1LF6A

Crystal structure of bacterial glucoamylase
Total Genus 242
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
242
sequence length
674
structure length
674
Chain Sequence
SIKIDRFNNISAVNGPGEEDTWASAQKQGVGTANNYVSKVWFTLANGAISEVYYPTIDTADVKEIKFIVTDGKSFVPDETKDAISKVEKFTDKSLGYKLVNTDKKGRYRITKDIFTDVKRNSLIMKAKFEALEGSIHDYKLYLAYDPHIKNQGSYNEGYVIKANNNEMLMAKRDNVYTALSSNIGWKGYSIGYYKVNDIMTDLDENKQMTKHYDSARGNIIEGAEIDLTKNSEFEIVLSFGQSDSEAAKTALETLGEDYNNLKNNYIDEWTKYCNTLNNFNGKANSLYYNSMMILKASEDKTNKGAYIASLSIPWGDGQRDDNTGGYHLVWSRDLYHVANAFIAAGDVDSANRSLDYLAKVVKDNGMIPQNTWISGKPYWTGIQLDEQADPIILSYRLKRYDLYDSLVKPLADFIIKIGPKTGQERWEEIGGYSPATMAAEVAGLTCAAYIAEQNKDYESAQKYQEKADNWQKLIDNLTYTENGPLGNGQYYIRIAGLSDPDADFMINIANGGGVYDQKEIVDPSFLELVRLGVKSADDPKILNTLKVVDSTIKVDTPKGPSWYRYNHDGYGEPSKTELYHGAGKGRLWPLLTGERGMYEIAAGKDATPYVKAMEKFANEGGIISEQVWEDTGLPTDSASPLNWAHAEYVILFASNIEHKVLDMPDIVYKRYVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure and evolution of prokaryotic glucoamylase
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords glucoamylase
total genus 242
structure length 674
sequence length 674
chains with identical sequence B
ec nomenclature ec 3.2.1.3: Glucan 1,4-alpha-glucosidase.
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00723 Glyco_hydro_15 Glycosyl hydrolases family 15
A PF09137 Glucodextran_N Glucodextranase, domain N
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1lf6A02
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1lf6A01
2AFAA 3IAQA 1H13A 1LXMA 1UG9A 3QDEA 1NSMA 1GAIA 2HTAA 3H3KA 3RX7A 5KKBA 4FUSA 1K1WA 2FBAA 1N7QA 1SNZA 2WVYA 4BZEA 1J0NA 3E73A 5M7IA 1NSZA 4TTGA 3QFYA 1WU6A 1HN1A 1FO2A 1AYXA 2WVZA 1PX3A 3SEPA 4WU0A 1LF6A 2CIRA 3MUZ1 2WW1A 1JYNA 1RWCA 1JZ6A 1KRFA 3VDAA 2F6DA 2AHGA 1KFGA 1HMWA 2BRVX 3H7LA 3WKHA 1LURA 3ANKA 1V5CA 3OB8A 1JZ3A 3T2PA 5M7YA 3S4DA 1MN0A 1N7OA 3WFAA 1FO3A 1FAEA 1C82A 1OJPA 1NS4A 3T0AA 3RSYA 2FV0A 3J7HA 3WKFA 3DECA 1X1JA 3WUXA 3S4CA 4DOEA 1X9DA 4TXTA 3ACSA 5E2JA 1FCEA 1KKTA 3Q1NA 3T2OA 5CD2A 1CB8A 4AYQA 3DYMA 2D73A 4L0GA 1TXKA 2DRRA 2WVXB 3OBAA 1EGUA 1GAHA 3I3BA 3A24A 3VD3A 5CZLA 2WCOA 1CEMA 2YIKA 1YGAA 4ZH5A 1XW2A 5A1AA 4Q88A 2HTBA 2GZ6A 4AYPA 4WVAA 1KWFA 3S4BA 4Z4JA 3VDCA 3EQAA 2D8LA 4CJ0A 4CJ1A 2ZZRA 2RI8A 2NVPA 3EZ8A 2WW2A 1JZ4A 1RWAA 3CIHA 4Z4LA 1IA6A 1KSCA 1NSVA 3WIRA 3AFJA 4XUVA 3QFZA 1JYVA 1WZZA 3QSPA 3TF4A 3GLYA 2CIQA 2WW0A 3VD9A 2D5JA 1FP3A 2WVXA 4BZGA 4RNLA 3T0BA 1HM3A 1IS9A 1XWQA 1Z45A 2JKEA 3VDBA 3A3VA 1H12A 1JS4A 1AGMA 1JZ2A 3K11A 2EADA 3BGAA 1RQ5A 2JKAA 2FUZA 1JYXA 4Q2BA 5E1QA 2JF4A 1KSDA 3D3IA 1LXKA 4J5TA 1CLCA 3RX5A 1F9GA 1RWHA 3ACTA 2RGKA 1N7RA 3W7TA 3DCDA 3DYOA 1L1YA 1F1SA 2Q1FA 2RI9A 1HCUA 1V7WA 2XSGA 1KS8A 1NSUA 2X03A 1MMYA 1FBOA 1UT9A 1K1XA 3S4AA 3VD7A 3T08A 3I3DA 3MV01 1N7PA 3T2QA 1DP0A 1K72A 1RWFA 2WDAA 4BZFA 1H54A 3GZKA 1ULVA 3MUY1 3W5NA 1NS0A 3MWXA 4BZHA 2A8ZA 1K1YA 2FV1A 3WKGA 1L7JA 3QT3A 2WYNA 1OJMA 3WIQA 1NS7A 1JZ8A 4AYOA 1NC5A 3VW5A 1RWGA 3MV11 1G9GA 3WIWA 3W5MA 3VD4A 1N7NA 4AYRA 1NSRA 4WVBA 1TF4A 1F4HA 1X1HA 3T33A 3E6UA 1NXCA 1PX4A 1KREA 3GT5A 1L2AA 1WU4A 2CQSA 1V7VA 1RW9A 1MMUA 2ZXQA 1FMIA 2B4FA 1NSSA 2ZQ0A 1GA2A 4EL8A 2VN7A 4DODA 1HN0A 2JKPA 1MMXA 2DRSA 2EACA 2GH4A 3QWTA 3RENA 3VXDA 3H2WA 3IMHA 2XFGA 3QRYA 1HM2A 1NS2A 1NSXA 1NKGA 1F9OA 3DYPA 3NJXA 1JYWA 3OS7A 1F9DA 2WW3A 2E22A 3K25A 1NS8A 1YQ2A 3WKIA 4DUVA 1I8QA 4JJJA 2Z07A 3WC3A 3T0DA 4ZG8A 3W7XA 3VD5A 2CQTA 4L6XA 4WVCA 1F4AA 1LOHA 1OJNA 1OJOA 3QT9A 3ANJA 3RX8A 1V7XA 2E24A 2XHNA 1FBWA 1IA7A 1W3YA 1JZ5A 1J0MA 3P2CA 1LF9A 1JZ7A 2VN4A 2DROA 3QG0A 2JG0A 1WU5A 3NJVA 2JJBA 3CZJA 3IAPA 3W7WA 2DRQA 1JOVA 1H14A 1MMZA 2P0VA 2QNOA 3X17A 2BRPA 4KTPA 1G6IA 4TF4A 5DGQA 5MEHA 3QXFA 3RRSA 1DL2A 2WZSA 1G87A 2OKXA 1XWTA 4DUWA 2EAEA 3ECQA 1DOGA 4KTRA 4AQ0A 1HMUA 2ZBLA 2BRWA 3E1F1 4CE7A 1VD5A 1GLMA 4DUXA 3I3EA 5CA3A 3PMMA 3QPFA 5GY3A 5DGRA 1X1IA 1L7KA 2AHFA 3NREA 1V5DA 1G9JA 1SO0A 3T09A 3ON6A 2EABA 3W7SA 3QXQA 3ANIA 3W7UA 5GW7A 2CISA
chains in the Genus database with same CATH superfamily
2AFAA 3IAQA 1H13A 1LXMA 1UG9A 4YDOB 2E2UA 3QDEA 2BB6A 1C3DA 1NSMA 1TQSA 3VSMA 3BUIA 1GAIA 3MI6A 2HTAA 3H3KA 3RX7A 3WA2X 3EUVB 4FUSA 5KKBA 1K1WA 4GTVB 2OQEA 2PN5A 2XN2A 3DSSB 3D4ZA 3SQCA 1QX1A 2FBAA 1N7QA 3DPYB 4GTTB 1SNZA 3EU5B 2WVYA 4LNVA 4K35A 1HXCA 5ILKA 4BZEA 1J0NA 3E73A 4ONTA 5M7IA 1NSZA 4TTGA 3QFYA 4GTPB 2IEJB 5EATA 2CFGA 1WU6A 1HN1A 1JRQA 1FO2A 1WMPA 3OXUA 5IM1A 2Y74A 1AYXA 2WVZA 1PX3A 1LD7B 4E1YA 2XWJB 4K3AA 2F1AA 3HXEB 3SEPA 4WU0A 3CZSA 2YFNA 3M7CA 1LF6A 2CIRA 3MUZ1 1JCRB 2WW1A 3PYAA 3SFXB 4KFEA 4KKJA 1JYNA 1LTXB 1RWCA 1JZ6A 1KRFA 1TNBB 3KIIA 3VDAA 2F6DA 2AHGA 1IQYA 3M76A 2H6GB 1KSIA 1KFGA 1O1RB 1HMWA 2BB5A 2BRVX 4GTOB 2BT3A 3PGBA 3H7LA 3KSLB 3WKHA 2CFDA 1LURA 3ANKA 1V5CA 3C72B 3OB8A 1JZ3A 3T2PA 5M7YA 3S4DA 1MN0A 1N7OA 2WY7A 3LVTA 3WFAA 4V1SA 3SDVA 2FYVA 4D4CA 1FO3A 2WO0A 1C82A 1FAEA 1OJPA 1PS3A 1SIHA 1WMOA 3M7BA 1NS4A 2F7PA 3T0AA 1N94B 1HZFA 1S63B 3RSYA 1N21A 2FV0A 2ZIRB 3J7HA 3SDRA 3X41A 1X1JA 2WIIB 3WKFA 3WUXA 3S4CA 4DOEA 1N9EA 3DECA 4FNUA 1X9DA 1D8DB 1IVXA 4TXTA 3ACSA 1SA5B 5E2JA 1N22A 3RJ3A 3HXDB 4F13A 3AMOB 3SDUA 1FCEA 1KKTA 3Q1NA 3T2OA 5CD2A 1CB8A 4AYQA 3BUBA 1IU7A 3KLSA 3K7XA 3DYMA 2YX9A 2CWTA 2D73A 1QSJA 3BUQA 4L0GA 1TXKA 2E2VA 1N9AB 2DRRA 2WVXB 3OBAA 3EU8A 1EGUA 1GAHA 5JPNB 3I3BA 1O6RA 3A24A 2SQCA 1FPPB 5IK6A 2WYIA 3VD3A 2GOXA 4NEIA 5CZLA 3SX1A 2WCOA 1H3AA 3M7LA 1CEMA 2YIKA 1MZCB 1HXKA 1YGAA 4ZH5A 3E37B 3BVVA 1XW2A 5A1AA 4Q88A 2HTBA 2GZ6A 3EJUA 1N4SB 3HXBB 4AYPA 1TQWA 3WA3A 4WVAA 1KWFA 3M75A 3S4BA 4Z4JA 3VDCA 3EQAA 2D8LA 4CJ0A 1PU4A 1W6GA 4CJ1A 4UFCA 2ZZRA 2RI8A 1DYUA 4QT9A 2NVPA 4FNSA 3EZ8A 2WW2A 1JZ4A 1RWAA 3K5TA 3D5RA 4M76A 3BVXA 3CIHA 3SXXA 4FXGB 2WGQA 2WOHA 4Z4LA 3X40A 1RJOA 3CZNA 1IA6A 1KSCA 1NSVA 1D6YA 3WIRA 1N95B 3HIGA 3AFJA 2YFOA 4ZRPA 3MPHA 4XUVA 3QFZA 3Q78B 3M73A 5DHKA 1W4NA 1JYVA 2XN1A 3M78A 1WZZA 2F18A 3QSPA 3TF4A 1GXMA 1QQFA 1N20A 3GLYA 1O1SB 5ILDA 4OJZA 3Q75B 2CIQA 1HX9A 2WW0A 3BVUA 3VD9A 2D5JA 5ILZA 1FP3A 2WVXA 4BZGA 1GXNA 4RNLA 3T0BA 1HM3A 1IS9A 1XWQA 1TN6B 4GTRB 4YDEB 1LVNA 1Z45A 2G0DA 2JKEA 3BS6A 3VDBA 3A3VA 2XQWA 1H12A 2F0YB 1JS4A 1AGMA 2H6IB 5GZKA 2PMVA 1D8EB 2ZL8A 1JZ2A 3K11A 4LNBB 4KFDA 2EADA 2CFLA 3BGAA 1RQ5A 2JKAA 2FUZA 3DDGA 1JYXA 5IKAA 3G6JB 4Q2BA 1IVUA 1O5MB 5KBPA 3KSQB 2JF4A 5E1QA 1KSDA 3D3IA 1GSZA 4RNQA 1LXKA 1SIIA 3M01A 5DHIA 4J5TA 1CLCA 1F9GA 1RWHA 3RX5A 5IK0A 3ACTA 1SPUA 1S64B 3WVFA 1H3CA 1JCSB 1QAFA 1OACA 2RGKA 1TU5A 1N7RA 3W7TA 2V3NA 1QWUA 3DCDA 3DYOA 1L1YA 1F1SA 1TN8B 3DSXB 2Q1FA 1GXOA 1IQXA 1LD8B 1RKYA 2RI9A 3ALAA 3X3XA 3X3ZA 3BVWA 1HCUA 1V7WA 2XSGA 3DDFA 1KS8A 3OEDA 5EASA 3BUPA 1NSUA 2X03A 1QAZA 4EV5A 3M71A 1AVLA 1MMYA 1FBOA 1UT9A 1K1XA 1NL4B 2OW6A 1QALA 3S4AA 3VSNA 4L9PB 3VD7A 2F7RA 4GTQB 2WOFA 3LZ9A 3Q7AB 5ILYA 5IL3A 3T08A 3I3DA 3MV01 4BTWA 1N7PA 2NOJA 2RDYA 3DX3A 5FO7B 4D94A 2FUQA 1HXAA 3PZ3B 3T2QA 1DP0A 1K72A 1RWFA 4ZH1A 3D51A 2WDAA 4BZFA 3Q79B 4D4DA 1H54A 3GZKA 2V8JA 2CFWA 1ULVA 1H3BA 3MUY1 3W5NA 1NS0A 3MWXA 4BZHA 2A8ZA 2A73B 3Q73B 4GAXA 1A2VA 1K1YA 2XN0A 2FV1A 3WKGA 1L7JA 1DCEB 3T0UA 1W6KA 2V8KA 3AMOA 1FT1B 3QT3A 5AGDA 2WYNA 1OJMA 3WIQA 1NS7A 3SDQA 1JZ8A 4AYOA 2CWUA 4V1RA 3HXCB 1NC5A 1QWNA 4ZRQA 1HXGA 3VW5A 2OW7A 3E80A 3DX2A 1RWGA 4BTXA 3MV11 1G9GA 3WIWA 1R34A 3W5MA 3CU7A 1UI7A 2ONHA 3VD4A 3M00A 1N7NA 4AYRA 3NFVA 1TNOB 1NSRA 4WVBA 1TF4A 1F4HA 1X1HA 3T33A 4OK4A 1O7DD 3E6UA 1N4RB 2V8IA 1NXCA 1WMNA 1AVKA 3X3YA 1PX4A 1KREA 3DSUB 3GT5A 2Y73A 1L2AA 1WU4A 2CQSA 3D50A 3DX0A 1V7VA 1RW9A 1MMUA 1AV4A 2ZXQA 1FMIA 2B4FA 1NSSA 3BLCA 4BOKA 2ZQ0A 1GA2A 1TQTA 2F7QA 1HV6A 1UI8A 4EL8A 2VN7A 4FNTA 1O6HA 4LNGB 1TNZB 4KKIA 1N4QB 2XWBB 4DODA 5EAUA 1H37A 2WY8A 1HN0A 3DSTB 2E2TA 2JKPA 3KN4A 1QAKA 1MMXA 2OOVA 2F1BA 3M77A 1TNUB 2DRSA 2EACA 2GH4A 1N24A 4YCRA 3DSVB 3QWTA 3RENA 1H35A 3VXDA 2H6FB 3H2WA 3LOYA 3IMHA 2BEDB 3BLBA 2PNCA 2XFGA 3QRYA 1HWWA 1HM2A 3TY1A 1NS2A 2WYHA 1NSXA 3SAEA 1NKGA 1F9OA 4D4BA 3DYPA 1W5ZA 3NJXA 3OS7A 1JYWA 5JPMB 3BUDA 3NBJA 2FUTA 1KZPB 1F9DA 4MMIA 2WW3A 3E7JA 3DSWB 2E22A 1W6JA 4GL3A 4EHMB 4OZVA 4FNQA 3K25A 3P5RA 1NS8A 1R33A 1YQ2A 3DX4A 3WKIA 1O1TB 3M02A 2WINB 3E33B 2I07B 1FT2B 3M72A 3M74A 4DUVA 3N0FA 3X42A 1I8QA 1O79A 4BOJA 3EJRA 1N23A 3S9VA 2BBCA 5FOBB 5JMDA 4JJJA 1N1ZA 2Z07A 2CFKA 1IVWA 3BVTA 3WC3A 3T0DA 1N1BA 4ZG8A 3W7XA 2V3PA 3VD5A 2CQTA 4L6XA 1H36A 4WVCA 3NNBA 1D6UA 2ONGA 1F4AA 1LOHA 1OJNA 2H6HB 3DRAB 1OJOA 4MBGB 4LIXA 3EJTA 1UMPA 3QT9A 2OOVC 3E32B 3ANJA 3RX8A 1V7XA 3G4DA 2E24A 1SA4B 2C11A 3D4YA 3Q7FB 1FBWA 1IA7A 1W3YA 2XHNA 4BTYA 1JZ5A 1J0MA 4OZWA 3PYBA 3P2CA 3N9HA 1LF9A 1JZ7A 2VN4A 4FNVA 2DROA 1QBQB 3QG0A 2B39A 3NBBA 2R2LB 2JG0A 1WU5A 5ILIA 3D52A 3PZ1B 3NJVA 5IK9A 2OQEC 4FNPA 4EV2A 2JJBA 5JMFA 1D6ZA 3CZJA 3IAPA 3PZ4B 1NI1B 3W7WA 2DRQA 3EJPA 4MU9A 1JOVA 1W7CA 1H14A 1MMZA 2P0VA 2QNOA 2C10A 3PZ2B 4FXKB 2G02A 3X17A 3N0GA 4GTMB 1O6QA 3SFYB 1EKMA 3HXFB 2BRPA 1X81B 3A0OA 3AFLA 5IKHA 5C05A 3KQ4A 4KTPA 4FJQA 4D4AA 1G6IA 4F10A 3HIIA 2D1WA 4TF4A 3CV5A 3SDTA 3G4FA 5DGQA 5MEHA 3EJSA 5FO9B 3QXFA 3RRSA 1DL2A 2WZSA 5ILHA 3HI7A 1G87A 2OKXA 1XWTA 1W6CA 1H39A 2EAEA 4DUWA 1IVVA 3ECQA 1DOGA 3P5PA 2CG1A 4KTRA 1TQVA 4AQ0A 1HMUA 2BRWA 2ZBLA 4CE7A 3E1F1 1VD5A 1GLMA 4DUXA 3I3EA 2ALWA 2CWVA 4KFFA 5CA3A 1R76A 3PMMA 3M7EA 5IL8A 3DX1A 3QPFA 1W2ZA 1US1A 1TQUA 1TNYB 1JCQB 3E30B 3E34B 5DGRA 5GY3A 1N4PB 5FO8B 2ZISB 1X1IA 2W0QA 1L7KA 1SQCA 2AHFA 1TN7B 3NREA 4C1SA 5ILJA 1V5DA 4MMHA 2J5CA 3D5SA 4DI5A 1G9JA 2CG0A 1SO0A 3T09A 3ON6A 2EABA 4GTSB 3W7SA 4OK2A 3QXQA 1GHQA 3ANIA 4FNRA 3W7UA 3EJQA 1KZOB 2F7OA 5GW7A 1HTYA 2CISA
chains in the Genus database with same CATH topology
2AFAA 3IAQA 1H13A 4YDOB 1UG9A 1LXMA 3QDEA 2BB6A 1C3DA 1NSMA 3VSMA 1GAIA 2HTAA 3H3KA 3RX7A 3EUVB 4FUSA 5KKBA 1K1WA 4GTVB 2PN5A 3DSSB 3SQCA 2FBAA 3DPYB 4GTTB 1N7QA 1SNZA 3EU5B 2WVYA 4LNVA 4BZEA 1J0NA 3E73A 4ONTA 5M7IA 1NSZA 4TTGA 3QFYA 4GTPB 2IEJB 1WU6A 1HN1A 1FO2A 3OXUA 1AYXA 2WVZA 1PX3A 1LD7B 2XWJB 3HXEB 3SEPA 4WU0A 3M7CA 1LF6A 2CIRA 3MUZ1 1JCRB 2WW1A 3PYAA 3SFXB 4KKJA 1JYNA 1LTXB 1RWCA 1JZ6A 1KRFA 1TNBB 3VDAA 2F6DA 2AHGA 3M76A 2H6GB 1KFGA 1O1RB 1HMWA 2BB5A 4GTOB 2BRVX 3H7LA 3KSLB 3WKHA 1LURA 3ANKA 1V5CA 3C72B 3OB8A 1JZ3A 3T2PA 5M7YA 3S4DA 1MN0A 2WY7A 1N7OA 3WFAA 4V1SA 3SDVA 4D4CA 1FO3A 1FAEA 1C82A 1OJPA 3M7BA 1NS4A 3T0AA 1N94B 1HZFA 1S63B 3RSYA 2FV0A 3J7HA 2ZIRB 3SDRA 2WIIB 3WKFA 1X1JA 3WUXA 3S4CA 4DOEA 3DECA 1X9DA 1D8DB 4TXTA 3ACSA 1SA5B 5E2JA 3RJ3A 3HXDB 3SDUA 1FCEA 1KKTA 3Q1NA 3T2OA 5CD2A 1CB8A 4AYQA 3KLSA 3K7XA 3DYMA 2D73A 1QSJA 4L0GA 1TXKA 1N9AB 2DRRA 2WVXB 3OBAA 3EU8A 1EGUA 1GAHA 5JPNB 3I3BA 1O6RA 3A24A 2SQCA 1FPPB 3VD3A 2GOXA 4NEIA 5CZLA 2WCOA 1H3AA 3M7LA 1CEMA 2YIKA 1MZCB 1YGAA 4ZH5A 3E37B 1XW2A 5A1AA 4Q88A 2HTBA 2GZ6A 1N4SB 3HXBB 4AYPA 4WVAA 1KWFA 3M75A 3S4BA 4Z4JA 3VDCA 3EQAA 2D8LA 4CJ0A 4CJ1A 2ZZRA 2RI8A 4QT9A 2NVPA 3EZ8A 2WW2A 1JZ4A 1RWAA 3D5RA 4M76A 3CIHA 4FXGB 4Z4LA 1IA6A 1KSCA 1NSVA 3WIRA 1N95B 3AFJA 4ZRPA 4XUVA 3QFZA 3Q78B 3M73A 1JYVA 3M78A 1WZZA 3QSPA 3TF4A 1GXMA 1QQFA 3GLYA 1O1SB 4OJZA 3Q75B 2CIQA 2WW0A 3VD9A 2D5JA 1FP3A 2WVXA 4BZGA 1GXNA 4RNLA 3T0BA 1HM3A 1IS9A 1XWQA 1TN6B 4GTRB 4YDEB 1Z45A 3BS6A 2G0DA 2JKEA 3VDBA 3A3VA 2XQWA 1H12A 2F0YB 1JS4A 1AGMA 2H6IB 5GZKA 2PMVA 1D8EB 1JZ2A 3K11A 4LNBB 2EADA 3BGAA 1RQ5A 2JKAA 2FUZA 1JYXA 3G6JB 4Q2BA 1O5MB 3KSQB 2JF4A 5E1QA 1KSDA 1GSZA 3D3IA 1LXKA 4J5TA 1CLCA 3RX5A 1F9GA 1RWHA 3ACTA 1S64B 3WVFA 1H3CA 1JCSB 2RGKA 1N7RA 3W7TA 2V3NA 3DCDA 3DYOA 1L1YA 1TN8B 3DSXB 1F1SA 2Q1FA 1GXOA 1LD8B 2RI9A 1HCUA 1V7WA 2XSGA 1KS8A 3OEDA 1NSUA 2X03A 3M71A 1MMYA 1FBOA 1UT9A 1K1XA 1NL4B 3S4AA 3VSNA 4L9PB 3VD7A 4GTQB 3Q7AB 3T08A 3I3DA 3MV01 1N7PA 2NOJA 5FO7B 4D94A 2FUQA 3PZ3B 3T2QA 1DP0A 1K72A 1RWFA 4ZH1A 2WDAA 4BZFA 3Q79B 4D4DA 1H54A 3GZKA 2V8JA 1ULVA 1H3BA 3MUY1 3W5NA 1NS0A 3MWXA 4BZHA 2A8ZA 2A73B 3Q73B 1K1YA 2FV1A 3WKGA 1L7JA 1DCEB 1W6KA 2V8KA 1FT1B 3QT3A 5AGDA 2WYNA 1OJMA 3WIQA 1NS7A 3SDQA 1JZ8A 4AYOA 4V1RA 3HXCB 1NC5A 4ZRQA 3VW5A 3E80A 1RWGA 3MV11 1G9GA 3WIWA 3W5MA 3CU7A 3VD4A 1N7NA 4AYRA 1TNOB 1NSRA 4WVBA 1TF4A 1F4HA 1X1HA 3T33A 4OK4A 3E6UA 1N4RB 2V8IA 1NXCA 1PX4A 1KREA 3DSUB 3GT5A 1L2AA 1WU4A 2CQSA 1V7VA 1RW9A 1MMUA 2ZXQA 1FMIA 2B4FA 1NSSA 3BLCA 4BOKA 2ZQ0A 1GA2A 4EL8A 2VN7A 1O6HA 4LNGB 1TNZB 4KKIA 1N4QB 2XWBB 4DODA 1H37A 2WY8A 3DSTB 1HN0A 2JKPA 1MMXA 3M77A 1TNUB 2DRSA 2EACA 2GH4A 4YCRA 3DSVB 3QWTA 3RENA 1H35A 3VXDA 2H6FB 3H2WA 3IMHA 2BEDB 2XFGA 3QRYA 1HM2A 3TY1A 1NS2A 1NSXA 3SAEA 1NKGA 1F9OA 4D4BA 3DYPA 3NJXA 1JYWA 3OS7A 5JPMB 2FUTA 1KZPB 1F9DA 2WW3A 4MMIA 3E7JA 3DSWB 4EHMB 1W6JA 4GL3A 2E22A 3K25A 3P5RA 1NS8A 1YQ2A 3WKIA 1O1TB 2WINB 3E33B 2I07B 1FT2B 3M72A 3M74A 4DUVA 1I8QA 1O79A 4BOJA 3S9VA 2BBCA 5FOBB 5JMDA 4JJJA 2Z07A 3WC3A 3T0DA 4ZG8A 3W7XA 2V3PA 3VD5A 2CQTA 4L6XA 1H36A 4WVCA 1F4AA 1LOHA 2H6HB 3DRAB 4MBGB 4LIXA 1OJOA 1OJNA 1UMPA 3QT9A 3E32B 3ANJA 3RX8A 1V7XA 2E24A 1SA4B 3Q7FB 1FBWA 1IA7A 1W3YA 2XHNA 1JZ5A 1J0MA 3PYBA 3P2CA 1LF9A 1JZ7A 2VN4A 4FNVA 2DROA 1QBQB 3QG0A 2B39A 2R2LB 2JG0A 1WU5A 3PZ1B 3NJVA 2JJBA 5JMFA 3CZJA 3IAPA 3PZ4B 1NI1B 3W7WA 2DRQA 4MU9A 1JOVA 1H14A 1MMZA 2P0VA 2QNOA 3PZ2B 4FXKB 2G02A 3X17A 4GTMB 1O6QA 3SFYB 3HXFB 2BRPA 1X81B 3A0OA 3AFLA 3KQ4A 4KTPA 4D4AA 1G6IA 4TF4A 3SDTA 5DGQA 5MEHA 5FO9B 3QXFA 3RRSA 1DL2A 2WZSA 1G87A 2OKXA 1XWTA 1H39A 2EAEA 4DUWA 3ECQA 1DOGA 3P5PA 4KTRA 4AQ0A 1HMUA 2ZBLA 2BRWA 4CE7A 3E1F1 1VD5A 1GLMA 4DUXA 3I3EA 5CA3A 1R76A 3PMMA 3M7EA 3QPFA 1TNYB 1JCQB 3E30B 3E34B 5DGRA 5GY3A 1N4PB 5FO8B 2ZISB 1X1IA 1L7KA 1SQCA 2AHFA 1TN7B 3NREA 4C1SA 1V5DA 4MMHA 3D5SA 1G9JA 1SO0A 3T09A 3ON6A 2EABA 4GTSB 3W7SA 4OK2A 3QXQA 1GHQA 3ANIA 3W7UA 1KZOB 5GW7A 2CISA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AFA A;  3IAQ A;  1H13 A;  1LXM A;  1UG9 A;  3QDE A;  1NSM A;  1GAI A;  2HTA A;  3H3K A;  3RX7 A;  5KKB A;  4FUS A;  1K1W A;  2FBA A;  1N7Q A;  1SNZ A;  2WVY A;  4BZE A;  1J0N A;  3E73 A;  5M7I A;  1NSZ A;  4TTG A;  3QFY A;  1WU6 A;  1HN1 A;  1FO2 A;  1AYX A;  2WVZ A;  1PX3 A;  3SEP A;  4WU0 A;  1LF6 A;  2CIR A;  3MUZ 1;  2WW1 A;  1JYN A;  1RWC A;  1JZ6 A;  1KRF A;  3VDA A;  2F6D A;  2AHG A;  1KFG A;  1HMW A;  2BRV X;  3H7L A;  3WKH A;  1LUR A;  3ANK A;  1V5C A;  3OB8 A;  1JZ3 A;  3T2P A;  5M7Y A;  3S4D A;  1MN0 A;  1N7O A;  3WFA A;  1FO3 A;  1FAE A;  1C82 A;  1OJP A;  1NS4 A;  3T0A A;  3RSY A;  2FV0 A;  3J7H A;  3WKF A;  3DEC A;  1X1J A;  3WUX A;  3S4C A;  4DOE A;  1X9D A;  4TXT A;  3ACS A;  5E2J A;  1FCE A;  1KKT A;  3Q1N A;  3T2O A;  5CD2 A;  1CB8 A;  4AYQ A;  3DYM A;  2D73 A;  4L0G A;  1TXK A;  2DRR A;  2WVX B;  3OBA A;  1EGU A;  1GAH A;  3I3B A;  3A24 A;  3VD3 A;  5CZL A;  2WCO A;  1CEM A;  2YIK A;  1YGA A;  4ZH5 A;  1XW2 A;  5A1A A;  4Q88 A;  2HTB A;  2GZ6 A;  4AYP A;  4WVA A;  1KWF A;  3S4B A;  4Z4J A;  3VDC A;  3EQA A;  2D8L A;  4CJ0 A;  4CJ1 A;  2ZZR A;  2RI8 A;  2NVP A;  3EZ8 A;  2WW2 A;  1JZ4 A;  1RWA A;  3CIH A;  4Z4L A;  1IA6 A;  1KSC A;  1NSV A;  3WIR A;  3AFJ A;  4XUV A;  3QFZ A;  1JYV A;  1WZZ A;  3QSP A;  3TF4 A;  3GLY A;  2CIQ A;  2WW0 A;  3VD9 A;  2D5J A;  1FP3 A;  2WVX A;  4BZG A;  4RNL A;  3T0B A;  1HM3 A;  1IS9 A;  1XWQ A;  1Z45 A;  2JKE A;  3VDB A;  3A3V A;  1H12 A;  1JS4 A;  1AGM A;  1JZ2 A;  3K11 A;  2EAD A;  3BGA A;  1RQ5 A;  2JKA A;  2FUZ A;  1JYX A;  4Q2B A;  5E1Q A;  2JF4 A;  1KSD A;  3D3I A;  1LXK A;  4J5T A;  1CLC A;  3RX5 A;  1F9G A;  1RWH A;  3ACT A;  2RGK A;  1N7R A;  3W7T A;  3DCD A;  3DYO A;  1L1Y A;  1F1S A;  2Q1F A;  2RI9 A;  1HCU A;  1V7W A;  2XSG A;  1KS8 A;  1NSU A;  2X03 A;  1MMY A;  1FBO A;  1UT9 A;  1K1X A;  3S4A A;  3VD7 A;  3T08 A;  3I3D A;  3MV0 1;  1N7P A;  3T2Q A;  1DP0 A;  1K72 A;  1RWF A;  2WDA A;  4BZF A;  1H54 A;  3GZK A;  1ULV A;  3MUY 1;  3W5N A;  1NS0 A;  3MWX A;  4BZH A;  2A8Z A;  1K1Y A;  2FV1 A;  3WKG A;  1L7J A;  3QT3 A;  2WYN A;  1OJM A;  3WIQ A;  1NS7 A;  1JZ8 A;  4AYO A;  1NC5 A;  3VW5 A;  1RWG A;  3MV1 1;  1G9G A;  3WIW A;  3W5M A;  3VD4 A;  1N7N A;  4AYR A;  1NSR A;  4WVB A;  1TF4 A;  1F4H A;  1X1H A;  3T33 A;  3E6U A;  1NXC A;  1PX4 A;  1KRE A;  3GT5 A;  1L2A A;  1WU4 A;  2CQS A;  1V7V A;  1RW9 A;  1MMU A;  2ZXQ A;  1FMI A;  2B4F A;  1NSS A;  2ZQ0 A;  1GA2 A;  4EL8 A;  2VN7 A;  4DOD A;  1HN0 A;  2JKP A;  1MMX A;  2DRS A;  2EAC A;  2GH4 A;  3QWT A;  3REN A;  3VXD A;  3H2W A;  3IMH A;  2XFG A;  3QRY A;  1HM2 A;  1NS2 A;  1NSX A;  1NKG A;  1F9O A;  3DYP A;  3NJX A;  1JYW A;  3OS7 A;  1F9D A;  2WW3 A;  2E22 A;  3K25 A;  1NS8 A;  1YQ2 A;  3WKI A;  4DUV A;  1I8Q A;  4JJJ A;  2Z07 A;  3WC3 A;  3T0D A;  4ZG8 A;  3W7X A;  3VD5 A;  2CQT A;  4L6X A;  4WVC A;  1F4A A;  1LOH A;  1OJN A;  1OJO A;  3QT9 A;  3ANJ A;  3RX8 A;  1V7X A;  2E24 A;  2XHN A;  1FBW A;  1IA7 A;  1W3Y A;  1JZ5 A;  1J0M A;  3P2C A;  1LF9 A;  1JZ7 A;  2VN4 A;  2DRO A;  3QG0 A;  2JG0 A;  1WU5 A;  3NJV A;  2JJB A;  3CZJ A;  3IAP A;  3W7W A;  2DRQ A;  1JOV A;  1H14 A;  1MMZ A;  2P0V A;  2QNO A;  3X17 A;  2BRP A;  4KTP A;  1G6I A;  4TF4 A;  5DGQ A;  5MEH A;  3QXF A;  3RRS A;  1DL2 A;  2WZS A;  1G87 A;  2OKX A;  1XWT A;  4DUW A;  2EAE A;  3ECQ A;  1DOG A;  4KTR A;  4AQ0 A;  1HMU A;  2ZBL A;  2BRW A;  3E1F 1;  4CE7 A;  1VD5 A;  1GLM A;  4DUX A;  3I3E A;  5CA3 A;  3PMM A;  3QPF A;  5GY3 A;  5DGR A;  1X1I A;  1L7K A;  2AHF A;  3NRE A;  1V5D A;  1G9J A;  1SO0 A;  3T09 A;  3ON6 A;  2EAB A;  3W7S A;  3QXQ A;  3ANI A;  3W7U A;  5GW7 A;  2CIS A; 
#chains in the Genus database with same CATH topology
 2AFA A;  3IAQ A;  1H13 A;  1LXM A;  1UG9 A;  4YDO B;  2E2U A;  3QDE A;  2BB6 A;  1C3D A;  1NSM A;  1TQS A;  3VSM A;  3BUI A;  1GAI A;  3MI6 A;  2HTA A;  3H3K A;  3RX7 A;  3WA2 X;  3EUV B;  4FUS A;  5KKB A;  1K1W A;  4GTV B;  2OQE A;  2PN5 A;  2XN2 A;  3DSS B;  3D4Z A;  3SQC A;  1QX1 A;  2FBA A;  1N7Q A;  3DPY B;  4GTT B;  1SNZ A;  3EU5 B;  2WVY A;  4LNV A;  4K35 A;  1HXC A;  5ILK A;  4BZE A;  1J0N A;  3E73 A;  4ONT A;  5M7I A;  1NSZ A;  4TTG A;  3QFY A;  4GTP B;  2IEJ B;  5EAT A;  2CFG A;  1WU6 A;  1HN1 A;  1JRQ A;  1FO2 A;  1WMP A;  3OXU A;  5IM1 A;  2Y74 A;  1AYX A;  2WVZ A;  1PX3 A;  1LD7 B;  4E1Y A;  2XWJ B;  4K3A A;  2F1A A;  3HXE B;  3SEP A;  4WU0 A;  3CZS A;  2YFN A;  3M7C A;  1LF6 A;  2CIR A;  3MUZ 1;  1JCR B;  2WW1 A;  3PYA A;  3SFX B;  4KFE A;  4KKJ A;  1JYN A;  1LTX B;  1RWC A;  1JZ6 A;  1KRF A;  1TNB B;  3KII A;  3VDA A;  2F6D A;  2AHG A;  1IQY A;  3M76 A;  2H6G B;  1KSI A;  1KFG A;  1O1R B;  1HMW A;  2BB5 A;  2BRV X;  4GTO B;  2BT3 A;  3PGB A;  3H7L A;  3KSL B;  3WKH A;  2CFD A;  1LUR A;  3ANK A;  1V5C A;  3C72 B;  3OB8 A;  1JZ3 A;  3T2P A;  5M7Y A;  3S4D A;  1MN0 A;  1N7O A;  2WY7 A;  3LVT A;  3WFA A;  4V1S A;  3SDV A;  2FYV A;  4D4C A;  1FO3 A;  2WO0 A;  1C82 A;  1FAE A;  1OJP A;  1PS3 A;  1SIH A;  1WMO A;  3M7B A;  1NS4 A;  2F7P A;  3T0A A;  1N94 B;  1HZF A;  1S63 B;  3RSY A;  1N21 A;  2FV0 A;  2ZIR B;  3J7H A;  3SDR A;  3X41 A;  1X1J A;  2WII B;  3WKF A;  3WUX A;  3S4C A;  4DOE A;  1N9E A;  3DEC A;  4FNU A;  1X9D A;  1D8D B;  1IVX A;  4TXT A;  3ACS A;  1SA5 B;  5E2J A;  1N22 A;  3RJ3 A;  3HXD B;  4F13 A;  3AMO B;  3SDU A;  1FCE A;  1KKT A;  3Q1N A;  3T2O A;  5CD2 A;  1CB8 A;  4AYQ A;  3BUB A;  1IU7 A;  3KLS A;  3K7X A;  3DYM A;  2YX9 A;  2CWT A;  2D73 A;  1QSJ A;  3BUQ A;  4L0G A;  1TXK A;  2E2V A;  1N9A B;  2DRR A;  2WVX B;  3OBA A;  3EU8 A;  1EGU A;  1GAH A;  5JPN B;  3I3B A;  1O6R A;  3A24 A;  2SQC A;  1FPP B;  5IK6 A;  2WYI A;  3VD3 A;  2GOX A;  4NEI A;  5CZL A;  3SX1 A;  2WCO A;  1H3A A;  3M7L A;  1CEM A;  2YIK A;  1MZC B;  1HXK A;  1YGA A;  4ZH5 A;  3E37 B;  3BVV A;  1XW2 A;  5A1A A;  4Q88 A;  2HTB A;  2GZ6 A;  3EJU A;  1N4S B;  3HXB B;  4AYP A;  1TQW A;  3WA3 A;  4WVA A;  1KWF A;  3M75 A;  3S4B A;  4Z4J A;  3VDC A;  3EQA A;  2D8L A;  4CJ0 A;  1PU4 A;  1W6G A;  4CJ1 A;  4UFC A;  2ZZR A;  2RI8 A;  1DYU A;  4QT9 A;  2NVP A;  4FNS A;  3EZ8 A;  2WW2 A;  1JZ4 A;  1RWA A;  3K5T A;  3D5R A;  4M76 A;  3BVX A;  3CIH A;  3SXX A;  4FXG B;  2WGQ A;  2WOH A;  4Z4L A;  3X40 A;  1RJO A;  3CZN A;  1IA6 A;  1KSC A;  1NSV A;  1D6Y A;  3WIR A;  1N95 B;  3HIG A;  3AFJ A;  2YFO A;  4ZRP A;  3MPH A;  4XUV A;  3QFZ A;  3Q78 B;  3M73 A;  5DHK A;  1W4N A;  1JYV A;  2XN1 A;  3M78 A;  1WZZ A;  2F18 A;  3QSP A;  3TF4 A;  1GXM A;  1QQF A;  1N20 A;  3GLY A;  1O1S B;  5ILD A;  4OJZ A;  3Q75 B;  2CIQ A;  1HX9 A;  2WW0 A;  3BVU A;  3VD9 A;  2D5J A;  5ILZ A;  1FP3 A;  2WVX A;  4BZG A;  1GXN A;  4RNL A;  3T0B A;  1HM3 A;  1IS9 A;  1XWQ A;  1TN6 B;  4GTR B;  4YDE B;  1LVN A;  1Z45 A;  2G0D A;  2JKE A;  3BS6 A;  3VDB A;  3A3V A;  2XQW A;  1H12 A;  2F0Y B;  1JS4 A;  1AGM A;  2H6I B;  5GZK A;  2PMV A;  1D8E B;  2ZL8 A;  1JZ2 A;  3K11 A;  4LNB B;  4KFD A;  2EAD A;  2CFL A;  3BGA A;  1RQ5 A;  2JKA A;  2FUZ A;  3DDG A;  1JYX A;  5IKA A;  3G6J B;  4Q2B A;  1IVU A;  1O5M B;  5KBP A;  3KSQ B;  2JF4 A;  5E1Q A;  1KSD A;  3D3I A;  1GSZ A;  4RNQ A;  1LXK A;  1SII A;  3M01 A;  5DHI A;  4J5T A;  1CLC A;  1F9G A;  1RWH A;  3RX5 A;  5IK0 A;  3ACT A;  1SPU A;  1S64 B;  3WVF A;  1H3C A;  1JCS B;  1QAF A;  1OAC A;  2RGK A;  1TU5 A;  1N7R A;  3W7T A;  2V3N A;  1QWU A;  3DCD A;  3DYO A;  1L1Y A;  1F1S A;  1TN8 B;  3DSX B;  2Q1F A;  1GXO A;  1IQX A;  1LD8 B;  1RKY A;  2RI9 A;  3ALA A;  3X3X A;  3X3Z A;  3BVW A;  1HCU A;  1V7W A;  2XSG A;  3DDF A;  1KS8 A;  3OED A;  5EAS A;  3BUP A;  1NSU A;  2X03 A;  1QAZ A;  4EV5 A;  3M71 A;  1AVL A;  1MMY A;  1FBO A;  1UT9 A;  1K1X A;  1NL4 B;  2OW6 A;  1QAL A;  3S4A A;  3VSN A;  4L9P B;  3VD7 A;  2F7R A;  4GTQ B;  2WOF A;  3LZ9 A;  3Q7A B;  5ILY A;  5IL3 A;  3T08 A;  3I3D A;  3MV0 1;  4BTW A;  1N7P A;  2NOJ A;  2RDY A;  3DX3 A;  5FO7 B;  4D94 A;  2FUQ A;  1HXA A;  3PZ3 B;  3T2Q A;  1DP0 A;  1K72 A;  1RWF A;  4ZH1 A;  3D51 A;  2WDA A;  4BZF A;  3Q79 B;  4D4D A;  1H54 A;  3GZK A;  2V8J A;  2CFW A;  1ULV A;  1H3B A;  3MUY 1;  3W5N A;  1NS0 A;  3MWX A;  4BZH A;  2A8Z A;  2A73 B;  3Q73 B;  4GAX A;  1A2V A;  1K1Y A;  2XN0 A;  2FV1 A;  3WKG A;  1L7J A;  1DCE B;  3T0U A;  1W6K A;  2V8K A;  3AMO A;  1FT1 B;  3QT3 A;  5AGD A;  2WYN A;  1OJM A;  3WIQ A;  1NS7 A;  3SDQ A;  1JZ8 A;  4AYO A;  2CWU A;  4V1R A;  3HXC B;  1NC5 A;  1QWN A;  4ZRQ A;  1HXG A;  3VW5 A;  2OW7 A;  3E80 A;  3DX2 A;  1RWG A;  4BTX A;  3MV1 1;  1G9G A;  3WIW A;  1R34 A;  3W5M A;  3CU7 A;  1UI7 A;  2ONH A;  3VD4 A;  3M00 A;  1N7N A;  4AYR A;  3NFV A;  1TNO B;  1NSR A;  4WVB A;  1TF4 A;  1F4H A;  1X1H A;  3T33 A;  4OK4 A;  1O7D D;  3E6U A;  1N4R B;  2V8I A;  1NXC A;  1WMN A;  1AVK A;  3X3Y A;  1PX4 A;  1KRE A;  3DSU B;  3GT5 A;  2Y73 A;  1L2A A;  1WU4 A;  2CQS A;  3D50 A;  3DX0 A;  1V7V A;  1RW9 A;  1MMU A;  1AV4 A;  2ZXQ A;  1FMI A;  2B4F A;  1NSS A;  3BLC A;  4BOK A;  2ZQ0 A;  1GA2 A;  1TQT A;  2F7Q A;  1HV6 A;  1UI8 A;  4EL8 A;  2VN7 A;  4FNT A;  1O6H A;  4LNG B;  1TNZ B;  4KKI A;  1N4Q B;  2XWB B;  4DOD A;  5EAU A;  1H37 A;  2WY8 A;  1HN0 A;  3DST B;  2E2T A;  2JKP A;  3KN4 A;  1QAK A;  1MMX A;  2OOV A;  2F1B A;  3M77 A;  1TNU B;  2DRS A;  2EAC A;  2GH4 A;  1N24 A;  4YCR A;  3DSV B;  3QWT A;  3REN A;  1H35 A;  3VXD A;  2H6F B;  3H2W A;  3LOY A;  3IMH A;  2BED B;  3BLB A;  2PNC A;  2XFG A;  3QRY A;  1HWW A;  1HM2 A;  3TY1 A;  1NS2 A;  2WYH A;  1NSX A;  3SAE A;  1NKG A;  1F9O A;  4D4B A;  3DYP A;  1W5Z A;  3NJX A;  3OS7 A;  1JYW A;  5JPM B;  3BUD A;  3NBJ A;  2FUT A;  1KZP B;  1F9D A;  4MMI A;  2WW3 A;  3E7J A;  3DSW B;  2E22 A;  1W6J A;  4GL3 A;  4EHM B;  4OZV A;  4FNQ A;  3K25 A;  3P5R A;  1NS8 A;  1R33 A;  1YQ2 A;  3DX4 A;  3WKI A;  1O1T B;  3M02 A;  2WIN B;  3E33 B;  2I07 B;  1FT2 B;  3M72 A;  3M74 A;  4DUV A;  3N0F A;  3X42 A;  1I8Q A;  1O79 A;  4BOJ A;  3EJR A;  1N23 A;  3S9V A;  2BBC A;  5FOB B;  5JMD A;  4JJJ A;  1N1Z A;  2Z07 A;  2CFK A;  1IVW A;  3BVT A;  3WC3 A;  3T0D A;  1N1B A;  4ZG8 A;  3W7X A;  2V3P A;  3VD5 A;  2CQT A;  4L6X A;  1H36 A;  4WVC A;  3NNB A;  1D6U A;  2ONG A;  1F4A A;  1LOH A;  1OJN A;  2H6H B;  3DRA B;  1OJO A;  4MBG B;  4LIX A;  3EJT A;  1UMP A;  3QT9 A;  2OOV C;  3E32 B;  3ANJ A;  3RX8 A;  1V7X A;  3G4D A;  2E24 A;  1SA4 B;  2C11 A;  3D4Y A;  3Q7F B;  1FBW A;  1IA7 A;  1W3Y A;  2XHN A;  4BTY A;  1JZ5 A;  1J0M A;  4OZW A;  3PYB A;  3P2C A;  3N9H A;  1LF9 A;  1JZ7 A;  2VN4 A;  4FNV A;  2DRO A;  1QBQ B;  3QG0 A;  2B39 A;  3NBB A;  2R2L B;  2JG0 A;  1WU5 A;  5ILI A;  3D52 A;  3PZ1 B;  3NJV A;  5IK9 A;  2OQE C;  4FNP A;  4EV2 A;  2JJB A;  5JMF A;  1D6Z A;  3CZJ A;  3IAP A;  3PZ4 B;  1NI1 B;  3W7W A;  2DRQ A;  3EJP A;  4MU9 A;  1JOV A;  1W7C A;  1H14 A;  1MMZ A;  2P0V A;  2QNO A;  2C10 A;  3PZ2 B;  4FXK B;  2G02 A;  3X17 A;  3N0G A;  4GTM B;  1O6Q A;  3SFY B;  1EKM A;  3HXF B;  2BRP A;  1X81 B;  3A0O A;  3AFL A;  5IKH A;  5C05 A;  3KQ4 A;  4KTP A;  4FJQ A;  4D4A A;  1G6I A;  4F10 A;  3HII A;  2D1W A;  4TF4 A;  3CV5 A;  3SDT A;  3G4F A;  5DGQ A;  5MEH A;  3EJS A;  5FO9 B;  3QXF A;  3RRS A;  1DL2 A;  2WZS A;  5ILH A;  3HI7 A;  1G87 A;  2OKX A;  1XWT A;  1W6C A;  1H39 A;  2EAE A;  4DUW A;  1IVV A;  3ECQ A;  1DOG A;  3P5P A;  2CG1 A;  4KTR A;  1TQV A;  4AQ0 A;  1HMU A;  2BRW A;  2ZBL A;  4CE7 A;  3E1F 1;  1VD5 A;  1GLM A;  4DUX A;  3I3E A;  2ALW A;  2CWV A;  4KFF A;  5CA3 A;  1R76 A;  3PMM A;  3M7E A;  5IL8 A;  3DX1 A;  3QPF A;  1W2Z A;  1US1 A;  1TQU A;  1TNY B;  1JCQ B;  3E30 B;  3E34 B;  5DGR A;  5GY3 A;  1N4P B;  5FO8 B;  2ZIS B;  1X1I A;  2W0Q A;  1L7K A;  1SQC A;  2AHF A;  1TN7 B;  3NRE A;  4C1S A;  5ILJ A;  1V5D A;  4MMH A;  2J5C A;  3D5S A;  4DI5 A;  1G9J A;  2CG0 A;  1SO0 A;  3T09 A;  3ON6 A;  2EAB A;  4GTS B;  3W7S A;  4OK2 A;  3QXQ A;  1GHQ A;  3ANI A;  4FNR A;  3W7U A;  3EJQ A;  1KZO B;  2F7O A;  5GW7 A;  1HTY A;  2CIS A; 
#chains in the Genus database with same CATH homology
 2AFA A;  3IAQ A;  1H13 A;  4YDO B;  1UG9 A;  1LXM A;  3QDE A;  2BB6 A;  1C3D A;  1NSM A;  3VSM A;  1GAI A;  2HTA A;  3H3K A;  3RX7 A;  3EUV B;  4FUS A;  5KKB A;  1K1W A;  4GTV B;  2PN5 A;  3DSS B;  3SQC A;  2FBA A;  3DPY B;  4GTT B;  1N7Q A;  1SNZ A;  3EU5 B;  2WVY A;  4LNV A;  4BZE A;  1J0N A;  3E73 A;  4ONT A;  5M7I A;  1NSZ A;  4TTG A;  3QFY A;  4GTP B;  2IEJ B;  1WU6 A;  1HN1 A;  1FO2 A;  3OXU A;  1AYX A;  2WVZ A;  1PX3 A;  1LD7 B;  2XWJ B;  3HXE B;  3SEP A;  4WU0 A;  3M7C A;  1LF6 A;  2CIR A;  3MUZ 1;  1JCR B;  2WW1 A;  3PYA A;  3SFX B;  4KKJ A;  1JYN A;  1LTX B;  1RWC A;  1JZ6 A;  1KRF A;  1TNB B;  3VDA A;  2F6D A;  2AHG A;  3M76 A;  2H6G B;  1KFG A;  1O1R B;  1HMW A;  2BB5 A;  4GTO B;  2BRV X;  3H7L A;  3KSL B;  3WKH A;  1LUR A;  3ANK A;  1V5C A;  3C72 B;  3OB8 A;  1JZ3 A;  3T2P A;  5M7Y A;  3S4D A;  1MN0 A;  2WY7 A;  1N7O A;  3WFA A;  4V1S A;  3SDV A;  4D4C A;  1FO3 A;  1FAE A;  1C82 A;  1OJP A;  3M7B A;  1NS4 A;  3T0A A;  1N94 B;  1HZF A;  1S63 B;  3RSY A;  2FV0 A;  3J7H A;  2ZIR B;  3SDR A;  2WII B;  3WKF A;  1X1J A;  3WUX A;  3S4C A;  4DOE A;  3DEC A;  1X9D A;  1D8D B;  4TXT A;  3ACS A;  1SA5 B;  5E2J A;  3RJ3 A;  3HXD B;  3SDU A;  1FCE A;  1KKT A;  3Q1N A;  3T2O A;  5CD2 A;  1CB8 A;  4AYQ A;  3KLS A;  3K7X A;  3DYM A;  2D73 A;  1QSJ A;  4L0G A;  1TXK A;  1N9A B;  2DRR A;  2WVX B;  3OBA A;  3EU8 A;  1EGU A;  1GAH A;  5JPN B;  3I3B A;  1O6R A;  3A24 A;  2SQC A;  1FPP B;  3VD3 A;  2GOX A;  4NEI A;  5CZL A;  2WCO A;  1H3A A;  3M7L A;  1CEM A;  2YIK A;  1MZC B;  1YGA A;  4ZH5 A;  3E37 B;  1XW2 A;  5A1A A;  4Q88 A;  2HTB A;  2GZ6 A;  1N4S B;  3HXB B;  4AYP A;  4WVA A;  1KWF A;  3M75 A;  3S4B A;  4Z4J A;  3VDC A;  3EQA A;  2D8L A;  4CJ0 A;  4CJ1 A;  2ZZR A;  2RI8 A;  4QT9 A;  2NVP A;  3EZ8 A;  2WW2 A;  1JZ4 A;  1RWA A;  3D5R A;  4M76 A;  3CIH A;  4FXG B;  4Z4L A;  1IA6 A;  1KSC A;  1NSV A;  3WIR A;  1N95 B;  3AFJ A;  4ZRP A;  4XUV A;  3QFZ A;  3Q78 B;  3M73 A;  1JYV A;  3M78 A;  1WZZ A;  3QSP A;  3TF4 A;  1GXM A;  1QQF A;  3GLY A;  1O1S B;  4OJZ A;  3Q75 B;  2CIQ A;  2WW0 A;  3VD9 A;  2D5J A;  1FP3 A;  2WVX A;  4BZG A;  1GXN A;  4RNL A;  3T0B A;  1HM3 A;  1IS9 A;  1XWQ A;  1TN6 B;  4GTR B;  4YDE B;  1Z45 A;  3BS6 A;  2G0D A;  2JKE A;  3VDB A;  3A3V A;  2XQW A;  1H12 A;  2F0Y B;  1JS4 A;  1AGM A;  2H6I B;  5GZK A;  2PMV A;  1D8E B;  1JZ2 A;  3K11 A;  4LNB B;  2EAD A;  3BGA A;  1RQ5 A;  2JKA A;  2FUZ A;  1JYX A;  3G6J B;  4Q2B A;  1O5M B;  3KSQ B;  2JF4 A;  5E1Q A;  1KSD A;  1GSZ A;  3D3I A;  1LXK A;  4J5T A;  1CLC A;  3RX5 A;  1F9G A;  1RWH A;  3ACT A;  1S64 B;  3WVF A;  1H3C A;  1JCS B;  2RGK A;  1N7R A;  3W7T A;  2V3N A;  3DCD A;  3DYO A;  1L1Y A;  1TN8 B;  3DSX B;  1F1S A;  2Q1F A;  1GXO A;  1LD8 B;  2RI9 A;  1HCU A;  1V7W A;  2XSG A;  1KS8 A;  3OED A;  1NSU A;  2X03 A;  3M71 A;  1MMY A;  1FBO A;  1UT9 A;  1K1X A;  1NL4 B;  3S4A A;  3VSN A;  4L9P B;  3VD7 A;  4GTQ B;  3Q7A B;  3T08 A;  3I3D A;  3MV0 1;  1N7P A;  2NOJ A;  5FO7 B;  4D94 A;  2FUQ A;  3PZ3 B;  3T2Q A;  1DP0 A;  1K72 A;  1RWF A;  4ZH1 A;  2WDA A;  4BZF A;  3Q79 B;  4D4D A;  1H54 A;  3GZK A;  2V8J A;  1ULV A;  1H3B A;  3MUY 1;  3W5N A;  1NS0 A;  3MWX A;  4BZH A;  2A8Z A;  2A73 B;  3Q73 B;  1K1Y A;  2FV1 A;  3WKG A;  1L7J A;  1DCE B;  1W6K A;  2V8K A;  1FT1 B;  3QT3 A;  5AGD A;  2WYN A;  1OJM A;  3WIQ A;  1NS7 A;  3SDQ A;  1JZ8 A;  4AYO A;  4V1R A;  3HXC B;  1NC5 A;  4ZRQ A;  3VW5 A;  3E80 A;  1RWG A;  3MV1 1;  1G9G A;  3WIW A;  3W5M A;  3CU7 A;  3VD4 A;  1N7N A;  4AYR A;  1TNO B;  1NSR A;  4WVB A;  1TF4 A;  1F4H A;  1X1H A;  3T33 A;  4OK4 A;  3E6U A;  1N4R B;  2V8I A;  1NXC A;  1PX4 A;  1KRE A;  3DSU B;  3GT5 A;  1L2A A;  1WU4 A;  2CQS A;  1V7V A;  1RW9 A;  1MMU A;  2ZXQ A;  1FMI A;  2B4F A;  1NSS A;  3BLC A;  4BOK A;  2ZQ0 A;  1GA2 A;  4EL8 A;  2VN7 A;  1O6H A;  4LNG B;  1TNZ B;  4KKI A;  1N4Q B;  2XWB B;  4DOD A;  1H37 A;  2WY8 A;  3DST B;  1HN0 A;  2JKP A;  1MMX A;  3M77 A;  1TNU B;  2DRS A;  2EAC A;  2GH4 A;  4YCR A;  3DSV B;  3QWT A;  3REN A;  1H35 A;  3VXD A;  2H6F B;  3H2W A;  3IMH A;  2BED B;  2XFG A;  3QRY A;  1HM2 A;  3TY1 A;  1NS2 A;  1NSX A;  3SAE A;  1NKG A;  1F9O A;  4D4B A;  3DYP A;  3NJX A;  1JYW A;  3OS7 A;  5JPM B;  2FUT A;  1KZP B;  1F9D A;  2WW3 A;  4MMI A;  3E7J A;  3DSW B;  4EHM B;  1W6J A;  4GL3 A;  2E22 A;  3K25 A;  3P5R A;  1NS8 A;  1YQ2 A;  3WKI A;  1O1T B;  2WIN B;  3E33 B;  2I07 B;  1FT2 B;  3M72 A;  3M74 A;  4DUV A;  1I8Q A;  1O79 A;  4BOJ A;  3S9V A;  2BBC A;  5FOB B;  5JMD A;  4JJJ A;  2Z07 A;  3WC3 A;  3T0D A;  4ZG8 A;  3W7X A;  2V3P A;  3VD5 A;  2CQT A;  4L6X A;  1H36 A;  4WVC A;  1F4A A;  1LOH A;  2H6H B;  3DRA B;  4MBG B;  4LIX A;  1OJO A;  1OJN A;  1UMP A;  3QT9 A;  3E32 B;  3ANJ A;  3RX8 A;  1V7X A;  2E24 A;  1SA4 B;  3Q7F B;  1FBW A;  1IA7 A;  1W3Y A;  2XHN A;  1JZ5 A;  1J0M A;  3PYB A;  3P2C A;  1LF9 A;  1JZ7 A;  2VN4 A;  4FNV A;  2DRO A;  1QBQ B;  3QG0 A;  2B39 A;  2R2L B;  2JG0 A;  1WU5 A;  3PZ1 B;  3NJV A;  2JJB A;  5JMF A;  3CZJ A;  3IAP A;  3PZ4 B;  1NI1 B;  3W7W A;  2DRQ A;  4MU9 A;  1JOV A;  1H14 A;  1MMZ A;  2P0V A;  2QNO A;  3PZ2 B;  4FXK B;  2G02 A;  3X17 A;  4GTM B;  1O6Q A;  3SFY B;  3HXF B;  2BRP A;  1X81 B;  3A0O A;  3AFL A;  3KQ4 A;  4KTP A;  4D4A A;  1G6I A;  4TF4 A;  3SDT A;  5DGQ A;  5MEH A;  5FO9 B;  3QXF A;  3RRS A;  1DL2 A;  2WZS A;  1G87 A;  2OKX A;  1XWT A;  1H39 A;  2EAE A;  4DUW A;  3ECQ A;  1DOG A;  3P5P A;  4KTR A;  4AQ0 A;  1HMU A;  2ZBL A;  2BRW A;  4CE7 A;  3E1F 1;  1VD5 A;  1GLM A;  4DUX A;  3I3E A;  5CA3 A;  1R76 A;  3PMM A;  3M7E A;  3QPF A;  1TNY B;  1JCQ B;  3E30 B;  3E34 B;  5DGR A;  5GY3 A;  1N4P B;  5FO8 B;  2ZIS B;  1X1I A;  1L7K A;  1SQC A;  2AHF A;  1TN7 B;  3NRE A;  4C1S A;  1V5D A;  4MMH A;  3D5S A;  1G9J A;  1SO0 A;  3T09 A;  3ON6 A;  2EAB A;  4GTS B;  3W7S A;  4OK2 A;  3QXQ A;  1GHQ A;  3ANI A;  3W7U A;  1KZO B;  5GW7 A;  2CIS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...