79B 3W5MA 1H12A 2RI9A 5JPMB 5E2JA 1O5MB 2JKEA 4AYQA 5CZLA 3VXDA 1KZOB 4JJJA 2GZ6A 3DSXB 1KRFA 3E6UA 4GTMB 2XSGA 1NS8A 3M71A 2CISA 2D73A 4GTPB 1RWGA 4ZH5A 4EL8A 1XWTA 4BOJA 3VSMA 4J5TA 2D8LA 2RI8A 2F0YB 1JYWA 1H54A 2WW3A 3NJXA 2B4FA 4KTPA 1RWCA 1N94B 3H2WA 1O6HA 1TN6B 4Q2BA 3NJVA 4DUXA 3NREA 4ZG8A 1SA5B 5JMFA 1C3DA 1F9DA 3ACTA 4EHMB 4BZEA 1YQ2A 3HXDB 5GW7A 4BZGA 3QWTA 4LNGB 1NSVA 3T0BA 1RW9A 3DCDA 2V8KA 1IS9A 3Q73B 1HN1A 3Q1NA 3D5RA 1NS2A 2HTBA 1W6JA 2FUTA 3ANJA 5GZKA 3VSNA 3PZ1B 2BBCA 3QG0A 3SAEA 2G0DA 1CLCA 1W3YA 3ANIA 1HM2A 2XWBB 1JZ7A 1JCQB 3M78A 1OJMA 2CIRA 4KKJA 3PYAA 1CB8A 3QT9A 1SNZA 1FO2A 2JKPA 3VDCA 3S4BA 2V8IA 2EACA 1GAHA 1WU4A 1N4SB 3S4DA 2Z07A 3DYPA 1MZCB 4DUWA 2AHGA 2H6HB 1DL2A 5GY3A 2BRVX 3SFYB 2WDAA 1V7XA 2EADA 3EUVB 4LIXA 2WVYA 5E1QA 3AFLA 1LOHA 5A1AA 1G6IA 1YGAA 3E32B 2VN4A 1FBWA 3QSPA 1HN0A 2WIIB 4GTVB 1TN8B 1NC5A 2V8JA 2E22A 3E1F1 2V3NA 2ZBLA 3EZ8A 3T2OA 3SDTA 1KS8A 3HXFB 3VDBA 2QNOA 1DOGA 1AYXA 3DSWB 2FV0A 3T2PA 4GTRB 1V5DA 3WKHA 4CJ1A 1H13A 3W7WA 2WZSA 1LF6A 3TF4A 5CD2A 1GXMA 2JG0A 3M7CA 2WW0A 1NSRA 4WU0A 3K11A 3W5NA 4L6XA 3M7BA 1X1HA 3SDUA 1JOVA 3QFZA 3DYOA 3MV01 1V7VA 3BLCA 1MMYA 4LNBB 5AGDA 3ECQA 1R76A 1JZ2A 4GTQB 1MMUA 1KSDA 1UMPA 3DSSB 4WVAA 3M74A 4DUVA 4GL3A 3I3BA 1SO0A 3DSVB 5DGQA 2ZISB 3IAQA 1L2AA 2P0VA 2WCOA 3I3EA 1ULVA 4ZH1A 1TNZB 3P5RA 3KQ4A 2DRQA 2R2LB 5M7YA 3ACSA 3RRSA 3A24A 3M7EA 1KZPB 3QXQA 1EGUA 2XQWA 1GSZA 2Q1FA 1FO3A 3MWXA 1KWFA 1FMIA 4AYOA 2X03A 3K7XA 3PMMA 2WY8A 2WW1A 1PX4A 2XWJB 3H7LA 3VD4A 2A73B 1VD5A 3MUY1 3VW5A 1G87A 2H6GB 2ZZRA 3S4CA 3E37B 3T2QA 5JMDA 2RGKA 1TNBB 3E30B 1FBOA 3RJ3A 2BB5A 4GTOB 3E33B 2BEDB 2PMVA 4NEIA 2ZXQA 1PX3A 3T0DA 3HXCB 3M76A 3M73A 1J0NA 3T08A 5CA3A 2FUZA 3Q75B 1J0MA 3M75A 2VN7A 4D4DA 4DOEA 3KLSA 1HMWA 3SDRA 1N7PA 1X1JA 2CQSA 1V5CA 3BS6A 4CE7A 3SQCA 4LNVA 4D4AA 1H14A 1H37A 2IEJB 3M72A 3C72B 1CEMA 2WVXA 1JYVA 1H35A 1UG9A 3I3DA 3VDAA 1FPPB 3S4AA 3HXEB 4WVBA 3BGAA 1SQCA 3EQAA 2H6IB 4MBGB 1QSJA 1O6QA 3D3IA 1NL4B 4ZRPA 2EABA 1LURA 3K25A 4FNVA 2WVXB 3DSTB 1N7RA 3OB8A 4XUVA 4TTGA 1S63B 1N7OA 5MEHA 1FT1B 4YDOB 4AQ0A 2EAEA 1L7KA 4FXGB 1JZ3A 3QT3A 2JF4A 1K1XA 1GXOA 3GT5A 2D5JA 1Z45A 3DPYB 2A8ZA 1RWAA 3A0OA 3E34B 3T0AA 1HCUA 3Q78B 1O6RA 4WVCA 3OS7A 1GXNA 1F9GA 1NKGA 3T33A 1X1IA 1GAIA 3QRYA 1N95B 2GOXA 4BZFA 3WUXA 1F9OA 1TNYB 1JZ8A 1JZ5A 1F1SA 3DYMA 3M77A 3DECA 1LXMA 2SQCA 3W7TA 4MMIA 3WC3A 4MU9A 2YIKA 2JKAA 3OEDA 3AFJA 4MMHA 1KSCA 1TNUB 1I8QA 1DCEB 3ANKA 4V1SA 3W7XA 2WYNA 1RWHA 1MMXA 2ZQ0A 4FXKB 3VD7A 4Q88A 1S64B 1N7NA 4OK4A 1IA6A 4Z4JA 3VD5A 1G9JA 3RX5A 4ONTA 3DSUB 3WFAA 2WY7A 1NSZA 1JCRB 1KFGA 1UT9A 3SFXB 4D94A 1N4RB 1O1TB 3P2CA 1JS4A 3VD3A 3Q7AB 2F6DA 5FO8B 1TXKA 3G6JB 1LXKA 2AFAA 4GTSB 3GLYA 1F4HA 2BB6A 1H36A 2I07B 3X17A 3SDVA 4BZHA 1NS7A 3D5SA 4KKIA 1O79A 3W7SA 1NSUA 1H39A 1N4QB 3ON6A 1F4AA 3W7UA 3CZJA 3QPFA 2DRRA 4GTTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FUS A;  2JJB A;  5DGR A;  1WZZ A;  1NSX A;  1K72 A;  3WKG A;  4Z4L A;  1RQ5 A;  1AGM A;  1MMZ A;  1L1Y A;  1FP3 A;  2HTA A;  4RNL A;  1GLM A;  2WW2 A;  1K1W A;  2DRO A;  2XHN A;  1V7W A;  2NVP A;  3SEP A;  4KTR A;  4AYR A;  5KKB A;  2CQT A;  1FAE A;  1GA2 A;  1G9G A;  1XWQ A;  3REN A;  1OJO A;  1DP0 A;  1NS0 A;  2XFG A;  1JZ6 A;  1JYX A;  3CIH A;  3E73 A;  1HMU A;  2E24 A;  1X9D A;  3J7H A;  1FCE A;  1OJN A;  1JYN A;  5M7I A;  2FBA A;  1NS4 A;  3MV1 1;  3VD9 A;  2OKX A;  1N7Q A;  1K1Y A;  3GZK A;  2DRS A;  1NSS A;  4DOD A;  1RWF A;  2CIQ A;  3IMH A;  2GH4 A;  1IA7 A;  3RX7 A;  3WKF A;  4TF4 A;  2BRW A;  1KKT A;  1WU6 A;  3WIR A;  3QFY A;  4TXT A;  3WIQ A;  3QDE A;  3H3K A;  3RSY A;  1L7J A;  3WIW A;  4AYP A;  4CJ0 A;  1MN0 A;  2BRP A;  1C82 A;  3T09 A;  1OJP A;  4L0G A;  1NXC A;  2WVZ A;  3MUZ 1;  1KRE A;  3OBA A;  3WKI A;  1HM3 A;  3QXF A;  1TF4 A;  3A3V A;  2FV1 A;  3RX8 A;  2AHF A;  1NSM A;  1XW2 A;  3IAP A;  1WU5 A;  1JZ4 A;  1LF9 A;  3W5M A;  1H12 A;  2RI9 A;  2JKE A;  5E2J A;  4AYQ A;  5CZL A;  3VXD A;  4JJJ A;  2GZ6 A;  1KRF A;  3E6U A;  2XSG A;  1NS8 A;  2CIS A;  2D73 A;  1RWG A;  4ZH5 A;  4EL8 A;  1XWT A;  4J5T A;  2D8L A;  2RI8 A;  1JYW A;  1H54 A;  2WW3 A;  3NJX A;  2B4F A;  4KTP A;  1RWC A;  3H2W A;  3NJV A;  4Q2B A;  4DUX A;  3NRE A;  4ZG8 A;  1F9D A;  3ACT A;  4BZE A;  1YQ2 A;  5GW7 A;  4BZG A;  3QWT A;  1NSV A;  3T0B A;  1RW9 A;  3DCD A;  1IS9 A;  3Q1N A;  1HN1 A;  1NS2 A;  2HTB A;  3ANJ A;  3QG0 A;  1CLC A;  1W3Y A;  3ANI A;  1HM2 A;  1JZ7 A;  1OJM A;  2CIR A;  1CB8 A;  3QT9 A;  1SNZ A;  1FO2 A;  2JKP A;  3VDC A;  3S4B A;  2EAC A;  1GAH A;  1WU4 A;  3S4D A;  2Z07 A;  3DYP A;  4DUW A;  2AHG A;  1DL2 A;  5GY3 A;  2BRV X;  2WDA A;  1V7X A;  2EAD A;  2WVY A;  5E1Q A;  1LOH A;  5A1A A;  1G6I A;  1YGA A;  2VN4 A;  1FBW A;  3QSP A;  1HN0 A;  1NC5 A;  2E22 A;  3E1F 1;  2ZBL A;  3EZ8 A;  3T2O A;  1KS8 A;  3VDB A;  2QNO A;  1DOG A;  1AYX A;  2FV0 A;  3T2P A;  1V5D A;  3WKH A;  4CJ1 A;  1H13 A;  3W7W A;  2WZS A;  1LF6 A;  3TF4 A;  5CD2 A;  2JG0 A;  2WW0 A;  1NSR A;  4WU0 A;  3K11 A;  3W5N A;  4L6X A;  1X1H A;  1JOV A;  3QFZ A;  3DYO A;  3MV0 1;  1V7V A;  1MMY A;  3ECQ A;  1JZ2 A;  1MMU A;  1KSD A;  4WVA A;  4DUV A;  3I3B A;  1SO0 A;  5DGQ A;  3IAQ A;  1L2A A;  2P0V A;  2WCO A;  3I3E A;  1ULV A;  2DRQ A;  5M7Y A;  3ACS A;  3RRS A;  3A24 A;  3QXQ A;  1EGU A;  2Q1F A;  1FO3 A;  3MWX A;  1KWF A;  1FMI A;  4AYO A;  2X03 A;  3PMM A;  2WW1 A;  1PX4 A;  3H7L A;  3VD4 A;  1VD5 A;  3MUY 1;  3VW5 A;  1G87 A;  2ZZR A;  3S4C A;  3T2Q A;  2RGK A;  1FBO A;  2ZXQ A;  1PX3 A;  3T0D A;  1J0N A;  3T08 A;  5CA3 A;  2FUZ A;  1J0M A;  2VN7 A;  4DOE A;  1HMW A;  1X1J A;  1N7P A;  2CQS A;  1V5C A;  4CE7 A;  1H14 A;  1CEM A;  2WVX A;  1JYV A;  1UG9 A;  3I3D A;  3VDA A;  3S4A A;  4WVB A;  3BGA A;  3EQA A;  3D3I A;  2EAB A;  1LUR A;  3K25 A;  2WVX B;  1N7R A;  3OB8 A;  4XUV A;  4TTG A;  1N7O A;  5MEH A;  2EAE A;  1L7K A;  1JZ3 A;  3QT3 A;  2JF4 A;  1K1X A;  3GT5 A;  2D5J A;  1Z45 A;  2A8Z A;  1RWA A;  3T0A A;  1HCU A;  4WVC A;  3OS7 A;  1F9G A;  1NKG A;  3T33 A;  1X1I A;  1GAI A;  3QRY A;  4BZF A;  3WUX A;  1F9O A;  1JZ8 A;  1JZ5 A;  1F1S A;  3DYM A;  3DEC A;  1LXM A;  3W7T A;  3WC3 A;  2YIK A;  2JKA A;  3AFJ A;  1KSC A;  1I8Q A;  3ANK A;  3W7X A;  2WYN A;  1RWH A;  1MMX A;  2ZQ0 A;  3VD7 A;  4Q88 A;  1N7N A;  1IA6 A;  4Z4J A;  3VD5 A;  1G9J A;  3RX5 A;  3WFA A;  1NSZ A;  1KFG A;  1UT9 A;  3P2C A;  1JS4 A;  3VD3 A;  2F6D A;  1TXK A;  1LXK A;  2AFA A;  3GLY A;  1F4H A;  3X17 A;  4BZH A;  1NS7 A;  3W7S A;  1NSU A;  3ON6 A;  1F4A A;  3W7U A;  3CZJ A;  3QPF A;  2DRR A;  4AQ0 A; 
#chains in the Genus database with same CATH topology
 3N9H A;  2G02 A;  4FUS A;  1N1Z A;  2JJB A;  1D8D B;  4QT9 A;  4D4B A;  5DGR A;  1WZZ A;  1NSX A;  3NFV A;  1K72 A;  3WKG A;  4Z4L A;  1KSI A;  1RQ5 A;  3X40 A;  1AGM A;  3PYB A;  1MMZ A;  1L1Y A;  3NNB A;  1AV4 A;  1IVW A;  1FP3 A;  1H3B A;  3S9V A;  4OK2 A;  4YCR A;  2HTA A;  4RNL A;  1GLM A;  5DHK A;  3X3Z A;  2WW2 A;  1K1W A;  2DRO A;  2XHN A;  1V7W A;  4BOK A;  2ZIR B;  2NVP A;  1HXA A;  3SEP A;  4KTR A;  3PZ4 B;  2B39 A;  3DX2 A;  4AYR A;  1X81 B;  5KKB A;  2CQT A;  1FAE A;  1HWW A;  1JCS B;  1O1R B;  5FOB B;  3E80 A;  1GA2 A;  2PNC A;  1G9G A;  1XWQ A;  3T0U A;  1OJO A;  3REN A;  4M76 A;  1H3A A;  4OJZ A;  2PN5 A;  1DP0 A;  1NS0 A;  2WIN B;  3BUP A;  2XFG A;  1JZ6 A;  1O1S B;  1JYX A;  2V3P A;  3CIH A;  4K35 A;  1LVN A;  4V1R A;  2F7P A;  3E73 A;  3M7L A;  3KSL B;  5IK6 A;  1HMU A;  5EAS A;  2E24 A;  4L9P B;  1SPU A;  1X9D A;  1LD8 B;  3J7H A;  3LVT A;  3CZN A;  3X42 A;  1FCE A;  1QWN A;  1OJN A;  1HZF A;  1N4P B;  1JYN A;  3BUI A;  4E1Y A;  2F18 A;  3NBB A;  5M7I A;  3EJS A;  1QBQ B;  2FBA A;  3OXU A;  3EU5 B;  2H6F B;  3D51 A;  1NS4 A;  2WOF A;  2WYH A;  3DX1 A;  1TNO B;  3MV1 1;  3MPH A;  1FT2 B;  3VD9 A;  3EU8 A;  3DX0 A;  3E7J A;  1N9A B;  2OKX A;  1N7Q A;  1TN7 B;  3SX1 A;  1IQY A;  4FNP A;  1K1Y A;  3GZK A;  2DRS A;  1W5Z A;  2WGQ A;  1NSS A;  4DOD A;  1W2Z A;  1RWF A;  4D4C A;  3PZ2 B;  2CIQ A;  1GHQ A;  3IMH A;  3PZ3 B;  2GH4 A;  1D6U A;  1IA7 A;  1H3C A;  4FJQ A;  1LD7 B;  1OAC A;  3BVW A;  4KFE A;  3RX7 A;  3WKF A;  4TF4 A;  3P5P A;  3D52 A;  4K3A A;  2BRW A;  1KKT A;  1WU6 A;  1W6K A;  1NI1 B;  3WIR A;  3QFY A;  4TXT A;  3WIQ A;  3QDE A;  5FO9 B;  3H3K A;  3DRA B;  3RSY A;  1L7J A;  3WIW A;  4AYP A;  4YDE B;  4CJ0 A;  1MN0 A;  4F10 A;  3TY1 A;  5IKA A;  2BRP A;  4FNR A;  2F7R A;  1C82 A;  3T09 A;  1OJP A;  3BVX A;  4L0G A;  3Q7F B;  1NXC A;  4ZRQ A;  2WVZ A;  1D6Z A;  3CU7 A;  2OOV C;  3WA3 A;  3MI6 A;  3BUD A;  4F13 A;  2ZL8 A;  2FUQ A;  1RJO A;  1SA4 B;  1HXK A;  3WVF A;  1IVU A;  2NOJ A;  3MUZ 1;  3HXB B;  1LTX B;  5FO7 B;  1KRE A;  3N0G A;  3OBA A;  3WKI A;  3KSQ B;  1HM3 A;  3QXF A;  1TF4 A;  3PGB A;  3A3V A;  4BTX A;  5IK0 A;  5DHI A;  5ILK A;  1HX9 A;  2FV1 A;  5IL8 A;  3RX8 A;  4C1S A;  1JRQ A;  1D8E B;  2AHF A;  2J5C A;  2C11 A;  1NSM A;  5JPN B;  3SDQ A;  1XW2 A;  2W0Q A;  3IAP A;  1WU5 A;  1JZ4 A;  1LF9 A;  3Q79 B;  3W5M A;  2C10 A;  1H12 A;  2RI9 A;  5JPM B;  5E2J A;  1O5M B;  2ONG A;  2JKE A;  4AYQ A;  5CZL A;  3VXD A;  3BUQ A;  1KZO B;  4JJJ A;  2GZ6 A;  3DSX B;  1KRF A;  3E6U A;  1N1B A;  4GTM B;  2XSG A;  1NS8 A;  2OQE A;  4OZW A;  3M71 A;  3DDF A;  2CIS A;  2D73 A;  4GTP B;  2ONH A;  1RWG A;  1O7D D;  5C05 A;  1EKM A;  4ZH5 A;  3LZ9 A;  1IU7 A;  4EL8 A;  1XWT A;  5EAU A;  3VSM A;  4J5T A;  2D8L A;  2RI8 A;  2F0Y B;  4BOJ A;  1WMP A;  1H54 A;  1JYW A;  3EJQ A;  2WW3 A;  4KFD A;  3NJX A;  2ALW A;  2B4F A;  4KTP A;  1RWC A;  1N94 B;  3H2W A;  1O6H A;  1TN6 B;  4Q2B A;  3NJV A;  4DUX A;  3NRE A;  1R34 A;  3CV5 A;  1TQU A;  4ZG8 A;  1SA5 B;  5JMF A;  1C3D A;  5ILZ A;  1F9D A;  3ACT A;  1PS3 A;  4EHM B;  4FNQ A;  1YQ2 A;  3HXD B;  5GW7 A;  4BZG A;  3EJU A;  4GAX A;  1TQW A;  3HIG A;  4BZE A;  3QWT A;  3BLB A;  4BTW A;  4LNG B;  4DI5 A;  2WOH A;  1NSV A;  3T0B A;  1RW9 A;  1IVX A;  3DCD A;  2V8K A;  1IS9 A;  3Q73 B;  1HN1 A;  3Q1N A;  3D5R A;  2CG1 A;  1NS2 A;  2HTB A;  1W6J A;  5ILD A;  2FUT A;  3ANJ A;  5GZK A;  1QAL A;  3KN4 A;  3VSN A;  3PZ1 B;  2BBC A;  3QG0 A;  3SAE A;  2Y73 A;  2G0D A;  1CLC A;  1W3Y A;  1HM2 A;  3ANI A;  2XWB B;  1JZ7 A;  1JCQ B;  1HV6 A;  2E2U A;  1OJM A;  3M78 A;  2CIR A;  4KKJ A;  4RNQ A;  1CB8 A;  3PYA A;  3QT9 A;  1SNZ A;  1FO2 A;  2JKP A;  3VDC A;  3S4B A;  2V8I A;  2EAC A;  2F1B A;  1GAH A;  3HI7 A;  1WU4 A;  1N4S B;  3S4D A;  2Z07 A;  2YFN A;  3DYP A;  3LOY A;  1MZC B;  4DUW A;  2AHG A;  2H6H B;  1DL2 A;  1PU4 A;  2RDY A;  5GY3 A;  2BRV X;  3SFY B;  2WDA A;  1V7X A;  5KBP A;  2EAD A;  2CFL A;  3EUV B;  4LIX A;  3NBJ A;  1W7C A;  2E2T A;  1N22 A;  5IM1 A;  2WVY A;  5E1Q A;  3BUB A;  1TQS A;  3AFL A;  1LOH A;  1QAF A;  4UFC A;  5A1A A;  1G6I A;  1YGA A;  3E32 B;  2VN4 A;  2YFO A;  3G4F A;  1FBW A;  3QSP A;  1N9E A;  1HN0 A;  2WII B;  4GTV B;  1TN8 B;  1NC5 A;  2V8J A;  2E22 A;  3E1F 1;  2V3N A;  2ZBL A;  3EZ8 A;  3T2O A;  3SDT A;  3BVU A;  1HXC A;  1KS8 A;  3HXF B;  3VDB A;  2QNO A;  1DOG A;  1AYX A;  3M02 A;  3DSW B;  1WMO A;  2FV0 A;  3T2P A;  2Y74 A;  4GTR B;  1V5D A;  3WKH A;  4CJ1 A;  1H13 A;  3W7W A;  2WO0 A;  1QAZ A;  2WZS A;  1LF6 A;  5ILY A;  3TF4 A;  5CD2 A;  1GXM A;  2JG0 A;  3M7C A;  3ALA A;  2WW0 A;  1NSR A;  3M01 A;  1SII A;  2BT3 A;  4WU0 A;  3K11 A;  3W5N A;  4L6X A;  3DX3 A;  1X1H A;  3M7B A;  3SDU A;  1JOV A;  2OOV A;  4KFF A;  3QFZ A;  1QWU A;  3DYO A;  3MV0 1;  3D50 A;  1N21 A;  1V7V A;  3BLC A;  1SIH A;  1MMY A;  4LNB B;  1N20 A;  5AGD A;  3ECQ A;  3BVT A;  1R76 A;  1JZ2 A;  4BTY A;  1AVL A;  4GTQ B;  2OW7 A;  1MMU A;  1KSD A;  1UMP A;  3DSS B;  5EAT A;  4WVA A;  3M74 A;  4DUV A;  1QAK A;  5IK9 A;  4GL3 A;  3I3B A;  1SO0 A;  5ILH A;  3DSV B;  1TQV A;  1DYU A;  5DGQ A;  2ZIS B;  3EJP A;  1L2A A;  2P0V A;  2WCO A;  3I3E A;  1ULV A;  3IAQ A;  4ZH1 A;  2YX9 A;  1TNZ B;  3P5R A;  3KQ4 A;  2DRQ A;  2R2L B;  5M7Y A;  3ACS A;  3RRS A;  3A24 A;  3M7E A;  1W6G A;  1KZP B;  3D4Y A;  3QXQ A;  1EGU A;  2Q1F A;  1GSZ A;  2XQW A;  1FO3 A;  3X3Y A;  3N0F A;  3MWX A;  1KWF A;  1FMI A;  2X03 A;  4AYO A;  3K7X A;  3PMM A;  4EV5 A;  2WY8 A;  2WW1 A;  2CWT A;  1PX4 A;  2XWJ B;  3H7L A;  3VD4 A;  2A73 B;  1VD5 A;  3MUY 1;  3VW5 A;  5ILJ A;  1G87 A;  1N24 A;  3K5T A;  2H6G B;  1A2V A;  2ZZR A;  3S4C A;  3E37 B;  5JMD A;  3T2Q A;  2RGK A;  2OW6 A;  1TNB B;  3E30 B;  1FBO A;  3RJ3 A;  2BB5 A;  4GTO B;  3E33 B;  2BED B;  2PMV A;  4NEI A;  2ZXQ A;  1PX3 A;  1UI7 A;  3T0D A;  3HXC B;  1J0N A;  3M76 A;  3M73 A;  4OZV A;  3T08 A;  5CA3 A;  1IVV A;  2FUZ A;  3Q75 B;  1WMN A;  3M00 A;  1J0M A;  3M75 A;  4FNT A;  2VN7 A;  4D4D A;  4DOE A;  3KLS A;  3X41 A;  1HMW A;  1X1J A;  1N7P A;  3SDR A;  2CQS A;  1V5C A;  3BS6 A;  4CE7 A;  3SXX A;  3SQC A;  4LNV A;  4D4A A;  1H14 A;  1H37 A;  2IEJ B;  3M72 A;  3C72 B;  1CEM A;  2WVX A;  1JYV A;  3X3X A;  1H35 A;  1UG9 A;  5IKH A;  3I3D A;  1FPP B;  3VDA A;  3S4A A;  2E2V A;  1HXG A;  3HXE B;  4WVB A;  3AMO A;  3BGA A;  1SQC A;  3EQA A;  2H6I B;  3DX4 A;  4MBG B;  1W4N A;  1TU5 A;  1QSJ A;  1O6Q A;  3D3I A;  1NL4 B;  4ZRP A;  2EAB A;  1LUR A;  3K25 A;  4FNV A;  2CFG A;  2WVX B;  3DST B;  1N7R A;  3OB8 A;  4XUV A;  5IL3 A;  1US1 A;  4TTG A;  3AMO B;  1S63 B;  3QPF A;  1N7O A;  5ILI A;  2XN1 A;  5MEH A;  1FT1 B;  4YDO B;  4AQ0 A;  2EAE A;  1L7K A;  4FXG B;  1JZ3 A;  3QT3 A;  2JF4 A;  2D1W A;  1RKY A;  1K1X A;  1GXO A;  3GT5 A;  2D5J A;  1Z45 A;  3HII A;  3DPY B;  1RWA A;  2A8Z A;  3A0O A;  1AVK A;  3E34 B;  3T0A A;  1HCU A;  3Q78 B;  1O6R A;  4WVC A;  3OS7 A;  1GXN A;  3G4D A;  1F9G A;  1NKG A;  1X1I A;  3T33 A;  2CFW A;  1GAI A;  3QRY A;  1N95 B;  2GOX A;  3CZS A;  3EJR A;  3WUX A;  4BZF A;  1F9O A;  1TNY B;  1JZ8 A;  2CG0 A;  1JZ5 A;  1F1S A;  3DYM A;  4EV2 A;  3M77 A;  3DEC A;  1LXM A;  1D6Y A;  2SQC A;  3W7T A;  4FNS A;  4MMI A;  3KII A;  3WC3 A;  2CWU A;  4MU9 A;  2YIK A;  2JKA A;  3OED A;  3AFJ A;  2FYV A;  4MMH A;  1N23 A;  1KSC A;  1TNU B;  1W6C A;  1I8Q A;  1DCE B;  3ANK A;  4V1S A;  3W7X A;  3EJT A;  2WYN A;  1RWH A;  1HTY A;  1MMX A;  4FXK B;  2F7O A;  2ZQ0 A;  3VD7 A;  4Q88 A;  1S64 B;  2XN0 A;  1N7N A;  4OK4 A;  1IA6 A;  4Z4J A;  2F1A A;  3VD5 A;  1G9J A;  3BVV A;  3RX5 A;  4ONT A;  1UI8 A;  3DSU B;  2WYI A;  2WY7 A;  1NSZ A;  3WFA A;  1JCR B;  1KFG A;  1UT9 A;  3SFX B;  4D94 A;  2XN2 A;  4FNU A;  1N4R B;  1O1T B;  3P2C A;  1JS4 A;  1R33 A;  3VD3 A;  2CWV A;  3Q7A B;  2F6D A;  5FO8 B;  1TXK A;  2CFD A;  3G6J B;  1LXK A;  2AFA A;  4GTS B;  3GLY A;  1F4H A;  2BB6 A;  1TQT A;  3WA2 X;  1H36 A;  2CFK A;  2I07 B;  3X17 A;  1IQX A;  3SDV A;  4BZH A;  1NS7 A;  2OQE C;  3D5S A;  4KKI A;  1O79 A;  3W7S A;  3D4Z A;  3DDG A;  1NSU A;  1H39 A;  1N4Q B;  3ON6 A;  1F4A A;  3W7U A;  2F7Q A;  3CZJ A;  1QQF A;  2DRR A;  4GTT B;  1QX1 A; 
#chains in the Genus database with same CATH homology
 2G02 A;  4FUS A;  2JJB A;  1D8D B;  4QT9 A;  4D4B A;  5DGR A;  1WZZ A;  1NSX A;  1K72 A;  3WKG A;  4Z4L A;  1RQ5 A;  1AGM A;  3PYB A;  1MMZ A;  1L1Y A;  1FP3 A;  1H3B A;  3S9V A;  4YCR A;  2HTA A;  4OK2 A;  4RNL A;  1GLM A;  2WW2 A;  1K1W A;  2DRO A;  2XHN A;  1V7W A;  4BOK A;  2ZIR B;  2NVP A;  3SEP A;  4KTR A;  3PZ4 B;  2B39 A;  4AYR A;  1X81 B;  5KKB A;  2CQT A;  1FAE A;  1JCS B;  1O1R B;  5FOB B;  3E80 A;  1GA2 A;  1G9G A;  1XWQ A;  3REN A;  1OJO A;  4M76 A;  1H3A A;  4OJZ A;  2PN5 A;  1DP0 A;  1NS0 A;  2WIN B;  2XFG A;  1JZ6 A;  1O1S B;  1JYX A;  2V3P A;  3CIH A;  4V1R A;  3E73 A;  3M7L A;  3KSL B;  1HMU A;  4L9P B;  2E24 A;  1X9D A;  1LD8 B;  3J7H A;  1FCE A;  1OJN A;  1N4P B;  1HZF A;  1JYN A;  5M7I A;  1QBQ B;  2FBA A;  3OXU A;  3EU5 B;  2H6F B;  1NS4 A;  1TNO B;  3MV1 1;  1FT2 B;  3VD9 A;  3EU8 A;  3E7J A;  1N9A B;  2OKX A;  1N7Q A;  1TN7 B;  1K1Y A;  3GZK A;  2DRS A;  1NSS A;  4DOD A;  1RWF A;  4D4C A;  3PZ2 B;  2CIQ A;  1QQF A;  1GHQ A;  3IMH A;  3PZ3 B;  2GH4 A;  1IA7 A;  1H3C A;  1LD7 B;  3RX7 A;  3WKF A;  4TF4 A;  3P5P A;  2BRW A;  1KKT A;  1WU6 A;  1W6K A;  1NI1 B;  3WIR A;  3QFY A;  4TXT A;  3WIQ A;  3QDE A;  5FO9 B;  3H3K A;  3DRA B;  3RSY A;  1L7J A;  3WIW A;  4AYP A;  4YDE B;  4CJ0 A;  1MN0 A;  3TY1 A;  2BRP A;  1C82 A;  3T09 A;  1OJP A;  4L0G A;  3Q7F B;  1NXC A;  4ZRQ A;  2WVZ A;  3CU7 A;  2FUQ A;  1SA4 B;  3WVF A;  2NOJ A;  3MUZ 1;  3HXB B;  1LTX B;  5FO7 B;  1KRE A;  3OBA A;  3WKI A;  3KSQ B;  1HM3 A;  3QXF A;  1TF4 A;  3A3V A;  2FV1 A;  3RX8 A;  4C1S A;  1D8E B;  2AHF A;  1NSM A;  5JPN B;  3SDQ A;  1XW2 A;  3IAP A;  1WU5 A;  1JZ4 A;  1LF9 A;  3Q79 B;  3W5M A;  1H12 A;  2RI9 A;  5JPM B;  5E2J A;  1O5M B;  2JKE A;  4AYQ A;  5CZL A;  3VXD A;  1KZO B;  4JJJ A;  2GZ6 A;  3DSX B;  1KRF A;  3E6U A;  4GTM B;  2XSG A;  1NS8 A;  3M71 A;  2CIS A;  2D73 A;  4GTP B;  1RWG A;  4ZH5 A;  4EL8 A;  1XWT A;  4BOJ A;  3VSM A;  4J5T A;  2D8L A;  2RI8 A;  2F0Y B;  1JYW A;  1H54 A;  2WW3 A;  3NJX A;  2B4F A;  4KTP A;  1RWC A;  1N94 B;  3H2W A;  1O6H A;  1TN6 B;  4Q2B A;  3NJV A;  4DUX A;  3NRE A;  4ZG8 A;  1SA5 B;  5JMF A;  1C3D A;  1F9D A;  3ACT A;  4EHM B;  4BZE A;  1YQ2 A;  3HXD B;  5GW7 A;  4BZG A;  3QWT A;  4LNG B;  1NSV A;  3T0B A;  1RW9 A;  3DCD A;  2V8K A;  1IS9 A;  3Q73 B;  1HN1 A;  3Q1N A;  3D5R A;  1NS2 A;  2HTB A;  1W6J A;  2FUT A;  3ANJ A;  5GZK A;  3VSN A;  3PZ1 B;  2BBC A;  3QG0 A;  3SAE A;  2G0D A;  1CLC A;  1W3Y A;  3ANI A;  1HM2 A;  2XWB B;  1JZ7 A;  1JCQ B;  3M78 A;  1OJM A;  2CIR A;  4KKJ A;  3PYA A;  1CB8 A;  3QT9 A;  1SNZ A;  1FO2 A;  2JKP A;  3VDC A;  3S4B A;  2V8I A;  2EAC A;  1GAH A;  1WU4 A;  1N4S B;  3S4D A;  2Z07 A;  3DYP A;  1MZC B;  4DUW A;  2AHG A;  2H6H B;  1DL2 A;  5GY3 A;  2BRV X;  3SFY B;  2WDA A;  1V7X A;  2EAD A;  3EUV B;  4LIX A;  2WVY A;  5E1Q A;  3AFL A;  1LOH A;  5A1A A;  1G6I A;  1YGA A;  3E32 B;  2VN4 A;  1FBW A;  3QSP A;  1HN0 A;  2WII B;  4GTV B;  1TN8 B;  1NC5 A;  2V8J A;  2E22 A;  3E1F 1;  2V3N A;  2ZBL A;  3EZ8 A;  3T2O A;  3SDT A;  1KS8 A;  3HXF B;  3VDB A;  2QNO A;  1DOG A;  1AYX A;  3DSW B;  2FV0 A;  3T2P A;  4GTR B;  1V5D A;  3WKH A;  4CJ1 A;  1H13 A;  3W7W A;  2WZS A;  1LF6 A;  3TF4 A;  5CD2 A;  1GXM A;  2JG0 A;  3M7C A;  2WW0 A;  1NSR A;  4WU0 A;  3K11 A;  3W5N A;  4L6X A;  3M7B A;  1X1H A;  3SDU A;  1JOV A;  3QFZ A;  3DYO A;  3MV0 1;  1V7V A;  3BLC A;  1MMY A;  4LNB B;  5AGD A;  3ECQ A;  1R76 A;  1JZ2 A;  4GTQ B;  1MMU A;  1KSD A;  1UMP A;  3DSS B;  4WVA A;  3M74 A;  4DUV A;  4GL3 A;  3I3B A;  1SO0 A;  3DSV B;  5DGQ A;  2ZIS B;  3IAQ A;  1L2A A;  2P0V A;  2WCO A;  3I3E A;  1ULV A;  4ZH1 A;  1TNZ B;  3P5R A;  3KQ4 A;  2DRQ A;  2R2L B;  5M7Y A;  3ACS A;  3RRS A;  3A24 A;  3M7E A;  1KZP B;  3QXQ A;  1EGU A;  2XQW A;  1GSZ A;  2Q1F A;  1FO3 A;  3MWX A;  1KWF A;  1FMI A;  4AYO A;  2X03 A;  3K7X A;  3PMM A;  2WY8 A;  2WW1 A;  1PX4 A;  2XWJ B;  3H7L A;  3VD4 A;  2A73 B;  1VD5 A;  3MUY 1;  3VW5 A;  1G87 A;  2H6G B;  2ZZR A;  3S4C A;  3E37 B;  3T2Q A;  5JMD A;  2RGK A;  1TNB B;  3E30 B;  1FBO A;  3RJ3 A;  2BB5 A;  4GTO B;  3E33 B;  2BED B;  2PMV A;  4NEI A;  2ZXQ A;  1PX3 A;  3T0D A;  3HXC B;  3M76 A;  3M73 A;  1J0N A;  3T08 A;  5CA3 A;  2FUZ A;  3Q75 B;  1J0M A;  3M75 A;  2VN7 A;  4D4D A;  4DOE A;  3KLS A;  1HMW A;  3SDR A;  1N7P A;  1X1J A;  2CQS A;  1V5C A;  3BS6 A;  4CE7 A;  3SQC A;  4LNV A;  4D4A A;  1H14 A;  1H37 A;  2IEJ B;  3M72 A;  3C72 B;  1CEM A;  2WVX A;  1JYV A;  1H35 A;  1UG9 A;  3I3D A;  3VDA A;  1FPP B;  3S4A A;  3HXE B;  4WVB A;  3BGA A;  1SQC A;  3EQA A;  2H6I B;  4MBG B;  1QSJ A;  1O6Q A;  3D3I A;  1NL4 B;  4ZRP A;  2EAB A;  1LUR A;  3K25 A;  4FNV A;  2WVX B;  3DST B;  1N7R A;  3OB8 A;  4XUV A;  4TTG A;  1S63 B;  1N7O A;  5MEH A;  1FT1 B;  4YDO B;  4AQ0 A;  2EAE A;  1L7K A;  4FXG B;  1JZ3 A;  3QT3 A;  2JF4 A;  1K1X A;  1GXO A;  3GT5 A;  2D5J A;  1Z45 A;  3DPY B;  2A8Z A;  1RWA A;  3A0O A;  3E34 B;  3T0A A;  1HCU A;  3Q78 B;  1O6R A;  4WVC A;  3OS7 A;  1GXN A;  1F9G A;  1NKG A;  3T33 A;  1X1I A;  1GAI A;  3QRY A;  1N95 B;  2GOX A;  4BZF A;  3WUX A;  1F9O A;  1TNY B;  1JZ8 A;  1JZ5 A;  1F1S A;  3DYM A;  3M77 A;  3DEC A;  1LXM A;  2SQC A;  3W7T A;  4MMI A;  3WC3 A;  4MU9 A;  2YIK A;  2JKA A;  3OED A;  3AFJ A;  4MMH A;  1KSC A;  1TNU B;  1I8Q A;  1DCE B;  3ANK A;  4V1S A;  3W7X A;  2WYN A;  1RWH A;  1MMX A;  2ZQ0 A;  4FXK B;  3VD7 A;  4Q88 A;  1S64 B;  1N7N A;  4OK4 A;  1IA6 A;  4Z4J A;  3VD5 A;  1G9J A;  3RX5 A;  4ONT A;  3DSU B;  3WFA A;  2WY7 A;  1NSZ A;  1JCR B;  1KFG A;  1UT9 A;  3SFX B;  4D94 A;  1N4R B;  1O1T B;  3P2C A;  1JS4 A;  3VD3 A;  3Q7A B;  2F6D A;  5FO8 B;  1TXK A;  3G6J B;  1LXK A;  2AFA A;  4GTS B;  3GLY A;  1F4H A;  2BB6 A;  1H36 A;  2I07 B;  3X17 A;  3SDV A;  4BZH A;  1NS7 A;  3D5S A;  4KKI A;  1O79 A;  3W7S A;  1NSU A;  1H39 A;  1N4Q B;  3ON6 A;  1F4A A;  3W7U A;  3CZJ A;  3QPF A;  2DRR A;  4GTT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...