1LF8A

Complex of gga3-vhs domain and ci-mpr c-terminal phosphopeptide
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
151
structure length
151
Chain Sequence
b'ESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEWEALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYSWTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADP-ribosylation factor binding protein GGA3
publication title Phosphoregulation of sorting signal-VHS domain interactions by a direct electrostatic mechanism.
pubmed rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 57
structure length 151
sequence length 151
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00790 VHS VHS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1lf8A00
2DIWA 4HFGA 3D9PA 2QY7A 4JXTA 3D9NA 1DVPA 3LDZA 4NACA 1SZAA 3D9IA 3RRUA 3ZYKA 3D9LA 5LOZA 3G2VA 2V8SE 4GZDA 4Q96A 4Q94A 3CLJA 1EDUA 1HFAA 1UJKA 2BF0X 2KM4A 3ZYQA 5LP0A 1SZ9A 1EYHA 2L0TB 1XGWA 5CMWA 3G2TA 1H0AA 3ZYMA 1JUQA 1MHQA 1ELKA 2MOWA 1VDYA 5CMYA 1X5BA 4AVXA 3G2SA 4GZCA 3ZYLA 3D9MA 1HF8A 1HG5A 1JPLA 3G2WA 4FU3A 2L0IA 1INZA 1JWGA 1JWFA 2DCPA 3ONLA 5J08A 2LO6A 1PY1A 1LF8A 1UJJA 3D9KA 3D9JA 3G2UA 3ONKA 1HX8A 3D9OA 1HG2A 4FLBA
chains in the Genus database with same CATH superfamily
2HO1A 4I9CA 3FH8A 3MCXA 4EECA 2X6KA 2P9IG 4XE0A 4ANVA 1HU3A 4PS7A 2PL2A 2X6FA 3TWWA 4G8LA 4IN3B 4YDWA 4GTPA 4YDOA 3CHMA 3FEXA 4JW1A 4FJYA 3SNXA 2RFAA 5AQ9A 2J08A 4ANUA 4X8QA 1KT0A 3CSFA 3IBEA 3LVQE 2AVPA 3EHRA 5M72A 4BEPA 3LJNA 2ZISA 2H6FA 2A4ZA 1MX4A 3OAWA 4BT8A 5FQ8A 1G3NB 5G55A 2QZAA 4ANWA 2DZNA 1WDYA 2WPVA 3LKUA 3TWXA 3ZIMA 4D10C 1EYHA 5EYPF 4ZFHA 4TUMA 4HS2A 2CHXA 3UPVA 2OVFA 2GRMA 4B89A 1IHBA 4UI9C 4ZHBA 2OOEA 4DK5A 2LSUA 2E2EA 3HXCA 3ASOE 1EF1C 4WAFA 4DRXE 3PS6A 2QYJA 3Q47B 5AQBA 4GTQA 2Y3AA 3ZKJA 1NI1A 2WMNA 4I17A 1IQUA 3ZEFA 2NYJA 2DYSE 1SVXA 3V30A 3GZ1A 2NXPA 2V5QC 5KNHD 5KNGA 2J4DA 2A5UA 1JCRA 1KPSB 3F6QA 2JEKA 3SI5A 5IY5E 3T9KA 2I1KA 4EQFA 4KMOA 4I1MA 5CECB 1MX2A 1BPOA 5G04J 3DPYA 4GPKA 2WXGA 3AS8A 1OCRE 2XEVA 2L0TB 3FTWA 3PE3A 4LERA 2UY1B 3V2XA 3ASDA 3DBSA 2R03A 3B7RL 4LEUA 3DSTA 2VYIA 2X6IA 2XZDG 2DYRE 1OWMA 3UM0A 4CT4A 3LY9A 4WNDA 2IU1A 2MOWA 2IF4A 3ZYLA 4K03A 4GA2A 1K3ZD 4DLOA 1MX6A 4XZ4A 3FH7A 1ZBPA 5CERB 4LSZE 2LXMA 4G24A 3CLJA 4J8DA 3ZXSA 3OTNA 4QQIA 3I5PA 4GZ5A 4GA0A 1RZ4A 1E90A 1Z6TA 3B95A 3JYSA 2XS8A 2RFMA 2R02A 4PS3A 3HG0D 1QZ2A 4A63B 3CSTA 3I3NA 3Q5MA 2BEDA 2X6JA 4O60A 4C0MA 3FU3A 1PAQA 4N5CA 3PUJA 2J9QA 5J08A 2VQ2A 4FLBA 5CRVA 3FDHA 5D2MC 3ASHA 4B0ZA 5E75A 1Z5SC 3JXIA 3FUEA 3EIQC 1XGWA 3RO2A 2X3MA 2XQ0A 4TUUA 2XEEA 3C3RA 3GZ2A 1N52A 2PM7A 3APFA 2C2LA 4HI9A 2WXKA 1N9AA 2YHEA 3PEVB 5CMYA 1O1SA 1JWFA 5J90A 2JLBA 3D9JA 3R7RA 3TG5A 5HI7A 3ESLA 3DXMG 3OXLA 3B7BA 3I4RB 1NP7A 3EU9A 4U04A 3MJWA 1E8ZA 1E7UA 1EPUA 3ASGA 3QWPA 5BV0A 4APFA 2ETAA 5C1DA 5FZQA 2P9KG 3I4GA 3SD5A 1E8YA 2DWZA 3L08A 3B7TA 2IQCA 1FT1A 5AAOA 2XS1A 3TWTA 2V4LA 2WXNA 1E8WA 2YINA 3QC1A 4LNGA 4JVSA 4EZKA 5EX0A 1SA4A 5EILA 2LAHA 4LRZA 2GRNB 4OVUA 4KT6B 4NACA 5CCLA 5CEDB 1JCQA 1P5QA 4L2YA 1HFAA 3VTXA 2P9SG 3FY4A 3AU5A 5EIDA 4P29A 4GYYA 5JMND 3UM3A 3MX3A 3DSXA 4J0UA 5AARA 4JHRA 4WNGA 3DWLG 1H19A 2VJ8A 4WWPA 3SZ7A 2KM4A 3MKQB 2IJGX 3FEYA 4U8HA 4GTOA 4CCAA 1KZPA 2L9BA 4BERA 1X81A 1WAO1 4DUIA 1Y6IA 4DX2A 5LP0A 2CFUA 3HRAA 4DJAA 2MYOA 2GRLA 2B6CA 2DCPA 3LXUX 5EN5D 3D9KA 2X6HA 4UI9J 1E7VA 3VLFA 5EX3A 2I2OA 4JD2G 1XNFA 4G11A 4TRQA 4DX1A 2KBXA 2AW6A 1FT2A 4EZLA 1OCCE 2P9NG 4GTTA 3Q49B 1K1AA 3NQPA 3PUKA 4LCTA 3TJPA 4AY5A 2KCKA 4EBAG 4CYMD 4EBAA 4URKA 3DEOA 4BX9A 4A3TA 4TXPA 1JWGA 1V54E 2HR2A 2YQ8A 2KXPC 3C5RA 3ZNGA 2OEWA 5CCMA 3PDNA 3EHQA 5B1AE 1OXJA 2F8XK 1S70B 3EHMA 3MZLB 4FP7A 3S7JA 3SFZA 2BKGA 3KEZA 4Y6WA 2IO3C 1TJCA 3Q9UC 1K8KG 4ANXA 4KBQA 4CEMA 2GRQB 4I6EA 3P1UA 3UKRG 2CHWA 2ZU6B 3NB2A 3RRMB 5FZRA 5HS0A 1TR4A 2LSVA 2WXJA 2GGFA 1TNZA 4NIKA 5KJMA 3FULA 5DBKA 3ASNE 3PZ1A 3Q9NC 4CGWA 2DIWA 1U3CA 2XPYA 2PZIA 5BPPA 4HLLA 2HM8A 4XI9A 3X2QE 2WQ6A 2H6GA 1NL4A 2Y69E 4WWNA 5AQ7A 3AG4E 3FUDA 3Q7FA 1HH8A 4HRLA 5EKQD 4G8KA 4GPMA 5BXUA 1PC2A 2QFCA 2XENA 3QOUA 2A5EA 2WXHA 3AJIA 2GROB 4NRHB 3CHQA 3FFLA 3UTMA 4LUNU 5ANLA 3U3WA 4G25A 2R2LA 1UOHA 4L1BA 5FINA 1H2UA 1NFIE 1N4QA 1UW4B 1N54A 3CK7A 2C0LA 3UM2A 3FUMA 4HOTA 3NBNB 3E34A 5FT9A 2UY1A 4FJZA 1SZ9A 5CMWA 3ZPJA 3QK0A 3SO8A 4FU3A 4CDRA 2WVIA 3UT8A 5BXOA 1BI7B 4JL0A 2L6JA 5KWDA 2NC9A 5ENRD 4GTMA 4BSXA 3D9IA 4XKBA 3TWQA 2RKKA 2WXRA 3WG7E 3UXGA 2R05A 2VGYA 1H0AA 4LNBA 3Q4AB 2RD0A 1VDYA 5B3SE 3CIAA 4BTAA 1ELRA 3JCKC 2CHZA 3BQOA 4ILGA 4UI9K 4CGVA 2YNQA 4H7XA 2EIME 1TYQG 2KZTB 3UIOC 1TN6A 3FTXA 3KS2A 4Z68A 3GYZA 4FHKA 4ILIA 3CR3A 2VGXB 2OEVA 1IYGA 4W9RA 2J09A 4ILHB 1N0QA 4KYOB 5BUZA 5LFAA 2ZGDA 3FTSA 3CKCA 4L2LA 4GZDA 4FLHA 4A3VA 2EINE 1YCSB 4KZ0A 4BESA 3FTVA 3FTUA 2XCBA 4IYPA 4EHMA 4CDMA 4N3AA 2KCVA 3IV0A 5FQ4A 3ZUVB 4XI0A 5FZSA 2F37A 3HXDA 5AQAA 5ENTD 2LNIA 5T4YA 1TNUA 4R7LA 4U0SA 3LEWA 1E96B 1NA0A 1HE8A 4G23A 4AVXA 3OXFA 4AJWA 1UJJA 4GMJA 1HG2A 4F1SA 3NAWA 3FUKA 3SHFA 2IONA 3G2TA 2DVWA 3HXBA 2XRZA 4L7TA 1K1BA 3TXNA 4DX6D 3FWVA 2IO2C 2WXMA 5BNWA 1H6OA 5JJ7A 2QC9A 3CGHA 4Q96A 3O4ZA 4IULA 4V3IA 4JA9A 3DSUA 2YHCA 4O1PA 3NOCD 1E8XA 3O48A 3Q79A 3E33A 3EHNA 1OUVA 2P58C 4HOSA 3S7FA 3DXKG 1UJKA 4MRUA 3RKVA 3AAAC 4J8YA 2H6IA 1Z3YA 4UWLA 2EQXA 3S7BA 2KCLA 4GCOA 3QARA 2DBAA 1UN9A 1AWCB 4F3VA 1TN7A 5G05C 2GRRB 2IOLA 3UX4A 4GA1A 3KEAA 4OAVB 3CHRA 3TL5A 4BTBA 4JA7A 4N5QA 3UINC 2EILE 3MKQA 3QNKA 3AS4A 4JHKA 4G26A 2V8SE 5EDSA 2ZIRA 3NF1A 3EIJA 4HORA 3G2SA 4N2SA 1QBQA 3PRZA 4AXHA 4I2ZA 5ARFA 3QAQA 3BU8A 3CHOA 2B0OE 2Y4TA 2J4BA 3B7SA 2Q7FA 4ATGA 4GCNA 1RW2A 3SBSA 4KZCA 4UWFA 4M3OA 3UIPC 2LAIA 5KJKA 5DIZA 3ZU7B 3LJ3A 3ENEA 4JPSA 1NZNA 4I6GA 5H7PA 3NZUA 4ABNA 4F6RD 1SW6A 3ZVVA 3HYMB 4GAAA 2FEZA 3AU4A 4UWKA 3APCA 3QDNA 4TXRA 4GMRA 3ZRHA 2F0YA 3D9PA 5ANRA 5ITZF 1IQRA 3KAEA 3PZ3A 2NSZA 2P9UG 2VGEA 2ILRA 3IKOB 5FJYA 2CG3A 2QYUA 4CDNA 2XHEA 1GW6A 5A6CA 4YDYA 2XGSA 3QWVA 3PEUB 1YMPA 4JC8A 3CHSA 5E76A 1HO8A 2V0PA 4OYSA 4RG9A 3K9IA 3ESKA 3EUVA 4EZJA 2DZOA 2AWIA 3DEPA 3T5VA 3FU6A 4I43A 1U3DA 2XZTG 3ZW3A 2WQHA 3BG0B 4F1PA 4BY6A 2WXQA 2IEJA 3APDA 4O6FA 3CK8A 3RIBA 1ELKA 3SY2A 1OWNA 3UT4A 4U63A 1HX8A 1V55E 3ABLE 4ME2A 4FHJA 4L23A 3IXEA 2VSOE 5T8IA 1N11A 4FC8A 4K5CA 1DNPA 4GZ6A 4WWOA 2LO6A 1W3BA 2V4HC 3D9OA 4O1OA 4Q69A 3D9NA 1OY3D 1OCZE 3W9GA 1H6PA 1ZU2A 4PUCA 3IHYA 4WNEA 3TWRA 3HHMA 4JZYA 3QKYA 2L0IA 4FA6A 4AV7A 2XGOA 4N3CA 4BX8A 3W9FA 3RRNB 3EJNA 2L6BA 3CQCB 3MV3B 4U95D 4HNAD 2C0MA 1BLXB 3VLEA 3FH5A 2AXUA 4GU5A 1JUQA 3TXMA 1MHQA 3KD7A 3P2BA 1LD7A 4NURA 4A1GA 4BT9A 3JQ1A 3ZHEB 4RVBA 3R7QA 3QJZA 1ELWA 3GW4A 4KXKB 4C0EA 3J5PA 3UT7A 1HZ4A 4U8YD 3RRUA 4OVVA 1TNYA 3PE4A 2KATA 4OAUC 4XEIG 2CFZA 4A55A 2BKKB 3SFYA 4F53A 2WMOA 3R9MA 4HOUA 3BUAA 2HE0A 4CT0A 1X5BA 4U0UA 4J8SA 1FPPA 3HVEB 3MKRA 5KJNA 2AJAA 5ENNA 4JEHA 3ABKE 3RAUA 2KZTA 4FADA 3PNLB 3C72A 4Y6CA 1NA3A 1FVHA 2VGXA 4N39A 5G2NA 3AG2E 3PVLA 5D0QD 2JABA 3EU5A 3LVRE 3L13A 1IXVA 4JEUA 1FVFA 3RU0A 3WXXA 3LYAA 4L9PA 1HF8A 3MEKA 5A7DB 3ONLA 3Q75A 4N3BA 2J49A 4QFVA 3ZYKA 5AIJA 4KVOA 2I1JA 3Q73A 1SA5A 2Y4UA 4K5BA 4HVBA 3T8KA 5JJ6A 2V5FA 4APOA 5JA4D 3Q15A 4PH4B 3SBTB 4RSYA 4XIFA 4GTSA 1WG0A 4UWGA 4I9EA 5LX8A 1O5MA 5G05J 3ISMC 5HRYA 2PNNA 3CQGB 3TWUA 3OXGA 2BTDA 1TEZA 5JJTA 2PM6A 2BUGA 1DCEA 3UKUG 3BEEA 2MHKA 5LOZA 5AN8A 3LCAA 3MYVA 5KCMA 3JUIA 1UN8A 4ACKA 5LCWC 1A17A 3UUXA 4C48B 1D9SA 1KT1A 5BT1A 3G2WA 1S0PA 3L82A 1PY1A 1S64A 4CZ2D 2Y1LE 3CVQA 3FTYA 2XGMA 3HDXA 2XCCA 4LNUD 2ETBA 1N95A 2KC7A 2WXLA 2P2CP 3B7UX 3CVLA 4J6IA 4MLPA 4I2WA 4AP2A 3ZGQA 4DPRA 3ULQA 4GYWA 3ML8A 2R17C 3MGBA 1JCSA 2VTBB 3FU0A 3ULEG 1BD8A 4JB8P 3UMVA 2LXLA 4GZCA 1L5JA 4J8FA 4HB5A 2WQ7A 4YVQC 4HRMB 5ENOD 3FUIA 1N94A 5B1BE 4HFGA 2FI7A 3L54A 4K5AB 2MRIA 4WUYA 5CRUA 2XEHA 3C3QA 1A5EA 5BV1A 1TNBA 1KLXA 4RG6A 5A23A 2HYZA 3MV2B 3L22A 1YA0A 2EIJE 2IOSA 3DPDA 2FF4A 5KJLA 3FUNA 5CBNA 4YDEA 3RSEG 5AENA 1H6KA 3HXEA 1OT8A 1MZCA 1LTXA 5ENSD 2CG2A 3CVWA 4AOFA 4DI3A 3CKBA 3Q78A 3ZN3A 5JHBA 3UI2A 3CVNA 4AIFA 5AYWD 3J5QB 3TWVA 3E4BA 3AS5A 3HXFA 5HQ8A 3PZ4A 4BFRA 2J8SD 1N4PA 3CVYA 5CHEE 3DRAA 4MKTA 1H2VC 1SZAA 3Q7AA 3T8MA 4BSZB 2WXPA 3NOGD 1KZOA 3FU5A 5CEAA 2OCCE 2VSYA 4PDXA 4AY6A 1TNOA 5FTPA 1LF8A 1IKND 3G2UA 1WM5A 4CRWA 3S7DA 3C98A 3TG4A 2FO1E 4GZ3A 4UQXA 3HIZA 1HS6A 2BF0X 2FO7A 2PQNA 2RG8A 1D8EA 5FQ7A 2H6HA 3RJVA 1TN8A 1BU9A 4U96D 5C2YA 2LUHA 3URZA 5AJLA 3D9LA 3PZ2A 3AG1E 1HXIA 3N71A 2GRPB 5EIBE 3MA5A 3CVXA 4RLYA 3PREA 5ARGA 3CVUA 1AP7A 4I1OB 4PS8A 3SF4A 2FBNA 4AEZC 3KSQA 4B8AA 1MJ0A 4JXTA 3D9HA 4HXIA 3LS8A 2ETCA 5FWQA 2EIKE 4Q94A 3TGOA 4UUCA 1IHGA 1QNFA 3RK6A 2OV8A 3V79K 5HKPA 2Y0BG 3E37A 5D66A 3KSLA 2I6HA 3JXJA 3S2AA 2VSXE 4UQYA 4K0RA 3NZSA 3U66A 4DI4A 5JHAA 3FUHA 2ZGGA 3B13A 2ONDA 4YVOA 2XPZA 5ENQD 1N4RA 1OWOA 2UWJG 4B94A 1U2VG 3VTYA 5FQ6A 4GB9A 3ULYA 3TAXA 4EPZA 3E32A 3SGHA 4I1AA 3RO3A 3LPZA 3DSWA 4DLQA 1BI8B 2WXIA 2OVBA 4HI8A 5ENPD 2GW1A 1INZA 4AM9A 4LG6A 3FUJA 3ONKA 3CEQA 5G04C 4MBGA 4J8EA 1H2TC 3LDZA 1Q2ZA 3FUFA 1B89A 3VLDA 4JHJA 4U07A 4HLEA 3LY8A 3ABME 3ZHEA 4E85A 2M63A 3GZSA 2AXVA 2XRYA 3TWSA 2P9PG 3IHVA 4C9BB 3SFXA 4DX7D 3PZDA 5T3RA 3UM1A 4GTVA 3FHEA 3L6AA 4HQDA 3U64A 4IRUA 1MYOA 3CV0A 3HVEA 3ASFA 4UWHA 3T5XA 5LCWJ 4XKCA 1OWLA 3U4TA 4NQ0A 4M7CA 3UQ3A 4XX5A 2ZXWE 4BETA 4B8CB 3DSSA 1N4SA 1DVPA 1TJFA 1O1TA 4TXQA 1DCQA 1D8DA 4ACLA 1LD8A 2F8YA 1Y8MA 1OWPA 3SQVA 4WNFA 1JPLA 2P9LG 3L9TA 2WXOA 3CVVA 2IY0C 4U7EB 4ATZD 1MQSA 4A1SA 1ZB1A 2VSNA 3L17A 4RQIA 5FIOA 1FCHA 3G2VA 2WB2A 4DX5D 4U0ZA 2AXZA 3C3OA 4B93B 3U9WA 4U8VD 4G2VA 4I6JA 2WXFA 3FTZA 4HOQA 5EYLA 3V2OA 3CVPA 2QY7A 3FP3A 3IEGA 3BG1B 3CHPA 3AG3E 3ZYQA 3PNTB 4HBDA 2XPIA 3QWWA 3PH0C 3L16A 1QYMA 1DC2A 3CK9A 4MS6A 4E6HA 5D0OD 1Z3XA 3EDTB 3ZXPA 4GTRA 3ZFWA 4FULA 2J07A 1EDUA 1S63A 3DSVA 3ZYMA 1WY6A 2X38A 4BWRA 1HG5A 3E30A 3JUEA 4G1TA 1QQEA 1YYHA 3V31A 4GMLA 2I9CA 3QB2A 4KVMA 2IFUA 3D3MA 5AJDA 5CBOA 3LY7A 4GYOA 1OCOE 2E0IA 2VTBA 1UG3A 3D9MA 5BW8C 2R59A 3ML9A 2R5SA 4F7AA 1O1RA 4HRNA 1SQMA 3JQ0A 4YNDA 4N2QA 4J7WA 2FULA 3R9AB 1N0RA 4TV3A 4UQZA 4H7YA 5KBAA 2WM9A 2PQRA
chains in the Genus database with same CATH topology
2Y4TA 2HO1A 1E7VA 4I9CA 2J4BA 1H6KA 3FH8A 4UI9J 5EX3A 3VLFA 3B7SA 3MCXA 5AENA 2Q7FA 2I2OA 4ATGA 1XNFA 4EECA 4GCNA 4G11A 2X6KA 2CG2A 4TRQA 4XE0A 3SBSA 3CVWA 4AOFA 4KZCA 4DI3A 4ANVA 4UWFA 4M3OA 2LAIA 5KJKA 5DIZA 3CKBA 1HU3A 4PS7A 2AW6A 2PL2A 2X6FA 3LJ3A 3ENEA 4JPSA 3ZN3A 4EZLA 1NZNA 4IN3B 5JHBA 3Q49B 3CVNA 4I6GA 4AIFA 3CHMA 5AYWD 3FEXA 3NQPA 3PUKA 4LCTA 4JW1A 4FJYA 3SNXA 3NZUA 3TJPA 3E4BA 3AS5A 4ABNA 4AY5A 2KCKA 3ZVVA 3HYMB 4EBAG 4EBAA 4URKA 2J08A 4GAAA 2FEZA 4ANUA 4BX9A 3AU4A 1KT0A 3CSFA 4UWKA 5HQ8A 3IBEA 3LVQE 4A3TA 2AVPA 3APCA 5M72A 4BFRA 3QDNA 3CVYA 1JWGA 5CHEE 2A4ZA 2HR2A 3ZRHA 3OAWA 4BT8A 5FQ8A 2YQ8A 4MKTA 5G55A 3D9PA 1H2VC 4ANWA 5ANRA 1SZAA 2WPVA 3LKUA 5CCMA 3T8MA 3PDNA 1IQRA 2WXPA 3KAEA 2NSZA 3ZIMA 4D10C 1EYHA 3FU5A 2ILRA 3IKOB 5FJYA 3EHMA 3MZLB 2CG3A 4HS2A 2VSYA 2CHXA 2XHEA 1GW6A 4FP7A 3S7JA 3SFZA 4PDXA 4CDNA 5A6CA 3KEZA 3UPVA 4AY6A 4Y6WA 2OVFA 1TJCA 2GRMA 4B89A 5FTPA 4ANXA 1LF8A 3G2UA 2XGSA 4KBQA 4UI9C 4CEMA 1WM5A 3QWVA 2OOEA 4CRWA 3PEUB 3S7DA 4I6EA 4DK5A 2LSUA 2E2EA 3C98A 3TG4A 3P1UA 4JC8A 4GZ3A 2CHWA 2ZU6B 3RRMB 1EF1C 4UQXA 5FZRA 3HIZA 3CHSA 1HS6A 4WAFA 2BF0X 5E76A 2LSVA 2WXJA 1HO8A 2GGFA 5KJMA 2V0PA 2FO7A 2PQNA 2RG8A 3FULA 5DBKA 4OYSA 4RG9A 5FQ7A 3K9IA 3RJVA 3ESKA 3PS6A 4EZJA 2AWIA 3Q47B 5C2YA 4CGWA 2DIWA 2Y3AA 3T5VA 3URZA 1U3CA 2XPYA 2WMNA 3FU6A 4I17A 4I43A 1U3DA 5AJLA 1IQUA 2PZIA 2WQHA 3BG0B 3ZEFA 3ZW3A 3D9LA 4BY6A 2WXQA 5BPPA 3GZ1A 2NXPA 3APDA 4O6FA 2HM8A 1HXIA 2J4DA 3N71A 4XI9A 3CK8A 2A5UA 2WQ6A 3RIBA 4WWNA 1ELKA 3MA5A 2JEKA 3CVXA 3FUDA 3SI5A 3PREA 1OWNA 5ARGA 3CVUA 4I1OB 4PS8A 1HH8A 5EKQD 2I1KA 4U63A 3UT4A 4EQFA 3SF4A 4KMOA 2FBNA 4I1MA 4AEZC 1HX8A 1PC2A 2QFCA 4B8AA 1BPOA 3QOUA 4JXTA 4ME2A 5G04J 4HXIA 4FHJA 4GPKA 2WXHA 4L23A 3LS8A 2WXGA 5FWQA 3AS8A 2XEVA 4Q94A 4NRHB 3CHQA 3TGOA 2VSOE 3FFLA 4LUNU 5T8IA 5ANLA 3U3WA 2L0TB 4G25A 1IHGA 3FTWA 3PE3A 4LERA 1QNFA 4FC8A 3RK6A 2OV8A 1DNPA 4GZ6A 2UY1B 4L1BA 3ASDA 1H2UA 3DBSA 4WWOA 2LO6A 3B7RL 1W3BA 4LEUA 1UW4B 2I6HA 3D9OA 2VYIA 2X6IA 1N54A 3CK7A 3S2AA 2VSXE 2C0LA 4UQYA 4K0RA 4Q69A 3D9NA 3NZSA 3FUMA 4HOTA 3U66A 4DI4A 5JHAA 5FT9A 2UY1A 3FUHA 4FJZA 3B13A 2ONDA 1OWMA 4YVOA 1ZU2A 4CT4A 4PUCA 3IHYA 1SZ9A 4WNEA 5CMWA 2XPZA 3LY9A 3ZPJA 3QK0A 4WNDA 2IU1A 2MOWA 3HHMA 4JZYA 2IF4A 3QKYA 3ZYLA 1OWOA 4K03A 4GA2A 2UWJG 4FU3A 2L0IA 4CDRA 4DLOA 2WVIA 4B94A 4FA6A 3UT8A 4AV7A 2XGOA 4N3CA 4BX8A 4XZ4A 3VTYA 4JL0A 2L6JA 5FQ6A 4GB9A 2NC9A 1ZBPA 3FH7A 3EJNA 3RRNB 4BSXA 3CQCB 3D9IA 3MV3B 3TAXA 2C0MA 4EPZA 4G24A 3SGHA 3CLJA 4I1AA 4XKBA 4J8DA 3ZXSA 3RO3A 3VLEA 3LPZA 3OTNA 2WXRA 3I5PA 3FH5A 2AXUA 4DLQA 2VGYA 4GZ5A 4GA0A 1H0AA 2WXIA 4GU5A 1JUQA 2RD0A 1MHQA 3Q4AB 3TXMA 1VDYA 2OVBA 3CIAA 3KD7A 4BTAA 3P2BA 1ELRA 3JCKC 2GW1A 1INZA 1E90A 4NURA 4A1GA 2CHZA 1Z6TA 4AM9A 4BT9A 3FUJA 3JQ1A 4ILGA 4UI9K 3ONKA 4RVBA 3ZHEB 3R7QA 3QJZA 3CEQA 4CGVA 2YNQA 5G04C 4J8EA 1ELWA 1H2TC 3GW4A 4KXKB 4C0EA 4H7XA 3JYSA 3LDZA 3UT7A 1HZ4A 3RRUA 3FUFA 4OVVA 1B89A 3VLDA 3PE4A 4JHJA 2KATA 4U07A 4HLEA 4PS3A 4A55A 2CFZA 2KZTB 3KS2A 3FTXA 4F53A 2WMOA 1QZ2A 3LY8A 4HOUA 3CSTA 3GYZA 4FHKA 3ZHEA 3I3NA 4ILIA 3Q5MA 4CT0A 4E85A 2X6JA 1X5BA 4C0MA 3CR3A 3FU3A 4U0UA 1PAQA 2VGXB 4N5CA 3PUJA 4J8SA 2M63A 3GZSA 3HVEB 2J9QA 2AXVA 2XRYA 5J08A 1IYGA 3MKRA 5KJNA 4W9RA 2J09A 3IHVA 4ILHB 5ENNA 4JEHA 2VQ2A 4KYOB 4C9BB 4FLBA 5BUZA 5LFAA 3FDHA 2KZTA 3PZDA 5T3RA 4FADA 3PNLB 3FHEA 3FTSA 3L6AA 3U64A 4IRUA 4Y6CA 3CKCA 1NA3A 1FVHA 4L2LA 3ASHA 4GZDA 2VGXA 4N39A 4FLHA 3CV0A 3PVLA 5E75A 3HVEA 5G2NA 4B0ZA 3ASFA 5D0QD 3LVRE 3L13A 4A3VA 3FUEA 4JEUA 4UWHA 3EIQC 1XGWA 4KZ0A 1FVFA 3RO2A 3RU0A 3T5XA 3WXXA 5LCWJ 3LYAA 2X3MA 3FTUA 3FTVA 4XKCA 1HF8A 2XCBA 4IYPA 3MEKA 5A7DB 2XQ0A 3ONLA 1OWLA 3U4TA 4CDMA 4NQ0A 3UQ3A 4N3AA 4N3BA 4TUUA 2J49A 4XX5A 2KCVA 4B8CB 3GZ2A 3IV0A 1N52A 2PM7A 4QFVA 3APFA 5FQ4A 2C2LA 1DVPA 1TJFA 4XI0A 5FZSA 3ZYKA 5AIJA 4KVOA 2I1JA 2LNIA 5T4YA 4ACLA 2WXKA 4R7LA 4U0SA 1Y8MA 3LEWA 1E96B 1NA0A 2Y4UA 2YHEA 3PEVB 1OWPA 1HE8A 4G23A 5CMYA 4WNFA 4AVXA 4HVBA 1JPLA 5JJ6A 1JWFA 2V5FA 2WXOA 4APOA 3Q15A 3OXFA 4AJWA 2JLBA 3D9JA 1UJJA 4PH4B 3SBTB 5J90A 3CVVA 3R7RA 4GMJA 1HG2A 3TG5A 1MQSA 5HI7A 4F1SA 4A1SA 2VSNA 3L17A 3ESLA 4RSYA 3OXLA 4XIFA 3FUKA 1FCHA 3G2VA 2WB2A 3SHFA 3I4RB 4U0ZA 2AXZA 4I9EA 1NP7A 4UWGA 4U04A 5LX8A 3MJWA 2IONA 3U9WA 3G2TA 1E8ZA 5G05J 1E7UA 1EPUA 3ASGA 4L7TA 2XRZA 4G2VA 4I6JA 3CQGB 3QWPA 5BV0A 2WXFA 3FTZA 3TXNA 4APFA 3OXGA 4HOQA 2BTDA 5C1DA 1TEZA 5FZQA 3FWVA 3I4GA 5JJTA 2PM6A 3SD5A 2BUGA 1E8YA 3CVPA 2QY7A 3BEEA 2WXMA 3L08A 3B7TA 2MHKA 3FP3A 2IQCA 5LOZA 5BNWA 3LCAA 5JJ7A 3IEGA 3MYVA 3BG1B 3CHPA 3CGHA 4Q96A 5KCMA 3JUIA 1UN8A 4ACKA 3ZYQA 5LCWC 3PNTB 2V4LA 2WXNA 1E8WA 1A17A 2XPIA 2YINA 3O4ZA 3UUXA 3QC1A 4JVSA 1KT1A 5BT1A 4EZKA 3QWWA 4IULA 3G2WA 4JA9A 4V3IA 3PH0C 5EX0A 1S0PA 3L16A 1PY1A 2YHCA 3CK9A 4MS6A 2LAHA 4E6HA 5D0OD 1E8XA 3O48A 1Z3XA 4LRZA 3EDTB 4OVUA 3CVQA 4KT6B 4NACA 5CCLA 3EHNA 3FTYA 1OUVA 2P58C 4HOSA 2XGMA 3HDXA 3ZFWA 2XCCA 4FULA 3S7FA 1P5QA 4L2YA 2J07A 1EDUA 1HFAA 1UJKA 2KC7A 2WXLA 3VTXA 3B7UX 3FY4A 4MRUA 3CVLA 3AU5A 4J6IA 4P29A 1WY6A 3ZYMA 2X38A 3RKVA 4MLPA 4GYYA 4I2WA 4AP2A 4BWRA 1HG5A 3ZGQA 1Z3YA 4G1TA 4UWLA 2EQXA 3MX3A 3S7BA 4DPRA 3ULQA 1QQEA 2KCLA 4GYWA 4J0UA 3ML8A 4GCOA 3QARA 2R17C 4GMLA 2DBAA 2I9CA 1UN9A 3MGBA 3QB2A 2VTBB 4JHRA 3FU0A 4WNGA 4F3VA 4KVMA 2IFUA 1H19A 3D3MA 2VJ8A 4WWPA 5AJDA 3SZ7A 2KM4A 3MKQB 5G05C 2IOLA 3UX4A 4GA1A 3LY7A 3UMVA 2IJGX 3FEYA 4U8HA 4GZCA 4GYOA 1L5JA 4J8FA 3CHRA 2WQ7A 4YVQC 3TL5A 4BTBA 2E0IA 2VTBA 4CCAA 3FUIA 1UG3A 3D9MA 4JA7A 2L9BA 5BW8C 2R59A 3ML9A 1WAO1 4HFGA 2R5SA 2FI7A 3MKQA 3QNKA 3L54A 4F7AA 2MRIA 4WUYA 3AS4A 4JHKA 1SQMA 4G26A 2V8SE 1Y6IA 3JQ0A 5BV1A 4YNDA 4N2QA 5EDSA 5LP0A 1KLXA 4RG6A 3NF1A 5A23A 2CFUA 2HYZA 3EIJA 4HORA 2FULA 3G2SA 3R9AB 4DJAA 4N2SA 3PRZA 4TV3A 2GRLA 4AXHA 3MV2B 2DCPA 3L22A 4H7YA 1YA0A 4I2ZA 4UQZA 3LXUX 5ARFA 2IOSA 2WM9A 3DPDA 2FF4A 3D9KA 5KJLA 2X6HA 3FUNA 3QAQA 3CHOA 2PQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DIW A;  4HFG A;  3D9P A;  2QY7 A;  4JXT A;  3D9N A;  1DVP A;  3LDZ A;  4NAC A;  1SZA A;  3D9I A;  3RRU A;  3ZYK A;  3D9L A;  5LOZ A;  3G2V A;  2V8S E;  4GZD A;  4Q96 A;  4Q94 A;  3CLJ A;  1EDU A;  1HFA A;  1UJK A;  2BF0 X;  2KM4 A;  3ZYQ A;  5LP0 A;  1SZ9 A;  1EYH A;  2L0T B;  1XGW A;  5CMW A;  3G2T A;  1H0A A;  3ZYM A;  1JUQ A;  1MHQ A;  1ELK A;  2MOW A;  1VDY A;  5CMY A;  1X5B A;  4AVX A;  3G2S A;  4GZC A;  3ZYL A;  3D9M A;  1HF8 A;  1HG5 A;  1JPL A;  3G2W A;  4FU3 A;  2L0I A;  1INZ A;  1JWG A;  1JWF A;  2DCP A;  3ONL A;  5J08 A;  2LO6 A;  1PY1 A;  1LF8 A;  1UJJ A;  3D9K A;  3D9J A;  3G2U A;  3ONK A;  1HX8 A;  3D9O A;  1HG2 A;  4FLB A; 
#chains in the Genus database with same CATH topology
 2HO1 A;  4I9C A;  3FH8 A;  3MCX A;  4EEC A;  2X6K A;  2P9I G;  4XE0 A;  4ANV A;  1HU3 A;  4PS7 A;  2PL2 A;  2X6F A;  3TWW A;  4G8L A;  4IN3 B;  4YDW A;  4GTP A;  4YDO A;  3CHM A;  3FEX A;  4JW1 A;  4FJY A;  3SNX A;  2RFA A;  5AQ9 A;  2J08 A;  4ANU A;  4X8Q A;  1KT0 A;  3CSF A;  3IBE A;  3LVQ E;  2AVP A;  3EHR A;  5M72 A;  4BEP A;  3LJN A;  2ZIS A;  2H6F A;  2A4Z A;  1MX4 A;  3OAW A;  4BT8 A;  5FQ8 A;  1G3N B;  5G55 A;  2QZA A;  4ANW A;  2DZN A;  1WDY A;  2WPV A;  3LKU A;  3TWX A;  3ZIM A;  4D10 C;  1EYH A;  5EYP F;  4ZFH A;  4TUM A;  4HS2 A;  2CHX A;  3UPV A;  2OVF A;  2GRM A;  4B89 A;  1IHB A;  4UI9 C;  4ZHB A;  2OOE A;  4DK5 A;  2LSU A;  2E2E A;  3HXC A;  3ASO E;  1EF1 C;  4WAF A;  4DRX E;  3PS6 A;  2QYJ A;  3Q47 B;  5AQB A;  4GTQ A;  2Y3A A;  3ZKJ A;  1NI1 A;  2WMN A;  4I17 A;  1IQU A;  3ZEF A;  2NYJ A;  2DYS E;  1SVX A;  3V30 A;  3GZ1 A;  2NXP A;  2V5Q C;  5KNH D;  5KNG A;  2J4D A;  2A5U A;  1JCR A;  1KPS B;  3F6Q A;  2JEK A;  3SI5 A;  5IY5 E;  3T9K A;  2I1K A;  4EQF A;  4KMO A;  4I1M A;  5CEC B;  1MX2 A;  1BPO A;  5G04 J;  3DPY A;  4GPK A;  2WXG A;  3AS8 A;  1OCR E;  2XEV A;  2L0T B;  3FTW A;  3PE3 A;  4LER A;  2UY1 B;  3V2X A;  3ASD A;  3DBS A;  2R03 A;  3B7R L;  4LEU A;  3DST A;  2VYI A;  2X6I A;  2XZD G;  2DYR E;  1OWM A;  3UM0 A;  4CT4 A;  3LY9 A;  4WND A;  2IU1 A;  2MOW A;  2IF4 A;  3ZYL A;  4K03 A;  4GA2 A;  1K3Z D;  4DLO A;  1MX6 A;  4XZ4 A;  3FH7 A;  1ZBP A;  5CER B;  4LSZ E;  2LXM A;  4G24 A;  3CLJ A;  4J8D A;  3ZXS A;  3OTN A;  4QQI A;  3I5P A;  4GZ5 A;  4GA0 A;  1RZ4 A;  1E90 A;  1Z6T A;  3B95 A;  3JYS A;  2XS8 A;  2RFM A;  2R02 A;  4PS3 A;  3HG0 D;  1QZ2 A;  4A63 B;  3CST A;  3I3N A;  3Q5M A;  2BED A;  2X6J A;  4O60 A;  4C0M A;  3FU3 A;  1PAQ A;  4N5C A;  3PUJ A;  2J9Q A;  5J08 A;  2VQ2 A;  4FLB A;  5CRV A;  3FDH A;  5D2M C;  3ASH A;  4B0Z A;  5E75 A;  1Z5S C;  3JXI A;  3FUE A;  3EIQ C;  1XGW A;  3RO2 A;  2X3M A;  2XQ0 A;  4TUU A;  2XEE A;  3C3R A;  3GZ2 A;  1N52 A;  2PM7 A;  3APF A;  2C2L A;  4HI9 A;  2WXK A;  1N9A A;  2YHE A;  3PEV B;  5CMY A;  1O1S A;  1JWF A;  5J90 A;  2JLB A;  3D9J A;  3R7R A;  3TG5 A;  5HI7 A;  3ESL A;  3DXM G;  3OXL A;  3B7B A;  3I4R B;  1NP7 A;  3EU9 A;  4U04 A;  3MJW A;  1E8Z A;  1E7U A;  1EPU A;  3ASG A;  3QWP A;  5BV0 A;  4APF A;  2ETA A;  5C1D A;  5FZQ A;  2P9K G;  3I4G A;  3SD5 A;  1E8Y A;  2DWZ A;  3L08 A;  3B7T A;  2IQC A;  1FT1 A;  5AAO A;  2XS1 A;  3TWT A;  2V4L A;  2WXN A;  1E8W A;  2YIN A;  3QC1 A;  4LNG A;  4JVS A;  4EZK A;  5EX0 A;  1SA4 A;  5EIL A;  2LAH A;  4LRZ A;  2GRN B;  4OVU A;  4KT6 B;  4NAC A;  5CCL A;  5CED B;  1JCQ A;  1P5Q A;  4L2Y A;  1HFA A;  3VTX A;  2P9S G;  3FY4 A;  3AU5 A;  5EID A;  4P29 A;  4GYY A;  5JMN D;  3UM3 A;  3MX3 A;  3DSX A;  4J0U A;  5AAR A;  4JHR A;  4WNG A;  3DWL G;  1H19 A;  2VJ8 A;  4WWP A;  3SZ7 A;  2KM4 A;  3MKQ B;  2IJG X;  3FEY A;  4U8H A;  4GTO A;  4CCA A;  1KZP A;  2L9B A;  4BER A;  1X81 A;  1WAO 1;  4DUI A;  1Y6I A;  4DX2 A;  5LP0 A;  2CFU A;  3HRA A;  4DJA A;  2MYO A;  2GRL A;  2B6C A;  2DCP A;  3LXU X;  5EN5 D;  3D9K A;  2X6H A;  4UI9 J;  1E7V A;  3VLF A;  5EX3 A;  2I2O A;  4JD2 G;  1XNF A;  4G11 A;  4TRQ A;  4DX1 A;  2KBX A;  2AW6 A;  1FT2 A;  4EZL A;  1OCC E;  2P9N G;  4GTT A;  3Q49 B;  1K1A A;  3NQP A;  3PUK A;  4LCT A;  3TJP A;  4AY5 A;  2KCK A;  4EBA G;  4CYM D;  4EBA A;  4URK A;  3DEO A;  4BX9 A;  4A3T A;  4TXP A;  1JWG A;  1V54 E;  2HR2 A;  2YQ8 A;  2KXP C;  3C5R A;  3ZNG A;  2OEW A;  5CCM A;  3PDN A;  3EHQ A;  5B1A E;  1OXJ A;  2F8X K;  1S70 B;  3EHM A;  3MZL B;  4FP7 A;  3S7J A;  3SFZ A;  2BKG A;  3KEZ A;  4Y6W A;  2IO3 C;  1TJC A;  3Q9U C;  1K8K G;  4ANX A;  4KBQ A;  4CEM A;  2GRQ B;  4I6E A;  3P1U A;  3UKR G;  2CHW A;  2ZU6 B;  3NB2 A;  3RRM B;  5FZR A;  5HS0 A;  1TR4 A;  2LSV A;  2WXJ A;  2GGF A;  1TNZ A;  4NIK A;  5KJM A;  3FUL A;  5DBK A;  3ASN E;  3PZ1 A;  3Q9N C;  4CGW A;  2DIW A;  1U3C A;  2XPY A;  2PZI A;  5BPP A;  4HLL A;  2HM8 A;  4XI9 A;  3X2Q E;  2WQ6 A;  2H6G A;  1NL4 A;  2Y69 E;  4WWN A;  5AQ7 A;  3AG4 E;  3FUD A;  3Q7F A;  1HH8 A;  4HRL A;  5EKQ D;  4G8K A;  4GPM A;  5BXU A;  1PC2 A;  2QFC A;  2XEN A;  3QOU A;  2A5E A;  2WXH A;  3AJI A;  2GRO B;  4NRH B;  3CHQ A;  3FFL A;  3UTM A;  4LUN U;  5ANL A;  3U3W A;  4G25 A;  2R2L A;  1UOH A;  4L1B A;  5FIN A;  1H2U A;  1NFI E;  1N4Q A;  1UW4 B;  1N54 A;  3CK7 A;  2C0L A;  3UM2 A;  3FUM A;  4HOT A;  3NBN B;  3E34 A;  5FT9 A;  2UY1 A;  4FJZ A;  1SZ9 A;  5CMW A;  3ZPJ A;  3QK0 A;  3SO8 A;  4FU3 A;  4CDR A;  2WVI A;  3UT8 A;  5BXO A;  1BI7 B;  4JL0 A;  2L6J A;  5KWD A;  2NC9 A;  5ENR D;  4GTM A;  4BSX A;  3D9I A;  4XKB A;  3TWQ A;  2RKK A;  2WXR A;  3WG7 E;  3UXG A;  2R05 A;  2VGY A;  1H0A A;  4LNB A;  3Q4A B;  2RD0 A;  1VDY A;  5B3S E;  3CIA A;  4BTA A;  1ELR A;  3JCK C;  2CHZ A;  3BQO A;  4ILG A;  4UI9 K;  4CGV A;  2YNQ A;  4H7X A;  2EIM E;  1TYQ G;  2KZT B;  3UIO C;  1TN6 A;  3FTX A;  3KS2 A;  4Z68 A;  3GYZ A;  4FHK A;  4ILI A;  3CR3 A;  2VGX B;  2OEV A;  1IYG A;  4W9R A;  2J09 A;  4ILH B;  1N0Q A;  4KYO B;  5BUZ A;  5LFA A;  2ZGD A;  3FTS A;  3CKC A;  4L2L A;  4GZD A;  4FLH A;  4A3V A;  2EIN E;  1YCS B;  4KZ0 A;  4BES A;  3FTV A;  3FTU A;  2XCB A;  4IYP A;  4EHM A;  4CDM A;  4N3A A;  2KCV A;  3IV0 A;  5FQ4 A;  3ZUV B;  4XI0 A;  5FZS A;  2F37 A;  3HXD A;  5AQA A;  5ENT D;  2LNI A;  5T4Y A;  1TNU A;  4R7L A;  4U0S A;  3LEW A;  1E96 B;  1NA0 A;  1HE8 A;  4G23 A;  4AVX A;  3OXF A;  4AJW A;  1UJJ A;  4GMJ A;  1HG2 A;  4F1S A;  3NAW A;  3FUK A;  3SHF A;  2ION A;  3G2T A;  2DVW A;  3HXB A;  2XRZ A;  4L7T A;  1K1B A;  3TXN A;  4DX6 D;  3FWV A;  2IO2 C;  2WXM A;  5BNW A;  1H6O A;  5JJ7 A;  2QC9 A;  3CGH A;  4Q96 A;  3O4Z A;  4IUL A;  4V3I A;  4JA9 A;  3DSU A;  2YHC A;  4O1P A;  3NOC D;  1E8X A;  3O48 A;  3Q79 A;  3E33 A;  3EHN A;  1OUV A;  2P58 C;  4HOS A;  3S7F A;  3DXK G;  1UJK A;  4MRU A;  3RKV A;  3AAA C;  4J8Y A;  2H6I A;  1Z3Y A;  4UWL A;  2EQX A;  3S7B A;  2KCL A;  4GCO A;  3QAR A;  2DBA A;  1UN9 A;  1AWC B;  4F3V A;  1TN7 A;  5G05 C;  2GRR B;  2IOL A;  3UX4 A;  4GA1 A;  3KEA A;  4OAV B;  3CHR A;  3TL5 A;  4BTB A;  4JA7 A;  4N5Q A;  3UIN C;  2EIL E;  3MKQ A;  3QNK A;  3AS4 A;  4JHK A;  4G26 A;  2V8S E;  5EDS A;  2ZIR A;  3NF1 A;  3EIJ A;  4HOR A;  3G2S A;  4N2S A;  1QBQ A;  3PRZ A;  4AXH A;  4I2Z A;  5ARF A;  3QAQ A;  3BU8 A;  3CHO A;  2B0O E;  2Y4T A;  2J4B A;  3B7S A;  2Q7F A;  4ATG A;  4GCN A;  1RW2 A;  3SBS A;  4KZC A;  4UWF A;  4M3O A;  3UIP C;  2LAI A;  5KJK A;  5DIZ A;  3ZU7 B;  3LJ3 A;  3ENE A;  4JPS A;  1NZN A;  4I6G A;  5H7P A;  3NZU A;  4ABN A;  4F6R D;  1SW6 A;  3ZVV A;  3HYM B;  4GAA A;  2FEZ A;  3AU4 A;  4UWK A;  3APC A;  3QDN A;  4TXR A;  4GMR A;  3ZRH A;  2F0Y A;  3D9P A;  5ANR A;  5ITZ F;  1IQR A;  3KAE A;  3PZ3 A;  2NSZ A;  2P9U G;  2VGE A;  2ILR A;  3IKO B;  5FJY A;  2CG3 A;  2QYU A;  4CDN A;  2XHE A;  1GW6 A;  5A6C A;  4YDY A;  2XGS A;  3QWV A;  3PEU B;  1YMP A;  4JC8 A;  3CHS A;  5E76 A;  1HO8 A;  2V0P A;  4OYS A;  4RG9 A;  3K9I A;  3ESK A;  3EUV A;  4EZJ A;  2DZO A;  2AWI A;  3DEP A;  3T5V A;  3FU6 A;  4I43 A;  1U3D A;  2XZT G;  3ZW3 A;  2WQH A;  3BG0 B;  4F1P A;  4BY6 A;  2WXQ A;  2IEJ A;  3APD A;  4O6F A;  3CK8 A;  3RIB A;  1ELK A;  3SY2 A;  1OWN A;  3UT4 A;  4U63 A;  1HX8 A;  1V55 E;  3ABL E;  4ME2 A;  4FHJ A;  4L23 A;  3IXE A;  2VSO E;  5T8I A;  1N11 A;  4FC8 A;  4K5C A;  1DNP A;  4GZ6 A;  4WWO A;  2LO6 A;  1W3B A;  2V4H C;  3D9O A;  4O1O A;  4Q69 A;  3D9N A;  1OY3 D;  1OCZ E;  3W9G A;  1H6P A;  1ZU2 A;  4PUC A;  3IHY A;  4WNE A;  3TWR A;  3HHM A;  4JZY A;  3QKY A;  2L0I A;  4FA6 A;  4AV7 A;  2XGO A;  4N3C A;  4BX8 A;  3W9F A;  3RRN B;  3EJN A;  2L6B A;  3CQC B;  3MV3 B;  4U95 D;  4HNA D;  2C0M A;  1BLX B;  3VLE A;  3FH5 A;  2AXU A;  4GU5 A;  1JUQ A;  3TXM A;  1MHQ A;  3KD7 A;  3P2B A;  1LD7 A;  4NUR A;  4A1G A;  4BT9 A;  3JQ1 A;  3ZHE B;  4RVB A;  3R7Q A;  3QJZ A;  1ELW A;  3GW4 A;  4KXK B;  4C0E A;  3J5P A;  3UT7 A;  1HZ4 A;  4U8Y D;  3RRU A;  4OVV A;  1TNY A;  3PE4 A;  2KAT A;  4OAU C;  4XEI G;  2CFZ A;  4A55 A;  2BKK B;  3SFY A;  4F53 A;  2WMO A;  3R9M A;  4HOU A;  3BUA A;  2HE0 A;  4CT0 A;  1X5B A;  4U0U A;  4J8S A;  1FPP A;  3HVE B;  3MKR A;  5KJN A;  2AJA A;  5ENN A;  4JEH A;  3ABK E;  3RAU A;  2KZT A;  4FAD A;  3PNL B;  3C72 A;  4Y6C A;  1NA3 A;  1FVH A;  2VGX A;  4N39 A;  5G2N A;  3AG2 E;  3PVL A;  5D0Q D;  2JAB A;  3EU5 A;  3LVR E;  3L13 A;  1IXV A;  4JEU A;  1FVF A;  3RU0 A;  3WXX A;  3LYA A;  4L9P A;  1HF8 A;  3MEK A;  5A7D B;  3ONL A;  3Q75 A;  4N3B A;  2J49 A;  4QFV A;  3ZYK A;  5AIJ A;  4KVO A;  2I1J A;  3Q73 A;  1SA5 A;  2Y4U A;  4K5B A;  4HVB A;  3T8K A;  5JJ6 A;  2V5F A;  4APO A;  5JA4 D;  3Q15 A;  4PH4 B;  3SBT B;  4RSY A;  4XIF A;  4GTS A;  1WG0 A;  4UWG A;  4I9E A;  5LX8 A;  1O5M A;  5G05 J;  3ISM C;  5HRY A;  2PNN A;  3CQG B;  3TWU A;  3OXG A;  2BTD A;  1TEZ A;  5JJT A;  2PM6 A;  2BUG A;  1DCE A;  3UKU G;  3BEE A;  2MHK A;  5LOZ A;  5AN8 A;  3LCA A;  3MYV A;  5KCM A;  3JUI A;  1UN8 A;  4ACK A;  5LCW C;  1A17 A;  3UUX A;  4C48 B;  1D9S A;  1KT1 A;  5BT1 A;  3G2W A;  1S0P A;  3L82 A;  1PY1 A;  1S64 A;  4CZ2 D;  2Y1L E;  3CVQ A;  3FTY A;  2XGM A;  3HDX A;  2XCC A;  4LNU D;  2ETB A;  1N95 A;  2KC7 A;  2WXL A;  2P2C P;  3B7U X;  3CVL A;  4J6I A;  4MLP A;  4I2W A;  4AP2 A;  3ZGQ A;  4DPR A;  3ULQ A;  4GYW A;  3ML8 A;  2R17 C;  3MGB A;  1JCS A;  2VTB B;  3FU0 A;  3ULE G;  1BD8 A;  4JB8 P;  3UMV A;  2LXL A;  4GZC A;  1L5J A;  4J8F A;  4HB5 A;  2WQ7 A;  4YVQ C;  4HRM B;  5ENO D;  3FUI A;  1N94 A;  5B1B E;  4HFG A;  2FI7 A;  3L54 A;  4K5A B;  2MRI A;  4WUY A;  5CRU A;  2XEH A;  3C3Q A;  1A5E A;  5BV1 A;  1TNB A;  1KLX A;  4RG6 A;  5A23 A;  2HYZ A;  3MV2 B;  3L22 A;  1YA0 A;  2EIJ E;  2IOS A;  3DPD A;  2FF4 A;  5KJL A;  3FUN A;  5CBN A;  4YDE A;  3RSE G;  5AEN A;  1H6K A;  3HXE A;  1OT8 A;  1MZC A;  1LTX A;  5ENS D;  2CG2 A;  3CVW A;  4AOF A;  4DI3 A;  3CKB A;  3Q78 A;  3ZN3 A;  5JHB A;  3UI2 A;  3CVN A;  4AIF A;  5AYW D;  3J5Q B;  3TWV A;  3E4B A;  3AS5 A;  3HXF A;  5HQ8 A;  3PZ4 A;  4BFR A;  2J8S D;  1N4P A;  3CVY A;  5CHE E;  3DRA A;  4MKT A;  1H2V C;  1SZA A;  3Q7A A;  3T8M A;  4BSZ B;  2WXP A;  3NOG D;  1KZO A;  3FU5 A;  5CEA A;  2OCC E;  2VSY A;  4PDX A;  4AY6 A;  1TNO A;  5FTP A;  1LF8 A;  1IKN D;  3G2U A;  1WM5 A;  4CRW A;  3S7D A;  3C98 A;  3TG4 A;  2FO1 E;  4GZ3 A;  4UQX A;  3HIZ A;  1HS6 A;  2BF0 X;  2FO7 A;  2PQN A;  2RG8 A;  1D8E A;  5FQ7 A;  2H6H A;  3RJV A;  1TN8 A;  1BU9 A;  4U96 D;  5C2Y A;  2LUH A;  3URZ A;  5AJL A;  3D9L A;  3PZ2 A;  3AG1 E;  1HXI A;  3N71 A;  2GRP B;  5EIB E;  3MA5 A;  3CVX A;  4RLY A;  3PRE A;  5ARG A;  3CVU A;  1AP7 A;  4I1O B;  4PS8 A;  3SF4 A;  2FBN A;  4AEZ C;  3KSQ A;  4B8A A;  1MJ0 A;  4JXT A;  3D9H A;  4HXI A;  3LS8 A;  2ETC A;  5FWQ A;  2EIK E;  4Q94 A;  3TGO A;  4UUC A;  1IHG A;  1QNF A;  3RK6 A;  2OV8 A;  3V79 K;  5HKP A;  2Y0B G;  3E37 A;  5D66 A;  3KSL A;  2I6H A;  3JXJ A;  3S2A A;  2VSX E;  4UQY A;  4K0R A;  3NZS A;  3U66 A;  4DI4 A;  5JHA A;  3FUH A;  2ZGG A;  3B13 A;  2OND A;  4YVO A;  2XPZ A;  5ENQ D;  1N4R A;  1OWO A;  2UWJ G;  4B94 A;  1U2V G;  3VTY A;  5FQ6 A;  4GB9 A;  3ULY A;  3TAX A;  4EPZ A;  3E32 A;  3SGH A;  4I1A A;  3RO3 A;  3LPZ A;  3DSW A;  4DLQ A;  1BI8 B;  2WXI A;  2OVB A;  4HI8 A;  5ENP D;  2GW1 A;  1INZ A;  4AM9 A;  4LG6 A;  3FUJ A;  3ONK A;  3CEQ A;  5G04 C;  4MBG A;  4J8E A;  1H2T C;  3LDZ A;  1Q2Z A;  3FUF A;  1B89 A;  3VLD A;  4JHJ A;  4U07 A;  4HLE A;  3LY8 A;  3ABM E;  3ZHE A;  4E85 A;  2M63 A;  3GZS A;  2AXV A;  2XRY A;  3TWS A;  2P9P G;  3IHV A;  4C9B B;  3SFX A;  4DX7 D;  3PZD A;  5T3R A;  3UM1 A;  4GTV A;  3FHE A;  3L6A A;  4HQD A;  3U64 A;  4IRU A;  1MYO A;  3CV0 A;  3HVE A;  3ASF A;  4UWH A;  3T5X A;  5LCW J;  4XKC A;  1OWL A;  3U4T A;  4NQ0 A;  4M7C A;  3UQ3 A;  4XX5 A;  2ZXW E;  4BET A;  4B8C B;  3DSS A;  1N4S A;  1DVP A;  1TJF A;  1O1T A;  4TXQ A;  1DCQ A;  1D8D A;  4ACL A;  1LD8 A;  2F8Y A;  1Y8M A;  1OWP A;  3SQV A;  4WNF A;  1JPL A;  2P9L G;  3L9T A;  2WXO A;  3CVV A;  2IY0 C;  4U7E B;  4ATZ D;  1MQS A;  4A1S A;  1ZB1 A;  2VSN A;  3L17 A;  4RQI A;  5FIO A;  1FCH A;  3G2V A;  2WB2 A;  4DX5 D;  4U0Z A;  2AXZ A;  3C3O A;  4B93 B;  3U9W A;  4U8V D;  4G2V A;  4I6J A;  2WXF A;  3FTZ A;  4HOQ A;  5EYL A;  3V2O A;  3CVP A;  2QY7 A;  3FP3 A;  3IEG A;  3BG1 B;  3CHP A;  3AG3 E;  3ZYQ A;  3PNT B;  4HBD A;  2XPI A;  3QWW A;  3PH0 C;  3L16 A;  1QYM A;  1DC2 A;  3CK9 A;  4MS6 A;  4E6H A;  5D0O D;  1Z3X A;  3EDT B;  3ZXP A;  4GTR A;  3ZFW A;  4FUL A;  2J07 A;  1EDU A;  1S63 A;  3DSV A;  3ZYM A;  1WY6 A;  2X38 A;  4BWR A;  1HG5 A;  3E30 A;  3JUE A;  4G1T A;  1QQE A;  1YYH A;  3V31 A;  4GML A;  2I9C A;  3QB2 A;  4KVM A;  2IFU A;  3D3M A;  5AJD A;  5CBO A;  3LY7 A;  4GYO A;  1OCO E;  2E0I A;  2VTB A;  1UG3 A;  3D9M A;  5BW8 C;  2R59 A;  3ML9 A;  2R5S A;  4F7A A;  1O1R A;  4HRN A;  1SQM A;  3JQ0 A;  4YND A;  4N2Q A;  4J7W A;  2FUL A;  3R9A B;  1N0R A;  4TV3 A;  4UQZ A;  4H7Y A;  5KBA A;  2WM9 A;  2PQR A; 
#chains in the Genus database with same CATH homology
 2Y4T A;  2HO1 A;  1E7V A;  4I9C A;  2J4B A;  1H6K A;  3FH8 A;  4UI9 J;  5EX3 A;  3VLF A;  3B7S A;  3MCX A;  5AEN A;  2Q7F A;  2I2O A;  4ATG A;  1XNF A;  4EEC A;  4GCN A;  4G11 A;  2X6K A;  2CG2 A;  4TRQ A;  4XE0 A;  3SBS A;  3CVW A;  4AOF A;  4KZC A;  4DI3 A;  4ANV A;  4UWF A;  4M3O A;  2LAI A;  5KJK A;  5DIZ A;  3CKB A;  1HU3 A;  4PS7 A;  2AW6 A;  2PL2 A;  2X6F A;  3LJ3 A;  3ENE A;  4JPS A;  3ZN3 A;  4EZL A;  1NZN A;  4IN3 B;  5JHB A;  3Q49 B;  3CVN A;  4I6G A;  4AIF A;  3CHM A;  5AYW D;  3FEX A;  3NQP A;  3PUK A;  4LCT A;  4JW1 A;  4FJY A;  3SNX A;  3NZU A;  3TJP A;  3E4B A;  3AS5 A;  4ABN A;  4AY5 A;  2KCK A;  3ZVV A;  3HYM B;  4EBA G;  4EBA A;  4URK A;  2J08 A;  4GAA A;  2FEZ A;  4ANU A;  4BX9 A;  3AU4 A;  1KT0 A;  3CSF A;  4UWK A;  5HQ8 A;  3IBE A;  3LVQ E;  4A3T A;  2AVP A;  3APC A;  5M72 A;  4BFR A;  3QDN A;  3CVY A;  1JWG A;  5CHE E;  2A4Z A;  2HR2 A;  3ZRH A;  3OAW A;  4BT8 A;  5FQ8 A;  2YQ8 A;  4MKT A;  5G55 A;  3D9P A;  1H2V C;  4ANW A;  5ANR A;  1SZA A;  2WPV A;  3LKU A;  5CCM A;  3T8M A;  3PDN A;  1IQR A;  2WXP A;  3KAE A;  2NSZ A;  3ZIM A;  4D10 C;  1EYH A;  3FU5 A;  2ILR A;  3IKO B;  5FJY A;  3EHM A;  3MZL B;  2CG3 A;  4HS2 A;  2VSY A;  2CHX A;  2XHE A;  1GW6 A;  4FP7 A;  3S7J A;  3SFZ A;  4PDX A;  4CDN A;  5A6C A;  3KEZ A;  3UPV A;  4AY6 A;  4Y6W A;  2OVF A;  1TJC A;  2GRM A;  4B89 A;  5FTP A;  4ANX A;  1LF8 A;  3G2U A;  2XGS A;  4KBQ A;  4UI9 C;  4CEM A;  1WM5 A;  3QWV A;  2OOE A;  4CRW A;  3PEU B;  3S7D A;  4I6E A;  4DK5 A;  2LSU A;  2E2E A;  3C98 A;  3TG4 A;  3P1U A;  4JC8 A;  4GZ3 A;  2CHW A;  2ZU6 B;  3RRM B;  1EF1 C;  4UQX A;  5FZR A;  3HIZ A;  3CHS A;  1HS6 A;  4WAF A;  2BF0 X;  5E76 A;  2LSV A;  2WXJ A;  1HO8 A;  2GGF A;  5KJM A;  2V0P A;  2FO7 A;  2PQN A;  2RG8 A;  3FUL A;  5DBK A;  4OYS A;  4RG9 A;  5FQ7 A;  3K9I A;  3RJV A;  3ESK A;  3PS6 A;  4EZJ A;  2AWI A;  3Q47 B;  5C2Y A;  4CGW A;  2DIW A;  2Y3A A;  3T5V A;  3URZ A;  1U3C A;  2XPY A;  2WMN A;  3FU6 A;  4I17 A;  4I43 A;  1U3D A;  5AJL A;  1IQU A;  2PZI A;  2WQH A;  3BG0 B;  3ZEF A;  3ZW3 A;  3D9L A;  4BY6 A;  2WXQ A;  5BPP A;  3GZ1 A;  2NXP A;  3APD A;  4O6F A;  2HM8 A;  1HXI A;  2J4D A;  3N71 A;  4XI9 A;  3CK8 A;  2A5U A;  2WQ6 A;  3RIB A;  4WWN A;  1ELK A;  3MA5 A;  2JEK A;  3CVX A;  3FUD A;  3SI5 A;  3PRE A;  1OWN A;  5ARG A;  3CVU A;  4I1O B;  4PS8 A;  1HH8 A;  5EKQ D;  2I1K A;  4U63 A;  3UT4 A;  4EQF A;  3SF4 A;  4KMO A;  2FBN A;  4I1M A;  4AEZ C;  1HX8 A;  1PC2 A;  2QFC A;  4B8A A;  1BPO A;  3QOU A;  4JXT A;  4ME2 A;  5G04 J;  4HXI A;  4FHJ A;  4GPK A;  2WXH A;  4L23 A;  3LS8 A;  2WXG A;  5FWQ A;  3AS8 A;  2XEV A;  4Q94 A;  4NRH B;  3CHQ A;  3TGO A;  2VSO E;  3FFL A;  4LUN U;  5T8I A;  5ANL A;  3U3W A;  2L0T B;  4G25 A;  1IHG A;  3FTW A;  3PE3 A;  4LER A;  1QNF A;  4FC8 A;  3RK6 A;  2OV8 A;  1DNP A;  4GZ6 A;  2UY1 B;  4L1B A;  3ASD A;  1H2U A;  3DBS A;  4WWO A;  2LO6 A;  3B7R L;  1W3B A;  4LEU A;  1UW4 B;  2I6H A;  3D9O A;  2VYI A;  2X6I A;  1N54 A;  3CK7 A;  3S2A A;  2VSX E;  2C0L A;  4UQY A;  4K0R A;  4Q69 A;  3D9N A;  3NZS A;  3FUM A;  4HOT A;  3U66 A;  4DI4 A;  5JHA A;  5FT9 A;  2UY1 A;  3FUH A;  4FJZ A;  3B13 A;  2OND A;  1OWM A;  4YVO A;  1ZU2 A;  4CT4 A;  4PUC A;  3IHY A;  1SZ9 A;  4WNE A;  5CMW A;  2XPZ A;  3LY9 A;  3ZPJ A;  3QK0 A;  4WND A;  2IU1 A;  2MOW A;  3HHM A;  4JZY A;  2IF4 A;  3QKY A;  3ZYL A;  1OWO A;  4K03 A;  4GA2 A;  2UWJ G;  4FU3 A;  2L0I A;  4CDR A;  4DLO A;  2WVI A;  4B94 A;  4FA6 A;  3UT8 A;  4AV7 A;  2XGO A;  4N3C A;  4BX8 A;  4XZ4 A;  3VTY A;  4JL0 A;  2L6J A;  5FQ6 A;  4GB9 A;  2NC9 A;  1ZBP A;  3FH7 A;  3EJN A;  3RRN B;  4BSX A;  3CQC B;  3D9I A;  3MV3 B;  3TAX A;  2C0M A;  4EPZ A;  4G24 A;  3SGH A;  3CLJ A;  4I1A A;  4XKB A;  4J8D A;  3ZXS A;  3RO3 A;  3VLE A;  3LPZ A;  3OTN A;  2WXR A;  3I5P A;  3FH5 A;  2AXU A;  4DLQ A;  2VGY A;  4GZ5 A;  4GA0 A;  1H0A A;  2WXI A;  4GU5 A;  1JUQ A;  2RD0 A;  1MHQ A;  3Q4A B;  3TXM A;  1VDY A;  2OVB A;  3CIA A;  3KD7 A;  4BTA A;  3P2B A;  1ELR A;  3JCK C;  2GW1 A;  1INZ A;  1E90 A;  4NUR A;  4A1G A;  2CHZ A;  1Z6T A;  4AM9 A;  4BT9 A;  3FUJ A;  3JQ1 A;  4ILG A;  4UI9 K;  3ONK A;  4RVB A;  3ZHE B;  3R7Q A;  3QJZ A;  3CEQ A;  4CGV A;  2YNQ A;  5G04 C;  4J8E A;  1ELW A;  1H2T C;  3GW4 A;  4KXK B;  4C0E A;  4H7X A;  3JYS A;  3LDZ A;  3UT7 A;  1HZ4 A;  3RRU A;  3FUF A;  4OVV A;  1B89 A;  3VLD A;  3PE4 A;  4JHJ A;  2KAT A;  4U07 A;  4HLE A;  4PS3 A;  4A55 A;  2CFZ A;  2KZT B;  3KS2 A;  3FTX A;  4F53 A;  2WMO A;  1QZ2 A;  3LY8 A;  4HOU A;  3CST A;  3GYZ A;  4FHK A;  3ZHE A;  3I3N A;  4ILI A;  3Q5M A;  4CT0 A;  4E85 A;  2X6J A;  1X5B A;  4C0M A;  3CR3 A;  3FU3 A;  4U0U A;  1PAQ A;  2VGX B;  4N5C A;  3PUJ A;  4J8S A;  2M63 A;  3GZS A;  3HVE B;  2J9Q A;  2AXV A;  2XRY A;  5J08 A;  1IYG A;  3MKR A;  5KJN A;  4W9R A;  2J09 A;  3IHV A;  4ILH B;  5ENN A;  4JEH A;  2VQ2 A;  4KYO B;  4C9B B;  4FLB A;  5BUZ A;  5LFA A;  3FDH A;  2KZT A;  3PZD A;  5T3R A;  4FAD A;  3PNL B;  3FHE A;  3FTS A;  3L6A A;  3U64 A;  4IRU A;  4Y6C A;  3CKC A;  1NA3 A;  1FVH A;  4L2L A;  3ASH A;  4GZD A;  2VGX A;  4N39 A;  4FLH A;  3CV0 A;  3PVL A;  5E75 A;  3HVE A;  5G2N A;  4B0Z A;  3ASF A;  5D0Q D;  3LVR E;  3L13 A;  4A3V A;  3FUE A;  4JEU A;  4UWH A;  3EIQ C;  1XGW A;  4KZ0 A;  1FVF A;  3RO2 A;  3RU0 A;  3T5X A;  3WXX A;  5LCW J;  3LYA A;  2X3M A;  3FTU A;  3FTV A;  4XKC A;  1HF8 A;  2XCB A;  4IYP A;  3MEK A;  5A7D B;  2XQ0 A;  3ONL A;  1OWL A;  3U4T A;  4CDM A;  4NQ0 A;  3UQ3 A;  4N3A A;  4N3B A;  4TUU A;  2J49 A;  4XX5 A;  2KCV A;  4B8C B;  3GZ2 A;  3IV0 A;  1N52 A;  2PM7 A;  4QFV A;  3APF A;  5FQ4 A;  2C2L A;  1DVP A;  1TJF A;  4XI0 A;  5FZS A;  3ZYK A;  5AIJ A;  4KVO A;  2I1J A;  2LNI A;  5T4Y A;  4ACL A;  2WXK A;  4R7L A;  4U0S A;  1Y8M A;  3LEW A;  1E96 B;  1NA0 A;  2Y4U A;  2YHE A;  3PEV B;  1OWP A;  1HE8 A;  4G23 A;  5CMY A;  4WNF A;  4AVX A;  4HVB A;  1JPL A;  5JJ6 A;  1JWF A;  2V5F A;  2WXO A;  4APO A;  3Q15 A;  3OXF A;  4AJW A;  2JLB A;  3D9J A;  1UJJ A;  4PH4 B;  3SBT B;  5J90 A;  3CVV A;  3R7R A;  4GMJ A;  1HG2 A;  3TG5 A;  1MQS A;  5HI7 A;  4F1S A;  4A1S A;  2VSN A;  3L17 A;  3ESL A;  4RSY A;  3OXL A;  4XIF A;  3FUK A;  1FCH A;  3G2V A;  2WB2 A;  3SHF A;  3I4R B;  4U0Z A;  2AXZ A;  4I9E A;  1NP7 A;  4UWG A;  4U04 A;  5LX8 A;  3MJW A;  2ION A;  3U9W A;  3G2T A;  1E8Z A;  5G05 J;  1E7U A;  1EPU A;  3ASG A;  4L7T A;  2XRZ A;  4G2V A;  4I6J A;  3CQG B;  3QWP A;  5BV0 A;  2WXF A;  3FTZ A;  3TXN A;  4APF A;  3OXG A;  4HOQ A;  2BTD A;  5C1D A;  1TEZ A;  5FZQ A;  3FWV A;  3I4G A;  5JJT A;  2PM6 A;  3SD5 A;  2BUG A;  1E8Y A;  3CVP A;  2QY7 A;  3BEE A;  2WXM A;  3L08 A;  3B7T A;  2MHK A;  3FP3 A;  2IQC A;  5LOZ A;  5BNW A;  3LCA A;  5JJ7 A;  3IEG A;  3MYV A;  3BG1 B;  3CHP A;  3CGH A;  4Q96 A;  5KCM A;  3JUI A;  1UN8 A;  4ACK A;  3ZYQ A;  5LCW C;  3PNT B;  2V4L A;  2WXN A;  1E8W A;  1A17 A;  2XPI A;  2YIN A;  3O4Z A;  3UUX A;  3QC1 A;  4JVS A;  1KT1 A;  5BT1 A;  4EZK A;  3QWW A;  4IUL A;  3G2W A;  4JA9 A;  4V3I A;  3PH0 C;  5EX0 A;  1S0P A;  3L16 A;  1PY1 A;  2YHC A;  3CK9 A;  4MS6 A;  2LAH A;  4E6H A;  5D0O D;  1E8X A;  3O48 A;  1Z3X A;  4LRZ A;  3EDT B;  4OVU A;  3CVQ A;  4KT6 B;  4NAC A;  5CCL A;  3EHN A;  3FTY A;  1OUV A;  2P58 C;  4HOS A;  2XGM A;  3HDX A;  3ZFW A;  2XCC A;  4FUL A;  3S7F A;  1P5Q A;  4L2Y A;  2J07 A;  1EDU A;  1HFA A;  1UJK A;  2KC7 A;  2WXL A;  3VTX A;  3B7U X;  3FY4 A;  4MRU A;  3CVL A;  3AU5 A;  4J6I A;  4P29 A;  1WY6 A;  3ZYM A;  2X38 A;  3RKV A;  4MLP A;  4GYY A;  4I2W A;  4AP2 A;  4BWR A;  1HG5 A;  3ZGQ A;  1Z3Y A;  4G1T A;  4UWL A;  2EQX A;  3MX3 A;  3S7B A;  4DPR A;  3ULQ A;  1QQE A;  2KCL A;  4GYW A;  4J0U A;  3ML8 A;  4GCO A;  3QAR A;  2R17 C;  4GML A;  2DBA A;  2I9C A;  1UN9 A;  3MGB A;  3QB2 A;  2VTB B;  4JHR A;  3FU0 A;  4WNG A;  4F3V A;  4KVM A;  2IFU A;  1H19 A;  3D3M A;  2VJ8 A;  4WWP A;  5AJD A;  3SZ7 A;  2KM4 A;  3MKQ B;  5G05 C;  2IOL A;  3UX4 A;  4GA1 A;  3LY7 A;  3UMV A;  2IJG X;  3FEY A;  4U8H A;  4GZC A;  4GYO A;  1L5J A;  4J8F A;  3CHR A;  2WQ7 A;  4YVQ C;  3TL5 A;  4BTB A;  2E0I A;  2VTB A;  4CCA A;  3FUI A;  1UG3 A;  3D9M A;  4JA7 A;  2L9B A;  5BW8 C;  2R59 A;  3ML9 A;  1WAO 1;  4HFG A;  2R5S A;  2FI7 A;  3MKQ A;  3QNK A;  3L54 A;  4F7A A;  2MRI A;  4WUY A;  3AS4 A;  4JHK A;  1SQM A;  4G26 A;  2V8S E;  1Y6I A;  3JQ0 A;  5BV1 A;  4YND A;  4N2Q A;  5EDS A;  5LP0 A;  1KLX A;  4RG6 A;  3NF1 A;  5A23 A;  2CFU A;  2HYZ A;  3EIJ A;  4HOR A;  2FUL A;  3G2S A;  3R9A B;  4DJA A;  4N2S A;  3PRZ A;  4TV3 A;  2GRL A;  4AXH A;  3MV2 B;  2DCP A;  3L22 A;  4H7Y A;  1YA0 A;  4I2Z A;  4UQZ A;  3LXU X;  5ARF A;  2IOS A;  2WM9 A;  3DPD A;  2FF4 A;  3D9K A;  5KJL A;  2X6H A;  3FUN A;  3QAQ A;  3CHO A;  2PQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...