1LF6A

Crystal structure of bacterial glucoamylase
Total Genus 242
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
242
sequence length
674
structure length
674
Chain Sequence
SIKIDRFNNISAVNGPGEEDTWASAQKQGVGTANNYVSKVWFTLANGAISEVYYPTIDTADVKEIKFIVTDGKSFVPDETKDAISKVEKFTDKSLGYKLVNTDKKGRYRITKDIFTDVKRNSLIMKAKFEALEGSIHDYKLYLAYDPHIKNQGSYNEGYVIKANNNEMLMAKRDNVYTALSSNIGWKGYSIGYYKVNDIMTDLDENKQMTKHYDSARGNIIEGAEIDLTKNSEFEIVLSFGQSDSEAAKTALETLGEDYNNLKNNYIDEWTKYCNTLNNFNGKANSLYYNSMMILKASEDKTNKGAYIASLSIPWGDGQRDDNTGGYHLVWSRDLYHVANAFIAAGDVDSANRSLDYLAKVVKDNGMIPQNTWISGKPYWTGIQLDEQADPIILSYRLKRYDLYDSLVKPLADFIIKIGPKTGQERWEEIGGYSPATMAAEVAGLTCAAYIAEQNKDYESAQKYQEKADNWQKLIDNLTYTENGPLGNGQYYIRIAGLSDPDADFMINIANGGGVYDQKEIVDPSFLELVRLGVKSADDPKILNTLKVVDSTIKVDTPKGPSWYRYNHDGYGEPSKTELYHGAGKGRLWPLLTGERGMYEIAAGKDATPYVKAMEKFANEGGIISEQVWEDTGLPTDSASPLNWAHAEYVILFASNIEHKVLDMPDIVYKRYVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure and evolution of prokaryotic glucoamylase
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords glucoamylase
total genus 242
structure length 674
sequence length 674
chains with identical sequence B
ec nomenclature ec 3.2.1.3: Glucan 1,4-alpha-glucosidase.
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00723 Glyco_hydro_15 Glycosyl hydrolases family 15
A PF09137 Glucodextran_N Glucodextranase, domain N
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.10 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 1lf6A02
2.70.98.10 Mainly Beta Distorted Sandwich Beta-galactosidase; Chain A, domain 5 Beta-galactosidase; Chain A, domain 5 1lf6A01
3QRYA 3WC3A 1LURA 1AGMA 1WZZA 4ZH5A 1YQ2A 2JG0A 3WUXA 2D5JA 2CISA 3RX5A 1F9DA 2ZZRA 4AYRA 1G6IA 1MMZA 1F9OA 1JZ5A 3DYOA 1NS2A 1TF4A 2F6DA 3GT5A 4J5TA 3IAQA 1K1WA 3T0BA 3MV11 2WW3A 3VDAA 1FO2A 3ECQA 1CB8A 2WVYA 1UT9A 2EADA 3RENA 2WYNA 1WU5A 1NKGA 2WDAA 3VD7A 1AYXA 1DP0A 1LF9A 1W3YA 1FMIA 3P2CA 3MUY1 4AYOA 1MMUA 1NSUA 1N7RA 2JKPA 2RGKA 4AYPA 1HM2A 1RWGA 2EAEA 1DL2A 1N7PA 2Z07A 3W7SA 1SO0A 2XFGA 3VXDA 1V7XA 3WFAA 1NSRA 1JYXA 2EABA 1LXMA 5A1AA 1JOVA 1JZ3A 3W5MA 1OJMA 1NSXA 4FUSA 3A24A 3IMHA 3T0DA 1RQ5A 1HN0A 4L0GA 4Z4LA 1NSVA 1V5DA 1UG9A 1LF6A 2WW0A 4BZGA 2FV1A 4Q2BA 2WVXB 1NC5A 1HCUA 5KKBA 1F4HA 3I3BA 3ACSA 2DRRA 2DRSA 1V5CA 3H3KA 4AQ0A 1DOGA 2NVPA 1HMWA 1KSDA 4KTRA 2RI9A 2Q1FA 1G9JA 1KREA 1KFGA 3NJXA 3S4AA 3DYPA 1EGUA 1OJNA 1RWCA 1NSZA 2CQTA 3NJVA 3E6UA 1JZ2A 1IA6A 3QSPA 3QFYA 2B4FA 3MUZ1 1RWFA 3QPFA 2JJBA 3S4BA 1NXCA 1K72A 1X1HA 4WVAA 5DGQA 1V7VA 3DECA 1RWAA 1WU6A 3VD4A 1ULVA 1K1YA 4Q88A 2ZQ0A 3RX8A 1GAHA 1JZ8A 3T08A 5E2JA 2HTBA 1X9DA 2VN4A 1TXKA 3T33A 1N7NA 1KSCA 2EACA 1JS4A 1H12A 2RI8A 5DGRA 2QNOA 1KKTA 1XW2A 5CZLA 4CJ0A 2E22A 4RNLA 3J7HA 1Z45A 3WKIA 1VD5A 1J0MA 2XHNA 1X1IA 1CLCA 2WCOA 1IS9A 5M7IA 1G87A 3RSYA 1MN0A 4AYQA 2DRQA 1PX4A 2D8LA 4TTGA 1N7OA 3T2PA 2WW2A 3ACTA 1PX3A 1FAEA 2CIRA 1H13A 1JZ4A 2HTAA 3T09A 1LOHA 1GLMA 1NSSA 1HN1A 1SNZA 1GAIA 2ZXQA 1KWFA 1FP3A 1NS8A 2XSGA 3PMMA 1HMUA 3QT9A 2X03A 2FV0A 3RX7A 2WVZA 3VD5A 3QG0A 3H2WA 2A8ZA 3IAPA 3ANJA 3WKHA 3I3DA 2CIQA 3QDEA 3E73A 2FUZA 1JYNA 1K1XA 3H7LA 3DCDA 3QWTA 3S4DA 2GZ6A 3T2QA 5MEHA 1F9GA 3ON6A 4BZHA 4TF4A 4Z4JA 1L2AA 1NSMA 3VD3A 1HM3A 4WVBA 3I3EA 1MMYA 1H54A 3BGAA 3NREA 3QT3A 1RW9A 1FCEA 3K25A 2VN7A 3SEPA 3MWXA 4DOEA 3GLYA 3MV01 3X17A 2WVXA 3T2OA 3D3IA 2GH4A 1NS7A 3GZKA 1L7KA 3WIQA 2AHFA 1V7WA 1I8QA 3TF4A 5E1QA 4CJ1A 1MMXA 1NS4A 1L7JA 2WW1A 3VDBA 3ANKA 3AFJA 1FO3A 3OB8A 1OJOA 4KTPA 1OJPA 2BRWA 3W7XA 1X1JA 3OBAA 3WKFA 3VD9A 1FBWA 1XWTA 4DUWA 3S4CA 1FBOA 2FBAA 3W7TA 2P0VA 3CZJA 4WU0A 4L6XA 4XUVA 2E24A 5M7YA 2WZSA 1GA2A 3W5NA 3EZ8A 4BZEA 4EL8A 1C82A 3DYMA 1J0NA 3W7UA 3QXFA 1NS0A 3EQAA 4JJJA 5GW7A 1N7QA 1IA7A 3CIHA 3K11A 3VW5A 5GY3A 1KRFA 3WKGA 2JKEA 2YIKA 2ZBLA 4ZG8A 3QXQA 3ANIA 4TXTA 2OKXA 1YGAA 2DROA 2BRVX 1KS8A 1RWHA 3W7WA 3WIWA 3WIRA 1H14A 3Q1NA 1LXKA 1G9GA 3RRSA 1JYWA 2AHGA 2AFAA 2D73A 1CEMA 4DODA 3OS7A 2JF4A 2CQSA 1F1SA 4BZFA 1JZ6A 4DUXA 5CA3A 3A3VA 5CD2A 3VDCA 4WVCA 1JYVA 1F4AA 1L1YA 2JKAA 2BRPA 1XWQA 4DUVA 3E1F1 3QFZA 1JZ7A 4CE7A 3T0AA 1WU4A
chains in the Genus database with same CATH superfamily
3QRYA 1WMNA 3SDRA 3WC3A 1LURA 1AGMA 1WZZA 4ZH5A 2CFKA 3ALAA 4GTMB 1YQ2A 4D4CA 2JG0A 3WUXA 3SDQA 2D5JA 3X3XA 4D4DA 2CISA 3RX5A 1GXOA 4GTSB 2G02A 1F9DA 2ZZRA 4BTYA 4AYRA 3EJQA 1G6IA 5AGDA 3BUBA 3X42A 4MU9A 1MMZA 1F9OA 1JZ5A 3DYOA 2BB6A 3D5RA 4LNVA 3X3ZA 2H6IB 1JCSB 1GXMA 2PNCA 1NS2A 1D8EB 1TF4A 1QWUA 2F6DA 2WIIB 3GT5A 4J5TA 3IAQA 4F10A 5ILJA 2OQEA 1N23A 2NOJA 3SAEA 1K1WA 3SXXA 3T0BA 2WY7A 3MV11 2WW3A 3VDAA 1FO2A 3ECQA 1CB8A 4KFFA 2WVYA 1UT9A 2EADA 3RENA 2WYNA 3WA2X 1WU5A 1NKGA 2WDAA 3DSXB 3VD7A 1AYXA 1TU5A 2WYHA 1LF9A 1DP0A 1W3YA 3EU5B 1JCQB 4GTQB 2FYVA 1FMIA 5IK6A 3EUVB 2ONHA 4L9PB 3Q75B 3DPYB 3WVFA 3P2CA 2A73B 3MUY1 4AYOA 3HXEB 5C05A 1MMUA 3KSQB 1QWNA 1NSUA 1W6GA 1N7RA 4QT9A 2JKPA 2RGKA 3SDTA 1HV6A 4AYPA 1HM2A 1RWGA 2RDYA 2EAEA 1DL2A 1N7PA 5DHKA 2WYIA 1TNYB 2Z07A 1AVLA 2CFGA 3M78A 2W0QA 3BVUA 3W7SA 3MI6A 1SO0A 4OK2A 1R76A 1KZOB 5IK0A 2ZL8A 2XFGA 3VXDA 3AFLA 1V7XA 3WFAA 4GL3A 2D1WA 2Y74A 1NSRA 1O6QA 2YFNA 1QAFA 3HXBB 1JYXA 1RKYA 2EABA 3EJUA 1LTXB 3DSTB 1LXMA 5A1AA 3M75A 1JOVA 3PYBA 4LNGB 1JZ3A 1W4NA 3EJRA 3W5MA 1OJMA 4K35A 4ONTA 1NSXA 1MZCB 4FUSA 3A24A 3IMHA 3T0DA 1PS3A 4K3AA 1JCRB 4V1SA 1RQ5A 1HN0A 2V8JA 4L0GA 4Z4LA 1NSVA 1V5DA 1SA4B 3PZ4B 1UG9A 3SX1A 3HXDB 1N24A 1LF6A 2WW0A 4BZGA 2FV1A 3E30B 4Q2BA 2WVXB 2ONGA 3KN4A 1NC5A 3EJTA 1KZPB 3M01A 2IEJB 1HCUA 1N1BA 1QX1A 5KKBA 1HXCA 1F4HA 3ACSA 2DRRA 3I3BA 2DRSA 1GSZA 1V5CA 1IQYA 1QALA 1HX9A 3H3KA 1O6HA 2CFLA 2OOVA 3DX2A 4AQ0A 1DOGA 1HMWA 2NVPA 3M74A 2FUQA 1N20A 1WMPA 1KSDA 4KTRA 2RI9A 2Q1FA 2ZISB 3X3YA 1G9JA 1KREA 3DSWB 4YDEB 4MMIA 1KFGA 3E33B 2C10A 3NJXA 3NBJA 3S4AA 1TQUA 3DYPA 1EGUA 4GTPB 1N21A 1SIIA 1OJNA 1RWCA 1NSZA 2CQTA 3NJVA 2J5CA 3E6UA 3M72A 1W5ZA 3Q78B 1O1RB 3X41A 1JZ2A 4OK4A 4EHMB 1IA6A 5ILDA 3AMOB 3QSPA 3QFYA 3SDVA 4GTVB 2B4FA 3MUZ1 2F1AA 4MBGB 1DCEB 1TN8B 3SQCA 1X81B 1H35A 2OW7A 5IK9A 1RWFA 2BEDB 3QPFA 2JJBA 3S4BA 1NXCA 1K72A 4LNBB 1TQWA 1S63B 2F1BA 1X1HA 3M7BA 4LIXA 2H6FB 4WVAA 5DGQA 3SFXB 1V7VA 4FNPA 3DECA 2WGQA 1RWAA 1WU6A 3VD4A 1QQFA 1ULVA 1HTYA 1K1YA 3LOYA 3P5RA 2BT3A 1SQCA 1SIHA 4Q88A 2ZQ0A 3RX8A 1GAHA 1JZ8A 3T08A 4RNQA 5E2JA 2HTBA 1SA5B 3OEDA 4GTTB 1SPUA 4F13A 2I07B 3M7EA 2ZIRB 1X9DA 2VN4A 1TXKA 2BBCA 1D8DB 1N7NA 1UMPA 3T33A 1KSCA 1TQVA 2V8KA 2EACA 3D4YA 1PU4A 1JS4A 4ZH1A 1FT2B 1H12A 4FNTA 1QSJA 4OJZA 2RI8A 3M73A 4ZRQA 2E2TA 3A0OA 5DGRA 4KKJA 4BTWA 2QNOA 4E1YA 1KKTA 1XW2A 2WY8A 5CZLA 1DYUA 2XQWA 3G6JB 4CJ0A 5ILYA 5EAUA 2E22A 4RNLA 3J7HA 3DDGA 1HZFA 4FNVA 5ILHA 3E34B 1Z45A 1J0MA 1VD5A 3WKIA 3LVTA 2XHNA 1H36A 1X1IA 3DSUB 1CLCA 2WCOA 1IS9A 5M7IA 4BOKA 5KBPA 1G87A 3RSYA 1W2ZA 1MN0A 1GXNA 1N22A 4AYQA 1O7DD 2DRQA 1TNBB 1PX4A 3E80A 2D8LA 4BTXA 2YX9A 3D52A 4TTGA 2F0YB 1N7OA 3T2PA 1N9EA 2WW2A 3BUPA 3ACTA 1PX3A 1JRQA 1FAEA 1FPPB 2CIRA 2XWJB 1H13A 1JZ4A 2HTAA 2BB5A 3DSSB 3K5TA 3T0UA 1LOHA 3T09A 1GLMA 1LD8B 1NSSA 1W6CA 1HN1A 1HXKA 1UI7A 2PN5A 2WOFA 3NBBA 3Q79B 1SNZA 2CG0A 1GAIA 2ZXQA 1KWFA 1FP3A 1NS8A 2E2VA 3BLBA 3G4DA 3EU8A 1HXAA 1IVXA 2XSGA 2CG1A 1HMUA 3PMMA 2R2LB 3QT9A 3NFVA 3P5PA 2X03A 4V1RA 4D4BA 5IL8A 2FV0A 3RX7A 3N0FA 2XN2A 4BOJA 2E2UA 4KFDA 2WVZA 3M7LA 1AVKA 3CZNA 3VD5A 1LD7B 1N4QB 2CWUA 3PZ2B 3M00A 3QG0A 1IQXA 3H2WA 2OOVC 2A8ZA 2XN1A 3ANJA 3WKHA 2XN0A 2CFWA 2CIQA 3I3DA 3IAPA 3QDEA 4UFCA 5EASA 3E73A 1EKMA 5ILKA 2V8IA 2FUZA 1JYNA 1K1XA 3H7LA 1O1TB 3DCDA 5JMDA 3QWTA 5IL3A 3BLCA 3S4DA 4M76A 2GZ6A 3HXCB 4FNUA 1IVUA 1IVWA 1D6YA 3T2QA 5MEHA 1F9GA 3ON6A 4BZHA 4TF4A 1D6UA 4Z4JA 5IKHA 1KSIA 3HXFB 1L2AA 5JMFA 1NSMA 3D50A 2C11A 3VD3A 4OZWA 4ZRPA 1HM3A 4WVBA 2H6GB 2V3PA 3I3EA 1MMYA 3HIGA 1A2VA 3BVWA 1H54A 2F7QA 2G0DA 3BGAA 2F7OA 3N0GA 3E37B 1TNUB 3NREA 1RW9A 3QT3A 1FCEA 3K25A 1HWWA 2Y73A 2VN7A 1NL4B 3SEPA 1TNOB 3MWXA 1RJOA 4FXKB 4DOEA 3GLYA 5FOBB 2CFDA 3MV01 3X17A 1N9AB 1TQTA 2CWVA 1N95B 2WVXA 3MPHA 3T2OA 3D3IA 3M76A 4YDOB 3OXUA 2GH4A 1NS7A 5DHIA 3GZKA 1L7KA 3WIQA 2AHFA 1V7WA 3D4ZA 1N4SB 1I8QA 3NNBA 1FT1B 3DRAB 1UI8A 1TNZB 3TF4A 5E1QA 4CJ1A 4MMHA 3E7JA 5EATA 3CU7A 3KSLB 1L7JA 1MMXA 4FXGB 1NS4A 2WW1A 3VDBA 3VSNA 1W6KA 3ANKA 5FO9B 3AFJA 3BS6A 1FO3A 1QAZA 3OB8A 1OJOA 1TQSA 3EJSA 1QAKA 1LVNA 4FJQA 1OJPA 4GTRB 4KTPA 4C1SA 2BRWA 3E32B 3W7XA 3KLSA 3BVXA 1X1JA 4NEIA 3OBAA 3WKFA 1IVVA 1TN6B 3VD9A 1FBWA 3HI7A 1XWTA 2OW6A 4DUWA 1O5MB 3S4CA 3DX3A 3DDFA 2F7RA 3N9HA 1FBOA 2FBAA 5ILZA 1QBQB 3M71A 3X40A 1N4RB 3W7TA 2P0VA 3DX1A 3CZJA 4WU0A 4L6XA 1O1SB 4XUVA 5IM1A 2E24A 3D51A 5M7YA 1TN7B 2WZSA 3BVTA 3S9VA 1GA2A 4KFEA 2FUTA 4D94A 2WINB 1R34A 3W5NA 3LZ9A 3EZ8A 5IKAA 3G4FA 4FNSA 4BZEA 3CV5A 2WO0A 4OZVA 4EL8A 3EJPA 1C82A 2XWBB 3DYMA 1J0NA 1O79A 3QXFA 2PMVA 3W7UA 1NS0A 3D5SA 4GAXA 3BVVA 3EQAA 4JJJA 1NI1B 2V3NA 2CWTA 5GW7A 3AMOA 1N7QA 3M77A 1IA7A 1O6RA 3CIHA 3K11A 3VW5A 5GY3A 1C3DA 1KRFA 3WKGA 2JKEA 4KKIA 5GZKA 2YIKA 1HXGA 2ZBLA 3PGBA 4EV2A 4ZG8A 2GOXA 1H37A 3BUQA 3QXQA 3ANIA 3SFYB 4TXTA 2OKXA 3KIIA 1YGAA 2BRVX 2DROA 1KS8A 1RWHA 3W7WA 3Q7AB 5JPNB 2H6HB 4GTOB 2B39A 3WIWA 3WIRA 4FNQA 1N94B 3TY1A 5FO7B 3M02A 2OQEC 1H14A 1R33A 3Q1NA 3VSMA 1H39A 3Q7FB 1LXKA 3PZ3B 1G9GA 3RRSA 1AV4A 1JYWA 2AHGA 2AFAA 2D73A 3BUIA 3M7CA 5JPMB 1IU7A 1H3CA 1CEMA 4DODA 3OS7A 2JF4A 3K7XA 1N1ZA 2CQSA 1W7CA 3HIIA 1WMOA 3BUDA 4FNRA 1F1SA 3DX0A 4D4AA 2YFOA 4BZFA 1OACA 1JZ6A 1W6JA 1H3AA 5ILIA 3PZ1B 3SDUA 4DUXA 5CA3A 1S64B 4DI5A 2F18A 3WA3A 3A3VA 1H3BA 3CZSA 5CD2A 2ALWA 3VDCA 3C72B 4WVCA 1JYVA 2SQCA 1F4AA 1L1YA 3Q73B 1N4PB 3PYAA 2JKAA 2BRPA 2WOHA 1XWQA 4DUVA 3E1F1 3QFZA 3KQ4A 3DX4A 3RJ3A 2F7PA 4YCRA 3DSVB 5FO8B 1JZ7A 4CE7A 1D6ZA 1GHQA 4EV5A 3T0AA 1WU4A 1US1A
chains in the Genus database with same CATH topology
3QRYA 3SDRA 3WC3A 1LURA 1AGMA 1WZZA 4ZH5A 4GTMB 1YQ2A 4D4CA 2JG0A 3WUXA 3SDQA 2D5JA 4D4DA 2CISA 3RX5A 1GXOA 4GTSB 2G02A 1F9DA 2ZZRA 4AYRA 1G6IA 5AGDA 4MU9A 1MMZA 1F9OA 1JZ5A 3DYOA 2BB6A 3D5RA 4LNVA 2H6IB 1JCSB 1GXMA 1NS2A 1D8EB 1TF4A 2F6DA 2WIIB 3GT5A 4J5TA 3IAQA 2NOJA 3SAEA 1K1WA 3T0BA 2WY7A 3MV11 2WW3A 3VDAA 1FO2A 3ECQA 1CB8A 2WVYA 1UT9A 2EADA 3RENA 2WYNA 1WU5A 1NKGA 2WDAA 3DSXB 3VD7A 1AYXA 1LF9A 1DP0A 4GTQB 3EU5B 1JCQB 1W3YA 1FMIA 3EUVB 4L9PB 3Q75B 3DPYB 3WVFA 3P2CA 2A73B 3MUY1 4AYOA 3HXEB 1MMUA 3KSQB 1NSUA 1N7RA 4QT9A 2JKPA 2RGKA 3SDTA 4AYPA 1HM2A 1RWGA 2EAEA 1DL2A 1N7PA 1TNYB 2Z07A 3M78A 3W7SA 1SO0A 4OK2A 1R76A 1KZOB 2XFGA 3VXDA 3AFLA 1V7XA 3WFAA 4GL3A 1NSRA 1O6QA 3HXBB 1JYXA 2EABA 1LTXB 3DSTB 1LXMA 5A1AA 3M75A 1JOVA 3PYBA 4LNGB 1JZ3A 3W5MA 1OJMA 4ONTA 1NSXA 1MZCB 4FUSA 3A24A 3IMHA 3T0DA 1JCRB 4V1SA 1RQ5A 2V8JA 1HN0A 4L0GA 4Z4LA 1NSVA 1V5DA 1SA4B 3PZ4B 1UG9A 3HXDB 1LF6A 2WW0A 4BZGA 2FV1A 3E30B 4Q2BA 2WVXB 1NC5A 1KZPB 2IEJB 1HCUA 5KKBA 1F4HA 3I3BA 3ACSA 2DRRA 2DRSA 1GSZA 1V5CA 3H3KA 1O6HA 4AQ0A 1DOGA 2NVPA 1HMWA 3M74A 2FUQA 1KSDA 4KTRA 2RI9A 2Q1FA 2ZISB 1G9JA 1KREA 3DSWB 4YDEB 4MMIA 1KFGA 3E33B 3NJXA 3S4AA 3DYPA 4GTPB 1EGUA 1OJNA 1RWCA 1NSZA 2CQTA 3NJVA 3E6UA 3M72A 3Q78B 1O1RB 1JZ2A 4OK4A 4EHMB 1IA6A 3QSPA 3QFYA 3SDVA 4GTVB 2B4FA 3MUZ1 4MBGB 1DCEB 1TN8B 3SQCA 1X81B 1H35A 1RWFA 2BEDB 3QPFA 2JJBA 3S4BA 1NXCA 1K72A 4LNBB 1S63B 3M7BA 4LIXA 4WVAA 2H6FB 5DGQA 3SFXB 1X1HA 1V7VA 3DECA 1RWAA 1WU6A 3VD4A 1QQFA 1ULVA 1K1YA 3P5RA 1SQCA 4Q88A 2ZQ0A 3RX8A 1GAHA 1JZ8A 3T08A 5E2JA 2HTBA 1SA5B 3OEDA 4GTTB 2I07B 3M7EA 2ZIRB 1X9DA 2VN4A 1TXKA 2BBCA 1D8DB 1UMPA 3T33A 1N7NA 1KSCA 2V8KA 2EACA 1JS4A 4ZH1A 1FT2B 1H12A 1QSJA 4OJZA 2RI8A 3M73A 4ZRQA 5DGRA 3A0OA 4KKJA 2QNOA 1KKTA 1XW2A 2WY8A 5CZLA 2XQWA 3G6JB 4CJ0A 2E22A 4RNLA 3J7HA 1HZFA 4FNVA 3E34B 1Z45A 3WKIA 1VD5A 1J0MA 2XHNA 1H36A 1X1IA 3DSUB 1CLCA 2WCOA 1IS9A 5M7IA 4BOKA 1G87A 3RSYA 1MN0A 1GXNA 4AYQA 2DRQA 1TNBB 1PX4A 3E80A 2D8LA 4TTGA 2F0YB 1N7OA 3T2PA 2WW2A 3ACTA 1PX3A 1FAEA 1FPPB 2CIRA 2XWJB 1H13A 1JZ4A 2HTAA 2BB5A 3DSSB 3T09A 1LOHA 1GLMA 1LD8B 1NSSA 1HN1A 2PN5A 3Q79B 1SNZA 1GAIA 2ZXQA 1KWFA 1FP3A 1NS8A 3EU8A 2XSGA 3PMMA 1HMUA 2R2LB 3QT9A 3P5PA 2X03A 4V1RA 4D4BA 2FV0A 3RX7A 4BOJA 2WVZA 3M7LA 3VD5A 1LD7B 1N4QB 3PZ2B 3QG0A 3H2WA 2A8ZA 3IAPA 3ANJA 3WKHA 3I3DA 2CIQA 3QDEA 3E73A 2V8IA 2FUZA 1JYNA 1K1XA 3H7LA 1O1TB 3DCDA 5JMDA 3QWTA 3BLCA 3S4DA 4M76A 2GZ6A 3HXCB 3T2QA 5MEHA 1F9GA 3ON6A 4BZHA 4TF4A 4Z4JA 3HXFB 1L2AA 1NSMA 5JMFA 3VD3A 4ZRPA 1HM3A 4WVBA 2H6GB 2V3PA 3I3EA 1MMYA 1H54A 3BGAA 2G0DA 3E37B 1TNUB 3NREA 3QT3A 1RW9A 1FCEA 3K25A 2VN7A 1NL4B 3SEPA 1TNOB 3MWXA 4FXKB 4DOEA 3GLYA 5FOBB 3MV01 3X17A 1N9AB 2WVXA 1N95B 3T2OA 3D3IA 3M76A 4YDOB 3OXUA 2GH4A 1NS7A 3GZKA 1L7KA 3WIQA 2AHFA 1V7WA 1N4SB 1I8QA 1FT1B 3DRAB 1TNZB 3TF4A 5E1QA 4CJ1A 4MMHA 3E7JA 3CU7A 3KSLB 1L7JA 1MMXA 4FXGB 1NS4A 2WW1A 3VDBA 3VSNA 1W6KA 3ANKA 5FO9B 3AFJA 3BS6A 1FO3A 3OB8A 1OJOA 4GTRB 4KTPA 4C1SA 1OJPA 2BRWA 3E32B 3W7XA 3KLSA 1X1JA 3OBAA 4NEIA 3WKFA 1TN6B 3VD9A 1FBWA 1XWTA 4DUWA 1O5MB 3S4CA 1FBOA 2FBAA 1QBQB 3M71A 1N4RB 3W7TA 2P0VA 3CZJA 4WU0A 4L6XA 1O1SB 4XUVA 2E24A 5M7YA 1TN7B 2WZSA 3S9VA 1GA2A 2FUTA 4D94A 2WINB 3W5NA 3EZ8A 4BZEA 4EL8A 1C82A 2XWBB 3DYMA 1J0NA 1O79A 3QXFA 2PMVA 3W7UA 1NS0A 3D5SA 3EQAA 4JJJA 1NI1B 2V3NA 5GW7A 1N7QA 3M77A 1IA7A 1O6RA 3CIHA 3K11A 3VW5A 5GY3A 1C3DA 1KRFA 3WKGA 2JKEA 4KKIA 5GZKA 2YIKA 2ZBLA 4ZG8A 2GOXA 1H37A 3QXQA 3ANIA 3SFYB 4TXTA 2OKXA 1YGAA 2DROA 2BRVX 1KS8A 1RWHA 3W7WA 3Q7AB 5JPNB 2H6HB 4GTOB 2B39A 3WIWA 3WIRA 1N94B 3TY1A 5FO7B 1H14A 3Q1NA 3VSMA 1H39A 3Q7FB 1LXKA 3PZ3B 1G9GA 3RRSA 1JYWA 2AHGA 2AFAA 2D73A 3M7CA 5JPMB 1H3CA 1CEMA 4DODA 3OS7A 2JF4A 3K7XA 2CQSA 1F1SA 4D4AA 4BZFA 1JZ6A 1W6JA 1H3AA 3PZ1B 3SDUA 4DUXA 5CA3A 1S64B 3A3VA 1H3BA 5CD2A 3VDCA 3C72B 4WVCA 1JYVA 2SQCA 1F4AA 1L1YA 3Q73B 1N4PB 3PYAA 2JKAA 2BRPA 1XWQA 4DUVA 3E1F1 3QFZA 3KQ4A 3RJ3A 1JZ7A 4YCRA 3DSVB 5FO8B 4CE7A 1GHQA 3T0AA 1WU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QRY A;  3WC3 A;  1LUR A;  1AGM A;  1WZZ A;  4ZH5 A;  1YQ2 A;  2JG0 A;  3WUX A;  2D5J A;  2CIS A;  3RX5 A;  1F9D A;  2ZZR A;  4AYR A;  1G6I A;  1MMZ A;  1F9O A;  1JZ5 A;  3DYO A;  1NS2 A;  1TF4 A;  2F6D A;  3GT5 A;  4J5T A;  3IAQ A;  1K1W A;  3T0B A;  3MV1 1;  2WW3 A;  3VDA A;  1FO2 A;  3ECQ A;  1CB8 A;  2WVY A;  1UT9 A;  2EAD A;  3REN A;  2WYN A;  1WU5 A;  1NKG A;  2WDA A;  3VD7 A;  1AYX A;  1DP0 A;  1LF9 A;  1W3Y A;  1FMI A;  3P2C A;  3MUY 1;  4AYO A;  1MMU A;  1NSU A;  1N7R A;  2JKP A;  2RGK A;  4AYP A;  1HM2 A;  1RWG A;  2EAE A;  1DL2 A;  1N7P A;  2Z07 A;  3W7S A;  1SO0 A;  2XFG A;  3VXD A;  1V7X A;  3WFA A;  1NSR A;  1JYX A;  2EAB A;  1LXM A;  5A1A A;  1JOV A;  1JZ3 A;  3W5M A;  1OJM A;  1NSX A;  4FUS A;  3A24 A;  3IMH A;  3T0D A;  1RQ5 A;  1HN0 A;  4L0G A;  4Z4L A;  1NSV A;  1V5D A;  1UG9 A;  1LF6 A;  2WW0 A;  4BZG A;  2FV1 A;  4Q2B A;  2WVX B;  1NC5 A;  1HCU A;  5KKB A;  1F4H A;  3I3B A;  3ACS A;  2DRR A;  2DRS A;  1V5C A;  3H3K A;  4AQ0 A;  1DOG A;  2NVP A;  1HMW A;  1KSD A;  4KTR A;  2RI9 A;  2Q1F A;  1G9J A;  1KRE A;  1KFG A;  3NJX A;  3S4A A;  3DYP A;  1EGU A;  1OJN A;  1RWC A;  1NSZ A;  2CQT A;  3NJV A;  3E6U A;  1JZ2 A;  1IA6 A;  3QSP A;  3QFY A;  2B4F A;  3MUZ 1;  1RWF A;  3QPF A;  2JJB A;  3S4B A;  1NXC A;  1K72 A;  1X1H A;  4WVA A;  5DGQ A;  1V7V A;  3DEC A;  1RWA A;  1WU6 A;  3VD4 A;  1ULV A;  1K1Y A;  4Q88 A;  2ZQ0 A;  3RX8 A;  1GAH A;  1JZ8 A;  3T08 A;  5E2J A;  2HTB A;  1X9D A;  2VN4 A;  1TXK A;  3T33 A;  1N7N A;  1KSC A;  2EAC A;  1JS4 A;  1H12 A;  2RI8 A;  5DGR A;  2QNO A;  1KKT A;  1XW2 A;  5CZL A;  4CJ0 A;  2E22 A;  4RNL A;  3J7H A;  1Z45 A;  3WKI A;  1VD5 A;  1J0M A;  2XHN A;  1X1I A;  1CLC A;  2WCO A;  1IS9 A;  5M7I A;  1G87 A;  3RSY A;  1MN0 A;  4AYQ A;  2DRQ A;  1PX4 A;  2D8L A;  4TTG A;  1N7O A;  3T2P A;  2WW2 A;  3ACT A;  1PX3 A;  1FAE A;  2CIR A;  1H13 A;  1JZ4 A;  2HTA A;  3T09 A;  1LOH A;  1GLM A;  1NSS A;  1HN1 A;  1SNZ A;  1GAI A;  2ZXQ A;  1KWF A;  1FP3 A;  1NS8 A;  2XSG A;  3PMM A;  1HMU A;  3QT9 A;  2X03 A;  2FV0 A;  3RX7 A;  2WVZ A;  3VD5 A;  3QG0 A;  3H2W A;  2A8Z A;  3IAP A;  3ANJ A;  3WKH A;  3I3D A;  2CIQ A;  3QDE A;  3E73 A;  2FUZ A;  1JYN A;  1K1X A;  3H7L A;  3DCD A;  3QWT A;  3S4D A;  2GZ6 A;  3T2Q A;  5MEH A;  1F9G A;  3ON6 A;  4BZH A;  4TF4 A;  4Z4J A;  1L2A A;  1NSM A;  3VD3 A;  1HM3 A;  4WVB A;  3I3E A;  1MMY A;  1H54 A;  3BGA A;  3NRE A;  3QT3 A;  1RW9 A;  1FCE A;  3K25 A;  2VN7 A;  3SEP A;  3MWX A;  4DOE A;  3GLY A;  3MV0 1;  3X17 A;  2WVX A;  3T2O A;  3D3I A;  2GH4 A;  1NS7 A;  3GZK A;  1L7K A;  3WIQ A;  2AHF A;  1V7W A;  1I8Q A;  3TF4 A;  5E1Q A;  4CJ1 A;  1MMX A;  1NS4 A;  1L7J A;  2WW1 A;  3VDB A;  3ANK A;  3AFJ A;  1FO3 A;  3OB8 A;  1OJO A;  4KTP A;  1OJP A;  2BRW A;  3W7X A;  1X1J A;  3OBA A;  3WKF A;  3VD9 A;  1FBW A;  1XWT A;  4DUW A;  3S4C A;  1FBO A;  2FBA A;  3W7T A;  2P0V A;  3CZJ A;  4WU0 A;  4L6X A;  4XUV A;  2E24 A;  5M7Y A;  2WZS A;  1GA2 A;  3W5N A;  3EZ8 A;  4BZE A;  4EL8 A;  1C82 A;  3DYM A;  1J0N A;  3W7U A;  3QXF A;  1NS0 A;  3EQA A;  4JJJ A;  5GW7 A;  1N7Q A;  1IA7 A;  3CIH A;  3K11 A;  3VW5 A;  5GY3 A;  1KRF A;  3WKG A;  2JKE A;  2YIK A;  2ZBL A;  4ZG8 A;  3QXQ A;  3ANI A;  4TXT A;  2OKX A;  1YGA A;  2DRO A;  2BRV X;  1KS8 A;  1RWH A;  3W7W A;  3WIW A;  3WIR A;  1H14 A;  3Q1N A;  1LXK A;  1G9G A;  3RRS A;  1JYW A;  2AHG A;  2AFA A;  2D73 A;  1CEM A;  4DOD A;  3OS7 A;  2JF4 A;  2CQS A;  1F1S A;  4BZF A;  1JZ6 A;  4DUX A;  5CA3 A;  3A3V A;  5CD2 A;  3VDC A;  4WVC A;  1JYV A;  1F4A A;  1L1Y A;  2JKA A;  2BRP A;  1XWQ A;  4DUV A;  3E1F 1;  3QFZ A;  1JZ7 A;  4CE7 A;  3T0A A;  1WU4 A; 
#chains in the Genus database with same CATH topology
 3QRY A;  1WMN A;  3SDR A;  3WC3 A;  1LUR A;  1AGM A;  1WZZ A;  4ZH5 A;  2CFK A;  3ALA A;  4GTM B;  1YQ2 A;  4D4C A;  2JG0 A;  3WUX A;  3SDQ A;  2D5J A;  3X3X A;  4D4D A;  2CIS A;  3RX5 A;  1GXO A;  4GTS B;  2G02 A;  1F9D A;  2ZZR A;  4BTY A;  4AYR A;  3EJQ A;  1G6I A;  5AGD A;  3BUB A;  3X42 A;  4MU9 A;  1MMZ A;  1F9O A;  1JZ5 A;  3DYO A;  2BB6 A;  3D5R A;  4LNV A;  3X3Z A;  2H6I B;  1JCS B;  1GXM A;  2PNC A;  1NS2 A;  1D8E B;  1TF4 A;  1QWU A;  2F6D A;  2WII B;  3GT5 A;  4J5T A;  3IAQ A;  4F10 A;  5ILJ A;  2OQE A;  1N23 A;  2NOJ A;  3SAE A;  1K1W A;  3SXX A;  3T0B A;  2WY7 A;  3MV1 1;  2WW3 A;  3VDA A;  1FO2 A;  3ECQ A;  1CB8 A;  4KFF A;  2WVY A;  1UT9 A;  2EAD A;  3REN A;  2WYN A;  3WA2 X;  1WU5 A;  1NKG A;  2WDA A;  3DSX B;  3VD7 A;  1AYX A;  1TU5 A;  2WYH A;  1LF9 A;  1DP0 A;  1W3Y A;  3EU5 B;  1JCQ B;  4GTQ B;  2FYV A;  1FMI A;  5IK6 A;  3EUV B;  2ONH A;  4L9P B;  3Q75 B;  3DPY B;  3WVF A;  3P2C A;  2A73 B;  3MUY 1;  4AYO A;  3HXE B;  5C05 A;  1MMU A;  3KSQ B;  1QWN A;  1NSU A;  1W6G A;  1N7R A;  4QT9 A;  2JKP A;  2RGK A;  3SDT A;  1HV6 A;  4AYP A;  1HM2 A;  1RWG A;  2RDY A;  2EAE A;  1DL2 A;  1N7P A;  5DHK A;  2WYI A;  1TNY B;  2Z07 A;  1AVL A;  2CFG A;  3M78 A;  2W0Q A;  3BVU A;  3W7S A;  3MI6 A;  1SO0 A;  4OK2 A;  1R76 A;  1KZO B;  5IK0 A;  2ZL8 A;  2XFG A;  3VXD A;  3AFL A;  1V7X A;  3WFA A;  4GL3 A;  2D1W A;  2Y74 A;  1NSR A;  1O6Q A;  2YFN A;  1QAF A;  3HXB B;  1JYX A;  1RKY A;  2EAB A;  3EJU A;  1LTX B;  3DST B;  1LXM A;  5A1A A;  3M75 A;  1JOV A;  3PYB A;  4LNG B;  1JZ3 A;  1W4N A;  3EJR A;  3W5M A;  1OJM A;  4K35 A;  4ONT A;  1NSX A;  1MZC B;  4FUS A;  3A24 A;  3IMH A;  3T0D A;  1PS3 A;  4K3A A;  1JCR B;  4V1S A;  1RQ5 A;  1HN0 A;  2V8J A;  4L0G A;  4Z4L A;  1NSV A;  1V5D A;  1SA4 B;  3PZ4 B;  1UG9 A;  3SX1 A;  3HXD B;  1N24 A;  1LF6 A;  2WW0 A;  4BZG A;  2FV1 A;  3E30 B;  4Q2B A;  2WVX B;  2ONG A;  3KN4 A;  1NC5 A;  3EJT A;  1KZP B;  3M01 A;  2IEJ B;  1HCU A;  1N1B A;  1QX1 A;  5KKB A;  1HXC A;  1F4H A;  3ACS A;  2DRR A;  3I3B A;  2DRS A;  1GSZ A;  1V5C A;  1IQY A;  1QAL A;  1HX9 A;  3H3K A;  1O6H A;  2CFL A;  2OOV A;  3DX2 A;  4AQ0 A;  1DOG A;  1HMW A;  2NVP A;  3M74 A;  2FUQ A;  1N20 A;  1WMP A;  1KSD A;  4KTR A;  2RI9 A;  2Q1F A;  2ZIS B;  3X3Y A;  1G9J A;  1KRE A;  3DSW B;  4YDE B;  4MMI A;  1KFG A;  3E33 B;  2C10 A;  3NJX A;  3NBJ A;  3S4A A;  1TQU A;  3DYP A;  1EGU A;  4GTP B;  1N21 A;  1SII A;  1OJN A;  1RWC A;  1NSZ A;  2CQT A;  3NJV A;  2J5C A;  3E6U A;  3M72 A;  1W5Z A;  3Q78 B;  1O1R B;  3X41 A;  1JZ2 A;  4OK4 A;  4EHM B;  1IA6 A;  5ILD A;  3AMO B;  3QSP A;  3QFY A;  3SDV A;  4GTV B;  2B4F A;  3MUZ 1;  2F1A A;  4MBG B;  1DCE B;  1TN8 B;  3SQC A;  1X81 B;  1H35 A;  2OW7 A;  5IK9 A;  1RWF A;  2BED B;  3QPF A;  2JJB A;  3S4B A;  1NXC A;  1K72 A;  4LNB B;  1TQW A;  1S63 B;  2F1B A;  1X1H A;  3M7B A;  4LIX A;  2H6F B;  4WVA A;  5DGQ A;  3SFX B;  1V7V A;  4FNP A;  3DEC A;  2WGQ A;  1RWA A;  1WU6 A;  3VD4 A;  1QQF A;  1ULV A;  1HTY A;  1K1Y A;  3LOY A;  3P5R A;  2BT3 A;  1SQC A;  1SIH A;  4Q88 A;  2ZQ0 A;  3RX8 A;  1GAH A;  1JZ8 A;  3T08 A;  4RNQ A;  5E2J A;  2HTB A;  1SA5 B;  3OED A;  4GTT B;  1SPU A;  4F13 A;  2I07 B;  3M7E A;  2ZIR B;  1X9D A;  2VN4 A;  1TXK A;  2BBC A;  1D8D B;  1N7N A;  1UMP A;  3T33 A;  1KSC A;  1TQV A;  2V8K A;  2EAC A;  3D4Y A;  1PU4 A;  1JS4 A;  4ZH1 A;  1FT2 B;  1H12 A;  4FNT A;  1QSJ A;  4OJZ A;  2RI8 A;  3M73 A;  4ZRQ A;  2E2T A;  3A0O A;  5DGR A;  4KKJ A;  4BTW A;  2QNO A;  4E1Y A;  1KKT A;  1XW2 A;  2WY8 A;  5CZL A;  1DYU A;  2XQW A;  3G6J B;  4CJ0 A;  5ILY A;  5EAU A;  2E22 A;  4RNL A;  3J7H A;  3DDG A;  1HZF A;  4FNV A;  5ILH A;  3E34 B;  1Z45 A;  1J0M A;  1VD5 A;  3WKI A;  3LVT A;  2XHN A;  1H36 A;  1X1I A;  3DSU B;  1CLC A;  2WCO A;  1IS9 A;  5M7I A;  4BOK A;  5KBP A;  1G87 A;  3RSY A;  1W2Z A;  1MN0 A;  1GXN A;  1N22 A;  4AYQ A;  1O7D D;  2DRQ A;  1TNB B;  1PX4 A;  3E80 A;  2D8L A;  4BTX A;  2YX9 A;  3D52 A;  4TTG A;  2F0Y B;  1N7O A;  3T2P A;  1N9E A;  2WW2 A;  3BUP A;  3ACT A;  1PX3 A;  1JRQ A;  1FAE A;  1FPP B;  2CIR A;  2XWJ B;  1H13 A;  1JZ4 A;  2HTA A;  2BB5 A;  3DSS B;  3K5T A;  3T0U A;  1LOH A;  3T09 A;  1GLM A;  1LD8 B;  1NSS A;  1W6C A;  1HN1 A;  1HXK A;  1UI7 A;  2PN5 A;  2WOF A;  3NBB A;  3Q79 B;  1SNZ A;  2CG0 A;  1GAI A;  2ZXQ A;  1KWF A;  1FP3 A;  1NS8 A;  2E2V A;  3BLB A;  3G4D A;  3EU8 A;  1HXA A;  1IVX A;  2XSG A;  2CG1 A;  1HMU A;  3PMM A;  2R2L B;  3QT9 A;  3NFV A;  3P5P A;  2X03 A;  4V1R A;  4D4B A;  5IL8 A;  2FV0 A;  3RX7 A;  3N0F A;  2XN2 A;  4BOJ A;  2E2U A;  4KFD A;  2WVZ A;  3M7L A;  1AVK A;  3CZN A;  3VD5 A;  1LD7 B;  1N4Q B;  2CWU A;  3PZ2 B;  3M00 A;  3QG0 A;  1IQX A;  3H2W A;  2OOV C;  2A8Z A;  2XN1 A;  3ANJ A;  3WKH A;  2XN0 A;  2CFW A;  2CIQ A;  3I3D A;  3IAP A;  3QDE A;  4UFC A;  5EAS A;  3E73 A;  1EKM A;  5ILK A;  2V8I A;  2FUZ A;  1JYN A;  1K1X A;  3H7L A;  1O1T B;  3DCD A;  5JMD A;  3QWT A;  5IL3 A;  3BLC A;  3S4D A;  4M76 A;  2GZ6 A;  3HXC B;  4FNU A;  1IVU A;  1IVW A;  1D6Y A;  3T2Q A;  5MEH A;  1F9G A;  3ON6 A;  4BZH A;  4TF4 A;  1D6U A;  4Z4J A;  5IKH A;  1KSI A;  3HXF B;  1L2A A;  5JMF A;  1NSM A;  3D50 A;  2C11 A;  3VD3 A;  4OZW A;  4ZRP A;  1HM3 A;  4WVB A;  2H6G B;  2V3P A;  3I3E A;  1MMY A;  3HIG A;  1A2V A;  3BVW A;  1H54 A;  2F7Q A;  2G0D A;  3BGA A;  2F7O A;  3N0G A;  3E37 B;  1TNU B;  3NRE A;  1RW9 A;  3QT3 A;  1FCE A;  3K25 A;  1HWW A;  2Y73 A;  2VN7 A;  1NL4 B;  3SEP A;  1TNO B;  3MWX A;  1RJO A;  4FXK B;  4DOE A;  3GLY A;  5FOB B;  2CFD A;  3MV0 1;  3X17 A;  1N9A B;  1TQT A;  2CWV A;  1N95 B;  2WVX A;  3MPH A;  3T2O A;  3D3I A;  3M76 A;  4YDO B;  3OXU A;  2GH4 A;  1NS7 A;  5DHI A;  3GZK A;  1L7K A;  3WIQ A;  2AHF A;  1V7W A;  3D4Z A;  1N4S B;  1I8Q A;  3NNB A;  1FT1 B;  3DRA B;  1UI8 A;  1TNZ B;  3TF4 A;  5E1Q A;  4CJ1 A;  4MMH A;  3E7J A;  5EAT A;  3CU7 A;  3KSL B;  1L7J A;  1MMX A;  4FXG B;  1NS4 A;  2WW1 A;  3VDB A;  3VSN A;  1W6K A;  3ANK A;  5FO9 B;  3AFJ A;  3BS6 A;  1FO3 A;  1QAZ A;  3OB8 A;  1OJO A;  1TQS A;  3EJS A;  1QAK A;  1LVN A;  4FJQ A;  1OJP A;  4GTR B;  4KTP A;  4C1S A;  2BRW A;  3E32 B;  3W7X A;  3KLS A;  3BVX A;  1X1J A;  4NEI A;  3OBA A;  3WKF A;  1IVV A;  1TN6 B;  3VD9 A;  1FBW A;  3HI7 A;  1XWT A;  2OW6 A;  4DUW A;  1O5M B;  3S4C A;  3DX3 A;  3DDF A;  2F7R A;  3N9H A;  1FBO A;  2FBA A;  5ILZ A;  1QBQ B;  3M71 A;  3X40 A;  1N4R B;  3W7T A;  2P0V A;  3DX1 A;  3CZJ A;  4WU0 A;  4L6X A;  1O1S B;  4XUV A;  5IM1 A;  2E24 A;  3D51 A;  5M7Y A;  1TN7 B;  2WZS A;  3BVT A;  3S9V A;  1GA2 A;  4KFE A;  2FUT A;  4D94 A;  2WIN B;  1R34 A;  3W5N A;  3LZ9 A;  3EZ8 A;  5IKA A;  3G4F A;  4FNS A;  4BZE A;  3CV5 A;  2WO0 A;  4OZV A;  4EL8 A;  3EJP A;  1C82 A;  2XWB B;  3DYM A;  1J0N A;  1O79 A;  3QXF A;  2PMV A;  3W7U A;  1NS0 A;  3D5S A;  4GAX A;  3BVV A;  3EQA A;  4JJJ A;  1NI1 B;  2V3N A;  2CWT A;  5GW7 A;  3AMO A;  1N7Q A;  3M77 A;  1IA7 A;  1O6R A;  3CIH A;  3K11 A;  3VW5 A;  5GY3 A;  1C3D A;  1KRF A;  3WKG A;  2JKE A;  4KKI A;  5GZK A;  2YIK A;  1HXG A;  2ZBL A;  3PGB A;  4EV2 A;  4ZG8 A;  2GOX A;  1H37 A;  3BUQ A;  3QXQ A;  3ANI A;  3SFY B;  4TXT A;  2OKX A;  3KII A;  1YGA A;  2BRV X;  2DRO A;  1KS8 A;  1RWH A;  3W7W A;  3Q7A B;  5JPN B;  2H6H B;  4GTO B;  2B39 A;  3WIW A;  3WIR A;  4FNQ A;  1N94 B;  3TY1 A;  5FO7 B;  3M02 A;  2OQE C;  1H14 A;  1R33 A;  3Q1N A;  3VSM A;  1H39 A;  3Q7F B;  1LXK A;  3PZ3 B;  1G9G A;  3RRS A;  1AV4 A;  1JYW A;  2AHG A;  2AFA A;  2D73 A;  3BUI A;  3M7C A;  5JPM B;  1IU7 A;  1H3C A;  1CEM A;  4DOD A;  3OS7 A;  2JF4 A;  3K7X A;  1N1Z A;  2CQS A;  1W7C A;  3HII A;  1WMO A;  3BUD A;  4FNR A;  1F1S A;  3DX0 A;  4D4A A;  2YFO A;  4BZF A;  1OAC A;  1JZ6 A;  1W6J A;  1H3A A;  5ILI A;  3PZ1 B;  3SDU A;  4DUX A;  5CA3 A;  1S64 B;  4DI5 A;  2F18 A;  3WA3 A;  3A3V A;  1H3B A;  3CZS A;  5CD2 A;  2ALW A;  3VDC A;  3C72 B;  4WVC A;  1JYV A;  2SQC A;  1F4A A;  1L1Y A;  3Q73 B;  1N4P B;  3PYA A;  2JKA A;  2BRP A;  2WOH A;  1XWQ A;  4DUV A;  3E1F 1;  3QFZ A;  3KQ4 A;  3DX4 A;  3RJ3 A;  2F7P A;  4YCR A;  3DSV B;  5FO8 B;  1JZ7 A;  4CE7 A;  1D6Z A;  1GHQ A;  4EV5 A;  3T0A A;  1WU4 A;  1US1 A; 
#chains in the Genus database with same CATH homology
 3QRY A;  3SDR A;  3WC3 A;  1LUR A;  1AGM A;  1WZZ A;  4ZH5 A;  4GTM B;  1YQ2 A;  4D4C A;  2JG0 A;  3WUX A;  3SDQ A;  2D5J A;  4D4D A;  2CIS A;  3RX5 A;  1GXO A;  4GTS B;  2G02 A;  1F9D A;  2ZZR A;  4AYR A;  1G6I A;  5AGD A;  4MU9 A;  1MMZ A;  1F9O A;  1JZ5 A;  3DYO A;  2BB6 A;  3D5R A;  4LNV A;  2H6I B;  1JCS B;  1GXM A;  1NS2 A;  1D8E B;  1TF4 A;  2F6D A;  2WII B;  3GT5 A;  4J5T A;  3IAQ A;  2NOJ A;  3SAE A;  1K1W A;  3T0B A;  2WY7 A;  3MV1 1;  2WW3 A;  3VDA A;  1FO2 A;  3ECQ A;  1CB8 A;  2WVY A;  1UT9 A;  2EAD A;  3REN A;  2WYN A;  1WU5 A;  1NKG A;  2WDA A;  3DSX B;  3VD7 A;  1AYX A;  1LF9 A;  1DP0 A;  4GTQ B;  3EU5 B;  1JCQ B;  1W3Y A;  1FMI A;  3EUV B;  4L9P B;  3Q75 B;  3DPY B;  3WVF A;  3P2C A;  2A73 B;  3MUY 1;  4AYO A;  3HXE B;  1MMU A;  3KSQ B;  1NSU A;  1N7R A;  4QT9 A;  2JKP A;  2RGK A;  3SDT A;  4AYP A;  1HM2 A;  1RWG A;  2EAE A;  1DL2 A;  1N7P A;  1TNY B;  2Z07 A;  3M78 A;  3W7S A;  1SO0 A;  4OK2 A;  1R76 A;  1KZO B;  2XFG A;  3VXD A;  3AFL A;  1V7X A;  3WFA A;  4GL3 A;  1NSR A;  1O6Q A;  3HXB B;  1JYX A;  2EAB A;  1LTX B;  3DST B;  1LXM A;  5A1A A;  3M75 A;  1JOV A;  3PYB A;  4LNG B;  1JZ3 A;  3W5M A;  1OJM A;  4ONT A;  1NSX A;  1MZC B;  4FUS A;  3A24 A;  3IMH A;  3T0D A;  1JCR B;  4V1S A;  1RQ5 A;  2V8J A;  1HN0 A;  4L0G A;  4Z4L A;  1NSV A;  1V5D A;  1SA4 B;  3PZ4 B;  1UG9 A;  3HXD B;  1LF6 A;  2WW0 A;  4BZG A;  2FV1 A;  3E30 B;  4Q2B A;  2WVX B;  1NC5 A;  1KZP B;  2IEJ B;  1HCU A;  5KKB A;  1F4H A;  3I3B A;  3ACS A;  2DRR A;  2DRS A;  1GSZ A;  1V5C A;  3H3K A;  1O6H A;  4AQ0 A;  1DOG A;  2NVP A;  1HMW A;  3M74 A;  2FUQ A;  1KSD A;  4KTR A;  2RI9 A;  2Q1F A;  2ZIS B;  1G9J A;  1KRE A;  3DSW B;  4YDE B;  4MMI A;  1KFG A;  3E33 B;  3NJX A;  3S4A A;  3DYP A;  4GTP B;  1EGU A;  1OJN A;  1RWC A;  1NSZ A;  2CQT A;  3NJV A;  3E6U A;  3M72 A;  3Q78 B;  1O1R B;  1JZ2 A;  4OK4 A;  4EHM B;  1IA6 A;  3QSP A;  3QFY A;  3SDV A;  4GTV B;  2B4F A;  3MUZ 1;  4MBG B;  1DCE B;  1TN8 B;  3SQC A;  1X81 B;  1H35 A;  1RWF A;  2BED B;  3QPF A;  2JJB A;  3S4B A;  1NXC A;  1K72 A;  4LNB B;  1S63 B;  3M7B A;  4LIX A;  4WVA A;  2H6F B;  5DGQ A;  3SFX B;  1X1H A;  1V7V A;  3DEC A;  1RWA A;  1WU6 A;  3VD4 A;  1QQF A;  1ULV A;  1K1Y A;  3P5R A;  1SQC A;  4Q88 A;  2ZQ0 A;  3RX8 A;  1GAH A;  1JZ8 A;  3T08 A;  5E2J A;  2HTB A;  1SA5 B;  3OED A;  4GTT B;  2I07 B;  3M7E A;  2ZIR B;  1X9D A;  2VN4 A;  1TXK A;  2BBC A;  1D8D B;  1UMP A;  3T33 A;  1N7N A;  1KSC A;  2V8K A;  2EAC A;  1JS4 A;  4ZH1 A;  1FT2 B;  1H12 A;  1QSJ A;  4OJZ A;  2RI8 A;  3M73 A;  4ZRQ A;  5DGR A;  3A0O A;  4KKJ A;  2QNO A;  1KKT A;  1XW2 A;  2WY8 A;  5CZL A;  2XQW A;  3G6J B;  4CJ0 A;  2E22 A;  4RNL A;  3J7H A;  1HZF A;  4FNV A;  3E34 B;  1Z45 A;  3WKI A;  1VD5 A;  1J0M A;  2XHN A;  1H36 A;  1X1I A;  3DSU B;  1CLC A;  2WCO A;  1IS9 A;  5M7I A;  4BOK A;  1G87 A;  3RSY A;  1MN0 A;  1GXN A;  4AYQ A;  2DRQ A;  1TNB B;  1PX4 A;  3E80 A;  2D8L A;  4TTG A;  2F0Y B;  1N7O A;  3T2P A;  2WW2 A;  3ACT A;  1PX3 A;  1FAE A;  1FPP B;  2CIR A;  2XWJ B;  1H13 A;  1JZ4 A;  2HTA A;  2BB5 A;  3DSS B;  3T09 A;  1LOH A;  1GLM A;  1LD8 B;  1NSS A;  1HN1 A;  2PN5 A;  3Q79 B;  1SNZ A;  1GAI A;  2ZXQ A;  1KWF A;  1FP3 A;  1NS8 A;  3EU8 A;  2XSG A;  3PMM A;  1HMU A;  2R2L B;  3QT9 A;  3P5P A;  2X03 A;  4V1R A;  4D4B A;  2FV0 A;  3RX7 A;  4BOJ A;  2WVZ A;  3M7L A;  3VD5 A;  1LD7 B;  1N4Q B;  3PZ2 B;  3QG0 A;  3H2W A;  2A8Z A;  3IAP A;  3ANJ A;  3WKH A;  3I3D A;  2CIQ A;  3QDE A;  3E73 A;  2V8I A;  2FUZ A;  1JYN A;  1K1X A;  3H7L A;  1O1T B;  3DCD A;  5JMD A;  3QWT A;  3BLC A;  3S4D A;  4M76 A;  2GZ6 A;  3HXC B;  3T2Q A;  5MEH A;  1F9G A;  3ON6 A;  4BZH A;  4TF4 A;  4Z4J A;  3HXF B;  1L2A A;  1NSM A;  5JMF A;  3VD3 A;  4ZRP A;  1HM3 A;  4WVB A;  2H6G B;  2V3P A;  3I3E A;  1MMY A;  1H54 A;  3BGA A;  2G0D A;  3E37 B;  1TNU B;  3NRE A;  3QT3 A;  1RW9 A;  1FCE A;  3K25 A;  2VN7 A;  1NL4 B;  3SEP A;  1TNO B;  3MWX A;  4FXK B;  4DOE A;  3GLY A;  5FOB B;  3MV0 1;  3X17 A;  1N9A B;  2WVX A;  1N95 B;  3T2O A;  3D3I A;  3M76 A;  4YDO B;  3OXU A;  2GH4 A;  1NS7 A;  3GZK A;  1L7K A;  3WIQ A;  2AHF A;  1V7W A;  1N4S B;  1I8Q A;  1FT1 B;  3DRA B;  1TNZ B;  3TF4 A;  5E1Q A;  4CJ1 A;  4MMH A;  3E7J A;  3CU7 A;  3KSL B;  1L7J A;  1MMX A;  4FXG B;  1NS4 A;  2WW1 A;  3VDB A;  3VSN A;  1W6K A;  3ANK A;  5FO9 B;  3AFJ A;  3BS6 A;  1FO3 A;  3OB8 A;  1OJO A;  4GTR B;  4KTP A;  4C1S A;  1OJP A;  2BRW A;  3E32 B;  3W7X A;  3KLS A;  1X1J A;  3OBA A;  4NEI A;  3WKF A;  1TN6 B;  3VD9 A;  1FBW A;  1XWT A;  4DUW A;  1O5M B;  3S4C A;  1FBO A;  2FBA A;  1QBQ B;  3M71 A;  1N4R B;  3W7T A;  2P0V A;  3CZJ A;  4WU0 A;  4L6X A;  1O1S B;  4XUV A;  2E24 A;  5M7Y A;  1TN7 B;  2WZS A;  3S9V A;  1GA2 A;  2FUT A;  4D94 A;  2WIN B;  3W5N A;  3EZ8 A;  4BZE A;  4EL8 A;  1C82 A;  2XWB B;  3DYM A;  1J0N A;  1O79 A;  3QXF A;  2PMV A;  3W7U A;  1NS0 A;  3D5S A;  3EQA A;  4JJJ A;  1NI1 B;  2V3N A;  5GW7 A;  1N7Q A;  3M77 A;  1IA7 A;  1O6R A;  3CIH A;  3K11 A;  3VW5 A;  5GY3 A;  1C3D A;  1KRF A;  3WKG A;  2JKE A;  4KKI A;  5GZK A;  2YIK A;  2ZBL A;  4ZG8 A;  2GOX A;  1H37 A;  3QXQ A;  3ANI A;  3SFY B;  4TXT A;  2OKX A;  1YGA A;  2DRO A;  2BRV X;  1KS8 A;  1RWH A;  3W7W A;  3Q7A B;  5JPN B;  2H6H B;  4GTO B;  2B39 A;  3WIW A;  3WIR A;  1N94 B;  3TY1 A;  5FO7 B;  1H14 A;  3Q1N A;  3VSM A;  1H39 A;  3Q7F B;  1LXK A;  3PZ3 B;  1G9G A;  3RRS A;  1JYW A;  2AHG A;  2AFA A;  2D73 A;  3M7C A;  5JPM B;  1H3C A;  1CEM A;  4DOD A;  3OS7 A;  2JF4 A;  3K7X A;  2CQS A;  1F1S A;  4D4A A;  4BZF A;  1JZ6 A;  1W6J A;  1H3A A;  3PZ1 B;  3SDU A;  4DUX A;  5CA3 A;  1S64 B;  3A3V A;  1H3B A;  5CD2 A;  3VDC A;  3C72 B;  4WVC A;  1JYV A;  2SQC A;  1F4A A;  1L1Y A;  3Q73 B;  1N4P B;  3PYA A;  2JKA A;  2BRP A;  1XWQ A;  4DUV A;  3E1F 1;  3QFZ A;  3KQ4 A;  3RJ3 A;  1JZ7 A;  4YCR A;  3DSV B;  5FO8 B;  4CE7 A;  1GHQ A;  3T0A A;  1WU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...