1LF6A

Crystal structure of bacterial glucoamylase
Total Genus 242
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
242
sequence length
674
structure length
674
Chain Sequence
b'SIKIDRFNNISAVNGPGEEDTWASAQKQGVGTANNYVSKVWFTLANGAISEVYYPTIDTADVKEIKFIVTDGKSFVPDETKDAISKVEKFTDKSLGYKLVNTDKKGRYRITKDIFTDVKRNSLIMKAKFEALEGSIHDYKLYLAYDPHIKNQGSYNEGYVIKANNNEMLMAKRDNVYTALSSNIGWKGYSIGYYKVNDIMTDLDENKQMTKHYDSARGNIIEGAEIDLTKNSEFEIVLSFGQSDSEAAKTALETLGEDYNNLKNNYIDEWTKYCNTLNNFNGKANSLYYNSMMILKASEDKTNKGAYIASLSIPWGDGQRDDNTGGYHLVWSRDLYHVANAFIAAGDVDSANRSLDYLAKVVKDNGMIPQNTWISGKPYWTGIQLDEQADPIILSYRLKRYDLYDSLVKPLADFIIKIGPKTGQERWEEIGGYSPATMAAEVAGLTCAAYIAEQNKDYESAQKYQEKADNWQKLIDNLTYTENGPLGNGQYYIRIAGLSDPDADFMINIANGGGVYDQKEIVDPSFLELVRLGVKSADDPKILNTLKVVDSTIKVDTPKGPSWYRYNHDGYGEPSKTELYHGAGKGRLWPLLTGERGMYEIAAGKDATPYVKAMEKFANEGGIISEQVWEDTGLPTDSASPLNWAHAEYVILFASNIEHKVLDMPDIVYKRYVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords glucoamylase
publication title Crystal structure and evolution of prokaryotic glucoamylase
pubmed doi rcsb
molecule tags Hydrolase
total genus 242
structure length 674
sequence length 674
chains with identical sequence B
ec nomenclature ec 3.2.1.3: Glucan 1,4-alpha-glucosidase.
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00723 Glyco_hydro_15 Glycosyl hydrolases family 15
A PF09137 Glucodextran_N Glucodextranase, domain N
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1lf6A02
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1lf6A01
3ANJA 1WU6A 1CEMA 1FAEA 3QFZA 1FMIA 1NC5A 1K72A 2D73A 3T2OA 2JKEA 1N7NA 3A3VA 5CD2A 3ON6A 1N7OA 3GT5A 2VN4A 1NSXA 1F4HA 1LURA 2WVXA 1V7XA 2XFGA 3S4AA 1NXCA 5M7IA 4ZH5A 5GW7A 3OB8A 3T0BA 2EABA 4L6XA 2CQSA 2CIRA 1NS4A 1JS4A 3RENA 4TXTA 4TF4A 4AYQA 1JYWA 1NKGA 2HTAA 2GH4A 1OJPA 5CA3A 4Z4JA 2BRPA 2RI8A 1IA6A 1ULVA 1XW2A 1J0NA 1FBWA 2FUZA 1H12A 3VDAA 2WZSA 3ECQA 1GA2A 1KWFA 3IAQA 1MMUA 1H54A 1J0MA 2JKAA 3I3BA 5M7YA 3MV01 1KSDA 3QT3A 4FUSA 3VXDA 3ANKA 1N7PA 1HN1A 2ZBLA 1KKTA 5KKBA 2EACA 1HN0A 3P2CA 2ZZRA 1OJNA 1LF6A 2Q1FA 2WVXB 3WUXA 1TF4A 1F4AA 4CJ0A 1JZ3A 3BGAA 1X9DA 5DGQA 2AFAA 3WKFA 1K1WA 1LOHA 4AYOA 3DYMA 3PMMA 1NS8A 2YIKA 1F9GA 3T0AA 2BRVX 2A8ZA 1C82A 1NSRA 3ANIA 1NS7A 1K1YA 3WFAA 1WU4A 2B4FA 3AFJA 1XWTA 3T33A 3VDCA 3T0DA 1Z45A 1CB8A 2CISA 1L2AA 1JYNA 1HMWA 1N7RA 3VD5A 5E2JA 1WU5A 4L0GA 1YQ2A 1NSUA 1X1IA 3OS7A 1F1SA 1UT9A 3W7WA 3WKGA 3W5NA 2Z07A 3OBAA 1G9GA 1OJMA 1V5DA 1HCUA 3SEPA 2CQTA 3QRYA 2D8LA 3W7UA 3H7LA 2AHFA 1GLMA 1FO3A 1V7VA 3WIQA 2ZQ0A 1H13A 2JKPA 3E73A 2WVZA 3IMHA 2WDAA 4AYPA 1RWHA 1NS2A 2P0VA 1SO0A 1HMUA 3T09A 4DOEA 3RRSA 2GZ6A 4BZEA 5CZLA 1MMXA 1DOGA 2WW1A 4Q2BA 3RX5A 1JOVA 1FO2A 1IS9A 1AGMA 3VD3A 1G9JA 1JZ4A 3ACTA 3S4CA 4RNLA 3VD9A 1UG9A 3CIHA 1PX3A 1I8QA 4BZHA 1DP0A 3T2PA 2F6DA 3ACSA 4DUWA 1V7WA 4XUVA 3DYPA 1FBOA 2DRSA 5MEHA 4EL8A 4DUXA 2WYNA 3QPFA 1KREA 3WC3A 3T2QA 3T08A 1VD5A 1GAIA 2CIQA 1KRFA 4J5TA 3K11A 4WVBA 4ZG8A 3MUZ1 1RW9A 2X03A 1JZ2A 2VN7A 4AYRA 3QDEA 1EGUA 1G6IA 2JJBA 2OKXA 3NJXA 1F9DA 1TXKA 1NSMA 3MUY1 3K25A 1RWFA 4DUVA 3H2WA 3E1F1 2FV0A 1L7JA 1NSVA 4WVAA 2WVYA 3CZJA 1MMYA 1AYXA 1N7QA 1HM3A 2E24A 3E6UA 3H3KA 2WW2A 1NSZA 1KSCA 1RWCA 1JYXA 2D5JA 1GAHA 1FCEA 3VDBA 1YGAA 4AQ0A 3WIRA 1KFGA 1WZZA 3I3DA 3D3IA 3W7TA 3RX8A 1XWQA 4KTRA 4Q88A 3EQAA 1NS0A 1JZ8A 3VD4A 2EADA 3J7HA 3QSPA 3W7SA 2XHNA 2E22A 2DRRA 1L1YA 4Z4LA 3DECA 3IAPA 3I3EA 3DYOA 1W3YA 2QNOA 3W5MA 1OJOA 2RI9A 2DRQA 3A24A 4TTGA 5A1AA 1IA7A 4CE7A 4BZFA 1KS8A 1F9OA 3VD7A 3GZKA 1LXMA 1RQ5A 3MWXA 3S4DA 3QG0A 2FV1A 2XSGA 1MN0A 4JJJA 1LF9A 4CJ1A 1HM2A 4BZGA 3QWTA 3WKIA 1X1JA 1SNZA 1JZ5A 1PX4A 2WW3A 5E1QA 3WKHA 1DL2A 3TF4A 1JYVA 5DGRA 2RGKA 2WCOA 1L7KA 4KTPA 3WIWA 1LXKA 3VW5A 4WU0A 5GY3A 3MV11 3W7XA 2BRWA 3X17A 1RWGA 3QXQA 4DODA 1G87A 2JF4A 3QT9A 2WW0A 3RSYA 1H14A 2EAEA 3QXFA 1RWAA 1CLCA 3GLYA 3EZ8A 2JG0A 3S4BA 1K1XA 2AHGA 1FP3A 2DROA 2FBAA 3NREA 1X1HA 1JZ7A 3NJVA 1NSSA 1MMZA 3RX7A 2ZXQA 1JZ6A 3QFYA 3Q1NA 4WVCA 1V5CA 2NVPA 2HTBA 3DCDA
chains in the Genus database with same CATH superfamily
3ANJA 1WU6A 1CEMA 1FAEA 3QFZA 4YDEB 3CZSA 1FMIA 2CWVA 1NC5A 1K72A 3SX1A 4QT9A 2BB6A 2D73A 3T2OA 2ZIRB 4D4DA 1HWWA 2JKEA 1N7NA 3A3VA 3DSSB 5CD2A 1WMOA 3ON6A 3KIIA 1N7OA 3GT5A 1FPPB 2VN4A 1NSXA 3D50A 1F4HA 1AVLA 3M72A 1LURA 1V7XA 2WVXA 3BVTA 3KLSA 2XFGA 3S4AA 1NXCA 2NOJA 2WY7A 5M7IA 4FNPA 5JPNB 4FNSA 1H39A 5FO7B 3D5RA 1H3BA 4GTQB 1RJOA 4GTOB 1N24A 4ZH5A 2FYVA 5GW7A 3BUIA 4D4CA 3OB8A 3T0BA 2EABA 4L6XA 1N4RB 2YFOA 2CQSA 2CIRA 1NS4A 1JS4A 3RENA 4KFEA 1TQSA 4TXTA 4TF4A 4AYQA 3D52A 2ZISB 3PZ2B 1JYWA 1NKGA 4ZRPA 3M78A 1WMNA 1OJPA 2GH4A 2HTAA 5CA3A 4EV5A 2BRPA 4Z4JA 2RI8A 3EU5B 2SQCA 5ILYA 1IA6A 3BUQA 4BOKA 5FO8B 1ULVA 1XW2A 1J0NA 2CFKA 1W5ZA 3VSMA 3G6JB 1TU5A 2H6GB 1FBWA 1O1TB 4C1SA 1N95B 2FUZA 1H12A 4OZWA 3VDAA 5DHKA 2WZSA 2Y74A 3ECQA 1GA2A 1KWFA 2CFWA 3IAQA 1MMUA 1H54A 1J0MA 1TQUA 3EJSA 3DSXB 1H37A 2F0YB 1H3CA 1WMPA 2JKAA 3DDGA 3I3BA 5M7YA 5ILIA 1TNOB 3MV01 1KSDA 3M00A 1PS3A 3QT3A 4FUSA 3VXDA 3ANKA 1A2VA 1N7PA 2WYHA 1HN1A 2ZBLA 3AFLA 4GTSB 1DYUA 2RDYA 1KKTA 5KKBA 2PMVA 2EACA 1HN0A 3P2CA 4OK4A 2ZZRA 1OJNA 1LF6A 2Q1FA 1N94B 2WVXB 3WUXA 1TF4A 1F4AA 4CJ0A 2WOHA 4RNQA 3X3XA 1N23A 1JZ3A 3BGAA 1X9DA 3Q7AB 5DGQA 3E30B 3M71A 2AFAA 3WKFA 1IVVA 1K1WA 3RJ3A 1LOHA 4AYOA 3DYMA 3PMMA 1NS8A 2YIKA 3BUPA 1F9GA 1OACA 2BRVX 4KFDA 2A8ZA 3T0AA 2A73B 4LNBB 1C82A 1NSRA 2OOVC 3ANIA 1NS7A 2ONHA 1K1YA 2F1BA 3WFAA 1WU4A 4D4BA 3EUVB 3WVFA 5IL8A 3D4ZA 4FJQA 4V1RA 5ILZA 1W7CA 1LD7B 2B4FA 3Q78B 3BVVA 3AFJA 1XWTA 3T33A 3VDCA 4BTWA 3T0DA 3NBJA 1Z45A 1CB8A 3HXDB 1QALA 2J5CA 4D94A 1O1RB 1FT1B 3SDRA 4EHMB 4MMHA 2CISA 1L2AA 1JYNA 1HTYA 1HMWA 4LNGB 1R33A 1N7RA 3VD5A 3ALAA 5E2JA 2OQEA 1S64B 1H35A 1GXOA 1QWNA 1N4SB 1W2ZA 1WU5A 4L0GA 1O7DD 1YQ2A 3M7CA 4LIXA 1RKYA 2XWBB 3EU8A 1NSUA 1X1IA 3LOYA 3OS7A 1F1SA 1UT9A 3W7WA 3WKGA 3W5NA 1SIIA 2Z07A 2WY8A 1G9GA 1OJMA 3OBAA 3SAEA 1V5DA 4GL3A 3CZNA 1HCUA 3SEPA 1SA5B 1UI7A 2CQTA 3D4YA 2GOXA 3QRYA 4F13A 2D8LA 5ILKA 3W7UA 2H6HB 2F7OA 5EAUA 3H7LA 2C10A 3G4FA 2WO0A 3BVXA 4K35A 5EASA 2W0QA 2ZL8A 3DPYB 2PN5A 4NEIA 3DSWB 4MU9A 1GLMA 2AHFA 4FNUA 1FO3A 1V7VA 1KZPB 3WIQA 2ZQ0A 1H13A 3CU7A 1W6JA 3X3YA 2JKPA 3E73A 2WVZA 1N4PB 3IMHA 2WDAA 3BS6A 4AYPA 1RWHA 3AMOA 1NS2A 3Q75B 2F1AA 2P0VA 3N0GA 1DCEB 2V8IA 2BT3A 3PZ4B 3BLBA 3M02A 3SDVA 1HXCA 2OOVA 1SO0A 2CWTA 4EV2A 5GZKA 1HMUA 3T09A 4DOEA 2Y73A 3RRSA 3SDQA 3C72B 2GZ6A 3N0FA 3KSQB 3D5SA 1MZCB 4BZEA 5CZLA 3BVWA 3HXFB 1MMXA 1DOGA 4GTPB 2YX9A 2BB5A 2WW1A 1LVNA 3E37B 1TNYB 2WIIB 3P5RA 4Q2BA 1FO2A 3RX5A 1JOVA 3E33B 1IS9A 2F7RA 1AGMA 4E1YA 3X41A 3VD3A 2YFNA 1G9JA 3PZ3B 1JZ4A 1GXNA 3PZ1B 3ACTA 3S4CA 5JMFA 3X42A 3EJQA 4BOJA 4RNLA 4GTTB 3VD9A 5C05A 1UG9A 3CIHA 3K7XA 3X40A 2OW6A 1D8DB 4OK2A 1QBQB 1PX3A 1I8QA 4BTYA 3SFXB 4BZHA 1KZOB 5IK9A 1DP0A 3T2PA 2F6DA 3Q73B 5IM1A 3ACSA 1N9AB 2XWJB 4DUWA 1GXMA 1R76A 1V7WA 4OZVA 2H6IB 4XUVA 2WINB 3DYPA 2WYIA 1FBOA 1LD8B 1H36A 2DRSA 5MEHA 2WGQA 4EL8A 5JPMB 4DUXA 2WYNA 2XN1A 3QPFA 1KREA 5IKHA 3E7JA 3LZ9A 2E2UA 3BUDA 3WC3A 2IEJB 3T2QA 3T08A 1VD5A 1LTXB 1N1BA 1GAIA 2G0DA 1KRFA 3PYBA 1W6CA 2CIQA 4ONTA 3Q79B 4J5TA 3K11A 4WVBA 3AMOB 3EJPA 1GSZA 4ZG8A 2OW7A 3MUZ1 5IL3A 1RW9A 2X03A 1JZ2A 3SQCA 3NBBA 2VN7A 3M74A 4AYRA 3KQ4A 1W6GA 4GAXA 3QDEA 3M7EA 3HIGA 1EGUA 1G6IA 1TNUB 2JJBA 4LNVA 1US1A 2XN0A 3DX4A 2OKXA 3NJXA 2V3PA 4ZH1A 1F9DA 1N1ZA 1IVXA 3X3ZA 2V8KA 3NNBA 1TXKA 1IVWA 1JCQB 2F7PA 1NSMA 1QSJA 4UFCA 3MUY1 4F10A 3K25A 1RWFA 3MI6A 1D6YA 3H2WA 3E1F1 3EJUA 4DUVA 4L9PB 2FV0A 3OXUA 2FUQA 4KKJA 2I07B 3D51A 1L7JA 1NSVA 2R2LB 2ONGA 3P5PA 2BBCA 3SFYB 3T0UA 4WVAA 1QWUA 5DHIA 1UI8A 1O6QA 4GTRB 2WVYA 4FNQA 3CZJA 1MMYA 1AYXA 1N7QA 2CG1A 1HM3A 2E24A 3LVTA 1O1SB 2CFGA 1IQYA 4FXKB 5ILJA 1PU4A 1TNBB 3E6UA 4BTXA 3H3KA 2FUTA 2E2TA 1SQCA 5IKAA 2WW2A 1N9EA 4FNRA 4V1SA 4YDOB 1NSZA 4FXGB 3M77A 1TQVA 1GHQA 1HV6A 1KSCA 1RWCA 3KSLB 4DI5A 1QAFA 1JYXA 1O6RA 2D5JA 1GAHA 3HI7A 1FCEA 3VDBA 5IK0A 3K5TA 1YGAA 4AQ0A 3HXEB 3WIRA 1KFGA 1WZZA 3I3DA 4FNVA 3D3IA 3W7TA 3DX2A 3RX8A 5IK6A 1XWQA 4KTRA 3E34B 4Q88A 3DX3A 3EQAA 1NS0A 3HXBB 1D8EB 1JZ8A 1D6ZA 3VD4A 2EADA 3J7HA 3QSPA 3EJRA 3W7SA 2XHNA 2E22A 2DRRA 5FOBB 2BEDB 3HXCB 1L1YA 5ILDA 4GTVB 4Z4LA 3DECA 3IAPA 3WA2X 2ALWA 4OJZA 3I3EA 1TQTA 2F18A 2D1WA 3DYOA 1W3YA 1IU7A 3BVUA 1TNZB 3CV5A 3Q7FB 1QAZA 2QNOA 3W5MA 1QQFA 1OJOA 2RI9A 5FO9B 4GTMB 1W4NA 2V3NA 2DRQA 1SIHA 2C11A 3A24A 4TTGA 1TN6B 5A1AA 2PNCA 1C3DA 1IA7A 4CE7A 4BZFA 1KS8A 1F9OA 1JCSB 1W6KA 1X81B 3VD7A 3GZKA 1HXGA 3M75A 3SDUA 1HXKA 1LXMA 1RQ5A 3S9VA 1AV4A 2OQEC 3MWXA 4KFFA 3S4DA 3QG0A 2FV1A 1R34A 2XSGA 1HXAA 1MN0A 4JJJA 1LF9A 1HM2A 4CJ1A 5JMDA 4K3AA 3TY1A 3QWTA 2B39A 1X1JA 3WKIA 1SNZA 4BZGA 1JZ5A 1PX4A 4YCRA 3MPHA 2WW3A 1NI1B 5E1QA 3WKHA 1DL2A 3M01A 3TF4A 1JYVA 2CFLA 5DGRA 2RGKA 3M7LA 2WCOA 1S63B 4KTPA 3WIWA 1L7KA 1LXKA 1SA4B 3BUBA 3E80A 1IQXA 3OEDA 1TQWA 3VW5A 1O6HA 4WU0A 3M7BA 3BLCA 5GY3A 3MV11 3N9HA 3W7XA 1N4QB 2BRWA 3VSNA 1RWGA 1O5MB 3X17A 3QXQA 2E2VA 3G4DA 4D4AA 4DODA 1HX9A 2CFDA 1G87A 5EATA 1H3AA 3PGBA 1FT2B 2JF4A 1NL4B 3QT9A 3KN4A 2H6FB 1TN8B 2WW0A 1D6UA 3RSYA 1H14A 2CG0A 2WOFA 2EAEA 3QXFA 3PYAA 1RWAA 1N21A 1CLCA 3GLYA 3EZ8A 3DX1A 3NFVA 2XN2A 3DSVB 2JG0A 1HZFA 3S4BA 1KSIA 5AGDA 1K1XA 1FP3A 2AHGA 1JRQA 1IVUA 1JCRB 3SDTA 2DROA 2FBAA 3NREA 3DSTB 4FNTA 1X1HA 1JZ7A 4M76A 1O79A 3A0OA 3DSUB 4MMIA 5ILHA 3EJTA 1UMPA 3NJVA 2XQWA 1NSSA 5KBPA 1MMZA 1QAKA 4KKIA 3WA3A 1QX1A 2G02A 1N22A 4ZRQA 3M73A 2F7QA 3RX7A 2ZXQA 1TN7B 1EKMA 1N20A 1SPUA 1JZ6A 3QFYA 3Q1NA 4WVCA 3HIIA 3M76A 3SXXA 3DDFA 1V5CA 2V8JA 3DRAB 4MBGB 3DX0A 3E32B 2NVPA 2HTBA 2CWUA 3DCDA 1AVKA
chains in the Genus database with same CATH topology
3ANJA 1WU6A 1CEMA 1FAEA 3QFZA 4YDEB 1FMIA 1NC5A 1K72A 4QT9A 2BB6A 2D73A 3T2OA 2ZIRB 4D4DA 2JKEA 1N7NA 3A3VA 3DSSB 5CD2A 3ON6A 1N7OA 3GT5A 1FPPB 2VN4A 1NSXA 1F4HA 3M72A 1LURA 1V7XA 2WVXA 3KLSA 2XFGA 3S4AA 1NXCA 2NOJA 2WY7A 5M7IA 5JPNB 1H39A 5FO7B 3D5RA 1H3BA 4GTQB 4GTOB 4ZH5A 5GW7A 4D4CA 3OB8A 3T0BA 2EABA 4L6XA 1N4RB 2CQSA 2CIRA 1NS4A 1JS4A 3RENA 4TXTA 4TF4A 4AYQA 2ZISB 3PZ2B 1JYWA 1NKGA 4ZRPA 3M78A 2HTAA 2GH4A 1OJPA 5CA3A 4Z4JA 2BRPA 2RI8A 3EU5B 2SQCA 1IA6A 4BOKA 5FO8B 1ULVA 1XW2A 1J0NA 3VSMA 3G6JB 2H6GB 1FBWA 1O1TB 4C1SA 1N95B 2FUZA 1H12A 3VDAA 2WZSA 3ECQA 1GA2A 1KWFA 3IAQA 1MMUA 1H54A 1J0MA 3DSXB 1H37A 2F0YB 1H3CA 2JKAA 3I3BA 5M7YA 3MV01 1TNOB 1KSDA 3QT3A 4FUSA 3VXDA 3ANKA 1N7PA 1HN1A 2ZBLA 3AFLA 4GTSB 1KKTA 5KKBA 2PMVA 2EACA 1HN0A 3P2CA 4OK4A 2ZZRA 1OJNA 1LF6A 2Q1FA 1N94B 2WVXB 3WUXA 1TF4A 1F4AA 4CJ0A 1JZ3A 3BGAA 1X9DA 3Q7AB 5DGQA 3E30B 3M71A 2AFAA 3WKFA 1K1WA 3RJ3A 1LOHA 4AYOA 3DYMA 3PMMA 1NS8A 2YIKA 1F9GA 3T0AA 2BRVX 2A8ZA 2A73B 4LNBB 1C82A 1NSRA 3ANIA 1NS7A 1K1YA 3WFAA 1WU4A 4D4BA 3EUVB 3WVFA 4V1RA 1LD7B 2B4FA 3Q78B 3AFJA 1XWTA 3T33A 3VDCA 3T0DA 1Z45A 3HXDB 1CB8A 4D94A 1O1RB 1FT1B 3SDRA 4EHMB 4MMHA 2CISA 1L2AA 1JYNA 1HMWA 4LNGB 1N7RA 3VD5A 5E2JA 1S64B 1H35A 1GXOA 1N4SB 1WU5A 4L0GA 1YQ2A 3M7CA 4LIXA 2XWBB 3EU8A 1NSUA 1X1IA 3OS7A 1F1SA 1UT9A 3W7WA 3WKGA 3W5NA 2Z07A 2WY8A 1G9GA 1OJMA 3OBAA 3SAEA 1V5DA 4GL3A 1HCUA 3SEPA 1SA5B 2CQTA 2GOXA 3QRYA 2D8LA 3W7UA 2H6HB 3H7LA 3DPYB 2PN5A 4NEIA 3DSWB 4MU9A 1GLMA 2AHFA 1FO3A 1V7VA 1KZPB 3WIQA 2ZQ0A 1H13A 3CU7A 1W6JA 2JKPA 3E73A 2WVZA 1N4PB 3IMHA 2WDAA 3BS6A 4AYPA 1RWHA 1NS2A 3Q75B 2P0VA 1DCEB 2V8IA 3PZ4B 3SDVA 1SO0A 5GZKA 1HMUA 3T09A 4DOEA 3RRSA 3SDQA 3C72B 2GZ6A 3KSQB 3D5SA 1MZCB 4BZEA 5CZLA 3HXFB 1MMXA 1DOGA 4GTPB 2BB5A 2WW1A 3E37B 1TNYB 2WIIB 3P5RA 4Q2BA 1FO2A 3RX5A 1JOVA 3E33B 1IS9A 1AGMA 3VD3A 1G9JA 3PZ3B 1JZ4A 1GXNA 3PZ1B 3ACTA 3S4CA 5JMFA 4BOJA 4RNLA 4GTTB 3VD9A 1UG9A 3CIHA 3K7XA 1D8DB 4OK2A 1QBQB 1PX3A 1I8QA 3SFXB 4BZHA 1KZOB 1DP0A 3T2PA 2F6DA 3Q73B 3ACSA 1N9AB 2XWJB 4DUWA 1GXMA 1R76A 1V7WA 2H6IB 4XUVA 2WINB 3DYPA 1FBOA 1LD8B 1H36A 2DRSA 5MEHA 4EL8A 5JPMB 4DUXA 2WYNA 3QPFA 1KREA 3E7JA 3WC3A 2IEJB 3T2QA 3T08A 1VD5A 1LTXB 2G0DA 1GAIA 3PYBA 1KRFA 2CIQA 4ONTA 3Q79B 4J5TA 3K11A 4WVBA 1GSZA 4ZG8A 3MUZ1 1RW9A 2X03A 1JZ2A 3SQCA 2VN7A 3M74A 4AYRA 3KQ4A 3QDEA 3M7EA 1EGUA 1G6IA 1TNUB 2JJBA 4LNVA 2OKXA 3NJXA 2V3PA 4ZH1A 1F9DA 2V8KA 1TXKA 1JCQB 1NSMA 1QSJA 3MUY1 3K25A 1RWFA 4DUVA 3H2WA 3E1F1 4L9PB 2FV0A 3OXUA 2FUQA 4KKJA 2I07B 1L7JA 1NSVA 2R2LB 3P5PA 2BBCA 3SFYB 4WVAA 2WVYA 1O6QA 4GTRB 3CZJA 1MMYA 1AYXA 1N7QA 1HM3A 2E24A 1O1SB 4FXKB 1TNBB 3E6UA 3H3KA 2FUTA 1SQCA 2WW2A 4V1SA 4YDOB 1NSZA 4FXGB 3M77A 1GHQA 1KSCA 1RWCA 3KSLB 1JYXA 1O6RA 2D5JA 1GAHA 1FCEA 3VDBA 1YGAA 4AQ0A 3HXEB 3WIRA 1KFGA 1WZZA 3I3DA 4FNVA 3D3IA 3W7TA 3RX8A 1XWQA 4KTRA 3E34B 4Q88A 3EQAA 1NS0A 3HXBB 1D8EB 1JZ8A 3VD4A 2EADA 3J7HA 3QSPA 3W7SA 2XHNA 2E22A 2DRRA 5FOBB 2BEDB 3HXCB 1L1YA 4GTVB 4Z4LA 3DECA 3IAPA 3I3EA 4OJZA 3DYOA 1W3YA 1TNZB 3Q7FB 2QNOA 3W5MA 1QQFA 1OJOA 2RI9A 5FO9B 4GTMB 2V3NA 2DRQA 3A24A 4TTGA 1TN6B 5A1AA 1C3DA 1IA7A 4CE7A 4BZFA 1KS8A 1F9OA 1JCSB 1W6KA 1X81B 3VD7A 3GZKA 3M75A 3SDUA 1LXMA 1RQ5A 3S9VA 3MWXA 3S4DA 3QG0A 2FV1A 2XSGA 1MN0A 4JJJA 1LF9A 4CJ1A 1HM2A 4BZGA 5JMDA 3TY1A 3QWTA 2B39A 3WKIA 1SNZA 1X1JA 1JZ5A 1PX4A 4YCRA 2WW3A 1NI1B 5E1QA 3WKHA 1DL2A 3TF4A 1JYVA 5DGRA 2RGKA 3M7LA 2WCOA 1S63B 4KTPA 3WIWA 1L7KA 1LXKA 1SA4B 3E80A 3OEDA 3VW5A 1O6HA 4WU0A 3M7BA 3BLCA 5GY3A 3MV11 3W7XA 1N4QB 2BRWA 3X17A 1RWGA 1O5MB 3VSNA 3QXQA 4D4AA 4DODA 1G87A 1H3AA 1FT2B 2JF4A 1NL4B 3QT9A 2H6FB 1TN8B 2WW0A 3RSYA 1H14A 2EAEA 3QXFA 3PYAA 1RWAA 1CLCA 3GLYA 3EZ8A 3DSVB 2JG0A 1HZFA 3S4BA 5AGDA 1K1XA 1FP3A 2AHGA 1JCRB 3SDTA 2DROA 2FBAA 3NREA 3DSTB 1X1HA 1JZ7A 4M76A 1O79A 3DSUB 3A0OA 4MMIA 1UMPA 3NJVA 2XQWA 1NSSA 1MMZA 4KKIA 2G02A 4ZRQA 3M73A 3RX7A 2ZXQA 1TN7B 1JZ6A 3QFYA 3Q1NA 4WVCA 3M76A 1V5CA 2V8JA 3DRAB 4MBGB 3E32B 2NVPA 2HTBA 3DCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ANJ A;  1WU6 A;  1CEM A;  1FAE A;  3QFZ A;  1FMI A;  1NC5 A;  1K72 A;  2D73 A;  3T2O A;  2JKE A;  1N7N A;  3A3V A;  5CD2 A;  3ON6 A;  1N7O A;  3GT5 A;  2VN4 A;  1NSX A;  1F4H A;  1LUR A;  2WVX A;  1V7X A;  2XFG A;  3S4A A;  1NXC A;  5M7I A;  4ZH5 A;  5GW7 A;  3OB8 A;  3T0B A;  2EAB A;  4L6X A;  2CQS A;  2CIR A;  1NS4 A;  1JS4 A;  3REN A;  4TXT A;  4TF4 A;  4AYQ A;  1JYW A;  1NKG A;  2HTA A;  2GH4 A;  1OJP A;  5CA3 A;  4Z4J A;  2BRP A;  2RI8 A;  1IA6 A;  1ULV A;  1XW2 A;  1J0N A;  1FBW A;  2FUZ A;  1H12 A;  3VDA A;  2WZS A;  3ECQ A;  1GA2 A;  1KWF A;  3IAQ A;  1MMU A;  1H54 A;  1J0M A;  2JKA A;  3I3B A;  5M7Y A;  3MV0 1;  1KSD A;  3QT3 A;  4FUS A;  3VXD A;  3ANK A;  1N7P A;  1HN1 A;  2ZBL A;  1KKT A;  5KKB A;  2EAC A;  1HN0 A;  3P2C A;  2ZZR A;  1OJN A;  1LF6 A;  2Q1F A;  2WVX B;  3WUX A;  1TF4 A;  1F4A A;  4CJ0 A;  1JZ3 A;  3BGA A;  1X9D A;  5DGQ A;  2AFA A;  3WKF A;  1K1W A;  1LOH A;  4AYO A;  3DYM A;  3PMM A;  1NS8 A;  2YIK A;  1F9G A;  3T0A A;  2BRV X;  2A8Z A;  1C82 A;  1NSR A;  3ANI A;  1NS7 A;  1K1Y A;  3WFA A;  1WU4 A;  2B4F A;  3AFJ A;  1XWT A;  3T33 A;  3VDC A;  3T0D A;  1Z45 A;  1CB8 A;  2CIS A;  1L2A A;  1JYN A;  1HMW A;  1N7R A;  3VD5 A;  5E2J A;  1WU5 A;  4L0G A;  1YQ2 A;  1NSU A;  1X1I A;  3OS7 A;  1F1S A;  1UT9 A;  3W7W A;  3WKG A;  3W5N A;  2Z07 A;  3OBA A;  1G9G A;  1OJM A;  1V5D A;  1HCU A;  3SEP A;  2CQT A;  3QRY A;  2D8L A;  3W7U A;  3H7L A;  2AHF A;  1GLM A;  1FO3 A;  1V7V A;  3WIQ A;  2ZQ0 A;  1H13 A;  2JKP A;  3E73 A;  2WVZ A;  3IMH A;  2WDA A;  4AYP A;  1RWH A;  1NS2 A;  2P0V A;  1SO0 A;  1HMU A;  3T09 A;  4DOE A;  3RRS A;  2GZ6 A;  4BZE A;  5CZL A;  1MMX A;  1DOG A;  2WW1 A;  4Q2B A;  3RX5 A;  1JOV A;  1FO2 A;  1IS9 A;  1AGM A;  3VD3 A;  1G9J A;  1JZ4 A;  3ACT A;  3S4C A;  4RNL A;  3VD9 A;  1UG9 A;  3CIH A;  1PX3 A;  1I8Q A;  4BZH A;  1DP0 A;  3T2P A;  2F6D A;  3ACS A;  4DUW A;  1V7W A;  4XUV A;  3DYP A;  1FBO A;  2DRS A;  5MEH A;  4EL8 A;  4DUX A;  2WYN A;  3QPF A;  1KRE A;  3WC3 A;  3T2Q A;  3T08 A;  1VD5 A;  1GAI A;  2CIQ A;  1KRF A;  4J5T A;  3K11 A;  4WVB A;  4ZG8 A;  3MUZ 1;  1RW9 A;  2X03 A;  1JZ2 A;  2VN7 A;  4AYR A;  3QDE A;  1EGU A;  1G6I A;  2JJB A;  2OKX A;  3NJX A;  1F9D A;  1TXK A;  1NSM A;  3MUY 1;  3K25 A;  1RWF A;  4DUV A;  3H2W A;  3E1F 1;  2FV0 A;  1L7J A;  1NSV A;  4WVA A;  2WVY A;  3CZJ A;  1MMY A;  1AYX A;  1N7Q A;  1HM3 A;  2E24 A;  3E6U A;  3H3K A;  2WW2 A;  1NSZ A;  1KSC A;  1RWC A;  1JYX A;  2D5J A;  1GAH A;  1FCE A;  3VDB A;  1YGA A;  4AQ0 A;  3WIR A;  1KFG A;  1WZZ A;  3I3D A;  3D3I A;  3W7T A;  3RX8 A;  1XWQ A;  4KTR A;  4Q88 A;  3EQA A;  1NS0 A;  1JZ8 A;  3VD4 A;  2EAD A;  3J7H A;  3QSP A;  3W7S A;  2XHN A;  2E22 A;  2DRR A;  1L1Y A;  4Z4L A;  3DEC A;  3IAP A;  3I3E A;  3DYO A;  1W3Y A;  2QNO A;  3W5M A;  1OJO A;  2RI9 A;  2DRQ A;  3A24 A;  4TTG A;  5A1A A;  1IA7 A;  4CE7 A;  4BZF A;  1KS8 A;  1F9O A;  3VD7 A;  3GZK A;  1LXM A;  1RQ5 A;  3MWX A;  3S4D A;  3QG0 A;  2FV1 A;  2XSG A;  1MN0 A;  4JJJ A;  1LF9 A;  4CJ1 A;  1HM2 A;  4BZG A;  3QWT A;  3WKI A;  1X1J A;  1SNZ A;  1JZ5 A;  1PX4 A;  2WW3 A;  5E1Q A;  3WKH A;  1DL2 A;  3TF4 A;  1JYV A;  5DGR A;  2RGK A;  2WCO A;  1L7K A;  4KTP A;  3WIW A;  1LXK A;  3VW5 A;  4WU0 A;  5GY3 A;  3MV1 1;  3W7X A;  2BRW A;  3X17 A;  1RWG A;  3QXQ A;  4DOD A;  1G87 A;  2JF4 A;  3QT9 A;  2WW0 A;  3RSY A;  1H14 A;  2EAE A;  3QXF A;  1RWA A;  1CLC A;  3GLY A;  3EZ8 A;  2JG0 A;  3S4B A;  1K1X A;  2AHG A;  1FP3 A;  2DRO A;  2FBA A;  3NRE A;  1X1H A;  1JZ7 A;  3NJV A;  1NSS A;  1MMZ A;  3RX7 A;  2ZXQ A;  1JZ6 A;  3QFY A;  3Q1N A;  4WVC A;  1V5C A;  2NVP A;  2HTB A;  3DCD A; 
#chains in the Genus database with same CATH topology
 3ANJ A;  1WU6 A;  1CEM A;  1FAE A;  3QFZ A;  4YDE B;  3CZS A;  1FMI A;  2CWV A;  1NC5 A;  1K72 A;  3SX1 A;  4QT9 A;  2BB6 A;  2D73 A;  3T2O A;  2ZIR B;  4D4D A;  1HWW A;  2JKE A;  1N7N A;  3A3V A;  3DSS B;  5CD2 A;  1WMO A;  3ON6 A;  3KII A;  1N7O A;  3GT5 A;  1FPP B;  2VN4 A;  1NSX A;  3D50 A;  1F4H A;  1AVL A;  3M72 A;  1LUR A;  1V7X A;  2WVX A;  3BVT A;  3KLS A;  2XFG A;  3S4A A;  1NXC A;  2NOJ A;  2WY7 A;  5M7I A;  4FNP A;  5JPN B;  4FNS A;  1H39 A;  5FO7 B;  3D5R A;  1H3B A;  4GTQ B;  1RJO A;  4GTO B;  1N24 A;  4ZH5 A;  2FYV A;  5GW7 A;  3BUI A;  4D4C A;  3OB8 A;  3T0B A;  2EAB A;  4L6X A;  1N4R B;  2YFO A;  2CQS A;  2CIR A;  1NS4 A;  1JS4 A;  3REN A;  4KFE A;  1TQS A;  4TXT A;  4TF4 A;  4AYQ A;  3D52 A;  2ZIS B;  3PZ2 B;  1JYW A;  1NKG A;  4ZRP A;  3M78 A;  1WMN A;  1OJP A;  2GH4 A;  2HTA A;  5CA3 A;  4EV5 A;  2BRP A;  4Z4J A;  2RI8 A;  3EU5 B;  2SQC A;  5ILY A;  1IA6 A;  3BUQ A;  4BOK A;  5FO8 B;  1ULV A;  1XW2 A;  1J0N A;  2CFK A;  1W5Z A;  3VSM A;  3G6J B;  1TU5 A;  2H6G B;  1FBW A;  1O1T B;  4C1S A;  1N95 B;  2FUZ A;  1H12 A;  4OZW A;  3VDA A;  5DHK A;  2WZS A;  2Y74 A;  3ECQ A;  1GA2 A;  1KWF A;  2CFW A;  3IAQ A;  1MMU A;  1H54 A;  1J0M A;  1TQU A;  3EJS A;  3DSX B;  1H37 A;  2F0Y B;  1H3C A;  1WMP A;  2JKA A;  3DDG A;  3I3B A;  5M7Y A;  5ILI A;  1TNO B;  3MV0 1;  1KSD A;  3M00 A;  1PS3 A;  3QT3 A;  4FUS A;  3VXD A;  3ANK A;  1A2V A;  1N7P A;  2WYH A;  1HN1 A;  2ZBL A;  3AFL A;  4GTS B;  1DYU A;  2RDY A;  1KKT A;  5KKB A;  2PMV A;  2EAC A;  1HN0 A;  3P2C A;  4OK4 A;  2ZZR A;  1OJN A;  1LF6 A;  2Q1F A;  1N94 B;  2WVX B;  3WUX A;  1TF4 A;  1F4A A;  4CJ0 A;  2WOH A;  4RNQ A;  3X3X A;  1N23 A;  1JZ3 A;  3BGA A;  1X9D A;  3Q7A B;  5DGQ A;  3E30 B;  3M71 A;  2AFA A;  3WKF A;  1IVV A;  1K1W A;  3RJ3 A;  1LOH A;  4AYO A;  3DYM A;  3PMM A;  1NS8 A;  2YIK A;  3BUP A;  1F9G A;  1OAC A;  2BRV X;  4KFD A;  2A8Z A;  3T0A A;  2A73 B;  4LNB B;  1C82 A;  1NSR A;  2OOV C;  3ANI A;  1NS7 A;  2ONH A;  1K1Y A;  2F1B A;  3WFA A;  1WU4 A;  4D4B A;  3EUV B;  3WVF A;  5IL8 A;  3D4Z A;  4FJQ A;  4V1R A;  5ILZ A;  1W7C A;  1LD7 B;  2B4F A;  3Q78 B;  3BVV A;  3AFJ A;  1XWT A;  3T33 A;  3VDC A;  4BTW A;  3T0D A;  3NBJ A;  1Z45 A;  1CB8 A;  3HXD B;  1QAL A;  2J5C A;  4D94 A;  1O1R B;  1FT1 B;  3SDR A;  4EHM B;  4MMH A;  2CIS A;  1L2A A;  1JYN A;  1HTY A;  1HMW A;  4LNG B;  1R33 A;  1N7R A;  3VD5 A;  3ALA A;  5E2J A;  2OQE A;  1S64 B;  1H35 A;  1GXO A;  1QWN A;  1N4S B;  1W2Z A;  1WU5 A;  4L0G A;  1O7D D;  1YQ2 A;  3M7C A;  4LIX A;  1RKY A;  2XWB B;  3EU8 A;  1NSU A;  1X1I A;  3LOY A;  3OS7 A;  1F1S A;  1UT9 A;  3W7W A;  3WKG A;  3W5N A;  1SII A;  2Z07 A;  2WY8 A;  1G9G A;  1OJM A;  3OBA A;  3SAE A;  1V5D A;  4GL3 A;  3CZN A;  1HCU A;  3SEP A;  1SA5 B;  1UI7 A;  2CQT A;  3D4Y A;  2GOX A;  3QRY A;  4F13 A;  2D8L A;  5ILK A;  3W7U A;  2H6H B;  2F7O A;  5EAU A;  3H7L A;  2C10 A;  3G4F A;  2WO0 A;  3BVX A;  4K35 A;  5EAS A;  2W0Q A;  2ZL8 A;  3DPY B;  2PN5 A;  4NEI A;  3DSW B;  4MU9 A;  1GLM A;  2AHF A;  4FNU A;  1FO3 A;  1V7V A;  1KZP B;  3WIQ A;  2ZQ0 A;  1H13 A;  3CU7 A;  1W6J A;  3X3Y A;  2JKP A;  3E73 A;  2WVZ A;  1N4P B;  3IMH A;  2WDA A;  3BS6 A;  4AYP A;  1RWH A;  3AMO A;  1NS2 A;  3Q75 B;  2F1A A;  2P0V A;  3N0G A;  1DCE B;  2V8I A;  2BT3 A;  3PZ4 B;  3BLB A;  3M02 A;  3SDV A;  1HXC A;  2OOV A;  1SO0 A;  2CWT A;  4EV2 A;  5GZK A;  1HMU A;  3T09 A;  4DOE A;  2Y73 A;  3RRS A;  3SDQ A;  3C72 B;  2GZ6 A;  3N0F A;  3KSQ B;  3D5S A;  1MZC B;  4BZE A;  5CZL A;  3BVW A;  3HXF B;  1MMX A;  1DOG A;  4GTP B;  2YX9 A;  2BB5 A;  2WW1 A;  1LVN A;  3E37 B;  1TNY B;  2WII B;  3P5R A;  4Q2B A;  1FO2 A;  3RX5 A;  1JOV A;  3E33 B;  1IS9 A;  2F7R A;  1AGM A;  4E1Y A;  3X41 A;  3VD3 A;  2YFN A;  1G9J A;  3PZ3 B;  1JZ4 A;  1GXN A;  3PZ1 B;  3ACT A;  3S4C A;  5JMF A;  3X42 A;  3EJQ A;  4BOJ A;  4RNL A;  4GTT B;  3VD9 A;  5C05 A;  1UG9 A;  3CIH A;  3K7X A;  3X40 A;  2OW6 A;  1D8D B;  4OK2 A;  1QBQ B;  1PX3 A;  1I8Q A;  4BTY A;  3SFX B;  4BZH A;  1KZO B;  5IK9 A;  1DP0 A;  3T2P A;  2F6D A;  3Q73 B;  5IM1 A;  3ACS A;  1N9A B;  2XWJ B;  4DUW A;  1GXM A;  1R76 A;  1V7W A;  4OZV A;  2H6I B;  4XUV A;  2WIN B;  3DYP A;  2WYI A;  1FBO A;  1LD8 B;  1H36 A;  2DRS A;  5MEH A;  2WGQ A;  4EL8 A;  5JPM B;  4DUX A;  2WYN A;  2XN1 A;  3QPF A;  1KRE A;  5IKH A;  3E7J A;  3LZ9 A;  2E2U A;  3BUD A;  3WC3 A;  2IEJ B;  3T2Q A;  3T08 A;  1VD5 A;  1LTX B;  1N1B A;  1GAI A;  2G0D A;  1KRF A;  3PYB A;  1W6C A;  2CIQ A;  4ONT A;  3Q79 B;  4J5T A;  3K11 A;  4WVB A;  3AMO B;  3EJP A;  1GSZ A;  4ZG8 A;  2OW7 A;  3MUZ 1;  5IL3 A;  1RW9 A;  2X03 A;  1JZ2 A;  3SQC A;  3NBB A;  2VN7 A;  3M74 A;  4AYR A;  3KQ4 A;  1W6G A;  4GAX A;  3QDE A;  3M7E A;  3HIG A;  1EGU A;  1G6I A;  1TNU B;  2JJB A;  4LNV A;  1US1 A;  2XN0 A;  3DX4 A;  2OKX A;  3NJX A;  2V3P A;  4ZH1 A;  1F9D A;  1N1Z A;  1IVX A;  3X3Z A;  2V8K A;  3NNB A;  1TXK A;  1IVW A;  1JCQ B;  2F7P A;  1NSM A;  1QSJ A;  4UFC A;  3MUY 1;  4F10 A;  3K25 A;  1RWF A;  3MI6 A;  1D6Y A;  3H2W A;  3E1F 1;  3EJU A;  4DUV A;  4L9P B;  2FV0 A;  3OXU A;  2FUQ A;  4KKJ A;  2I07 B;  3D51 A;  1L7J A;  1NSV A;  2R2L B;  2ONG A;  3P5P A;  2BBC A;  3SFY B;  3T0U A;  4WVA A;  1QWU A;  5DHI A;  1UI8 A;  1O6Q A;  4GTR B;  2WVY A;  4FNQ A;  3CZJ A;  1MMY A;  1AYX A;  1N7Q A;  2CG1 A;  1HM3 A;  2E24 A;  3LVT A;  1O1S B;  2CFG A;  1IQY A;  4FXK B;  5ILJ A;  1PU4 A;  1TNB B;  3E6U A;  4BTX A;  3H3K A;  2FUT A;  2E2T A;  1SQC A;  5IKA A;  2WW2 A;  1N9E A;  4FNR A;  4V1S A;  4YDO B;  1NSZ A;  4FXG B;  3M77 A;  1TQV A;  1GHQ A;  1HV6 A;  1KSC A;  1RWC A;  3KSL B;  4DI5 A;  1QAF A;  1JYX A;  1O6R A;  2D5J A;  1GAH A;  3HI7 A;  1FCE A;  3VDB A;  5IK0 A;  3K5T A;  1YGA A;  4AQ0 A;  3HXE B;  3WIR A;  1KFG A;  1WZZ A;  3I3D A;  4FNV A;  3D3I A;  3W7T A;  3DX2 A;  3RX8 A;  5IK6 A;  1XWQ A;  4KTR A;  3E34 B;  4Q88 A;  3DX3 A;  3EQA A;  1NS0 A;  3HXB B;  1D8E B;  1JZ8 A;  1D6Z A;  3VD4 A;  2EAD A;  3J7H A;  3QSP A;  3EJR A;  3W7S A;  2XHN A;  2E22 A;  2DRR A;  5FOB B;  2BED B;  3HXC B;  1L1Y A;  5ILD A;  4GTV B;  4Z4L A;  3DEC A;  3IAP A;  3WA2 X;  2ALW A;  4OJZ A;  3I3E A;  1TQT A;  2F18 A;  2D1W A;  3DYO A;  1W3Y A;  1IU7 A;  3BVU A;  1TNZ B;  3CV5 A;  3Q7F B;  1QAZ A;  2QNO A;  3W5M A;  1QQF A;  1OJO A;  2RI9 A;  5FO9 B;  4GTM B;  1W4N A;  2V3N A;  2DRQ A;  1SIH A;  2C11 A;  3A24 A;  4TTG A;  1TN6 B;  5A1A A;  2PNC A;  1C3D A;  1IA7 A;  4CE7 A;  4BZF A;  1KS8 A;  1F9O A;  1JCS B;  1W6K A;  1X81 B;  3VD7 A;  3GZK A;  1HXG A;  3M75 A;  3SDU A;  1HXK A;  1LXM A;  1RQ5 A;  3S9V A;  1AV4 A;  2OQE C;  3MWX A;  4KFF A;  3S4D A;  3QG0 A;  2FV1 A;  1R34 A;  2XSG A;  1HXA A;  1MN0 A;  4JJJ A;  1LF9 A;  1HM2 A;  4CJ1 A;  5JMD A;  4K3A A;  3TY1 A;  3QWT A;  2B39 A;  1X1J A;  3WKI A;  1SNZ A;  4BZG A;  1JZ5 A;  1PX4 A;  4YCR A;  3MPH A;  2WW3 A;  1NI1 B;  5E1Q A;  3WKH A;  1DL2 A;  3M01 A;  3TF4 A;  1JYV A;  2CFL A;  5DGR A;  2RGK A;  3M7L A;  2WCO A;  1S63 B;  4KTP A;  3WIW A;  1L7K A;  1LXK A;  1SA4 B;  3BUB A;  3E80 A;  1IQX A;  3OED A;  1TQW A;  3VW5 A;  1O6H A;  4WU0 A;  3M7B A;  3BLC A;  5GY3 A;  3MV1 1;  3N9H A;  3W7X A;  1N4Q B;  2BRW A;  3VSN A;  1RWG A;  1O5M B;  3X17 A;  3QXQ A;  2E2V A;  3G4D A;  4D4A A;  4DOD A;  1HX9 A;  2CFD A;  1G87 A;  5EAT A;  1H3A A;  3PGB A;  1FT2 B;  2JF4 A;  1NL4 B;  3QT9 A;  3KN4 A;  2H6F B;  1TN8 B;  2WW0 A;  1D6U A;  3RSY A;  1H14 A;  2CG0 A;  2WOF A;  2EAE A;  3QXF A;  3PYA A;  1RWA A;  1N21 A;  1CLC A;  3GLY A;  3EZ8 A;  3DX1 A;  3NFV A;  2XN2 A;  3DSV B;  2JG0 A;  1HZF A;  3S4B A;  1KSI A;  5AGD A;  1K1X A;  1FP3 A;  2AHG A;  1JRQ A;  1IVU A;  1JCR B;  3SDT A;  2DRO A;  2FBA A;  3NRE A;  3DST B;  4FNT A;  1X1H A;  1JZ7 A;  4M76 A;  1O79 A;  3A0O A;  3DSU B;  4MMI A;  5ILH A;  3EJT A;  1UMP A;  3NJV A;  2XQW A;  1NSS A;  5KBP A;  1MMZ A;  1QAK A;  4KKI A;  3WA3 A;  1QX1 A;  2G02 A;  1N22 A;  4ZRQ A;  3M73 A;  2F7Q A;  3RX7 A;  2ZXQ A;  1TN7 B;  1EKM A;  1N20 A;  1SPU A;  1JZ6 A;  3QFY A;  3Q1N A;  4WVC A;  3HII A;  3M76 A;  3SXX A;  3DDF A;  1V5C A;  2V8J A;  3DRA B;  4MBG B;  3DX0 A;  3E32 B;  2NVP A;  2HTB A;  2CWU A;  3DCD A;  1AVK A; 
#chains in the Genus database with same CATH homology
 3ANJ A;  1WU6 A;  1CEM A;  1FAE A;  3QFZ A;  4YDE B;  1FMI A;  1NC5 A;  1K72 A;  4QT9 A;  2BB6 A;  2D73 A;  3T2O A;  2ZIR B;  4D4D A;  2JKE A;  1N7N A;  3A3V A;  3DSS B;  5CD2 A;  3ON6 A;  1N7O A;  3GT5 A;  1FPP B;  2VN4 A;  1NSX A;  1F4H A;  3M72 A;  1LUR A;  1V7X A;  2WVX A;  3KLS A;  2XFG A;  3S4A A;  1NXC A;  2NOJ A;  2WY7 A;  5M7I A;  5JPN B;  1H39 A;  5FO7 B;  3D5R A;  1H3B A;  4GTQ B;  4GTO B;  4ZH5 A;  5GW7 A;  4D4C A;  3OB8 A;  3T0B A;  2EAB A;  4L6X A;  1N4R B;  2CQS A;  2CIR A;  1NS4 A;  1JS4 A;  3REN A;  4TXT A;  4TF4 A;  4AYQ A;  2ZIS B;  3PZ2 B;  1JYW A;  1NKG A;  4ZRP A;  3M78 A;  2HTA A;  2GH4 A;  1OJP A;  5CA3 A;  4Z4J A;  2BRP A;  2RI8 A;  3EU5 B;  2SQC A;  1IA6 A;  4BOK A;  5FO8 B;  1ULV A;  1XW2 A;  1J0N A;  3VSM A;  3G6J B;  2H6G B;  1FBW A;  1O1T B;  4C1S A;  1N95 B;  2FUZ A;  1H12 A;  3VDA A;  2WZS A;  3ECQ A;  1GA2 A;  1KWF A;  3IAQ A;  1MMU A;  1H54 A;  1J0M A;  3DSX B;  1H37 A;  2F0Y B;  1H3C A;  2JKA A;  3I3B A;  5M7Y A;  3MV0 1;  1TNO B;  1KSD A;  3QT3 A;  4FUS A;  3VXD A;  3ANK A;  1N7P A;  1HN1 A;  2ZBL A;  3AFL A;  4GTS B;  1KKT A;  5KKB A;  2PMV A;  2EAC A;  1HN0 A;  3P2C A;  4OK4 A;  2ZZR A;  1OJN A;  1LF6 A;  2Q1F A;  1N94 B;  2WVX B;  3WUX A;  1TF4 A;  1F4A A;  4CJ0 A;  1JZ3 A;  3BGA A;  1X9D A;  3Q7A B;  5DGQ A;  3E30 B;  3M71 A;  2AFA A;  3WKF A;  1K1W A;  3RJ3 A;  1LOH A;  4AYO A;  3DYM A;  3PMM A;  1NS8 A;  2YIK A;  1F9G A;  3T0A A;  2BRV X;  2A8Z A;  2A73 B;  4LNB B;  1C82 A;  1NSR A;  3ANI A;  1NS7 A;  1K1Y A;  3WFA A;  1WU4 A;  4D4B A;  3EUV B;  3WVF A;  4V1R A;  1LD7 B;  2B4F A;  3Q78 B;  3AFJ A;  1XWT A;  3T33 A;  3VDC A;  3T0D A;  1Z45 A;  3HXD B;  1CB8 A;  4D94 A;  1O1R B;  1FT1 B;  3SDR A;  4EHM B;  4MMH A;  2CIS A;  1L2A A;  1JYN A;  1HMW A;  4LNG B;  1N7R A;  3VD5 A;  5E2J A;  1S64 B;  1H35 A;  1GXO A;  1N4S B;  1WU5 A;  4L0G A;  1YQ2 A;  3M7C A;  4LIX A;  2XWB B;  3EU8 A;  1NSU A;  1X1I A;  3OS7 A;  1F1S A;  1UT9 A;  3W7W A;  3WKG A;  3W5N A;  2Z07 A;  2WY8 A;  1G9G A;  1OJM A;  3OBA A;  3SAE A;  1V5D A;  4GL3 A;  1HCU A;  3SEP A;  1SA5 B;  2CQT A;  2GOX A;  3QRY A;  2D8L A;  3W7U A;  2H6H B;  3H7L A;  3DPY B;  2PN5 A;  4NEI A;  3DSW B;  4MU9 A;  1GLM A;  2AHF A;  1FO3 A;  1V7V A;  1KZP B;  3WIQ A;  2ZQ0 A;  1H13 A;  3CU7 A;  1W6J A;  2JKP A;  3E73 A;  2WVZ A;  1N4P B;  3IMH A;  2WDA A;  3BS6 A;  4AYP A;  1RWH A;  1NS2 A;  3Q75 B;  2P0V A;  1DCE B;  2V8I A;  3PZ4 B;  3SDV A;  1SO0 A;  5GZK A;  1HMU A;  3T09 A;  4DOE A;  3RRS A;  3SDQ A;  3C72 B;  2GZ6 A;  3KSQ B;  3D5S A;  1MZC B;  4BZE A;  5CZL A;  3HXF B;  1MMX A;  1DOG A;  4GTP B;  2BB5 A;  2WW1 A;  3E37 B;  1TNY B;  2WII B;  3P5R A;  4Q2B A;  1FO2 A;  3RX5 A;  1JOV A;  3E33 B;  1IS9 A;  1AGM A;  3VD3 A;  1G9J A;  3PZ3 B;  1JZ4 A;  1GXN A;  3PZ1 B;  3ACT A;  3S4C A;  5JMF A;  4BOJ A;  4RNL A;  4GTT B;  3VD9 A;  1UG9 A;  3CIH A;  3K7X A;  1D8D B;  4OK2 A;  1QBQ B;  1PX3 A;  1I8Q A;  3SFX B;  4BZH A;  1KZO B;  1DP0 A;  3T2P A;  2F6D A;  3Q73 B;  3ACS A;  1N9A B;  2XWJ B;  4DUW A;  1GXM A;  1R76 A;  1V7W A;  2H6I B;  4XUV A;  2WIN B;  3DYP A;  1FBO A;  1LD8 B;  1H36 A;  2DRS A;  5MEH A;  4EL8 A;  5JPM B;  4DUX A;  2WYN A;  3QPF A;  1KRE A;  3E7J A;  3WC3 A;  2IEJ B;  3T2Q A;  3T08 A;  1VD5 A;  1LTX B;  2G0D A;  1GAI A;  3PYB A;  1KRF A;  2CIQ A;  4ONT A;  3Q79 B;  4J5T A;  3K11 A;  4WVB A;  1GSZ A;  4ZG8 A;  3MUZ 1;  1RW9 A;  2X03 A;  1JZ2 A;  3SQC A;  2VN7 A;  3M74 A;  4AYR A;  3KQ4 A;  3QDE A;  3M7E A;  1EGU A;  1G6I A;  1TNU B;  2JJB A;  4LNV A;  2OKX A;  3NJX A;  2V3P A;  4ZH1 A;  1F9D A;  2V8K A;  1TXK A;  1JCQ B;  1NSM A;  1QSJ A;  3MUY 1;  3K25 A;  1RWF A;  4DUV A;  3H2W A;  3E1F 1;  4L9P B;  2FV0 A;  3OXU A;  2FUQ A;  4KKJ A;  2I07 B;  1L7J A;  1NSV A;  2R2L B;  3P5P A;  2BBC A;  3SFY B;  4WVA A;  2WVY A;  1O6Q A;  4GTR B;  3CZJ A;  1MMY A;  1AYX A;  1N7Q A;  1HM3 A;  2E24 A;  1O1S B;  4FXK B;  1TNB B;  3E6U A;  3H3K A;  2FUT A;  1SQC A;  2WW2 A;  4V1S A;  4YDO B;  1NSZ A;  4FXG B;  3M77 A;  1GHQ A;  1KSC A;  1RWC A;  3KSL B;  1JYX A;  1O6R A;  2D5J A;  1GAH A;  1FCE A;  3VDB A;  1YGA A;  4AQ0 A;  3HXE B;  3WIR A;  1KFG A;  1WZZ A;  3I3D A;  4FNV A;  3D3I A;  3W7T A;  3RX8 A;  1XWQ A;  4KTR A;  3E34 B;  4Q88 A;  3EQA A;  1NS0 A;  3HXB B;  1D8E B;  1JZ8 A;  3VD4 A;  2EAD A;  3J7H A;  3QSP A;  3W7S A;  2XHN A;  2E22 A;  2DRR A;  5FOB B;  2BED B;  3HXC B;  1L1Y A;  4GTV B;  4Z4L A;  3DEC A;  3IAP A;  3I3E A;  4OJZ A;  3DYO A;  1W3Y A;  1TNZ B;  3Q7F B;  2QNO A;  3W5M A;  1QQF A;  1OJO A;  2RI9 A;  5FO9 B;  4GTM B;  2V3N A;  2DRQ A;  3A24 A;  4TTG A;  1TN6 B;  5A1A A;  1C3D A;  1IA7 A;  4CE7 A;  4BZF A;  1KS8 A;  1F9O A;  1JCS B;  1W6K A;  1X81 B;  3VD7 A;  3GZK A;  3M75 A;  3SDU A;  1LXM A;  1RQ5 A;  3S9V A;  3MWX A;  3S4D A;  3QG0 A;  2FV1 A;  2XSG A;  1MN0 A;  4JJJ A;  1LF9 A;  4CJ1 A;  1HM2 A;  4BZG A;  5JMD A;  3TY1 A;  3QWT A;  2B39 A;  3WKI A;  1SNZ A;  1X1J A;  1JZ5 A;  1PX4 A;  4YCR A;  2WW3 A;  1NI1 B;  5E1Q A;  3WKH A;  1DL2 A;  3TF4 A;  1JYV A;  5DGR A;  2RGK A;  3M7L A;  2WCO A;  1S63 B;  4KTP A;  3WIW A;  1L7K A;  1LXK A;  1SA4 B;  3E80 A;  3OED A;  3VW5 A;  1O6H A;  4WU0 A;  3M7B A;  3BLC A;  5GY3 A;  3MV1 1;  3W7X A;  1N4Q B;  2BRW A;  3X17 A;  1RWG A;  1O5M B;  3VSN A;  3QXQ A;  4D4A A;  4DOD A;  1G87 A;  1H3A A;  1FT2 B;  2JF4 A;  1NL4 B;  3QT9 A;  2H6F B;  1TN8 B;  2WW0 A;  3RSY A;  1H14 A;  2EAE A;  3QXF A;  3PYA A;  1RWA A;  1CLC A;  3GLY A;  3EZ8 A;  3DSV B;  2JG0 A;  1HZF A;  3S4B A;  5AGD A;  1K1X A;  1FP3 A;  2AHG A;  1JCR B;  3SDT A;  2DRO A;  2FBA A;  3NRE A;  3DST B;  1X1H A;  1JZ7 A;  4M76 A;  1O79 A;  3DSU B;  3A0O A;  4MMI A;  1UMP A;  3NJV A;  2XQW A;  1NSS A;  1MMZ A;  4KKI A;  2G02 A;  4ZRQ A;  3M73 A;  3RX7 A;  2ZXQ A;  1TN7 B;  1JZ6 A;  3QFY A;  3Q1N A;  4WVC A;  3M76 A;  1V5C A;  2V8J A;  3DRA B;  4MBG B;  3E32 B;  2NVP A;  2HTB A;  3DCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...