1LF6A

Crystal structure of bacterial glucoamylase
Total Genus 242
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
242
sequence length
674
structure length
674
Chain Sequence
SIKIDRFNNISAVNGPGEEDTWASAQKQGVGTANNYVSKVWFTLANGAISEVYYPTIDTADVKEIKFIVTDGKSFVPDETKDAISKVEKFTDKSLGYKLVNTDKKGRYRITKDIFTDVKRNSLIMKAKFEALEGSIHDYKLYLAYDPHIKNQGSYNEGYVIKANNNEMLMAKRDNVYTALSSNIGWKGYSIGYYKVNDIMTDLDENKQMTKHYDSARGNIIEGAEIDLTKNSEFEIVLSFGQSDSEAAKTALETLGEDYNNLKNNYIDEWTKYCNTLNNFNGKANSLYYNSMMILKASEDKTNKGAYIASLSIPWGDGQRDDNTGGYHLVWSRDLYHVANAFIAAGDVDSANRSLDYLAKVVKDNGMIPQNTWISGKPYWTGIQLDEQADPIILSYRLKRYDLYDSLVKPLADFIIKIGPKTGQERWEEIGGYSPATMAAEVAGLTCAAYIAEQNKDYESAQKYQEKADNWQKLIDNLTYTENGPLGNGQYYIRIAGLSDPDADFMINIANGGGVYDQKEIVDPSFLELVRLGVKSADDPKILNTLKVVDSTIKVDTPKGPSWYRYNHDGYGEPSKTELYHGAGKGRLWPLLTGERGMYEIAAGKDATPYVKAMEKFANEGGIISEQVWEDTGLPTDSASPLNWAHAEYVILFASNIEHKVLDMPDIVYKRYVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords glucoamylase
publication title Crystal structure and evolution of prokaryotic glucoamylase
pubmed doi rcsb
molecule tags Hydrolase
total genus 242
structure length 674
sequence length 674
chains with identical sequence B
ec nomenclature ec 3.2.1.3: Glucan 1,4-alpha-glucosidase.
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00723 Glyco_hydro_15 Glycosyl hydrolases family 15
A PF09137 Glucodextran_N Glucodextranase, domain N
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1lf6A02
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1lf6A01
5GY3A 2BRPA 2HTAA 4Q88A 3VDAA 1FMIA 4ZG8A 1LOHA 4BZEA 1GAIA 3RENA 1MMZA 3T0BA 1N7RA 3NJVA 4CJ1A 3S4DA 2CQSA 1WZZA 1PX4A 3S4CA 1J0NA 2VN4A 1NS0A 3E73A 3EZ8A 3GT5A 1GLMA 3H2WA 2OKXA 5M7IA 1H14A 3S4AA 2WW2A 1KFGA 1JYNA 2WW0A 1MMXA 3H7LA 1G87A 1JYWA 3W5MA 3W7UA 1TF4A 3OBAA 4RNLA 2JKAA 3WIQA 1ULVA 2QNOA 3P2CA 3A24A 2JKPA 1JYXA 1YQ2A 2NVPA 1N7QA 1JZ3A 5CD2A 1X9DA 2DRRA 1YGAA 2BRVX 3ACSA 3K11A 3VW5A 1KSCA 1MMYA 4L0GA 3T2PA 1V5CA 1L7JA 5DGQA 1LF9A 5E2JA 5MEHA 4DUXA 3I3DA 2FUZA 3J7HA 3VD7A 3D3IA 4DUVA 2FV1A 2E22A 2B4FA 1RWGA 5CZLA 1NSVA 3T33A 1OJPA 3CZJA 1H54A 1RQ5A 2CQTA 2WYNA 4TXTA 1N7OA 3VD9A 3ANKA 3DCDA 3WFAA 2WVXB 1DOGA 3QSPA 1K1WA 5DGRA 4AYPA 3QPFA 2ZBLA 2F6DA 3QXQA 1LXMA 1V7VA 1AYXA 1K1XA 1L7KA 1RWFA 1SO0A 1NSRA 1JZ8A 1W3YA 1JZ5A 1XW2A 3QFZA 3W7XA 3T09A 3WC3A 3MWXA 2WDAA 1I8QA 4TTGA 1TXKA 4AYOA 1JYVA 1DL2A 1CB8A 4KTRA 3VD3A 3WIRA 1HN0A 3QT3A 1L1YA 3WKIA 2WVZA 3E6UA 3OB8A 1VD5A 1F1SA 1LXKA 1G9GA 3ANJA 4TF4A 1NSSA 2WCOA 3Q1NA 3T0AA 4KTPA 4AQ0A 1EGUA 4WU0A 3W7WA 1PX3A 2YIKA 2AHGA 3I3EA 3ACTA 1X1IA 2AHFA 3VXDA 1RWHA 1FCEA 4DOEA 3T0DA 4DODA 3IMHA 1JOVA 1V7WA 1X1HA 4AYQA 1LF6A 3MV11 1IA6A 1F9GA 2WZSA 1NSMA 3WKHA 2HTBA 2ZXQA 1WU6A 3NJXA 1HCUA 2Z07A 1H12A 1DP0A 1WU4A 3RSYA 3T2OA 1CEMA 1JZ4A 1UT9A 1N7NA 1X1JA 1JZ2A 3OS7A 2XFGA 2FBAA 3VDBA 3ON6A 5M7YA 3T2QA 1UG9A 1JZ6A 3GLYA 1IA7A 5KKBA 1NS4A 1FP3A 3SEPA 1L2AA 3MV01 3DECA 2RGKA 2D73A 3DYPA 3QFYA 3I3BA 2GZ6A 2RI8A 1NS8A 1NSUA 3DYOA 1KREA 1K72A 3W7SA 4EL8A 2VN7A 2RI9A 2AFAA 3E1F1 2DRSA 1F9OA 4BZGA 4ZH5A 1SNZA 3MUZ1 4BZHA 4L6XA 5GW7A 2EAEA 3RX8A 2E24A 1H13A 2JKEA 2XSGA 3QT9A 1RWCA 1HN1A 1F4AA 4Q2BA 2BRWA 1G6IA 2X03A 1C82A 4WVBA 3PMMA 1OJNA 1AGMA 2ZQ0A 2WW1A 1IS9A 4WVCA 2JJBA 2WVYA 4J5TA 3VD5A 1KS8A 2D8LA 1FO3A 3X17A 1RWAA 3MUY1 2D5JA 1JZ7A 3T08A 1KSDA 3NREA 1WU5A 2GH4A 3QXFA 1FAEA 2JF4A 3S4BA 4FUSA 2JG0A 2CISA 1NXCA 4Z4JA 1KWFA 2ZZRA 2CIRA 1K1YA 4XUVA 3RRSA 5A1AA 3H3KA 1HMUA 3IAPA 1NSZA 1N7PA 1MMUA 1HM3A 3K25A 2EADA 3DYMA 1MN0A 3RX5A 2WVXA 1LURA 1FBWA 4JJJA 3VD4A 4AYRA 3W7TA 1RW9A 1NS7A 3TF4A 1KKTA 1G9JA 2P0VA 2DROA 1HM2A 1FO2A 1NKGA 3IAQA 3QWTA 1XWTA 5E1QA 1Z45A 1NC5A 4Z4LA 1GA2A 4DUWA 2Q1FA 2FV0A 2CIQA 3VDCA 2WW3A 3WKGA 1FBOA 3QG0A 1NS2A 1GAHA 1HMWA 1OJMA 2EABA 1J0MA 3RX7A 2A8ZA 3ANIA 3AFJA 1F4HA 1XWQA 4CJ0A 3EQAA 3BGAA 2EACA 1V7XA 2XHNA 3QRYA 3WIWA 4BZFA 2DRQA 3CIHA 4CE7A 3A3VA 5CA3A 1F9DA 1NSXA 1V5DA 1JS4A 3WKFA 3WUXA 1KRFA 1OJOA 1CLCA 3QDEA 4WVAA 3ECQA 3W5NA 3GZKA
chains in the Genus database with same CATH superfamily
5GY3A 2CWUA 3EJSA 2BRPA 2HTAA 4Q88A 2WO0A 2F1BA 3VDAA 1FMIA 2H6IB 4ZG8A 1LOHA 4BZEA 1N9AB 2BB6A 5FOBB 1GAIA 1W4NA 1WMPA 3M75A 1IVUA 3X42A 3RENA 1MMZA 2G02A 2WY8A 3T0BA 1N7RA 4MU9A 1KSIA 3NJVA 2E2TA 4CJ1A 1H37A 3EU8A 3G4FA 3S4DA 2CQSA 1WZZA 3E37B 3TY1A 1PX4A 3AMOA 2PN5A 2A73B 3S4CA 1X81B 2PMVA 1J0NA 3D51A 4EHMB 1O6QA 2VN4A 1NS0A 3SDQA 1IVVA 3E73A 1N1BA 3EZ8A 3GT5A 1GLMA 1O5MB 1GXNA 1TQSA 3H2WA 4MBGB 3T0UA 2OKXA 5M7IA 1N4PB 1H14A 3S4AA 5EATA 4LNBB 5FO9B 2WW2A 1KFGA 2B39A 3E34B 2OQEC 2V8JA 1AVLA 1N9EA 2WW0A 1JYNA 1MMXA 3H7LA 1G87A 1SIHA 2WOHA 4D4AA 1JYWA 4KFFA 3DSXB 1TN8B 3W5MA 4YDEB 3W7UA 1TF4A 3OBAA 4RNLA 2CFDA 2JKAA 1TQWA 1OACA 3WIQA 1TQTA 1ULVA 1WMOA 2QNOA 3NFVA 1HXAA 4KFDA 4D94A 2ONGA 1PU4A 3P2CA 3A24A 3M74A 2BB5A 2JKPA 1QSJA 1PS3A 1YQ2A 2NVPA 1JYXA 1N7QA 3SDTA 1H3AA 1JZ3A 3DX1A 5CD2A 1W7CA 1X9DA 3N0FA 2DRRA 2ZISB 4MMHA 5FO7B 2BBCA 3VSNA 3K7XA 2BRVX 1YGAA 3ACSA 1N4QB 1JCSB 3K11A 3M7LA 5DHIA 1KSCA 5EASA 3VW5A 1MMYA 1TQUA 3HIGA 2CG1A 2H6GB 4L0GA 3T2PA 3DSVB 1V5CA 4E1YA 3D5SA 2E2VA 3NNBA 1L7JA 2GOXA 5DGQA 1LF9A 5E2JA 3M01A 5MEHA 4DUXA 1QAFA 3I3DA 2FUZA 4GTQB 1D6ZA 1HXCA 1W6JA 3J7HA 4OZWA 5DHKA 5IKHA 4K3AA 3D52A 3VD7A 1W6KA 3D3IA 4DUVA 2XN0A 2FV1A 2E22A 2B4FA 1RWGA 3M7EA 3DRAB 5CZLA 1NSVA 3T33A 1OJPA 5ILKA 3PZ2B 3LVTA 4FNTA 3CZJA 1H54A 5C05A 2BT3A 5ILJA 1RQ5A 2CQTA 2WYNA 4TXTA 4EV5A 1N20A 1N7OA 3VD9A 5IM1A 1N4RB 2H6FB 3BVVA 2ONHA 3Q7FB 3ANKA 4KKJA 3DCDA 3WFAA 1WMNA 3CU7A 3E7JA 2WVXB 1DOGA 3QSPA 3S9VA 1K1WA 3MPHA 1QX1A 3P5RA 5DGRA 4AYPA 3BUDA 4D4BA 3E80A 3QPFA 3CV5A 3NBBA 1QQFA 1DCEB 2XWJB 2ZBLA 2NOJA 5JMFA 2F6DA 3QXQA 4LNGB 5ILHA 3D50A 1LXMA 3HXFB 1AYXA 1V7VA 2F7OA 3BVWA 5AGDA 3M7BA 1K1XA 3C72B 5IL3A 2OOVC 4F13A 5FO8B 1L7KA 4OZVA 1RWFA 1SO0A 3DDFA 5JMDA 1NSRA 1JZ8A 1S63B 2G0DA 1W3YA 2CFLA 4FNQA 1JZ5A 1XW2A 1D6UA 3QFZA 3W7XA 3T09A 3WC3A 1TNBB 3MWXA 4NEIA 1GSZA 1TU5A 3SDVA 2WDAA 2F7RA 1I8QA 2F1AA 4TTGA 1TXKA 3Q75B 4AYOA 1JYVA 5GZKA 3M02A 1CB8A 1DL2A 3LZ9A 3OXUA 2C11A 4KTRA 3VD3A 4QT9A 3WIRA 1HN0A 3QT3A 3SDUA 1L1YA 3WKIA 2WVZA 3BUBA 3E6UA 1SIIA 3HXEB 1QAKA 3OB8A 1VD5A 2CG0A 1F1SA 2CFWA 2SQCA 2F7QA 3BUPA 1IVXA 1LXKA 4L9PB 1HTYA 1G9GA 3DPYB 3DX3A 3DSTB 3ANJA 4TF4A 4KFEA 1NSSA 1O1SB 2WY7A 2WCOA 3Q1NA 1D8EB 3T0AA 2F0YB 3KQ4A 3X41A 4KTPA 1O79A 3WVFA 2WINB 2C10A 4AQ0A 1EGUA 4GAXA 4WU0A 3W7WA 1PX3A 2WOFA 2YIKA 2AHGA 3PZ3B 3I3EA 2I07B 3SX1A 3ACTA 2V8KA 1X1IA 2AHFA 2H6HB 2V3NA 2CFGA 3VXDA 1RWHA 3M71A 2OW6A 1FCEA 1HXGA 1N21A 1W6CA 4DOEA 3T0DA 4DODA 3A0OA 1LD7B 1IQYA 1N95B 3IMHA 3PZ1B 1V7WA 1JOVA 1X1HA 4BOJA 3DX4A 4AYQA 3NBJA 1LF6A 4GTTB 1N4SB 3MV11 1IA6A 1SPUA 3X3XA 3P5PA 1MZCB 5EAUA 3BVUA 1F9GA 3M72A 2WZSA 3SAEA 1NSMA 2Y74A 3WKHA 2HTBA 2ZXQA 1JCRB 3DSSB 1WU6A 3AMOB 3NJXA 1HCUA 2Z07A 1H12A 4FXKB 1DP0A 1GXOA 4GTPB 1AVKA 1WU4A 3RSYA 4FNUA 4GTVB 1D6YA 5JPMB 3BUIA 3T2OA 3RJ3A 3DDGA 1O6RA 1CEMA 1JZ4A 1AV4A 2XN2A 1UT9A 1N7NA 1X1JA 4OK4A 3N0GA 1TN7B 3KIIA 1JZ2A 3OS7A 3EU5B 2XFGA 2FBAA 5ILZA 1TQVA 2WGQA 3BUQA 3M00A 3VDBA 1EKMA 3ON6A 5M7YA 3T2QA 1H35A 1R76A 1UG9A 1N23A 1JZ6A 1IVWA 4F10A 1QBQB 4GL3A 4D4CA 3N9HA 3GLYA 4FNPA 1IA7A 3M7CA 5KKBA 1NS4A 2IEJB 1FP3A 1A2VA 1L2AA 3SEPA 1SQCA 3MV01 2FUQA 2E2UA 3DECA 2RGKA 5IK9A 2D73A 3DYPA 3QFYA 3E33B 2GZ6A 3I3BA 3M78A 2RI8A 1NS8A 2ALWA 4BOKA 1NSUA 3DYOA 1KREA 1K72A 3W7SA 3SFXB 1HXKA 2D1WA 3LOYA 4EL8A 2VN7A 2RI9A 2BEDB 1KZPB 2AFAA 4ZRPA 1GXMA 2CWVA 2RDYA 3E1F1 2DRSA 4YCRA 3EJRA 1F9OA 1RKYA 1TNOB 1S64B 2V8IA 1JRQA 2XN1A 4BZGA 2OQEA 3EUVB 3HXBB 3Q78B 4ZH5A 1SNZA 1N94B 2V3PA 3MUZ1 4EV2A 4BZHA 4L6XA 2YFNA 5GW7A 2EAEA 1W5ZA 3RX8A 3Q7AB 2E24A 1GHQA 1H13A 1LTXB 2XQWA 2JKEA 2XSGA 3QT9A 2F18A 1RWCA 3ALAA 1HN1A 1F4AA 4MMIA 2BRWA 4Q2BA 4ZRQA 1G6IA 3BLCA 2X03A 4ZH1A 3CZNA 4GTMB 1C82A 1HX9A 4WVBA 3AFLA 3PMMA 1OJNA 1FT2B 1QAZA 1QALA 1AGMA 3BLBA 2ZQ0A 2WW1A 1IS9A 3D4YA 3G6JB 1NL4B 3OEDA 4OJZA 4WVCA 2JJBA 2WVYA 4J5TA 3D5RA 3VD5A 1KS8A 2ZIRB 4FNVA 2D8LA 3K5TA 3M73A 1R34A 1SA5B 3WA2X 1FO3A 3X17A 1JCQB 1RWAA 3SDRA 1TNZB 3X3ZA 3MUY1 2D5JA 2ZL8A 1N24A 2WIIB 1JZ7A 4LNVA 3T08A 1KSDA 4YDOB 4DI5A 3MI6A 3NREA 1N1ZA 1HV6A 1WU5A 5ILDA 2GH4A 3QXFA 1FAEA 2JF4A 3EJPA 2PNCA 3S4BA 4FUSA 2JG0A 2CISA 1NXCA 4Z4JA 2R2LB 1KWFA 2YFOA 1R33A 2ZZRA 5ILYA 1FT1B 2CIRA 1K1YA 1LD8B 4XUVA 3RRSA 3EJTA 4FJQA 5A1AA 3H3KA 1HMUA 3IAPA 2J5CA 1N7PA 1NSZA 1FPPB 1MMUA 4RNQA 1HM3A 3K25A 3KSQB 3HXDB 1LVNA 2EADA 3DYMA 1MN0A 1NI1B 1HZFA 3RX5A 1H39A 2WVXA 1H3BA 1LURA 3X40A 4BTXA 1FBWA 4BTYA 3CZSA 2CWTA 1C3DA 1KZOB 1US1A 4JJJA 1IQXA 3M76A 3KLSA 3Q79B 3VD4A 3BVTA 4AYRA 5IKAA 3SXXA 1UMPA 4D4DA 1UI8A 2Y73A 3PGBA 3W7TA 1RW9A 1NS7A 3TF4A 1TNUB 2WYHA 5IL8A 3PZ4B 3KSLB 1D8DB 1KKTA 2CFKA 3G4DA 1RJOA 1G9JA 3HI7A 2OOVA 3HIIA 1O1TB 5IK6A 2P0VA 2DROA 1HM2A 1FO2A 3E32B 1NKGA 3D4ZA 3EJQA 3QWTA 1XWTA 5IK0A 3IAQA 1O1RB 1NC5A 1Z45A 5E1QA 4Z4LA 1GA2A 1N22A 4DUWA 2Q1FA 2FV0A 5JPNB 3DSWB 2CIQA 4LIXA 2YX9A 3DX2A 4OK2A 3VDCA 2WW3A 4GTOB 2F7PA 3WKGA 3BS6A 1FBOA 3QG0A 4ONTA 1NS2A 1GAHA 4K35A 1H36A 4V1RA 1UI7A 4UFCA 3KN4A 1W6GA 3PYBA 1HMWA 1OJMA 2EABA 3DSUB 1J0MA 3RX7A 3BVXA 2A8ZA 3X3YA 4FNRA 3SFYB 3M77A 3ANIA 1QWUA 3PYAA 3AFJA 1F4HA 3WA3A 1XWQA 1W2ZA 4CJ0A 3EQAA 4FXGB 3BGAA 2EACA 1V7XA 2XHNA 3QRYA 3DX0A 1H3CA 4GTSB 2OW7A 3Q73B 3SQCA 3HXCB 1O6HA 2FYVA 5ILIA 3EJUA 4KKIA 3WIWA 2FUTA 1IU7A 1TN6B 4BZFA 2DRQA 1QWNA 4BTWA 1TNYB 4V1SA 3CIHA 2WYIA 3VSMA 4CE7A 4GTRB 1DYUA 5KBPA 3A3VA 5CA3A 1F9DA 4FNSA 2W0QA 1HWWA 4M76A 1NSXA 1V5DA 1JS4A 4C1SA 1O7DD 3WKFA 3WUXA 1SA4B 1KRFA 1OJOA 1CLCA 3QDEA 4WVAA 3ECQA 3E30B 2XWBB 3W5NA 3GZKA
chains in the Genus database with same CATH topology
5GY3A 2BRPA 2HTAA 4Q88A 3VDAA 1FMIA 2H6IB 4ZG8A 1LOHA 4BZEA 1N9AB 2BB6A 5FOBB 1GAIA 3M75A 3RENA 1MMZA 2G02A 2WY8A 3T0BA 4MU9A 1N7RA 3NJVA 4CJ1A 1H37A 3EU8A 3S4DA 2CQSA 1WZZA 3E37B 3TY1A 1PX4A 2PN5A 2A73B 3S4CA 1X81B 2PMVA 1J0NA 4EHMB 1O6QA 2VN4A 1NS0A 3SDQA 3E73A 3EZ8A 3GT5A 1GLMA 1O5MB 1GXNA 3H2WA 4MBGB 2OKXA 5M7IA 1N4PB 1H14A 3S4AA 5FO9B 4LNBB 2WW2A 1KFGA 2B39A 3E34B 2V8JA 1JYNA 2WW0A 1MMXA 3H7LA 1G87A 4D4AA 1JYWA 3DSXB 1TN8B 3W5MA 4YDEB 3W7UA 1TF4A 3OBAA 4RNLA 2JKAA 3WIQA 1ULVA 2QNOA 4D94A 3P2CA 3A24A 3M74A 2BB5A 2JKPA 1QSJA 1JYXA 1YQ2A 2NVPA 1N7QA 3SDTA 1H3AA 1JZ3A 5CD2A 1X9DA 2DRRA 2ZISB 5FO7B 4MMHA 2BBCA 3VSNA 3K7XA 1YGAA 2BRVX 3ACSA 1N4QB 1JCSB 3K11A 3M7LA 3VW5A 1KSCA 1MMYA 2H6GB 4L0GA 3T2PA 3DSVB 1V5CA 3D5SA 1L7JA 2GOXA 5DGQA 1LF9A 5E2JA 5MEHA 4DUXA 3I3DA 2FUZA 4GTQB 1W6JA 3J7HA 3VD7A 1W6KA 3D3IA 4DUVA 2FV1A 2E22A 2B4FA 1RWGA 3M7EA 3DRAB 5CZLA 1NSVA 3T33A 1OJPA 3PZ2B 3CZJA 1H54A 1RQ5A 2CQTA 2WYNA 4TXTA 1N7OA 3VD9A 1N4RB 2H6FB 3Q7FB 3ANKA 4KKJA 3DCDA 3WFAA 3CU7A 3E7JA 2WVXB 1DOGA 3QSPA 3S9VA 1K1WA 3P5RA 5DGRA 4AYPA 4D4BA 3E80A 3QPFA 1QQFA 1DCEB 2XWJB 2ZBLA 2NOJA 5JMFA 2F6DA 3QXQA 4LNGB 3HXFB 1LXMA 1AYXA 1V7VA 5AGDA 3M7BA 1K1XA 3C72B 5FO8B 1L7KA 1RWFA 1SO0A 5JMDA 1NSRA 1JZ8A 1S63B 2G0DA 1W3YA 1JZ5A 1XW2A 3QFZA 3W7XA 3T09A 3WC3A 1TNBB 3MWXA 4NEIA 1GSZA 3SDVA 2WDAA 1I8QA 4TTGA 1TXKA 3Q75B 4AYOA 1JYVA 5GZKA 1DL2A 1CB8A 3OXUA 4KTRA 3VD3A 4QT9A 3WIRA 1HN0A 3QT3A 3SDUA 1L1YA 3WKIA 2WVZA 3E6UA 3HXEB 3OB8A 1VD5A 1F1SA 2SQCA 1LXKA 4L9PB 1G9GA 3DPYB 3DSTB 3ANJA 4TF4A 1NSSA 1O1SB 2WY7A 2WCOA 3Q1NA 1D8EB 3T0AA 2F0YB 3KQ4A 4KTPA 1O79A 3WVFA 2WINB 4AQ0A 1EGUA 4WU0A 3W7WA 1PX3A 2YIKA 2AHGA 3PZ3B 3I3EA 2I07B 3ACTA 2V8KA 2V3NA 2AHFA 2H6HB 1X1IA 3VXDA 1RWHA 3M71A 1FCEA 4DOEA 3T0DA 4DODA 3A0OA 1LD7B 1N95B 3IMHA 3PZ1B 1V7WA 1JOVA 1X1HA 4BOJA 4AYQA 1LF6A 4GTTB 1N4SB 3MV11 1IA6A 3P5PA 1MZCB 1F9GA 3M72A 2WZSA 3SAEA 1NSMA 3WKHA 2HTBA 2ZXQA 1JCRB 3DSSB 1WU6A 3NJXA 1HCUA 2Z07A 1H12A 4FXKB 1DP0A 1GXOA 4GTPB 1WU4A 3RSYA 4GTVB 5JPMB 3T2OA 3RJ3A 1O6RA 1CEMA 1JZ4A 1UT9A 1N7NA 1X1JA 4OK4A 1TN7B 1JZ2A 3OS7A 3EU5B 2XFGA 2FBAA 3VDBA 3ON6A 5M7YA 3T2QA 1H35A 1R76A 1UG9A 1JZ6A 1QBQB 4GL3A 4D4CA 3GLYA 1IA7A 3M7CA 5KKBA 1NS4A 2IEJB 1FP3A 3SEPA 1L2AA 1SQCA 3MV01 2FUQA 3DECA 2RGKA 2D73A 3DYPA 3QFYA 3E33B 2GZ6A 3I3BA 3M78A 2RI8A 1NS8A 4BOKA 1NSUA 3DYOA 1KREA 1K72A 3W7SA 3SFXB 4EL8A 2VN7A 2RI9A 2BEDB 1KZPB 2AFAA 4ZRPA 1GXMA 3E1F1 2DRSA 4YCRA 1F9OA 1TNOB 1S64B 2V8IA 4BZGA 3EUVB 3HXBB 3Q78B 4ZH5A 1SNZA 1N94B 2V3PA 3MUZ1 4BZHA 4L6XA 5GW7A 2EAEA 3RX8A 3Q7AB 2E24A 1GHQA 1H13A 1LTXB 2XQWA 2JKEA 2XSGA 3QT9A 1RWCA 1HN1A 1F4AA 4MMIA 4Q2BA 2BRWA 4ZRQA 1G6IA 3BLCA 4ZH1A 2X03A 4GTMB 1C82A 4WVBA 3AFLA 3PMMA 1OJNA 1FT2B 1AGMA 2ZQ0A 2WW1A 1IS9A 3G6JB 1NL4B 3OEDA 4WVCA 4OJZA 2JJBA 2WVYA 4J5TA 3D5RA 3VD5A 1KS8A 2ZIRB 4FNVA 2D8LA 3M73A 1SA5B 1FO3A 3X17A 1JCQB 1RWAA 3SDRA 1TNZB 3MUY1 2D5JA 2WIIB 1JZ7A 4LNVA 3T08A 1KSDA 4YDOB 3NREA 1WU5A 2GH4A 3QXFA 1FAEA 2JF4A 3S4BA 4FUSA 2JG0A 2CISA 1NXCA 4Z4JA 2R2LB 1KWFA 2ZZRA 1FT1B 2CIRA 1K1YA 1LD8B 4XUVA 3RRSA 5A1AA 3H3KA 1HMUA 3IAPA 1NSZA 1N7PA 1FPPB 1MMUA 1HM3A 3K25A 3KSQB 3HXDB 2EADA 3DYMA 1MN0A 1NI1B 1HZFA 3RX5A 1H39A 2WVXA 1H3BA 1LURA 1FBWA 1C3DA 1KZOB 4JJJA 3M76A 3KLSA 3Q79B 3VD4A 4AYRA 1UMPA 4D4DA 3W7TA 1RW9A 1NS7A 3TF4A 1TNUB 3PZ4B 3KSLB 1D8DB 1KKTA 1G9JA 1O1TB 2P0VA 2DROA 1HM2A 1FO2A 3E32B 1NKGA 3IAQA 3QWTA 1XWTA 5E1QA 1O1RB 1NC5A 1Z45A 4Z4LA 1GA2A 4DUWA 2Q1FA 2FV0A 5JPNB 3DSWB 2CIQA 4LIXA 4OK2A 3VDCA 2WW3A 4GTOB 3WKGA 3BS6A 1FBOA 3QG0A 4ONTA 1NS2A 1GAHA 1H36A 4V1RA 3PYBA 1HMWA 1OJMA 2EABA 3DSUB 1J0MA 3RX7A 2A8ZA 3SFYB 3M77A 3ANIA 3PYAA 3AFJA 1F4HA 1XWQA 4CJ0A 3EQAA 4FXGB 3BGAA 2EACA 1V7XA 2XHNA 3QRYA 1H3CA 4GTSB 3Q73B 3SQCA 3HXCB 1O6HA 4KKIA 3WIWA 2FUTA 1TN6B 4BZFA 2DRQA 1TNYB 4V1SA 3CIHA 4CE7A 3VSMA 4GTRB 3A3VA 5CA3A 1F9DA 4M76A 1NSXA 1V5DA 1JS4A 4C1SA 3WKFA 3WUXA 1SA4B 1KRFA 1OJOA 1CLCA 3QDEA 4WVAA 3ECQA 3E30B 2XWBB 3W5NA 3GZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GY3 A;  2BRP A;  2HTA A;  4Q88 A;  3VDA A;  1FMI A;  4ZG8 A;  1LOH A;  4BZE A;  1GAI A;  3REN A;  1MMZ A;  3T0B A;  1N7R A;  3NJV A;  4CJ1 A;  3S4D A;  2CQS A;  1WZZ A;  1PX4 A;  3S4C A;  1J0N A;  2VN4 A;  1NS0 A;  3E73 A;  3EZ8 A;  3GT5 A;  1GLM A;  3H2W A;  2OKX A;  5M7I A;  1H14 A;  3S4A A;  2WW2 A;  1KFG A;  1JYN A;  2WW0 A;  1MMX A;  3H7L A;  1G87 A;  1JYW A;  3W5M A;  3W7U A;  1TF4 A;  3OBA A;  4RNL A;  2JKA A;  3WIQ A;  1ULV A;  2QNO A;  3P2C A;  3A24 A;  2JKP A;  1JYX A;  1YQ2 A;  2NVP A;  1N7Q A;  1JZ3 A;  5CD2 A;  1X9D A;  2DRR A;  1YGA A;  2BRV X;  3ACS A;  3K11 A;  3VW5 A;  1KSC A;  1MMY A;  4L0G A;  3T2P A;  1V5C A;  1L7J A;  5DGQ A;  1LF9 A;  5E2J A;  5MEH A;  4DUX A;  3I3D A;  2FUZ A;  3J7H A;  3VD7 A;  3D3I A;  4DUV A;  2FV1 A;  2E22 A;  2B4F A;  1RWG A;  5CZL A;  1NSV A;  3T33 A;  1OJP A;  3CZJ A;  1H54 A;  1RQ5 A;  2CQT A;  2WYN A;  4TXT A;  1N7O A;  3VD9 A;  3ANK A;  3DCD A;  3WFA A;  2WVX B;  1DOG A;  3QSP A;  1K1W A;  5DGR A;  4AYP A;  3QPF A;  2ZBL A;  2F6D A;  3QXQ A;  1LXM A;  1V7V A;  1AYX A;  1K1X A;  1L7K A;  1RWF A;  1SO0 A;  1NSR A;  1JZ8 A;  1W3Y A;  1JZ5 A;  1XW2 A;  3QFZ A;  3W7X A;  3T09 A;  3WC3 A;  3MWX A;  2WDA A;  1I8Q A;  4TTG A;  1TXK A;  4AYO A;  1JYV A;  1DL2 A;  1CB8 A;  4KTR A;  3VD3 A;  3WIR A;  1HN0 A;  3QT3 A;  1L1Y A;  3WKI A;  2WVZ A;  3E6U A;  3OB8 A;  1VD5 A;  1F1S A;  1LXK A;  1G9G A;  3ANJ A;  4TF4 A;  1NSS A;  2WCO A;  3Q1N A;  3T0A A;  4KTP A;  4AQ0 A;  1EGU A;  4WU0 A;  3W7W A;  1PX3 A;  2YIK A;  2AHG A;  3I3E A;  3ACT A;  1X1I A;  2AHF A;  3VXD A;  1RWH A;  1FCE A;  4DOE A;  3T0D A;  4DOD A;  3IMH A;  1JOV A;  1V7W A;  1X1H A;  4AYQ A;  1LF6 A;  3MV1 1;  1IA6 A;  1F9G A;  2WZS A;  1NSM A;  3WKH A;  2HTB A;  2ZXQ A;  1WU6 A;  3NJX A;  1HCU A;  2Z07 A;  1H12 A;  1DP0 A;  1WU4 A;  3RSY A;  3T2O A;  1CEM A;  1JZ4 A;  1UT9 A;  1N7N A;  1X1J A;  1JZ2 A;  3OS7 A;  2XFG A;  2FBA A;  3VDB A;  3ON6 A;  5M7Y A;  3T2Q A;  1UG9 A;  1JZ6 A;  3GLY A;  1IA7 A;  5KKB A;  1NS4 A;  1FP3 A;  3SEP A;  1L2A A;  3MV0 1;  3DEC A;  2RGK A;  2D73 A;  3DYP A;  3QFY A;  3I3B A;  2GZ6 A;  2RI8 A;  1NS8 A;  1NSU A;  3DYO A;  1KRE A;  1K72 A;  3W7S A;  4EL8 A;  2VN7 A;  2RI9 A;  2AFA A;  3E1F 1;  2DRS A;  1F9O A;  4BZG A;  4ZH5 A;  1SNZ A;  3MUZ 1;  4BZH A;  4L6X A;  5GW7 A;  2EAE A;  3RX8 A;  2E24 A;  1H13 A;  2JKE A;  2XSG A;  3QT9 A;  1RWC A;  1HN1 A;  1F4A A;  4Q2B A;  2BRW A;  1G6I A;  2X03 A;  1C82 A;  4WVB A;  3PMM A;  1OJN A;  1AGM A;  2ZQ0 A;  2WW1 A;  1IS9 A;  4WVC A;  2JJB A;  2WVY A;  4J5T A;  3VD5 A;  1KS8 A;  2D8L A;  1FO3 A;  3X17 A;  1RWA A;  3MUY 1;  2D5J A;  1JZ7 A;  3T08 A;  1KSD A;  3NRE A;  1WU5 A;  2GH4 A;  3QXF A;  1FAE A;  2JF4 A;  3S4B A;  4FUS A;  2JG0 A;  2CIS A;  1NXC A;  4Z4J A;  1KWF A;  2ZZR A;  2CIR A;  1K1Y A;  4XUV A;  3RRS A;  5A1A A;  3H3K A;  1HMU A;  3IAP A;  1NSZ A;  1N7P A;  1MMU A;  1HM3 A;  3K25 A;  2EAD A;  3DYM A;  1MN0 A;  3RX5 A;  2WVX A;  1LUR A;  1FBW A;  4JJJ A;  3VD4 A;  4AYR A;  3W7T A;  1RW9 A;  1NS7 A;  3TF4 A;  1KKT A;  1G9J A;  2P0V A;  2DRO A;  1HM2 A;  1FO2 A;  1NKG A;  3IAQ A;  3QWT A;  1XWT A;  5E1Q A;  1Z45 A;  1NC5 A;  4Z4L A;  1GA2 A;  4DUW A;  2Q1F A;  2FV0 A;  2CIQ A;  3VDC A;  2WW3 A;  3WKG A;  1FBO A;  3QG0 A;  1NS2 A;  1GAH A;  1HMW A;  1OJM A;  2EAB A;  1J0M A;  3RX7 A;  2A8Z A;  3ANI A;  3AFJ A;  1F4H A;  1XWQ A;  4CJ0 A;  3EQA A;  3BGA A;  2EAC A;  1V7X A;  2XHN A;  3QRY A;  3WIW A;  4BZF A;  2DRQ A;  3CIH A;  4CE7 A;  3A3V A;  5CA3 A;  1F9D A;  1NSX A;  1V5D A;  1JS4 A;  3WKF A;  3WUX A;  1KRF A;  1OJO A;  1CLC A;  3QDE A;  4WVA A;  3ECQ A;  3W5N A;  3GZK A; 
#chains in the Genus database with same CATH topology
 5GY3 A;  2CWU A;  3EJS A;  2BRP A;  2HTA A;  4Q88 A;  2WO0 A;  2F1B A;  3VDA A;  1FMI A;  2H6I B;  4ZG8 A;  1LOH A;  4BZE A;  1N9A B;  2BB6 A;  5FOB B;  1GAI A;  1W4N A;  1WMP A;  3M75 A;  1IVU A;  3X42 A;  3REN A;  1MMZ A;  2G02 A;  2WY8 A;  3T0B A;  1N7R A;  4MU9 A;  1KSI A;  3NJV A;  2E2T A;  4CJ1 A;  1H37 A;  3EU8 A;  3G4F A;  3S4D A;  2CQS A;  1WZZ A;  3E37 B;  3TY1 A;  1PX4 A;  3AMO A;  2PN5 A;  2A73 B;  3S4C A;  1X81 B;  2PMV A;  1J0N A;  3D51 A;  4EHM B;  1O6Q A;  2VN4 A;  1NS0 A;  3SDQ A;  1IVV A;  3E73 A;  1N1B A;  3EZ8 A;  3GT5 A;  1GLM A;  1O5M B;  1GXN A;  1TQS A;  3H2W A;  4MBG B;  3T0U A;  2OKX A;  5M7I A;  1N4P B;  1H14 A;  3S4A A;  5EAT A;  4LNB B;  5FO9 B;  2WW2 A;  1KFG A;  2B39 A;  3E34 B;  2OQE C;  2V8J A;  1AVL A;  1N9E A;  2WW0 A;  1JYN A;  1MMX A;  3H7L A;  1G87 A;  1SIH A;  2WOH A;  4D4A A;  1JYW A;  4KFF A;  3DSX B;  1TN8 B;  3W5M A;  4YDE B;  3W7U A;  1TF4 A;  3OBA A;  4RNL A;  2CFD A;  2JKA A;  1TQW A;  1OAC A;  3WIQ A;  1TQT A;  1ULV A;  1WMO A;  2QNO A;  3NFV A;  1HXA A;  4KFD A;  4D94 A;  2ONG A;  1PU4 A;  3P2C A;  3A24 A;  3M74 A;  2BB5 A;  2JKP A;  1QSJ A;  1PS3 A;  1YQ2 A;  2NVP A;  1JYX A;  1N7Q A;  3SDT A;  1H3A A;  1JZ3 A;  3DX1 A;  5CD2 A;  1W7C A;  1X9D A;  3N0F A;  2DRR A;  2ZIS B;  4MMH A;  5FO7 B;  2BBC A;  3VSN A;  3K7X A;  2BRV X;  1YGA A;  3ACS A;  1N4Q B;  1JCS B;  3K11 A;  3M7L A;  5DHI A;  1KSC A;  5EAS A;  3VW5 A;  1MMY A;  1TQU A;  3HIG A;  2CG1 A;  2H6G B;  4L0G A;  3T2P A;  3DSV B;  1V5C A;  4E1Y A;  3D5S A;  2E2V A;  3NNB A;  1L7J A;  2GOX A;  5DGQ A;  1LF9 A;  5E2J A;  3M01 A;  5MEH A;  4DUX A;  1QAF A;  3I3D A;  2FUZ A;  4GTQ B;  1D6Z A;  1HXC A;  1W6J A;  3J7H A;  4OZW A;  5DHK A;  5IKH A;  4K3A A;  3D52 A;  3VD7 A;  1W6K A;  3D3I A;  4DUV A;  2XN0 A;  2FV1 A;  2E22 A;  2B4F A;  1RWG A;  3M7E A;  3DRA B;  5CZL A;  1NSV A;  3T33 A;  1OJP A;  5ILK A;  3PZ2 B;  3LVT A;  4FNT A;  3CZJ A;  1H54 A;  5C05 A;  2BT3 A;  5ILJ A;  1RQ5 A;  2CQT A;  2WYN A;  4TXT A;  4EV5 A;  1N20 A;  1N7O A;  3VD9 A;  5IM1 A;  1N4R B;  2H6F B;  3BVV A;  2ONH A;  3Q7F B;  3ANK A;  4KKJ A;  3DCD A;  3WFA A;  1WMN A;  3CU7 A;  3E7J A;  2WVX B;  1DOG A;  3QSP A;  3S9V A;  1K1W A;  3MPH A;  1QX1 A;  3P5R A;  5DGR A;  4AYP A;  3BUD A;  4D4B A;  3E80 A;  3QPF A;  3CV5 A;  3NBB A;  1QQF A;  1DCE B;  2XWJ B;  2ZBL A;  2NOJ A;  5JMF A;  2F6D A;  3QXQ A;  4LNG B;  5ILH A;  3D50 A;  1LXM A;  3HXF B;  1AYX A;  1V7V A;  2F7O A;  3BVW A;  5AGD A;  3M7B A;  1K1X A;  3C72 B;  5IL3 A;  2OOV C;  4F13 A;  5FO8 B;  1L7K A;  4OZV A;  1RWF A;  1SO0 A;  3DDF A;  5JMD A;  1NSR A;  1JZ8 A;  1S63 B;  2G0D A;  1W3Y A;  2CFL A;  4FNQ A;  1JZ5 A;  1XW2 A;  1D6U A;  3QFZ A;  3W7X A;  3T09 A;  3WC3 A;  1TNB B;  3MWX A;  4NEI A;  1GSZ A;  1TU5 A;  3SDV A;  2WDA A;  2F7R A;  1I8Q A;  2F1A A;  4TTG A;  1TXK A;  3Q75 B;  4AYO A;  1JYV A;  5GZK A;  3M02 A;  1CB8 A;  1DL2 A;  3LZ9 A;  3OXU A;  2C11 A;  4KTR A;  3VD3 A;  4QT9 A;  3WIR A;  1HN0 A;  3QT3 A;  3SDU A;  1L1Y A;  3WKI A;  2WVZ A;  3BUB A;  3E6U A;  1SII A;  3HXE B;  1QAK A;  3OB8 A;  1VD5 A;  2CG0 A;  1F1S A;  2CFW A;  2SQC A;  2F7Q A;  3BUP A;  1IVX A;  1LXK A;  4L9P B;  1HTY A;  1G9G A;  3DPY B;  3DX3 A;  3DST B;  3ANJ A;  4TF4 A;  4KFE A;  1NSS A;  1O1S B;  2WY7 A;  2WCO A;  3Q1N A;  1D8E B;  3T0A A;  2F0Y B;  3KQ4 A;  3X41 A;  4KTP A;  1O79 A;  3WVF A;  2WIN B;  2C10 A;  4AQ0 A;  1EGU A;  4GAX A;  4WU0 A;  3W7W A;  1PX3 A;  2WOF A;  2YIK A;  2AHG A;  3PZ3 B;  3I3E A;  2I07 B;  3SX1 A;  3ACT A;  2V8K A;  1X1I A;  2AHF A;  2H6H B;  2V3N A;  2CFG A;  3VXD A;  1RWH A;  3M71 A;  2OW6 A;  1FCE A;  1HXG A;  1N21 A;  1W6C A;  4DOE A;  3T0D A;  4DOD A;  3A0O A;  1LD7 B;  1IQY A;  1N95 B;  3IMH A;  3PZ1 B;  1V7W A;  1JOV A;  1X1H A;  4BOJ A;  3DX4 A;  4AYQ A;  3NBJ A;  1LF6 A;  4GTT B;  1N4S B;  3MV1 1;  1IA6 A;  1SPU A;  3X3X A;  3P5P A;  1MZC B;  5EAU A;  3BVU A;  1F9G A;  3M72 A;  2WZS A;  3SAE A;  1NSM A;  2Y74 A;  3WKH A;  2HTB A;  2ZXQ A;  1JCR B;  3DSS B;  1WU6 A;  3AMO B;  3NJX A;  1HCU A;  2Z07 A;  1H12 A;  4FXK B;  1DP0 A;  1GXO A;  4GTP B;  1AVK A;  1WU4 A;  3RSY A;  4FNU A;  4GTV B;  1D6Y A;  5JPM B;  3BUI A;  3T2O A;  3RJ3 A;  3DDG A;  1O6R A;  1CEM A;  1JZ4 A;  1AV4 A;  2XN2 A;  1UT9 A;  1N7N A;  1X1J A;  4OK4 A;  3N0G A;  1TN7 B;  3KII A;  1JZ2 A;  3OS7 A;  3EU5 B;  2XFG A;  2FBA A;  5ILZ A;  1TQV A;  2WGQ A;  3BUQ A;  3M00 A;  3VDB A;  1EKM A;  3ON6 A;  5M7Y A;  3T2Q A;  1H35 A;  1R76 A;  1UG9 A;  1N23 A;  1JZ6 A;  1IVW A;  4F10 A;  1QBQ B;  4GL3 A;  4D4C A;  3N9H A;  3GLY A;  4FNP A;  1IA7 A;  3M7C A;  5KKB A;  1NS4 A;  2IEJ B;  1FP3 A;  1A2V A;  1L2A A;  3SEP A;  1SQC A;  3MV0 1;  2FUQ A;  2E2U A;  3DEC A;  2RGK A;  5IK9 A;  2D73 A;  3DYP A;  3QFY A;  3E33 B;  2GZ6 A;  3I3B A;  3M78 A;  2RI8 A;  1NS8 A;  2ALW A;  4BOK A;  1NSU A;  3DYO A;  1KRE A;  1K72 A;  3W7S A;  3SFX B;  1HXK A;  2D1W A;  3LOY A;  4EL8 A;  2VN7 A;  2RI9 A;  2BED B;  1KZP B;  2AFA A;  4ZRP A;  1GXM A;  2CWV A;  2RDY A;  3E1F 1;  2DRS A;  4YCR A;  3EJR A;  1F9O A;  1RKY A;  1TNO B;  1S64 B;  2V8I A;  1JRQ A;  2XN1 A;  4BZG A;  2OQE A;  3EUV B;  3HXB B;  3Q78 B;  4ZH5 A;  1SNZ A;  1N94 B;  2V3P A;  3MUZ 1;  4EV2 A;  4BZH A;  4L6X A;  2YFN A;  5GW7 A;  2EAE A;  1W5Z A;  3RX8 A;  3Q7A B;  2E24 A;  1GHQ A;  1H13 A;  1LTX B;  2XQW A;  2JKE A;  2XSG A;  3QT9 A;  2F18 A;  1RWC A;  3ALA A;  1HN1 A;  1F4A A;  4MMI A;  2BRW A;  4Q2B A;  4ZRQ A;  1G6I A;  3BLC A;  2X03 A;  4ZH1 A;  3CZN A;  4GTM B;  1C82 A;  1HX9 A;  4WVB A;  3AFL A;  3PMM A;  1OJN A;  1FT2 B;  1QAZ A;  1QAL A;  1AGM A;  3BLB A;  2ZQ0 A;  2WW1 A;  1IS9 A;  3D4Y A;  3G6J B;  1NL4 B;  3OED A;  4OJZ A;  4WVC A;  2JJB A;  2WVY A;  4J5T A;  3D5R A;  3VD5 A;  1KS8 A;  2ZIR B;  4FNV A;  2D8L A;  3K5T A;  3M73 A;  1R34 A;  1SA5 B;  3WA2 X;  1FO3 A;  3X17 A;  1JCQ B;  1RWA A;  3SDR A;  1TNZ B;  3X3Z A;  3MUY 1;  2D5J A;  2ZL8 A;  1N24 A;  2WII B;  1JZ7 A;  4LNV A;  3T08 A;  1KSD A;  4YDO B;  4DI5 A;  3MI6 A;  3NRE A;  1N1Z A;  1HV6 A;  1WU5 A;  5ILD A;  2GH4 A;  3QXF A;  1FAE A;  2JF4 A;  3EJP A;  2PNC A;  3S4B A;  4FUS A;  2JG0 A;  2CIS A;  1NXC A;  4Z4J A;  2R2L B;  1KWF A;  2YFO A;  1R33 A;  2ZZR A;  5ILY A;  1FT1 B;  2CIR A;  1K1Y A;  1LD8 B;  4XUV A;  3RRS A;  3EJT A;  4FJQ A;  5A1A A;  3H3K A;  1HMU A;  3IAP A;  2J5C A;  1N7P A;  1NSZ A;  1FPP B;  1MMU A;  4RNQ A;  1HM3 A;  3K25 A;  3KSQ B;  3HXD B;  1LVN A;  2EAD A;  3DYM A;  1MN0 A;  1NI1 B;  1HZF A;  3RX5 A;  1H39 A;  2WVX A;  1H3B A;  1LUR A;  3X40 A;  4BTX A;  1FBW A;  4BTY A;  3CZS A;  2CWT A;  1C3D A;  1KZO B;  1US1 A;  4JJJ A;  1IQX A;  3M76 A;  3KLS A;  3Q79 B;  3VD4 A;  3BVT A;  4AYR A;  5IKA A;  3SXX A;  1UMP A;  4D4D A;  1UI8 A;  2Y73 A;  3PGB A;  3W7T A;  1RW9 A;  1NS7 A;  3TF4 A;  1TNU B;  2WYH A;  5IL8 A;  3PZ4 B;  3KSL B;  1D8D B;  1KKT A;  2CFK A;  3G4D A;  1RJO A;  1G9J A;  3HI7 A;  2OOV A;  3HII A;  1O1T B;  5IK6 A;  2P0V A;  2DRO A;  1HM2 A;  1FO2 A;  3E32 B;  1NKG A;  3D4Z A;  3EJQ A;  3QWT A;  1XWT A;  5IK0 A;  3IAQ A;  1O1R B;  1NC5 A;  1Z45 A;  5E1Q A;  4Z4L A;  1GA2 A;  1N22 A;  4DUW A;  2Q1F A;  2FV0 A;  5JPN B;  3DSW B;  2CIQ A;  4LIX A;  2YX9 A;  3DX2 A;  4OK2 A;  3VDC A;  2WW3 A;  4GTO B;  2F7P A;  3WKG A;  3BS6 A;  1FBO A;  3QG0 A;  4ONT A;  1NS2 A;  1GAH A;  4K35 A;  1H36 A;  4V1R A;  1UI7 A;  4UFC A;  3KN4 A;  1W6G A;  3PYB A;  1HMW A;  1OJM A;  2EAB A;  3DSU B;  1J0M A;  3RX7 A;  3BVX A;  2A8Z A;  3X3Y A;  4FNR A;  3SFY B;  3M77 A;  3ANI A;  1QWU A;  3PYA A;  3AFJ A;  1F4H A;  3WA3 A;  1XWQ A;  1W2Z A;  4CJ0 A;  3EQA A;  4FXG B;  3BGA A;  2EAC A;  1V7X A;  2XHN A;  3QRY A;  3DX0 A;  1H3C A;  4GTS B;  2OW7 A;  3Q73 B;  3SQC A;  3HXC B;  1O6H A;  2FYV A;  5ILI A;  3EJU A;  4KKI A;  3WIW A;  2FUT A;  1IU7 A;  1TN6 B;  4BZF A;  2DRQ A;  1QWN A;  4BTW A;  1TNY B;  4V1S A;  3CIH A;  2WYI A;  3VSM A;  4CE7 A;  4GTR B;  1DYU A;  5KBP A;  3A3V A;  5CA3 A;  1F9D A;  4FNS A;  2W0Q A;  1HWW A;  4M76 A;  1NSX A;  1V5D A;  1JS4 A;  4C1S A;  1O7D D;  3WKF A;  3WUX A;  1SA4 B;  1KRF A;  1OJO A;  1CLC A;  3QDE A;  4WVA A;  3ECQ A;  3E30 B;  2XWB B;  3W5N A;  3GZK A; 
#chains in the Genus database with same CATH homology
 5GY3 A;  2BRP A;  2HTA A;  4Q88 A;  3VDA A;  1FMI A;  2H6I B;  4ZG8 A;  1LOH A;  4BZE A;  1N9A B;  2BB6 A;  5FOB B;  1GAI A;  3M75 A;  3REN A;  1MMZ A;  2G02 A;  2WY8 A;  3T0B A;  4MU9 A;  1N7R A;  3NJV A;  4CJ1 A;  1H37 A;  3EU8 A;  3S4D A;  2CQS A;  1WZZ A;  3E37 B;  3TY1 A;  1PX4 A;  2PN5 A;  2A73 B;  3S4C A;  1X81 B;  2PMV A;  1J0N A;  4EHM B;  1O6Q A;  2VN4 A;  1NS0 A;  3SDQ A;  3E73 A;  3EZ8 A;  3GT5 A;  1GLM A;  1O5M B;  1GXN A;  3H2W A;  4MBG B;  2OKX A;  5M7I A;  1N4P B;  1H14 A;  3S4A A;  5FO9 B;  4LNB B;  2WW2 A;  1KFG A;  2B39 A;  3E34 B;  2V8J A;  1JYN A;  2WW0 A;  1MMX A;  3H7L A;  1G87 A;  4D4A A;  1JYW A;  3DSX B;  1TN8 B;  3W5M A;  4YDE B;  3W7U A;  1TF4 A;  3OBA A;  4RNL A;  2JKA A;  3WIQ A;  1ULV A;  2QNO A;  4D94 A;  3P2C A;  3A24 A;  3M74 A;  2BB5 A;  2JKP A;  1QSJ A;  1JYX A;  1YQ2 A;  2NVP A;  1N7Q A;  3SDT A;  1H3A A;  1JZ3 A;  5CD2 A;  1X9D A;  2DRR A;  2ZIS B;  5FO7 B;  4MMH A;  2BBC A;  3VSN A;  3K7X A;  1YGA A;  2BRV X;  3ACS A;  1N4Q B;  1JCS B;  3K11 A;  3M7L A;  3VW5 A;  1KSC A;  1MMY A;  2H6G B;  4L0G A;  3T2P A;  3DSV B;  1V5C A;  3D5S A;  1L7J A;  2GOX A;  5DGQ A;  1LF9 A;  5E2J A;  5MEH A;  4DUX A;  3I3D A;  2FUZ A;  4GTQ B;  1W6J A;  3J7H A;  3VD7 A;  1W6K A;  3D3I A;  4DUV A;  2FV1 A;  2E22 A;  2B4F A;  1RWG A;  3M7E A;  3DRA B;  5CZL A;  1NSV A;  3T33 A;  1OJP A;  3PZ2 B;  3CZJ A;  1H54 A;  1RQ5 A;  2CQT A;  2WYN A;  4TXT A;  1N7O A;  3VD9 A;  1N4R B;  2H6F B;  3Q7F B;  3ANK A;  4KKJ A;  3DCD A;  3WFA A;  3CU7 A;  3E7J A;  2WVX B;  1DOG A;  3QSP A;  3S9V A;  1K1W A;  3P5R A;  5DGR A;  4AYP A;  4D4B A;  3E80 A;  3QPF A;  1QQF A;  1DCE B;  2XWJ B;  2ZBL A;  2NOJ A;  5JMF A;  2F6D A;  3QXQ A;  4LNG B;  3HXF B;  1LXM A;  1AYX A;  1V7V A;  5AGD A;  3M7B A;  1K1X A;  3C72 B;  5FO8 B;  1L7K A;  1RWF A;  1SO0 A;  5JMD A;  1NSR A;  1JZ8 A;  1S63 B;  2G0D A;  1W3Y A;  1JZ5 A;  1XW2 A;  3QFZ A;  3W7X A;  3T09 A;  3WC3 A;  1TNB B;  3MWX A;  4NEI A;  1GSZ A;  3SDV A;  2WDA A;  1I8Q A;  4TTG A;  1TXK A;  3Q75 B;  4AYO A;  1JYV A;  5GZK A;  1DL2 A;  1CB8 A;  3OXU A;  4KTR A;  3VD3 A;  4QT9 A;  3WIR A;  1HN0 A;  3QT3 A;  3SDU A;  1L1Y A;  3WKI A;  2WVZ A;  3E6U A;  3HXE B;  3OB8 A;  1VD5 A;  1F1S A;  2SQC A;  1LXK A;  4L9P B;  1G9G A;  3DPY B;  3DST B;  3ANJ A;  4TF4 A;  1NSS A;  1O1S B;  2WY7 A;  2WCO A;  3Q1N A;  1D8E B;  3T0A A;  2F0Y B;  3KQ4 A;  4KTP A;  1O79 A;  3WVF A;  2WIN B;  4AQ0 A;  1EGU A;  4WU0 A;  3W7W A;  1PX3 A;  2YIK A;  2AHG A;  3PZ3 B;  3I3E A;  2I07 B;  3ACT A;  2V8K A;  2V3N A;  2AHF A;  2H6H B;  1X1I A;  3VXD A;  1RWH A;  3M71 A;  1FCE A;  4DOE A;  3T0D A;  4DOD A;  3A0O A;  1LD7 B;  1N95 B;  3IMH A;  3PZ1 B;  1V7W A;  1JOV A;  1X1H A;  4BOJ A;  4AYQ A;  1LF6 A;  4GTT B;  1N4S B;  3MV1 1;  1IA6 A;  3P5P A;  1MZC B;  1F9G A;  3M72 A;  2WZS A;  3SAE A;  1NSM A;  3WKH A;  2HTB A;  2ZXQ A;  1JCR B;  3DSS B;  1WU6 A;  3NJX A;  1HCU A;  2Z07 A;  1H12 A;  4FXK B;  1DP0 A;  1GXO A;  4GTP B;  1WU4 A;  3RSY A;  4GTV B;  5JPM B;  3T2O A;  3RJ3 A;  1O6R A;  1CEM A;  1JZ4 A;  1UT9 A;  1N7N A;  1X1J A;  4OK4 A;  1TN7 B;  1JZ2 A;  3OS7 A;  3EU5 B;  2XFG A;  2FBA A;  3VDB A;  3ON6 A;  5M7Y A;  3T2Q A;  1H35 A;  1R76 A;  1UG9 A;  1JZ6 A;  1QBQ B;  4GL3 A;  4D4C A;  3GLY A;  1IA7 A;  3M7C A;  5KKB A;  1NS4 A;  2IEJ B;  1FP3 A;  3SEP A;  1L2A A;  1SQC A;  3MV0 1;  2FUQ A;  3DEC A;  2RGK A;  2D73 A;  3DYP A;  3QFY A;  3E33 B;  2GZ6 A;  3I3B A;  3M78 A;  2RI8 A;  1NS8 A;  4BOK A;  1NSU A;  3DYO A;  1KRE A;  1K72 A;  3W7S A;  3SFX B;  4EL8 A;  2VN7 A;  2RI9 A;  2BED B;  1KZP B;  2AFA A;  4ZRP A;  1GXM A;  3E1F 1;  2DRS A;  4YCR A;  1F9O A;  1TNO B;  1S64 B;  2V8I A;  4BZG A;  3EUV B;  3HXB B;  3Q78 B;  4ZH5 A;  1SNZ A;  1N94 B;  2V3P A;  3MUZ 1;  4BZH A;  4L6X A;  5GW7 A;  2EAE A;  3RX8 A;  3Q7A B;  2E24 A;  1GHQ A;  1H13 A;  1LTX B;  2XQW A;  2JKE A;  2XSG A;  3QT9 A;  1RWC A;  1HN1 A;  1F4A A;  4MMI A;  4Q2B A;  2BRW A;  4ZRQ A;  1G6I A;  3BLC A;  4ZH1 A;  2X03 A;  4GTM B;  1C82 A;  4WVB A;  3AFL A;  3PMM A;  1OJN A;  1FT2 B;  1AGM A;  2ZQ0 A;  2WW1 A;  1IS9 A;  3G6J B;  1NL4 B;  3OED A;  4WVC A;  4OJZ A;  2JJB A;  2WVY A;  4J5T A;  3D5R A;  3VD5 A;  1KS8 A;  2ZIR B;  4FNV A;  2D8L A;  3M73 A;  1SA5 B;  1FO3 A;  3X17 A;  1JCQ B;  1RWA A;  3SDR A;  1TNZ B;  3MUY 1;  2D5J A;  2WII B;  1JZ7 A;  4LNV A;  3T08 A;  1KSD A;  4YDO B;  3NRE A;  1WU5 A;  2GH4 A;  3QXF A;  1FAE A;  2JF4 A;  3S4B A;  4FUS A;  2JG0 A;  2CIS A;  1NXC A;  4Z4J A;  2R2L B;  1KWF A;  2ZZR A;  1FT1 B;  2CIR A;  1K1Y A;  1LD8 B;  4XUV A;  3RRS A;  5A1A A;  3H3K A;  1HMU A;  3IAP A;  1NSZ A;  1N7P A;  1FPP B;  1MMU A;  1HM3 A;  3K25 A;  3KSQ B;  3HXD B;  2EAD A;  3DYM A;  1MN0 A;  1NI1 B;  1HZF A;  3RX5 A;  1H39 A;  2WVX A;  1H3B A;  1LUR A;  1FBW A;  1C3D A;  1KZO B;  4JJJ A;  3M76 A;  3KLS A;  3Q79 B;  3VD4 A;  4AYR A;  1UMP A;  4D4D A;  3W7T A;  1RW9 A;  1NS7 A;  3TF4 A;  1TNU B;  3PZ4 B;  3KSL B;  1D8D B;  1KKT A;  1G9J A;  1O1T B;  2P0V A;  2DRO A;  1HM2 A;  1FO2 A;  3E32 B;  1NKG A;  3IAQ A;  3QWT A;  1XWT A;  5E1Q A;  1O1R B;  1NC5 A;  1Z45 A;  4Z4L A;  1GA2 A;  4DUW A;  2Q1F A;  2FV0 A;  5JPN B;  3DSW B;  2CIQ A;  4LIX A;  4OK2 A;  3VDC A;  2WW3 A;  4GTO B;  3WKG A;  3BS6 A;  1FBO A;  3QG0 A;  4ONT A;  1NS2 A;  1GAH A;  1H36 A;  4V1R A;  3PYB A;  1HMW A;  1OJM A;  2EAB A;  3DSU B;  1J0M A;  3RX7 A;  2A8Z A;  3SFY B;  3M77 A;  3ANI A;  3PYA A;  3AFJ A;  1F4H A;  1XWQ A;  4CJ0 A;  3EQA A;  4FXG B;  3BGA A;  2EAC A;  1V7X A;  2XHN A;  3QRY A;  1H3C A;  4GTS B;  3Q73 B;  3SQC A;  3HXC B;  1O6H A;  4KKI A;  3WIW A;  2FUT A;  1TN6 B;  4BZF A;  2DRQ A;  1TNY B;  4V1S A;  3CIH A;  4CE7 A;  3VSM A;  4GTR B;  3A3V A;  5CA3 A;  1F9D A;  4M76 A;  1NSX A;  1V5D A;  1JS4 A;  4C1S A;  3WKF A;  3WUX A;  1SA4 B;  1KRF A;  1OJO A;  1CLC A;  3QDE A;  4WVA A;  3ECQ A;  3E30 B;  2XWB B;  3W5N A;  3GZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...