1LFPA

Crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
243
structure length
243
Chain Sequence
SHWAQIKHKKAKVDAQRGKLFSKLIREIIVATRLGGPNPEFNPRLRTAIEQAKKANMPWENIERAIKKGAGELEGEQFEEVIYEGYAPGGVAVMVLATTDNRNRTTSEVRHVFTKHGGNLGASGCVSYLFERKGYIEVPAKEVSEEELLEKAIEVGAEDVQPGEEVHIIYTVPEELYEVKENLEKLGVPIEKAQITWKPISTVQINDEETAQKVIKLLNALEELDDVQQVIANFEIPEEILQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of conserved hypothetical protein Aq1575 from Aquifex aeolicus.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Rna binding protein
molecule keywords Hypothetical protein AQ_1575
total genus 68
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2002-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01709 Transcrip_reg Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1lfpA01
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lfpA03
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lfpA02
1KONA 4F3QA 1E0EA 1WJEA 1LFPA 1WJFA 1K6YA 1WJBA 3F9KA 1WJCA 3HPHA 1MW7A 1WJAA 3HPGA 1WJDA
chains in the Genus database with same CATH superfamily
2ZSIB 3MMBA 5KFIA 1IWGA 1FRKA 2M7AA 3FF5A 2YNHA 2ZMEB 1AZSA 4LLLA 4PAAA 1PJRA 3A0HC 3HKWA 4RZRA 5L39A 2L7MP 2E1RA 4B44A 3E3VA 4LF5F 4DV3J 5IP9J 4PXDA 4PG8A 4W98A 1IM6A 1QY7A 2MSTA 1MBJA 3JREA 4DV2F 3O1LA 2MA3A 1AU7A 4HQMA 1S1VB 4CDGA 2Z3YA 3K5LA 2YNIB 2LSOA 1KBRA 1WG5A 2R8JA 1VIOA 4LIRA 1X1DA 3V2UC 1FFWB 1LQ1A 4AVPA 1WOSA 3GTQJ 2JLFA 1BMQB 3OSGA 1OR7C 4O0NA 3R5DA 5H9EJ 4I69A 2MKKA 1SVMA 4DI6A 1VQNI 3OT9A 1D5YA 1TL7B 2XM3A 2APOA 5JXSA 3TANA 2Y30A 2VOOA 4OU0A 2E1MC 4LF6F 2JOQA 5E3OA 1YO5C 2R7VA 1TUWA 3HSDA 5ETRA 2OHDA 3OFGA 4XNFA 1OY9A 2BY1A 5ILSA 4OX6A 5DM7F 2AYGA 4BXXJ 3H3VK 2G4BA 3S6EA 4Z2YA 2IMOA 4ZCKA 1FSHA 2ZJPF 1B72A 1Z2ZA 3A1YG 2CNOB 4ED7A 2JWTA 3IAS9 2Z16A 1TUVA 1CJTB 1O57A 4IJAA 4QIWN 2GLOA 2V9PA 2BXYA 1G4DA 3D5SC 1ZA2B 2IY5B 2RN7A 1F0XA 4J5OA 1U6FA 4B47A 1SC6A 3KHRA 5EEAA 5HJYA 4B9SA 4UVBA 1WSUA 5B0AA 1BW6A 2GXBA 3VQSA 4F26A 1E3PA 3L2VA 3IS9A 3U27A 3E1SA 4DR5J 1MBGA 4IEJA 1YI2I 1LWCB 1EETA 3N05A 2XC9A 3IGVA 1JXVA 1JLAA 1V3ZA 3NGRA 2OEKA 3W2VA 2ZCWA 2ZXWH 4ER8A 3OYEA 2EZKA 2XRNA 3WU1B 2DGOA 3TARA 1BWVA 4RUHA 3BPXA 1R71A 2QSWA 3CJNA 3OSFA 3CSKA 2Y0SN 2OELA 1N36F 2EV6A 1JKHB 4NLTA 4CQ1A 2KT2A 4ZIVA 4Q44A 1QU3A 2J6TA 3CPWR 3S01A 2CG8A 3U1LA 4NHJA 2ELKA 5GMDA 2W8KA 1XTZA 4J19A 4M9ZA 1WC3A 3MOZA 4G1QA 3VWSA 1FRIA 1V5EA 3OVBA 3VOEA 5AE3A 4HPQA 3QBCA 4IQMA 3OL6A 1GMUA 4I0WA 2JA7J 4U7BA 3DKDA 1QVFR 1K4SA 4Y28C 2WSCC 4ZTFA 2QENA 4DSLA 3HHEA 1M5SA 2LY2A 2CQCA 1RUNA 2YKAA 3CC2S 2V4QA 1HPZB 3BKTA 3ZMZA 4GVBA 4NZ6A 1ETYA 1IRGA 2IRUA 4XOPA 1NZ8A 1FDDA 4PJLA 2XGQA 3MF5A 2ZBRA 3CCJI 3DRPB 3VVTA 1O3TA 4I0AA 2O61A 1J9IA 2FLNA 3G6XA 1UA1A 3JB9k 2W1BA 3T8RA 2IBDA 4WWCA 4BUPA 1MSFC 5F1RA 1X60A 4DV6J 4RBOA 5GPCA 4HI2A 2FJWA 1FWZA 2RDDA 2WW4A 1FKPA 4A3JJ 5FKMA 3DP7A 1MNDA 1SAXA 2XRLA 2CADA 4JX4A 2CPYA 4HA8A 3BO4A 1GXUA 2JHEA 2O7OA 3LSIA 2L3MA 1S1TA 4I2PA 1QZYA 1U4BA 1XWLA 3DLKA 5KT7A 2QSHX 3TVKA 2L54A 2W01A 3N01A 3DOKB 5J2MA 1VK8A 3DN9A 2V6CA 2WONB 4QIVA 1IUJA 4TU9A 5E5NA 3OYFA 2W57A 3ZQLA 1F5BA 1ZLKA 2L9NA 4J9MA 3W6KB 4CYDA 4HI1A 3W8GA 4UY85 2OAZA 1YQAA 3PX4A 1RT2B 4GCVA 3C16B 4F3MA 5DETA 3RJPA 4QWDA 1I3AA 3MZYA 1KN6A 4PG6A 1X0PA 2UXDJ 3LUYA 5DDRC 2D1HA 1XB4A 1JJ8C 5BXIA 3OYBA 2XY5A 1ZPVA 2FHKA 4TY8A 2VJIA 1VRTB 2QLZA 4QW8A 2HS3A 4PK4A 4GC7A 2FZCB 2QTWA 2M1BA 1IRXA 5K7HA 4OZ3A 2QG9B 1Q8IA 4EATA 1F1ZA 4Z37A 3CIMA 3FMRA 4LJMA 1YFHA 3I32A 3Q8SB 3W9JA 4XK8C 4LVNP 4ESFA 4F2SA 3ZMTA 5ETTA 4H4OB 3HIFA 4EJUA 4BXUA 3VAIA 2DMTA 4F4KA 2OA4A 4FYDA 3ULHA 3GE9A 1S1TB 4I2PB 3FSYA 4B48A 2NYHA 1ETQA 3DF8A 3OHBA 1R1UA 2BKNA 2VG6B 2XCPA 1PUFB 3HSEA 2X6OA 1N5TA 5A6WA 3Q3SA 1K1SA 4F3OA 2KL4A 4KMFA 3CO0P 1FX2A 3FBFA 2NXJA 5LGNA 2LKXA 1GVJA 2QCOA 2DNLA 2TRTA 4HTJA 1VQPS 2LH9A 3C2BA 3QRRA 5F41A 2XAUA 1GMWD 4UUVA 3UPFA 1BGXT 4IRCA 1BQMA 2VQLA 2OBPA 5JVGF 4KICA 1RTHA 3HRUA 4ERDA 2L7KA 4NQWB 1T9TA 2CPEA 1T38A 4RMNA 2DR8A 4WU3A 1PYOB 4G1PA 2XIGA 3O8HA 2Z1DA 5G0RB 5HANA 2BZTA 2DK8A 1Y8QB 3P6YC 3IM9A 2NVXJ 1U1MA 3TAMB 1YDLA 2FDNA 4YIFA 5DD4A 1N75A 4NB5A 2B63J 1XJWB 4IRIA 1VK3A 3GTYX 3Q0UA 2HYJA 3AOCA 4B9LA 2XTJP 2LA6A 1EH7A 1HW9A 1VRQC 1QSLA 5D4LA 4FYVB 3M1CA 1CS4A 2H8RA 4NX9A 1KP6A 1RT6A 4G12A 3D28A 2CZVC 2QVOA 4NXMF 1G7CB 1ZOTA 1U2RA 4BDZA 1Q0NA 2C3OA 1VBKA 4Y7NJ 1VQ9S 4EM2A 4EJVA 4C2MA 4N0BA 2DLLA 2AXLA 2ZBQA 2HQRA 4RNNA 3ZQCA 4BY1J 3DU6A 4CH0S 2ZH9A 2WSFC 4HX4A 1X4CA 1GT8A 2XQCA 3FM3A 2M0CA 3P9IA 1VQSA 5GAHU 4MYTA 5LSRA 2CKWA 2ACYA 3JXOA 3KLEA 2OV7A 3C2HA 2FLPA 1NRKA 4V19X 4IXAA 3A1YA 2BOAA 4E2FB 3Q0AA 4CYUA 1FWPA 5DUKA 4ANDA 1ETWA 2R5YB 1JLBB 1VQ5I 3EVWA 4AUXA 2W4DA 2W1OA 4EGLA 1VQ8I 4X0GA 2MZTA 3D54A 2OPPA 2ZH3A 1UW4A 4B9UA 1U8SA 2CWEA 2ID3A 4CCLA 4ZMMA 1EKRA 1N33J 3CDAA 2HZTA 3DTIA 1I5ZA 3L9FA 4KKOA 5GP9A 1SJQA 1K4TA 4UHTA 3FZBA 1SI9A 1KVJA 5BJRA 1TVRA 5DV5A 1VRUB 4C8OA 1YLFA 4B3MJ 1R43A 3K8VA 4DR4F 1GUUA 2V7FA 1NK9A 1CULB 1SH3A 1FWLA 1OCPA 2NR0A 4OJ1A 2AGPA 2YKPA 2RE1A 3LSMA 4BQNA 3E6CC 1QLNA 1RPWA 2BDPA 5E3MA 4AYBD 4R25A 2HOSA 1USTA 4QTRA 4F93B 5BPDA 1WD6A 2H4WB 1VQ4I 2FA5A 3MN2A 2R8IA 3DLBA 1RZ4A 4NLUA 3IC1A 3H1CA 5HQLA 3GP9A 2DT9A 3ASOH 2L7FP 3F8BA 1N8RT 1YI2S 4ZPDA 4B3SJ 2VKRA 2MG4A 3N4MA 4UB6C 4PSWA 4HBLA 1D1AA 3K5PA 3NWRA 4QOTA 3K0LA 5H9EK 1ERDA 1RADB 2MBFA 4A8QA 2EG1A 3HOWJ 1JXEA 4XLCA 1RT5B 2QEXI 2ZNYA 4MIAA 1WFXA 5HMYA 2HXOA 4FQGA 4I0BA 2J6SA 3SFZA 1S1VA 1V3FA 3CJ3A 4DFKA 1M5VC 2W7NA 2VBZA 3A13A 2GIFA 3GR1A 2WVEA 2ZE2A 3U1NA 4X4VA 1IKVB 3J81K 1FPQA 4QBUA 4J9KA 1Q53A 5D4SA 3FXJA 2P9GA 2QYOA 1Y3KA 2O5RA 1ZM9A 2OD4A 3FRZA 4B3TJ 1RISA 3B6CA 2RNEA 4G3IA 8AT1B 2F63A 2E5JA 4V19K 1GDTA 3K58A 4TVAB 2Y1RI 4JI1J 3PNVA 2VT2A 2E19A 1FYMA 3C8YA 1G4CA 5EGOA 3DYAB 4C97A 1FTZA 1DZ5A 4KHPF 1I39A 3R8YA 2DA4A 3PY8A 2U1AA 4KH1B 4ES2A 1XMQF 3OS1A 1BHNA 3BZCA 3TO7A 2ETHA 5FROA 2RMLA 3SV4A 1JE8A 1WKLA 2DITA 3IWFA 4ZS6A 2WB4A 4LBIA 2M5WA 2DYAA 2VZ9A 4MQ9F 3CDBA 1I94F 2JEGA 1TK5A 2CQPA 2V6EA 3GR0A 3GONA 3I59A 3W7BA 2UV1A 3D9BA 2CPZA 5J4VA 4FYYB 4FP9A 2VQEJ 1N48A 2BQ3A 4HF1A 3JRGA 1SV5A 2IAJA 1FF2A 4WPAA 4HDGA 3T0YA 4NXNJ 4ED5A 3KYCB 4C2TA 4FBUA 3DTKA 4JOMA 4USIA 4UVAA 3S1NJ 4ECRA 2N4DA 1RUSA 1NH8A 1WHVA 2M4KA 3ELHA 4PZVA 2W4PA 3A8EA 1V4RA 1GLNA 3HRMA 3LP1B 4K0KJ 5JFRA 5F0HA 3QWLA 1GXTA 3S3NA 4MEYF 1QD1A 2J6UA 4FDFA 5ETSA 1RTDB 1LDDA 4ZPVR 4JI3F 1HW1A 4A6EA 2OSQA 3HK2A 3BJOA 5C24A 2RUSA 3FXQA 1DPUA 2EI5A 4XBFA 5E20A 3KJVA 1XSXA 2FB0A 2MC4A 4DN0A 2M2BA 2DH7A 4XN3A 3C1DA 1DARA 1FOYA 3F3XA 4P75A 1EZZB 2Y0MA 2J5OA 1YG2A 4ELVA 4CCKA 2OD5A 2RRAA 3KEYA 4MT1A 4QU7A 3PIOF 5E3CA 3HEFA 1X5TA 3FXUA 2BJ1A 2LFBA 5JLXA 2ZC3A 2I1RA 2BM0A 3NCRA 2RC4A 2QMWA 4UVCA 5C24B 4LSZB 2K85A 4KISA 4HV6A 4GYGA 1L3SA 2DA5A 2J0XA 5G0RA 2GS8A 1XNRJ 3HG9A 4K4TA 1VC5A 3MCSA 1FZPB 3GW2A 5L1IA 4DR2J 2V4JA 3SZGA 3ZQFA 4F36A 4AXIA 5GADI 2DRAA 1HNWF 2ZM6J 4UT4A 3JAMU 1YBAA 1P4WA 1TL1B 4A0YA 2Y8YA 3ZNUA 3MD3A 2UVWA 2DMUA 2QC3A 1WJBA 5F3TA 1FMVA 1VQ9I 3VAKA 1ZGJA 2AQ4A 3T19A 1XGOA 1QQIA 4EGYA 2QBYA 4YHHJ 2ELJA 4F50A 3MKWB 4XQFA 1MG7A 3HOXJ 2FUG2 4MKVA 4JI8F 5L9XA 1NK0A 4FT8A 5DLGA 3BTCA 1IRFA 2JPBA 1HNVB 2EKYA 3TZXA 3L2RA 1XCVA 1H88C 2X1FA 4GO1A 2W4SA 1FK9B 2DGSA 3ZQ7A 1RHRB 1LVKA 4AWXB 1UZDA 5KFTA 3PX6A 4ED4A 2DYSH 1OYIA 2Z9OA 3LAMA 1ZZFA 2K7JA 1BQNB 3U7JA 2OUMA 4GKJF 4UUXA 2JFDA 4NOHA 3TO9A 4K2XA 5KFNA 1U9NA 1XGSA 2MD0A 4NMXA 7FD1A 1HI8A 4E70A 4J9PA 2VG5B 4JBAA 2A1BA 4MKAA 3MCZA 2HZVA 4AIHA 2NXNB 3FCHA 4YFNF 3SQGA 3UN2A 1FBUA 5LHHA 2UV8G 2A3SA 1L3TA 2MKHA 2Y1IA 1X1CA 2VBXA 3VPRA 2HFOA 5DGBA 1J5EJ 3ZPLA 2R3SA 1N5YB 1PYTA 1CJUB 3KK3B 1HSJA 2R2TA 1U8BA 4H0EA 3EZOA 1BC6A 1EKEA 2JN6A 1HKQA 2Z58B 3AAWB 1VTNC 4WK8F 1NO8A 2JDJA 1P2FA 4OV1A 3H4BA 1BE4A 3W1YC 1TNTA 2YNHB 3GFHA 4IDKA 1G6NA 3BG9A 1TVRB 2CWXA 1YRXA 1B64A 5KFVA 2EXUA 4CUGA 2ZJPQ 3TP0A 3MZIA 3TAQA 1S6PA 1QTNB 2ZHOA 3G4SS 3SJMA 2O01C 1VFCA 4L3KA 1NEEA 1MDMA 3UR0A 5D8KB 3SDEB 4ZVFA 1WI3A 4NLWA 4L18B 2IA0A 2HWHA 2CUYA 5E7OB 2OFHX 4RB1A 1IVZA 3NLCA 4P9FA 2ZM6F 1HSTA 1WJAA 2K1RA 4O3RA 3OPKA 5H9FK 1R36A 1CQTA 1NJWA 3DMJB 2C3MA 3IMQJ 1N32J 1CULA 3D4JA 4FN5A 2YNIA 1K6YA 4O3MA 1BJZA 1Z77A 1LWEB 2JZ5A 5K8PA 3KJNB 1DQUA 3NMRA 1FTTA 2BJ3A 3MAAB 1WUUA 4HSTA 3S93A 4A69C 1RAGB 4LMYA 4I2QA 1NK3P 3B02A 1U1OA 2VDHA 2NREA 1IUFA 4LQ9A 4DR3F 1ZTRA 4CM2A 4BWJA 2LY1A 5M2PA 4M1KA 3HMJG 1RTIB 4BBSJ 2ZD1A 3ZTQA 2XB5A 3FEXB 5DG7A 1K0VA 1FD8A 5IQ6A 3P3DA 3JTOA 1Q8LA 3T1YJ 1XX5A 3OYMA 2LMIA 3ILOA 2B51A 2BE2B 1CLFA 3QPLA 5KFBA 5LSOA 2MB0B 4JI5F 1WJ5A 1R5HA 2DQLA 5KHDA 1YVFA 3QRFF 2IEKA 1AHDP 1KVIA 2VKZG 2W2NP 2FMYA 1WPKA 1RWVB 1FMWA 2LLKA 3LFUA 3EICA 1WTBA 3RZOJ 3R3TA 4MIWA 4ZCMA 2HTJA 1DTQA 2QQ8A 1PYVA 5KFWA 3MM6A 3CCMI 2RIJA 1MJBA 5ETMA 1Q7LB 2XMVA 2CPDA 3M8WA 9ANTA 4KIAA 1L3LA 4DZPA 3NS7B 3IR5B 1NHKL 4Q5VA 3IS9B 2UXBF 2WA0A 3KHHA 1XDSA 5FKLA 4B9NA 1YKWA 3NEUA 2P7VB 2ZE2B 4Q7AA 1RK8A 2GJIA 3BGLA 5CAAA 3GYXB 2D3OR 4JI2J 3DEUA 3WTSC 1GXLA 1S0MA 1JLEB 4ZPBA 4UUWA 1MSEC 4KPYA 3E7LA 4WKRA 5J2NB 4B09A 2A3JA 1G3SA 4JI0J 4FE4A 3PFIA 2VPXB 4AIKA 2ZOGA 1YJVA 2ZHBA 3OL4A 4DL2A 3LW5C 3CZ6A 2ZZMA 1U3EM 2GA7A 5H6QA 2DTRA 2E1PA 1VQNS 2XCAA 2EFOA 2J5PA 2UUTA 4A3GJ 2Y69H 1CF7A 3E97A 2ADBA 1UZCA 1SMYF 4C3HJ 3R60A 2CO5A 4NE9C 5L46A 1IN6A 2BE2A 4PFPA 4Q8EA 1HA8A 2LXUA 5L3DA 2VOPA 2HBYB 2Q2EB 4NC8A 4UUSB 1SD7A 5KT6A 1TKZA 3ZFVA 5DGAA 2FGOA 2MY8A 1A31A 1KSPA 3FXKA 1LXNA 3I0SA 5FD1A 1ZRCA 2RKHA 1CJKA 3QOPA 1HHTP 4JI1F 3L2UA 4YDDB 2PFDA 2R7UA 3IH2A 3RYLA 2LDIA 3M30B 1R6YA 3FKBA 2VQFJ 2Z56B 3K10A 5J1NA 3CMQA 5FIIA 3VAGA 3QYYA 2A61A 1S1UA 4ED8A 1IAWA 2BE9B 3I56S 2X48A 1I3QJ 5F27A 4OV6A 1HBUB 1BQXA 2GVZA 1ZM4A 2RF2B 1XMQJ 3CDIA 2WAQD 4BDPA 3V4GA 2F5GA 3Q8PB 2Y8WA 4C8YA 3BF4A 2KT0A 3HTSB 3MEGB 2W9BB 1K79A 2IRYA 2XUBA 5F8LA 2JLGA 5L3CA 1TL3B 4EQQA 3OQ2A 1V5VA 2D3ZA 2GIRA 2DVIA 2CGPA 3F8MA 4LUBA 1I27A 4PQAA 3TUPA 2AJ4A 3K2AA 1S9EA 1ZPWX 4LFCF 2FSWA 2YVSA 3NGSA 1S4EA 1SVDA 2J76E 3MWMA 3EUAA 2C42A 1SUQA 3BZQA 5BR8J 2LXFA 3I96A 3RKYA 3CCES 3Q8VA 3ERMA 2HEOA 4RUBA 4WIIA 5KFOA 3Q9VA 5M5WJ 3MOJB 1EIYB 1TL1A 3FMBA 5CXTA 4TXSA 1JNZB 2MSSA 1XR6A 3JQJA 3KLEB 3DLKB 2IGMA 1ICEB 2M30A 3K6GA 2VFSA 2OIHA 4YG2F 3GFXA 2CRLA 3UN5A 5FLXY 3MXHP 3EDQB 4TLRA 3DV8A 1VQKI 2H54B 1D0EA 2AIRB 3CUQA 5K8OA 3HZEA 1R6VA 1EAYC 4Y2CA 3RZAA 3KP7A 1YJ7A 4X4OA 2FPHX 1KA8A 3ULQB 2O8KA 4RLQA 3QPSA 4M5MA 3MR3A 3LPYA 5L3EA 1M1KT 1SFUA 4DV7J 1FJGF 1IJEB 2V2ZA 4XK4A 3RTRA 4C8KA 1YG0A 4CGZA 2Q79A 3CT9A 2CDQA 4P96A 1B3TA 1NDCA 3J81Z 2QE5A 3H2LA 1XIQA 3WIUA 1RYSA 1CEZA 3R97A 2NZ4A 4IZZA 1HR0F 3FHZA 5CVVA 1UELB 4J00A 1R5GA 2O6GE 3GTLJ 3QZ8A 1RTZA 4J90A 1VR6A 5IOYA 2OTLI 1A7GE 3PSFA 3IH3A 1HKSA 1FBQA 1RHJB 3TP2A 4ENOA 3FCWA 2ZBPA 1GHCA 3SXLA 1I51B 2O3FA 1Y56A 3PFOA 3GXOA 3IKVA 4YQWA 3ZTRA 4IHYA 2F40A 2IJNA 3ZXSA 3JTHA 2KXHA 3REOA 1S12A 1UWAA 3F73A 1LEBA 3R7BB 4USTA 2DISA 1S77D 1JKRC 3OOUA 1E6VB 2A18A 4WFNQ 1J5OB 3K7RA 1CJUA 3RRKA 4YB6A 1SVLA 4JYAF 3J81Y 2XHCA 4BGDA 1FEXA 5AXNA 1C0TA 2M88A 2QQAA 1AWCA 3ENVA 1IGNA 2R93J 1C0UA 2KI2A 4DX5A 5LJ5Y 5HS7A 3LP0A 2PMZN 1XK8A 3C66A 2AF6A 1FOKA 1IKXB 3FMWA 4N4NB 2RJZA 1QVTA 3G87A 1S9HA 3JR9A 2XB2D 1N36J 1S99A 1AT1B 4OZLA 4WFAQ 1D0YA 5HODA 3WG7H 2DDBA 3FNNA 3H2UB 1GMWA 2QSFA 1MJ9A 3WBZA 4A3KJ 5K9FA 3KEOA 2XNRA 4DNCA 2V4JC 1R9TJ 4EK2A 1R8AA 2VLAA 1JWWA 4FX0A 4ZOSA 1SL1A 4B3SF 4EM0B 3A12A 1B72B 1RWKB 3OYKA 1ACMB 1JNRB 2LQBA 4IKAA 4K4WA 1RWUA 4L9NA 5D4PA 2JC1A 1ZAOA 3B6BA 1XDUA 2JLEA 4YR2A 2HFUA 1RCOB 5J1PA 4IFVA 2MLZA 3PR5B 4I6AA 2RKIA 3KK2A 1JGSA 1HBMA 5I3UA 2HHHJ 3H20A 2P81A 1PKUA 2HNZB 2JL9A 2DJIA 4A8FA 3PR4A 5HMZA 1B9NA 3UW1A 4IRGA 2NUUG 1H9TA 1W7PA 1WKMA 1NB2A 2V50A 2RHQB 3TW0A 1FVQA 2FGCA 3NG8A 3S8PA 3HVTB 3MWBA 2XVCA 4FBTA 3V7SA 1Z7UA 4CLTA 2ICWG 3A8JA 1HQ2A 2HPUA 4RW8A 1HNZJ 1RSCA 5IOLA 5I3PA 3G2XA 4A8SA 2ZWOA 4A93J 1FRLA 1P9YA 2GO8A 4I7FB 1IXCA 1BN5A 1VQ7I 5GTHC 3CCEI 1JQGA 3ZTSA 2BQRA 3UNYA 1SV5B 4KITB 3QLHB 4Y17A 2HIQA 2FIUA 2NS7A 2G13A 2F5VA 1KLMB 1H7WA 3OBIA 4Q5SF 1U47A 5E0OA 2E9TA 1PP8F 2ZJQF 1C1BA 3H2VE 3CJQA 3LALA 3GJSB 2GGPB 2OCCH 1WEXA 2JA2A 3SCLE 3AG1H 3ECHA 3MEDA 1SXLA 1B7YB 2GC8A 1DP7P 2YKOA 2IVYA 1AA1B 3TX0A 3GB0A 2BR0A 4XRMA 3KG0A 3M8PB 2RVCA 1WGXA 1J2VA 2E2HJ 2YTCA 2HVZA 1TNSA 3QYEA 1OYYA 1IBLF 3SHFA 2W8LA 4PUOA 3LQQA 2Z99A 3DRSB 5KAIC 4CZZA 3R2DJ 2YX4A 1KONA 3MTJA 2W9AA 1R5ID 4HR2A 4DXLA 2CQDA 4MK9A 2YNFA 4TN2A 5AE2A 4ZHRB 1EP4B 4NI2B 2LU1A 3MAQA 3S7RA 4I99C 2HEKA 3SQNA 3Q22A 4DPUA 4DF4A 1FYKA 2KYZA 3TI0A 1TT0A 4OYAA 5IY5H 1JLQB 1N52B 4ZJQA 4K50A 2F4FA 4DV4J 1U9OA 4M5NA 4RW4A 3M8FA 3MCOA 2IAIA 2YWHA 2ZUAA 1RWOB 2F5DA 3ONQA 5J8CA 3F23A 2E5HA 4EUVA 3HHDA 2ABYA 1SCJB 2EIKH 4KH0B 1VQMS 1W5TA 1OWXA 4RGXA 3O8WA 2HU9A 4ZP7A 2FLLA 4QYZK 2L5QA 3M1EA 4F8RA 1FEHA 4MIMA 3TBIA 1ZZNA 2UUCF 3M2UB 2X85A 2G7HA 2STTA 2R4GA 1IKVA 3H90A 4ZLNA 3TA0A 4DYRA 4LFUA 3PW5A 4EJTA 4OI0A 5KAFC 4DG1A 1VLOA 3N4WA 4WXHA 3L7UA 4XN0A 3L2CA 1ZRFA 3B4DA 3DXBA 5L1LA 2I5JA 1FE4A 3KLHB 1RKIA 1SFOJ 5HVGA 2BHYA 4ZHRA 3OL8A 3IA0A 3I56I 1WOOA 2JJ7A 4Q0BB 1EARA 2IXSA 2CQQA 1VQ5S 1VQOI 3L3CA 4WCGA 2DBBA 1MMNA 4L0YB 3U2RA 1WDDA 1APSA 4ID8A 1UEUA 4DFPA 4IG0B 4WWSA 2CQ7A 2CPXA 2JTVA 3S2DJ 2IM2A 3WE2A 3PRDA 1S1XA 4UOHA 3HKZN 4QYZJ 2E5NA 4HEA9 4LSLA 4A8KA 2OAUA 4OHYA 1R22A 3FQKA 5ILUA 4G7HF 2DMQA 2ISZA 4F91B 5KK1A 2V8GA 1IBKF 2J7KA 3RW7A 3SIPB 1S10A 1R49A 3TQ1A 3W2WA 5KTQA 2WBMA 2QFIA 2BXZA 4N8OA 2M3DA 3BGUA 2BJ7A 4DIQA 2J8SA 2BW2A 1OR7A 4F0HA 5GADU 3VAHA 4OI1A 3U1KA 1X4OA 3NNAA 4ZC3A 2IAJB 1UHSA 1Q16B 5IWAJ 4P6QA 3KHLA 4RB0A 2GHPA 4FPRA 1O51A 3H5NA 3NBPA 3MMCB 3G1MA 2QA2A 5FD5A 1LW2A 4A8OA 3BLYA 2HFZA 1VIXA 2B4UA 5EDWA 1E6VA 1J5OA 3O2PE 3VEPA 4A0XA 1RA6A 2FOWA 2DNQA 4RBUA 3JSRA 4P72A 2IPQX 2LDUA 1HI1A 3GSDA 4F3QA 3D0SA 2L4AA 4F02A 4X4SA 4CT8A 2LOOA 1UTAA 1OJLA 3DFGA 1U6BA 1TWCJ 2XGCA 2D3UA 1B0PA 2OPSA 5ICFA 1B0VA 5HROB 2O8XA 4ITSA 3EXCX 3TKYA 4EFAC 1JGGA 2DRDA 2ZH2A 2NVQJ 4BLGA 2VBYA 2FJAB 5LL6d 3GQCA 1N4LA 2NRAC 4BS2A 4PQUB 4R5PA 1AFIA 4W4MA 3S15J 3CDWA 4NLYA 4FX4A 1WORA 1JLBA 3CLOA 1FJGJ 4RUAA 3QP5A 2YWKA 2HNDA 3JCUC 3PYEA 3QT7A 3PW4A 4M5IA 2KRCA 4O44A 5CYMB 3WGHA 3TL4X 2V4JB 1P92A 5A2QU 3ZZYA 3G3ZA 4C11A 1EHWA 2R7FA 1B9MA 2E2JJ 3LWFA 5CA5A 2CAJA 4X4PA 2XGEA 2EFNA 1CC8A 2G0IA 2WVFA 3OW2R 2OF7A 3I55I 1UFMA 3MM6B 5AE1A 2JNJA 3TAPA 2FVCA 3HT0A 3SDBA 4HLBA 3B78A 4O4GA 3C14B 1WI8A 5D5XB 3H9GA 1S6OA 1HBMB 5I3UB 2HGCA 3HL2A 2JA5J 3BROA 2VG6A 4CXFA 4KHMA 4OINF 3OR1C 2CQ0A 2PN6A 2HS5A 2CQ1A 3FC9A 1NU4A 1U8WA 5TISC 1EQ0A 4CRJA 2B7CB 2BABA 2HZCA 3HJEA 2MGQA 4DQPA 2EVZA 1NNDA 3DGPB 4DQ2A 5CZXA 2O3DA 2RSQA 3LQRA 4DPXA 4JP0A 4RDUA 2OEJA 2V8PA 5KFXA 3OL3A 2NXNA 5LFAA 5IP6A 2BRKA 2F9DA 2DCLA 3B73A 3ERED 1ZGAA 2CV1A 1FERA 1Y0HA 4P2MA 2EFPA 4DZ6A 1S7AA 1Z7LA 1QPMA 3T41A 4BH9A 2F48A 3WHBA 1AUSL 1ZLJA 3EVOA 3IWLA 3QJPA 4OMZA 2J0SD 1UVJA 3M8ZA 3Q24A 4U95A 1KTVA 2AYMA 1UCNA 2NUHA 1GH8A 4OYPA 3ILLA 2OPRA 1QNTA 5B0CA 4YY3J 2QN6B 5L3GA 5LEKA 2IT0A 1KLMA 4DZJA 4PG4A 5F3ZA 4O3SA 1MIJA 1O7LA 4X64J 1ZGWA 1FKOA 4OZJA 2AGOA 3SV3A 1JK9B 3LSTA 4BE2A 3RBXA 5I42B 1AFJA 2X51A 4KNYA 3V81B 4ANJA 2W7AA 4LF2A 2JUGA 1I5OB 4UXNA 2HMIA 2G7UA 2FJ1A 3ML6A 3A02A 1QDUB 3D1QA 2IP2A 2OQRA 2L01A 5GAEI 4XLNF 2VFTA 1NG6A 3ZXWA 2XLKA 1OKRA 3LWLA 4B3OA 2CUZA 1RKWA 2W82A 3CF2A 2BRLA 5CH7B 1FDAA 1W0UA 1FFSB 5FRNA 2ILYA 2EPFA 2OMOA 1SPBP 3SFUA 3KG4A 3CO6C 1ZG3A 1ACIA 5K5OA 3UR3C 4O3OA 1CJVA 4U7CA 1MH4A 2FBHA 1R31A 4UW2A 3FFIB 1SH2A 5KG6A 2MYSA 4C2MJ 2H51B 2LCWA 3IG1A 1N33F 4EJOA 4DBRA 1S4FA 1ETVA 2IYGA 2E71A 2E1MB 3UKGA 4GO7X 4NEZA 1VQ6S 3S1QJ 4MTDA 3SZTA 4DMZA 2YY3A 1Y3JA 2EQRA 4F4XA 1W2IA 2GAGC 3UCZP 3C18A 2HGMA 4PJNA 2GZOA 2NYXA 3Q8UA 3IC7A 1YS6A 1XCBA 3FWEA 4M8LA 3CCZA 4Y0FA 3TOQA 2GMHA 3K5NA 4ZH4F 3PV8A 4UY8I 2KFDA 1LFWA 1MH3A 2CH0A 1IUYA 2EFQA 3U9GA 4DCJB 3LGHA 3DRXA 3F8FA 1JLCA 5EZHA 3C6TA 3TO8A 5F04A 3NGTA 3O2IA 2BY3A 3GTKJ 1NSAA 3GMGA 1BXNA 4OX7A 4ILRA 2KO1A 2J9CA 4E7JA 1FRJA 2PIIA 4BQQA 2LNBA 2MHNA 3M1VB 1TWFJ 2HNYA 4IHWA 1T0TV 4AIJA 3I82A 4X4NA 2CQNA 3O3KA 1NSPA 2YQ1A 4JYKA 2HVRA 5KFFA 3MURP 4UV8A 3JYTA 3I71A 1SH0A 2DHHA 4YR0A 1OS5A 2M9HA 1XN7A 1Q8KA 4OHVA 1NTCA 5I4MA 3G4SI 2PX9A 3NEKA 4K5SA 2LMDA 4FXDA 2FHMA 1VC6A 1H89C 5AJ3F 2V1UA 1BD6A 3BZ6A 4PPDA 3KZZA 1RHUB 3HFZB 1IZ1A 4PSXA 3P8BB 1OJ4A 1Y0UA 2A6OA 2V2QA 1MROA 1FTRA 3UD3P 1SC4B 3HHKA 3ZQHA 2JK3A 5E1WA 2FJBB 2EK6A 4RNOA 2J9EA 3GG1A 4I6WA 4G6DA 4HOBA 4E6KG 1RT7B 1DP3A 3FZ2A 5E33A 2FYXA 5EHHA 2XWYA 2JT1A 4AT1B 1RT1A 5AIPA 3CCQI 3CJ4A 4RB2C 3W9HA 1UG2A 4E8UA 1W2BR 1Q81T 2V1XA 4KT6A 1BIAA 1I1SA 2E36A 4R8UB 3C15A 5L1JA 2ZMEA 2YXLA 2WRMA 5F8MA 2F6CA 4NYOA 2BVMA 4W97A 2Z0GA 4RW7A 2V79A 2XHWA 4ED2A 1OCOH 3K1PA 4ZVUB 5D3GA 1T8IA 4BE0A 3FBEA 2AYEA 1ZYRF 4OAZA 1RTHB 1S0NA 5DEQA 1JUMA 5J8FA 2IDLA 3J80K 3R5AA 2MLGA 4HF2A 4YIIA 3HM9A 3PIPF 1ETKA 5LMNF 5FLXK 3DTEA 1S6UA 4LB6B 4IOCF 1X4BA 4Y2MA 4LF1A 1MMGA 2BM1A 2GZWA 3JRHA 2IIHA 3T1AA 4M3EA 4FNIA 2QGFB 3SYTA 3P5BP 1YJ9S 2F4IA 3W64A 3OV7A 3IRWP 3DDIA 3F8CA 1SC7A 4W90B 4BEHA 3WG9A 5IS2A 4GRIA 2VIXA 3K9TA 4PJJA 2UXCF 3ESWB 4DG1B 2PQ8A 2IDEA 2KIFA 1WJDA 3C6UB 1SKUB 3L2QA 3AY0A 2XGPA 2R7SA 2BEOA 5IM0B 2XY6A 5KFZA 1BR2A 4M3DA 3BR5A 1HWLA 2CW0F 3NAHA 3IWXA 3CJTA 1D8YA 2ROEA 2A69F 3K89A 2TCTA 1VC0A 3UQSA 3BR9A 4HHHA 3JW4A 1S6PB 3G2BA 1WNEA 1IN7A 4HEA2 1H8AC 3K1MA 1U1NA 4RW9A 3JRDA 1YX5A 3QU3A 2ZH1A 2D3O1 2JVGA 2H3EB 3TO6A 4DBQA 2DH8A 3UCUP 3MFKA 1SQEA 2K1RB 2VXZA 3RPUD 1A04A 3PACA 2P2CB 3HXLA 2R5YA 4LF9J 4LREA 4Q48A 2P8TA 3GCWP 2VBWA 1S72I 1WI9A 3CJTB 4AU7A 4WF2A 3BG6A 5KT5A 1TP4A 3NARA 3VFZA 3QQAA 4NLQA 2LYCA 2E9RX 5CYVA 4K4SA 4PYAA 4K5RA 1TV6B 4ECVA 3PHTA 2PJRA 1WSVA 3JRFA 1SFXA 4FF1A 3S1RJ 1YZ7A 2K02A 1KFDA 1WHUA 2DTZA 1RI7A 2WSEC 4PABA 3JTGA 3CD5A 1OQ3A 5ETLA 2DQRA 2FUG9 1YYVA 1NMEB 3EMTA 5AONA 4OYOA 4ZVRB 3ZCOA 2LQJA 2QLXA 1URNA 2KHDA 4OYWA 4IRHA 2ZZNA 1TT5B 3RKQA 4IG3B 3C3LA 1TR0A 1QZZA 4DFMA 3HPGA 5E1ZB 3M7GA 1FKOB 4HKQA 2OC6A 1S9FA 3BPDA 3QMQA 1REPC 3S1MJ 2UP1A 3PCOB 3UD4P 5CLSA 1H3DA 1PGZA 2X1CA 1JXLA 2ZNZA 2XC7A 1HLWA 2BE7D 4FZVA 2ZFWA 1L0OC 1B4SA 2AQFA 4QR1A 2BX6A 2W9CB 3EQLF 3ZZPA 4FPIA 3T1BA 4XORA 1AUDA 3BEGB 1TL4A 2JFKA 3V5RA 3K59A 4BC9A 1TKXA 1XBWA 3VAFA 5D77A 1M0SA 1IDYA 4DV5J 3CD0A 5DQGA 1C1CA 3J7YU 1H98A 2Y1LB 5L3FA 4HLXA 1FBSA 2VJJA 1ON1A 4RS8A 2WHOA 3KEQA 4I01A 2HRYA 1Q1KA 1HD0A 1TKTB 5DQHA 2ACJA 1UETA 4C6AA 4OYBA 4UTGA 3RAXA 4II3A 5EG0A 3L00A 2YWGA 4DV1J 3MI7X 1TWGJ 4J9NA 1X9SA 2W2QP 3TNVA 4U9RA 4KT0C 2KRHA 3DC2A 4RW8B 2IM0A 3GF2A 1U49A 3SXYA 4J9UE 2VC1A 2JA6J 3NRBA 2C6YA 3EWGA 2Y0SA 4OL8A 4ZA1A 4L0ZB 3C6TB 2B4VA 4D5FA 3P4UB 3MEXA 1TKDA 2RAQA 2C2MB 2CIMA 2DGUA 4HDVA 2IVMA 3M1VA 1T9XA 3GO5A 3IO1A 3KYDB 4NWBA 2YKMA 1QHHD 3K0JA 2K3FA 4B1RA 1W4MA 5H20A 2ALYB 8ATCB 3FBNB 5KFYA 2IJLA 1RESA 3OYNA 2BW3B 1BIBA 2R7TA 2GVZB 3R6GB 4KB7A 4A3MJ 1NH7A 4IHSA 1RT4A 2GNKA 4A8YA 2LYVA 2V0NA 5IZHA 2WY7Q 1LWFB 4LR7A 1NG7A 1LW0B 1WRJA 2CJXB 1D1BA 2LECA 1VF9A 4CCOA 3OYDA 3VODA 5DUIA 4ENMA 2BMBA 2VKVA 1HR0J 2Y9YA 3BGFA 4ON0A 4UB8C 1G3OA 3O6BB 5B1BH 4WTYA 3A4TA 3OJUA 4CHUA 2KYXA 4OZ0A 3NRVA 3AA9A 4ETXA 3I0RA 1EH6A 3DLAA 4DSEA 4RW6A 5F8JA 2YNFB 4RKUC 3N5BA 1RWMB 3JQMA 4RPFA 3JSPA 2LC2A 4YN3B 1AOYA 4MMOA 4L75A 3UWTA 2WOMA 2Q43A 4X1EA 4QU6A 4RWWA 1FESA 2C3PA 1NLKL 2HHUA 4LSNA 2AGQA 2QWWA 2ME6A 2ROPA 3HRSA 3ENWA 2XKPA 2EC2A 4KGKA 2K5CA 4CTAA 2ZFHA 3H5AA 1YE9A 2K4BA 3PRVA 2C28A 1YBUA 3MM8A 3OXLA 1B8IA 1MU2A 2H9ZA 3IXQA 5DLFA 5D0HA 3K70D 4JI6J 2DEJA 1UMJA 2VJUA 2STWA 4DDFA 4QWBA 5IC6B 3I9V2 1FCAA 2NSBA 4K8RA 3A3PB 2GBYA 2GIVA 1FVSA 2ZSHB 2CUJA 4IQJA 2B9XA 4DUZF 5DDOC 4QQBA 3OTCA 3KFWX 3J80Y 1X3UA 3LGNA 1A36A 4A3LJ 5B66C 3Q89A 4AL6A 1NHVA 5IXUA 2P7CB 3FEZA 3DDKA 1EKSA 3CGIA 4HV5A 3V7RA 5C42B 3W8PA 1KR4A 2CS3A 1F3FA 3LSGA 5TGTA 2VJ5A 3O3LA 1Y9OA 4A46A 1U45A 5ETNA 2KRRA 1Z05A 7AT1B 2F5FA 4QR0A 3D68A 1XMAA 1RHQB 1HNXF 1R0AB 5D0GA 3OTDA 1SQGA 3MEEB 4XSXF 1X4GA 3RAMA 3KUEA 1VQMI 1SC3B 1I3OB 2EC0A 3H3ZA 3UFCX 1S9EB 1AZSB 3KG1A 3RIRA 2HZDA 4CLYA 1IBMF 2VC0A 2KT5A 3V6KA 4AFFA 2RS2A 2Q1ZB 2Y2ZA 4CLZA 4HDUA 3MAHA 3FM5A 3HVRA 1HNWJ 3DOLA 4L5EA 3N97A 3KZIC 5J1EA 4ZPWR 2DXEA 1KYZA 2GX8A 4P7TA 4EJWA 1M1EB 1U6GA 4ZYHA 3GFIA 3T9NA 4FF4A 4RAZA 3V4IB 2CU7A 4XPEA 1PUFA 3LSPA 1RWNB 4BHQA 3EPZA 2HQ5A 2DFFA 4J9OA 3WGIA 2HQCA 4OZ2A 2LBFA 2TDXA 2A05A 1H2VZ 2AO9A 3K69A 3G82B 4ECSA 4RW9B 1P4XA 3VHQA 3MM9B 3HHLB 1NAQA 4N47A 3TQNA 2VFRA 4EVIA 1HWIA 4A3BJ 4ID5A 4AL7A 1HW2A 4CP5A 5LOQA 4USMA 5IPAA 2BOLA 2L9DA 1OFCX 5KFJA 3H36A 2IHR1 5B0BA 3AHPA 2BJ8A 4WK3A 2X1DA 4XONA 2HHHF 1TMJA 3OR2A 2RQQA 4B02A 1Q82T 1D5VA 1SJ3P 2DXDA 4K4ZA 1Y0NA 1ZG5A 2LP0A 3HDDA 1WC6A 1P4AA 2K4JA 1E2XA 1H72C 4C11B 3B6AA 3UO0A 1UFLA 2V2VA 3KETA 3HLUA 2PMZD 1M5PC 3MZHA 3OYAA 2HSEB 2ZBKA 2FZGB 2J8AA 2VPYB 4ED1A 5M2UA 1S6QA 3BSOA 4ZIWA 1S9GB 3WQPA 2MJNA 4HT7A 5IWAF 2F1FA 1OSDA 5IYCJ 4O4GB 1QUVA 3WIVA 4X4TA 1DY3A 2B9SA 2Z2ZA 2KFZA 3NWTA 3SQOP 3R7SB 5C4JJ 3QAEA 3SDEA 2KG1A 1OMSA 3QU6A 1J5YA 5CJ9A 3A8IA 4LR8A 3AG4H 2F9JA 1UWBA 4DX6A 2R8GA 1B0TA 2X1GA 2K8GA 4C3JJ 5JVGQ 1H74A 5IOZA 3H35A 4DL0C 3QGIA 3HSFA 3T8TA 1NDPA 3L1PA 2BBYA 1X4FA 2R7XA 3NMAA 3I4PA 1GTHA 3CC7S 1LWEA 2L48A 2HFSA 3JSMB 2XZWA 1ITYA 1FRHA 2ZH8A 1YGYA 3E0JB 4PWDB 4YFUA 2OU2A 1P8GA 3KJFB 1EX8A 4GVLA 1OLTA 2JH3A 4ECQA 2ZO4A 3BPVA 2UUAJ 4F67A 3VV2B 3AL0C 1ULRA 2I0XA 3BKFA 4FYWB 3CB4A 2K9QA 2XMTA 2XZDB 1SJFA 2YBVA 1RHMB 4NXMJ 1YIOA 1K8AT 5HLFA 2A68F 2W84A 2HVIA 3LOCA 4P1WA 2B8QA 1VFJA 5KG5A 4NL5A 2HBQB 4WCEQ 2I38A 3TP3A 3CJRA 4PUSA 3LGMA 3F56A 4A48A 2KRFA 3BC8A 2OEMA 2M8DB 5HP1B 3HOUJ 3HOYJ 1HQUA 3AL0B 3KYLA 4DFJA 1WH7A 3IAM2 3VCDA 3D0GE 4FF2A 1VQ4S 4A3IJ 4Y2KA 4KAIA 4XTTA 3PM1A 2C2RA 2RQ4A 3BV8A 1FX7A 3AD9C 3QOEA 3I9ZA 5K7ZA 1BOBA 3F0CA 3V6DB 4F04B 2DOEA 2V8VA 2WAQN 4Z2XA 2FD5A 3SFGA 2QMXA 4RR5A 2V6AA 3E5XA 4C0HA 3IN5A 1WQ2A 3TWZA 3K4MA 4HG2A 3S2HJ 4XLAA 3I0RB 2FQQB 2RDIA 3CC4S 1X8DA 2LQ5A 4DUYJ 4NPOA 5K8NA 3RI4A 3TVYA 2OTJS 3ZNJ1 2WOMB 3Q86A 3UDVA 1HQUB 1N5QA 3SZ2A 1JLFB 4NLOA 4DU7A 2VL8A 2HBZB 3DOMA 2Y48A 4KYZA 3BKUA 4IO9Q 1NZAA 2BW7A 1P1LA 3IP4B 3H4DA 2DI3A 2DO0A 3DXSX 3MM7B 1W36C 2L9SA 2EH3A 1Y11A 2Y31A 4QLCU 2XEXA 4IHTA 3LAPA 4A8MP 1T98A 4UV9A 2L9WA 3E01A 2V4RA 4IYQA 1RWWB 3PFEA 1UHMA 3LFKA 2CQHA 3IG1B 5CVIA 3QYBA 4DPYA 2CJYB 4PRFA 1ZQ3P 5FLMJ 1LK7A 3GLJA 3M4OJ 4UZCA 2JZYA 2V67A 1JTYA 3CCYA 1UVMA 5F0CA 3M9MB 3CCLI 1CQNA 1T6SA 4CH1A 4DLEA 5A0YB 2MKIA 4H4OA 2DOFA 1R8CA 2ZC2A 3V6JA 4P52A 5DG9A 3T1HF 1TP7A 3HBLA 2DPUA 3LAKA 3GWCA 3P5JA 1HF0A 1B4AA 3KDNA 3LF0A 2LF8A 1FJLA 3ZO7A 1J27A 3G1LA 1T94A 4NA3A 3AJ2A 2Y1JA 5KG1A 2ASYA 1H7XA 2FNAA 5ETOA 3ABUA 2YSRA 1XR5A 2QL5B 1G59A 2D69A 4DUTA 2PI5A 5LM7E 3EETA 1G6BA 1FFGB 1YTYA 2AQEA 3GFZA 3SI8A 3BTJA 4PXBA 1KC8T 1VQ6I 1G8XA 1HFEL 1VQ8S 1OCCH 1TV6A 2CG4A 5F8GA 2W85A 2XF5A 4I7FA 5F8IA 5JR3A 3GZ5A 2UXCJ 1RBLA 4BYYA 3B8HA 1A0OB 2R4FA 1U25A 3K70C 2M0GB 1Z21A 3G9CA 3IBWA 1UJ8A 4X65J 1RACB 1IR0A 5JVTA 2ZBCA 3HB9A 4ZZLA 5KFCA 5HLIA 3PL8A 2WZ1A 3J80U 3EPIA 3WTUC 5KFDA 1ENHA 2PFBA 3HVAA 2XI2A 2ZJRF 3BTIA 4IG3A 2F3JA 4JI5J 2H5IB 4ZYAA 4J01A 2HQ3A 2DK5A 1ETOA 4OMFG 1NK6A 2E5GA 3KNGA 2K9MA 1PJ6A 3JTNA 2OP5A 3QQCD 2YPYA 4ANEA 3BSCA 3OSNA 3RRHA 2PI4A 1S57A 2XI3A 3BQYA 3A3OB 3AD8C 1T05A 1EETB 3TW6A 2D2WA 5E3AA 2H65B 3PNYA 3QRPA 4E7SA 3IR6B 2BY2A 2NZCA 1VQLI 4LIWA 3M32B 4KO0B 3DKYA 2D41A 4CO2A 1SANA 2LF7A 2MC3A 2YH0A 4OJHA 1SC1B 4KGVB 2NAZA 3GYGA 4CYUB 4TYBA 4LVOP 4CDIA 4ABZA 4OIOF 4Z7YA 1ZH5A 3S1TA 4CNZA 4NCAA 1UP1A 1YLXA 3K5OA 5CD4H 4QW9A 3W61A 1A6IA 1U8RA 4LF9F 4I1TA 4GO5X 2AV5A 2HVHA 1D9DA 4KN7X 2KVQE 2D74B 4AD9A 1HBOB 2GVDB 3DHXA 1VQKS 2CJJA 1WC1A 5DS9A 2Q8KA 4DSFA 1KEKA 1JKPC 3KLFB 2QO3A 3EDRB 3MMBB 5IT9Z 3C6UA 2IBKA 3QNWB 5BPIA 5IT3A 4OLPA 4QWCA 1S59A 3CUNA 5FJ8J 1T3NA 2V5HG 4OIPF 3A03A 1K61A 5HNHA 1DQ9A 2KZVA 2MQQA 1QO0D 4ANCA 3RU0A 2LKPA 1R6RA 4DL3A 2O03A 5F1JA 1APLC 1FEEA 3KIOA 4WJBA 2RREA 4F55A 4KIBA 3R7NB 5EUHA 4WU2A 4Q0BA 1D0XA 2XPUA 5JVHQ 4QWQA 3JSMA 3EUHA 3CCRS 1TL7A 4U0VA 4JBCA 1BQMB 3DNCA 2EIJH 4MLOA 2VFUA 2HDDA 4EYHB 2L0KA 2QFJA 1IN0A 2ZB9A 1S0VA 4YMEA 3LTOA 1WJFA 5KFAA 1YJ9I 2GV1A 4CCNA 2MHEA 2ADUA 3A8KA 3OTBA 2K9NA 4B9TA 2L9RA 5D78A 2M7BA 3BG3A 2ZJRQ 4FETA 4U88A 2FTRA 3CEDA 3JSBA 2HURA 3VZIA 1YITS 3RKWA 1S8NA 4ECUA 4CCMA 2MY7A 2KZGA 1SL2A 4DS5A 4YP3A 4KJIA 2R7DA 3BH7B 1P6RA 4J9LA 1JTXA 2PEXA 2F4VF 1X1BA 4X6AJ 1OYWA 1XMBA 1TL8A 3GZNB 4F4AA 5J4YA 4C3KA 4H4MB 2DT7B 2R7RA 2VA2A 5K1YA 4FHTA 1D9AA 3LA2A 2I5UA 3OS0A 2DW4A 1XSVA 4KDPA 4G6TB 4P73A 1WC5A 3E51A 4FISA 5HLTA 3IGNA 4U7DA 3W63A 4LF4J 4ALZA 3P7NA 3WTTC 2IRFG 4TV7A 5KFSA 3R4KA 3WHIA 1T0FC 1DLOA 4BL0B 4DR7J 2AMCB 5FKOA 4BQAA 2VN2A 4NLXA 2HVQA 3F0NA 4URQU 1R8HA 1X5SA 1FIPA 5HDGA 4ZK7M 4MTEA 3MVPA 2RD5C 5KFRA 4DOZA 2FD2A 1DTQB 3NNHA 4HW0A 5BQTA 2A2CA 3MMJA 2W00A 1P6TA 1RBAA 2MKJA 2EV5A 2HOEA 2K3PA 2UVUA 1WF2A 3MEEA 3BWGA 2ZITA 4ZDNA 1SAUA 1HNZF 4QJVA 5LBQA 1RQ0A 2J0QD 3S2WA 2FJVA 2B9WA 3U1DA 3HHLC 3A3NB 1QBJA 2NVYJ 3FBIB 4F25A 4LFCJ 4XO0A 4ZVSB 3DU5A 4B4CA 4A4JA 2FBKA 2DCUB 2QYCA 2G0JA 3KK1B 1MBKA 4DGWB 5J40A 2OPQA 4M5LA 3CCVS 3KJVB 1TQMA 4JI6F 5HL7Q 3KHGA 4YFKF 1X5OA 4PWWA 3M8RA 3NL0A 4NUBA 4DL6A 2H94A 3WTYC 3VALA 1TTYA 1M90T 3COAC 4MGRA 4HH0A 1LWFA 2YQ0A 3OFFA 4DX8H 4LG0A 4CI0B 2HG4A 3W65A 3ZN1A 3F44A 4HYKA 4S0MA 2EZHA 3OY9A 1FRXA 3ENAA 1YHQI 4Q2LA 3PIOQ 2C1EB 3B4MA 4ID5B 5JHFA 2LEPA 2CFOA 1NSQA 5FB2A 3RBDA 4B3MF 5KFHA 2MKCA 3MUTP 3KK1A 2DA6A 3BTLA 3H0DA 4N4OB 2HIYA 2ZJQQ 2R9LA 1H0HB 2DIUA 2P9CA 4RAFA 3A4CA 4W92B 2LKSA 1Z1ZA 3HKZA 3VWBA 1DQAA 1X4PA 2L2OA 1D8ZA 5B0GA 3GU0A 3I54A 2GCFA 4A5NA 5T7LA 2YWWA 3G86A 5EWFA 2IS1A 1L3VA 1YIJS 4Q4ZF 3SDGA 4LK0F 4UF4A 2IGKA 3HHHA 2C2DA 1IF1A 1KHVA 3NY0A 2KXNB 5GADJ 2HRUA 3CJKA 1Y1VJ 4PXEA 4QIFA 3ZC4A 3QYFA 5DCMB 3MDFA 2HLTA 3W3SA 2B6AA 3SCKE 4IR9A 2YU9J 2X1BA 1Z9CA 2XGDA 2P8IA 4PUOB 4E7LA 4ENKA 3EGVA 4B3TF 2HVEA 1R7JA 5H2FC 5FJ4A 3QO9B 1JXSA 4PG7A 2F2EA 2FJXA 2QGUA 4HF0A 6PAXA 2QF7A 2DD8S 1FWKA 4C2UA 5ICGA 1BQNA 3MECB 4LITA 3FDYA 2RU9A 3LOUA 2X0LA 3GYNA 4F0KA 1RC9A 2DRBA 3BB5A 5J1UA 3NAUA 3QSIA 3C46A 3KTQA 2Z5UA 3UE2A 1MZBA 1IXKA 2MFZA 1T9YA 4NASA 4ED6A 1VQPI 4KTQA 1MBHA 4JUZA 5MAOA 1PBAA 2VU5A 2R7WA 3W5ZA 2HHTA 4B9VA 5JUMA 5LMUJ 4LRAA 4M3GA 5K5QA 2DODA 1SKSA 5D0RA 1ZHFA 3MFIA 4IQ4A 3CC2I 4KBIA 3EUHC 2MJUA 1KZHA 4YEAA 1PUEE 3QFHA 3DI6B 3M9AA 3PW7A 1HARA 1NDKA 4UQTA 1MDMB 1UL3A 4ZN3A 2XROA 2Q6CA 1DHMA 4QPXA 3CWJA 1HHQA 5GMKa 4DV5F 2BUNA 4NLSA 2O9LA 1QAXA 4GFBA 3AD7C 1K6OA 1T7PA 2DR9A 1DFDA 2XAJA 2IS6A 5D6EA 3PJXA 4XICA 3N5FA 1GQEA 2EFVA 4P2FA 2CUEA 3JRBA 2RQPA 4E98A 4Z7CA 5C2CA 5ICEA 3P5TL 4HHJA 3MQ0A 1MJAA 3E01B 1RT3B 4IOAF 4V2FA 1HMVB 2DA2A 4IX7A 3CCSI 1O3SA 4LLNA 3GIKA 2JVHA 2WW8A 3TYTA 4LFBF 3C14A 2E44A 5FGMA 5KOXA 2V9KA 1QVGR 4NA1A 1U2FA 1UA0A 2AS5F 3AKZA 3LPEA 2NLWA 2KFYA 4EM1A 2F8MA 3H8YA 2ZJ2A 2ZUGA 2MMYA 4DJBA 3N6LA 1ORKA 3I5CA 4X4QA 5CYQA 4HACB 2XSJA 3IHUA 3ITHB 1S1XB 3GFJA 2M8GX 3DI6A 3SCIE 2JSXA 3TJAA 2MTLA 4A47A 3CF5F 1RAHB 4AXJA 2H5EA 5FRMA 1ZAXA 4CCHA 2ASLA 5D4RA 5IM0A 3BY6A 1KQKA 4E7ZA 1N77A 1HWKA 3RR7A 5AXKA 2GW8A 3IM8A 2XS7A 1TKXB 2XAGA 4KR0B 1POGA 4HQEA 1ZR2A 1SJ1A 5M5XJ 3GZ7A 3GCXP 2XV4S 3ZP5A 3VGUA 2X6YA 4M5KA 3EX7B 3FKJA 1Z2LA 2O66A 4XLHA 2FHOB 1YX2A 3OL9A 3TDZC 4MK8A 1N0VC 3M07A 4F2RA 1Z1DA 5EG0B 4ZYEA 1U0JA 3FSIA 2YNGA 4LMZA 2H6BA 2R3VA 3TJ8A 1U2WA 1LUJB 4C9YA 3FSXA 4TNOA 3VZHA 2ZVIA 2FXAA 1ODDA 4IRKA 5IV3A 3BJ6A 3M8JA 4UOCA 3CO7C 2KHCA 3TUZC 4DJAA 1VRUA 3OFEA 4LRBA 4BDYA 3GPAA 2LDYA 4BBRJ 4OI2A 3KP4A 2CYYA 2LD5A 2PEBA 4XAKA 1O8BA 1PYSB 4Q8FA 2VKHA 2IJFA 2OI2A 1K73T 2O5DA 4PJMA 4ZVTB 4C3IJ 5G4DA 3V6HA 2NNNA 2NOJB 1J0RA 1IBLJ 4XOTA 4B3AA 3QAHA 3DHWC 4HHUA 2AEJA 2ASJA 3CCUS 1HNIA 1MW7A 1TBXA 3FQLA 5D15A 4ZYDA 1YSJA 5FKKA 2J9DE 1SJ4P 1OQYA 2GXAA 3DBRB 3R0AA 2VPLA 4EBDA 1LFBA 2P5KA 1S1UB 4USVA 4NCGB 2C2KB 4LRFA 2RRNA 2VASA 1VISA 3I4HX 2CQ4A 3DM2B 1I6HJ 4G1IA 2RF2A 4XLEA 4A3DJ 1MMLA 3M30A 2EWNA 1JT0A 3F22A 3GBGA 3T3FA 4Y65A 4NZ7A 3OHAA 2VH7A 3D66A 3KUGA 5DM6Q 5KFPA 2QQBA 3D6HB 2B8PA 5AXMA 2MZ1A 3FEYB 4F4YA 4ZVQB 4XDCA 2XMMA 1HOMA 1M5HA 4H54A 4OHWA 2CQKA 3AB4B 1Z3XA 1U5TA 1S6LA 4ZKAA 4NDLA 2WVBA 1ZM3A 4RU2A 2G1DA 2XGXA 4KA4A 2M4MA 1Z91A 1SUQB 4PFOA 1TL3A 1HBUA 2H27A 2NQPA 1H2TZ 5DDGA 3QGGA 3BO3A 4OYIA 3DYAA 3IRRA 2OD6A 1PBUA 4R8HA 4Y6IA 3NAIA 4MEXF 2FRHA 2VXDA 3M8EA 5GAGI 4MKYA 4HT5A 2CUFA 2HWIA 4N41A 4CCJA 3R1LA 4KMUX 3HD1A 2ECBA 2KM8B 3GZ6A 2XYGB 3VF0B 1V5FA 2WWYA 1NM2A 2XLJA 4TU7A 1IKYB 5E3RA 2ZKUA 1NK5A 4GKJJ 2XMUA 1RTIA 1O0PA 2ZD1B 3DBLB 5HP1A 1OQ6A 2AJ2A 1UVIA 1Y8RB 1TUGB 4F4WA 3W9IA 1V5IB 4EBCA 3CDUA 1RU2A 1FTCA 5CVUA 4LF4F 4NBQA 7FDRA 5BS6A 3H92A 3OS2A 3GV8B 2ACMA 2ZKTA 4HSRA 1U1PA 4C98A 1J2XA 2NVUB 3TUIC 1IXRC 4KUMA 2VL1A 1QE1A 2PLYA 5K7FA 4M9XA 5D8HB 3OR1B 2R2UA 4ZVEA 4JX6A 5T41A 4Q47A 4D7NA 1SB6A 3T5LA 4OMYA 4C0BA 3TDUC 2CVIA 3NQOA 4WZQA 1X7VA 2DGVA 4L74A 3K2YA 1XN9A 4OFZA 4GKKF 2MZQA 1IDZA 2UUZA 3DOMB 1CSJA 5DDPC 2I5JB 5CVRA 5E79C 2QLFB 4EBEA 1IG7A 3H5YA 3HPHA 2DCEA 1HNXJ 3BDEA 3UDCA 2HS0A 3RPQA 3BT9A 1KLNA 2I2YA 4DN9A 1V3RA 1QGPA 2D9OA 2B6AB 3PVXA 3L7PA 4IQXA 2OCEA 3D5LA 4KFBB 1F5AA 4ETZA 2A6EF 4I2QB 5CZVA 3G82A 2O67A 1ZR4A 4JI8J 1VQOS 3A0BC 4J37A 3NOGA 4XLPF 3TEHB 3PUFA 2R7ZJ 2UZKA 5H1SV 3NWGA 3T6JA 4IHXA 1KGSA 3J7AN 3O5TB 4D3HA 1S7EA 1Q1VA 3DPTA 1DAXA 3PEJA 3OD2A 2LBFB 2BHZA 4WYLA 2M52A 3EGNA 1Q95G 3HZGA 3BQ2A 4LQ3A 1TKZB 4O5VA 4IR1A 2LVWA 3L7OA 3GIMA 3I9V9 2KN4A 1YX3A 3PNIA 2WAFA 3D3CJ 1FJEB 3BP8A 1QE1B 3T5HA 1NPKA 1STZA 4BWMA 3CMES 3V8KA 1BL0A 2BKPA 2QLJB 3VYUB 3K4BA 1JHHA 2P0WA 3ELKA 4OX9J 1S49A 4G8XA 5EDNA 1FT8A 3IKTA 3VQTA 4I67A 1CBKA 5B5EC 2QBYB 2HNZA 2V2KA 5GAHI 1TWHJ 1P27B 5IT9U 2DR7A 2CW7A 1X19A 4KV8B 3EJMA 3PKMA 3M6VA 4DR7F 1BC7C 1O7FA 1JI8A 3E5UA 3LSRA 5LMUF 2V9VA 5EX3A 2EV0A 1NXIA 4M9SA 1RCXB 2CVEA 2Z57B 4OZ1A 3OIPA 4S0HB 1XPXA 2D1CA 4EMSA 4NRUA 1W7PB 4BY7J 3CC4I 1UKUA 1X4DA 5F9LA 3F8NA 4UOGA 1Q1HA 1LOUA 3UDLA 2IW5A 3PM9A 4DYQA 4HTIA 3WTVC 1IQZA 3H0PA 2DHGA 3MMAA 2ZXHA 1SFKA 3CJ0A 5CYJA 4FKYA 1RB0A 2VJVA 2R2SA 4KHPJ 3P9KA 2XZTB 4HX7A 1BI3A 5J1YA 2XYHB 5LRRA 3I3LA 2FVRA 3THTA 2CWKA 3MFHA 5F6FA 4JV5F 1AW0A 2LP4A 2HKXA 4WXWA 1SEUA 4NYPA 3GUDA 3KP6A 2CNNB 4RWXA 4RJVA 2VQEF 3R6LB 3LWMA 3FXLA 2J9DA 3HOVJ 3KP5A 4BQOA 3GIJA 2YPRA 5K14A 3DKWA 3DLLF 4AE5A 2QRRA 1IBCB 2ESHA 4Y3CA 4CO4A 2XDVA 4YB5A 2HHQA 3HOTA 5KT4A 4K4YA 2QJ3A 2VUGA 3EVMA 4PKDB 4V1Ak 2W7OA 3QIPA 3OYIA 4OAYA 3E6DA 2ZH4A 2B4PA 5HJXA 4CA0A 4ILMA 2E1NA 2CJBA 2VKEA 3M2VB 3DLJA 3AFHA 1FRMA 2CPFA 4R8UA 2EB7A 4JQFA 3MKYB 4D3GA 2AYBA 3RPUA 2CRGA 3JS9A 2KZZA 4YB1P 1SD4A 3J7Z5 1UCRA 1S29A 5DCFA 2L02A 2H8WA 1KU7A 4WFZA 5D0EA 1TMMA 2CQ2A 1WEZA 4LIVA 4XRSA 3ISZA 4GDFA 2HHVA 2JRMA 3OWTA 3MMAB 2FHJA 3HFVA 3PIPQ 2VDIA 2P6SA 3CJRB 2OGUA 1REGX 3M8QB 1KQGB 2RHSB 3MCMA 1PC5A 3RBZA 3KZYA 1VQYA 4LD5A 1QZEA 1ONVA 3TZWA 1U2CA 3WC2A 1K83J 3OYCA 3CUQB 3RRGA 2ZMEC 4C3MA 1L3KA 1WH5A 4RBTA 3VYRB 4LGWA 3EGZA 1FHTA 3ABLH 5MLCV 2DNYA 2MZJA 5M5YJ 2E29A 4DX7A 3GCMA 4F52A 4E7HA 2ZZTA 3PQJA 2VQHA 2KP6A 2CQXA 2JSCA 2OTJI 3F72A 5J47A 2YU3A 2E7WA 5KFGA 3G8SA 4ZVGA 2OUGA 3DRPA 1U78A 4ED0A 3DCFA 4X4RA 2AEFA 1SIZA 4C8LA 4U7UK 5HVHA 3N28A 1SIWB 2KJWA 2VI6A 1OISA 3DDNA 1IR2A 3K5MA 2W24A 3HM5A 4NNJA 3WDOA 3QT5A 2MQMA 5LLQA 2E1CA 4GGGA 4PXCA 4AQYJ 5KT3A 2KVIA 4DR6J 5FKNA 3QPTA 2OMLA 3V8LA 2L7ZA 1RT4B 4EGZA 1S0OA 2MQOA 4PCQA 5ETPA 2QLWA 1VQLS 2AX0A 3K17A 3ICLA 3FGVA 3GX4X 2XKOA 1EA3A 4AUKA 3EUNA 1DPRA 2UXDF 1CF7B 2YWFA 5A0YA 5DDQC 2BY0A 3I58A 2A10A 2FVSA 1F5TA 1ZREA 5HLHA 3BG5A 4PDKA 2HK2A 5HMXA 1K0TA 4IG0A 4JI4F 3AQOA 3HUGB 3RQ4A 3MPVA 4ZJLA 3ZQQA 3RZDJ 2NPIA 3DBHB 2VUMJ 3VYSB 5E17F 5HDNA 1BOAA 4CLFA 2CFXA 1F3VA 2W2PP 2HBRB 2K7KA 4CZCA 2CJAA 2FQ4A 1DURA 2KG0A 2OZUA 4UUSA 3DFEA 4WZMA 4ELUA 2FMLA 2XMKA 2A0FB 4DUZJ 2OFGX 1V54H 3QWUA 3BYRA 3A2KA 1BI1A 1YJNI 1FJ7A 1DU0A 3CCWA 1G3WA 1YITI 2IC3B 2WADA 5DG8A 3OTEA 1ZN2A 2BYVE 2NNYA 2VHGA 5LHIA 1VI7A 3PRBA 4U67Q 2QYGA 1YOVB 3HFKA 5F9NA 4RUCA 4K4VA 3FMSA 2YWEA 3GV5B 1LEAA 3JAMZ 1S6QB 3MAJA 1H0MA 1NHUA 3MMCA 2XYPB 1HMVA 5L3BA 5KFQA 3ZMVA 4CLUA 4IH7A 5EGOB 1NH3A 3H3UA 2WCXA 2AD9A 2W9CA 4DPWA 4ZJZA 1RJJA 1N6QB 1OYEA 4KFBA 4II2A 3NCQA 1K7AA 1U26A 1M5OC 3ILJA 2HHSA 1W0TA 4XKVA 3T5JA 2HGNA 3ZQGA 1YS7A 4RNHA 1D09B 1NK4A 2I8EA 2KQRA 3MM5A 4A5MA 1W7WA 4X4UA 1PJ7A 3M9OB 2QQ9A 4WE1A 2C2OB 3KJQB 5ETKA 4ES3A 4R79A 3CCMS 3CVKA 1OIAA 1A5JA 3W62A 5THWA 4DV0J 2OTLS 5HSPA 1FO1A 4UOFA 4DV4F 2KKHA 3MTKA 1HI0P 1MN9A 5ED4A 2PMUA 3UD5A 4PGGA 5HS9A 5DS7A 3OLAA 4DSJA 5IT9Y 2JSPA 2X3DA 4Q43A 1XMOJ 1N5YA 2EFGA 4LF7J 3OMYA 3TA2A 1Q4RA 4ECYA 2HAFA 1R0AA 1WELA 3KUHA 1JT6A 4WXOA 5BYQA 5HATA 2FC9A 4ZDOA 3MD2A 2IPOB 4Y2AA 2H5JB 2VG5A 4AQYF 3HOSA 2E1OA 2YNGB 1D8JA 1Z6TA 4MAKA 1WHWA 2HR3A 3MMYB 1Y7PA 2VIHA 4KIGA 1C1BB 2H48B 4BC7A 5D3GB 3BS9A 1MN7A 5B7WA 3DWLE 1FIAA 1KU3A 5JI6A 1UEVA 2BANA 4WFBQ 1EH8A 3D5RC 1VJWA 1HXDA 5TJJA 1LB2A 4AD6A 1PAEX 3S3MA 4C0OC 2CQGA 1B7FA 5EWGA 4CO8A 1RE1B 2EZLA 4BACA 2OPPB 3LSJA 2ZEJA 2E9ZA 4M6YA 4RGUA 4O4RA 4A3EJ 2DMPA 1TLHB 2GQCA 5EYRA 2QA4I 2AX1A 1P7JA 4XL9A 1YRNB 1T3OA 3S16J 2VE9A 3GJRB 5E2QA 4OI4A 2FY8A 1S76D 1JMTA 1IWAA 3CDHA 1JJ2R 3F6VA 3LL7A 1FLIA 5L9NA 4ETSA 5E8IA 2X6XA 2UV8A 5FD6A 4GRSA 4HL9A 2CPIA 2BE5F 4B08A 4M72A 4L6V3 4DCPB 4TYAA 5DQIA 1OPCA 1SJRA 1YJRA 2AKWB 3PO2J 1XERA 2DNKA 4MIBA 1IBMJ 3AH6A 4IFYB 5ERIA 3WC0A 3VVUA 1T9UA 4RLFA 3DRYA 1HNVA 3IWZA 4HVZA 3TZZA 4D9JA 1UW9A 3A01B 2E34A 5AXLA 2XF6A 3IRXA 1FNNA 3ISPA 2E66A 2Z8QA 4C4WA 3SBMA 1L5UA 4I4BA 2HQIA 1YK9A 1NCLA 4DPOA 1UMQA 3S14J 1HWJA 4OJ3A 3Q0WA 2HZAA 4KHRA 5E3LA 2ATLA 2B5JA 4DF8A 3RG6A 2XSDC 3M6XA 3I6PA 2K3KA 1W5CC 3HJVA 3OUYA 3N79A 3JRCA 1RTJB 5KVRA 2DA3A 3EXYA 5RUBA 4QIEA 1X3ZB 5GAEJ 1HBOA 5CCMA 2N82B 4NLRA 1RBOB 2UXXA 1AXQA 2WY8Q 3SSSA 4M5DA 4LG3A 4D0PA 4XKWA 1J7KA 4OIRF 1OCTC 4EWTA 1W36D 5EX0A 3MHYA 1P9QC 2BVLA 5EZGA 1VGYA 4OYMA 1MD0A 1XGMA 1F9HA 3WHCA 2ERRA 4NCBA 2QX0A 2BQUA 2DDAA 4XKBA 3WGGA 2LRDA 2DGTA 5BNGA 1SKWA 2KH9A 3JSYA 1M1HA 2Q0OA 2M3AA 2E1AA 3QLHA 1KFSA 1FD2A 2HRTA 1ZAVA 1CGPA 2UXNA 5D8LB 5AJ3J 3IFEA 1H9GA 3OL7A 4FS2A 1Y00A 1YQHA 2KZMA 2DNZA 3TMOA 3GFYA 4I6ZA 2Y3YA 3JSOA 4YFXF 1NKCA 5BYRA 4QWEA 1RXOB 4KGZB 1B1BA 3J7YJ 3W60A 2I9SA 1KU9A 2F4OB 2A6MA 4I56A 4ITVA 4MFEA 2G2ZA 1N0UA 1JLFA 4ZVOB 1WZ2A 4K7QA 1NJYA 2XPWA 1BW5A 5A8RB 2RDJA 2DHAA 3BYPA 4KN4X 2QMUB 3AQPA 4MK7A 4M5DB 2M70A 1S97A 5EJCA 2ELHA 1P1TA 2K40A 4USWA 1GK8A 2KTQA 3CD7A 1R23A 3K4LA 3BR1A 4RW4B 1F2HA 5ADZA 2V1DA 4KC5A 4KSEB 2JVOA 1YW9A 4FE7A 1Y1WJ 6AT1B 4P71A 3H5XA 1URRA 3O8GA 3UDEA 3D0IE 1YJNS 3QP6A 3ABMH 4JYAJ 5GPAA 2AZ1A 3G6EI 2VFVA 2NOGA 1O6XA 2NXUA 1REVB 4WFYA 4A3CJ 2MH9A 2Y9ZA 4ZJOA 2CDRB 1Z4UA 3GG0A 4GKKJ 1M1GA 4EYIB 4TKTA 4Y4RA 1I50J 4AL5A 4DV1F 4MNUA 3D67A 1QRYA 2IA6A 1YJTA 1KQ0A 2N7YA 2V8DA 3MR7A 1S1WB 1A9NB 2I10A 1DTTB 3MECA 1NJXA 1LPQA 3RTVA 5IYDJ 2BW3A 4NMLA 4DV3F 4B3XA 3BR8A 1UFWA 1LQ9A 1DUXC 4K4UA 1LE8A 3QODA 3THPA 2X7IA 2OPTA 1O3QA 3KLOA 3KLIB 2Z4PA 2K06A 1S7IA 1F6TA 2M9KA 3FXOA 2V68A 4DSIA 4LSLB 1K9MT 2FVQA 2Y0SD 4EO8A 8RUCA 1XMXA 3TW7A 3BR3A 1PO6A 2PT0A 4NLPA 4DV7F 1ZETA 2EZIA 3MGJA 1VS3A 4TY9A 1ETXA 3CP2A 2OPRB 2KISA 3AXKA 4Y2IA 2FQ3A 1Y10A 4L73A 5A8WA 2K7LA 4V2GA 4KPCA 4ZPCA 2R0QC 2BOPA 1EB0A 2FE3A 4GMKA 4PG5A 4RB3C 2ZH5A 4CYCA 4HYEA 2XLIA 3MPWA 1F2GA 3QIPB 2PSZA 4J7CA 4UZBA 1RRJA 3TJ9A 3G96A 1TELA 2DGXA 2XBPA 4OLOA 3GTJJ 1HW8A 2NXEA 1LW2B 2CMPA 1G1XA 4MHGA 2GXGA 1XR7A 1JB0C 3OLBA 2BANB 2KJBA 3D1HA 4ZPTR 3BJYA 2UU9F 2ZOMA 1AKHA 5D5WB 5ICCA 5B1AH 4M73A 4BJ5C 1VZ0A 4O3QA 5FFZA 1PAUB 5DD8A 3OYGA 4DYCA 3HOZJ 4ATNA 5GVQA 5EN1A 3HXMA 4E7KA 4FS1A 3M8YA 2M8EA 3WTXC 4JI7F 2IA2A 1LFUP 2Q6BA 1OPIA 4OIQF 4IHVA 2C2ZB 1F60B 3T5KA 3VGVA 3K7AJ 3BM7A 2ECCA 4DW6A 4OYZA 4HAMA 1GV2A 4P2XA 3BR6A 2KPMA 4YEJA 1UAWA 3KOAA 4LLGF 2BJEA 3QT8A 2K9LA 4XKCA 3CF5Q 3EPGA 4FKXA 5E3QA 1WF1A 1RUOA 3HJFA 3KE2A 3BDDA 3PDNA 4M5GA 4O44B 1D1UA 4OHZA 4Y52J 2KT3A 3IUOA 1JJHA 1VDHA 1A35A 1VMBA 1UVKA 1F5CA 5HQ8A 2MGZB 1Q86T 1CC7A 2V26A 3L09A 1ZG1A 1HC8A 2ZH6A 1QSYA 3MAAA 2VD3A 4RNFA 3DMJA 2X1AA 2E35A 4X64F 1IJWC 4IKFA 1SBRA 1CG2A 3OR2C 1O4XA 5LGUA 2RQMA 1CS4B 2HK3A 3KXDA 2ZH7A 5CVJA 3ZRGA 2DXFA 1ITPA 2B5JB 4GXOA 2DNOA 2HNYB 1IKWB 5LEJA 4I68A 4LK1F 2Z2SB 2CZ9A 4BJ6C 5KFLA 4ESJA 3J7AY 3OR2B 1SVOA 4RGSA 1U6ZA 3VDXA 3LAJA 2XAHA 2B7EA 2XWXA 3MM9A 4Y13A 1NJZA 1QA6A 3GVAA 2V8HA 2YKNB 2EEYA 4R0EA 1DU6A 3HUGA 2FC8A 3MM5B 2E7XA 3KLGB 1GVDA 3CCUI 4RU9A 3TOAA 5A76A 4NYZA 3T6BA 4CH7A 4OZ5A 3SZPA 4WBFA 3AFGA 3MR6A 3CW2C 2L4MA 2OQGA 2DNNA 1R4MB 1TK0A 4FF3A 2PJPA 1ZS6A 2GHWA 2DAOA 3ZTOA 4CLKA 4I02A 1K78A 2XAQA 3ZZTA 2KKOA 4G7ZF 2VQGA 2WV0A 2LFVA 1LEOA 4Y15A 2YX7A 1LJ9A 5LGTA 1OO0B 4FYXB 1ZBTA 1PILA 5CPRB 1VBYA 4LF7F 1RT1B 4FVMA 2N3OA 5C7PA 4DL5A 2DYRH 3AXMA 3D1NI 2RKIB 3KK2B 4OJGA 1XSDA 4D1QA 3Q8QB 2GQQA 2AT1B 2GHVC 3M2RB 4O23A 3ZR8X 3J7ZT 3M2VA 3C15B 1MNMC 3SEZA 1EV7A 3MD1A 1UHWA 4FASD 5HMWA 3TOBA 2H1KA 5A8RA 1N32F 1UWBB 1ZYQA 4BBYA 4P5OA 1RETA 3WX4A 4CO3A 4PWDA 1NSKL 5AIQA 2SXLA 3BR2A 4ESBA 4LF8J 2VQCA 4LOCA 1SD5A 3WZ0A 1SQFA 4CLPA 1YIJI 2HAIA 2VT3A 1G3TA 2K2PA 2FJDB 2LG4A 5D4OA 1D9FA 1ZARA 4U8VA 4AVZA 3Q0VA 2PA3A 5J2QA 1H6KX 2WONA 2K9SA 2DHXA 2HPMA 2XO6A 3RBEA 2DJNA 2MDAA 2CNLB 3HSJA 4P9UA 2ADCA 4IH6A 2R7OA 1W25A 3SQGB 1FI4A 2R7QA 4DCOB 5M3FJ 3G6VA 4FVCA 4USHA 1CJKB 5KG7A 2NS8A 5F8HA 5D4NA 2ZBIA 1U0HB 1RWPB 2DIVA 4JI3J 4FXVA 1WJEA 4JV0A 5AT1B 4EO6A 2KHMA 2JUCA 1S1WA 2AU0A 2FY1A 4BS9A 3H7HB 2GOXB 2ME0A 1NHAA 1SFEA 4C8NA 2MEWA 3QRQA 2C2NA 2RUGA 4JI2F 2DJWA 3AB2B 2LXIA 3SEOA 3H5UA 2HWTA 3EYZA 1U02A 1RR7A 5IYBJ 5CKTA 2BBEA 3AOBA 2LEBA 1LXJA 5IT0A 3K4CA 1UPPA 5U47A 1KQ8A 4DLGA 3PJ9A 3S3OA 1K1QA 1FK9A 4A3FJ 4OYXA 5FO5A 2BVZA 1BI2A 3QAUA 1FKAF 2UUAF 2HKOA 2GFFA 1XD7A 2MSYA 1BLUA 3EZ5A 4LB5A 2AEMA 1KOOA 3HHLD 2HHPA 4F92B 2DFEA 3BH6B 1HQCA 2GAHC 4R0JA 1FNXH 5C42A 3ISNC 3FXRA 2ZHAA 4R5PB 2HI3A 4ECZA 1SMTA 3QZ7A 4DR6F 1MBFA 1XC9A 2HQGA 3BN4A 2UVRA 3HPOA 4F7VA 3GLXA 1KDNA 5KG2A 4CO1A 5C4XJ 1WHXA 1A6LA 4ASNA 2FOKA 3K1NA 3RUBL 3PUBA 3DLHA 2L9VA 4EV0A 4IUFA 2VPZB 1JX4A 3LP2B 4JP8A 3MPUB 4LFAJ 3QGHA 1ULYA 4N76A 2KIQA 4NLGA 1DBDA 2EKNA 5ETQA 1M5KC 2COLA 3FVYA 2XSJC 4I64A 1ZTTA 2X1EA 2NS1B 1V55H 4CM0A 3E5QA 1WTFA 4YUDA 5J1EB 2RNGA 4KGXB 5HI7A 1MBEA 3LP1A 3A01A 5DCMA 2V1NA 2N4CA 2VF3A 4XIUA 1ZELA 1E3HA 2RNJA 3I4NJ 2BJDA 3BOQA 4OI6A 2CV2A 3J7ZI 2QSGX 3HF5A 1JLAB 2W2OP 1W1WE 3QGPA 3JAMY 4MFDA 1HDDC 1IC8A 4ELTA 3C19A 2IM1A 3DLLQ 3LP0B 4ZP6A 4E7IA 2D7SA 3BR0A 5BR8F 1GXQA 5B0EA 1DQ8A 4RAYA 1LK5A 2ZXJA 2XSFA 3HULA 1D8KA 2G0CA 2QEXS 3OV8A 3CJ5A 1T02A 4Q2MA 2HFHA 3PW2A 1TZLA 4MFBB 3G71I 1AA7A 4WE1B 3Q8YA 1NPPA 1HNIB 3CCVI 3D6TB 2A5WA 4P55A 4CIOA 4DR4J 4XM3A 3L2WA 3QJJA 1JUSA 2MD5A 5D6GA 1K44A 2IFXA 5ITHA 3I0SB 3GEZA 3F21A 5FDLB 3R27A 2DT6A 3QPIA 2COMA 4XRSG 5CD4A 3T9ZA 4KKOB 1RGVA 3HT3A 2AXTC 1XNQJ 4O3NA 4RLEA 1I94J 1P7IA 4HDHA 1IQTA 1FP2A 2ZFUA 3J81j 2MQ8A 2EILH 1LNQA 3BGRB 1GTEA 1UG0A 5F08A 3IWNC 4PZJA 2RQKA 4OHXA 3BQ1A 3FK6A 1HYSA 4CLWA 3ZGKA 3I53A 2D5VA 4ICLA 5CCLA 2LK2A 2HNDB 2HXIA 1FP1D 3UVJB 4E4HA 1IW7F 3PYGA 4KQZA 2CQBA 2CPJA 4YRVA 1X58A 3QT6A 3KLGA 3F6OA 1FDNA 1X31C 3HYIA 1WVRA 3Q23A 3M8QA 4M95A 2XPVA 1Z3YA 2WB1D 2DGQA 1XTAA 4WP3A 4WFXA 5C3EJ 4PJ0C 1ON2A 4PQUA 1USSA 3G6YA 2EFWA 2PO4A 2M8HA 2QA4G 4H4MA 3CUOA 1XC5A 2IM3A 5A8WB 5SUHA 1E6YB 3TR5A 3MPDA 4EEFG 2G2OA 2GGPA 2PJRB 2XMWA 3LMMA 2XSJB 4GC6A 5LD2C 3ZTPA 2Z2YB 2MZSA 5K5RA 4ZCIA 3FBCA 3HGYA 3US5A 5E18F 2OZ6A 2R5ZA 3RB4A 1QAIA 3TEDA 1VHFA 2V9WA 4E0DA 4O6JA 2RGVA 2QT7A 3P96A 4U96A 5KG0A 2XF7A 1RKTA 2UUBJ 3OTOF 3NWSA 1K78B 3BGRA 3RB6A 3CTAA 3L7WA 4USUA 1RR8C 1KOHA 4LIUA 1HKAA 5DZ7A 1FOWA 4CNYA 2G2YA 1U1KA 2UVVA 1Q7YT 5JHUA 5CQGA 2BJ9A 2JRSA 1GV5A 2BEFA 5J2PB 1EP4A 1NDLA 1ZRDA 1MMDA 3LANA 3DRSA 3I5UA 1JLGB 1T9WA 1XEZA 4RGRA 3I87A 2OJ3A 1PJ5A 2KIUA 4J9RA 2D45A 2MLKA 2ALZA 4CLLA 5F8NA 3EZUA 5GAGJ 1T11A 3CMAI 3BDPA 2ROGA 5KOWA 1AKHB 2FVPA 2HVSA 3W6JB 2GA1A 1S5LC 3HHLA 3CD6I 3LNQA 1E3OC 1FNMA 1HKTA 2GJ2A 2J0WA 2ZWPA 3BREA 3QIDA 4M74A 2CV0A 1FXDA 4NI2A 4L5IA 4TLQA 3DM2A 3PQKA 2E5ZA 2FLOA 1OY8A 1PG5B 1IBKJ 4URGA 3EM1A 3HZJA 2MQPA 4JI7J 2W48A 1OPZA 3NGDA 4P74A 3DQVC 3OSPA 3PSIA 5HS8A 1Y39A 1G2EA 2PMWA 1FC3A 1XG1A 3MUMP 3K57A 1SL0A 4EU0A 4J91A 4W1UA 2B9YA 5CQEA 3M2UA 5B0FA 4BE1A 2HW3A 1B6AA 2YS9A 2DNPA 3Q83A 2JVRA 4JV1A 4IO9F 3N9UC 3BSAA 3MCNA 4L72B 1N5VA 4CYCB 5A2QY 1MNEA 2HOTA 1MROB 5C25A 3HCXA 1ZK8A 5I42A 1KS2A 1LDKB 2IS2A 2HOAA 3BCAA 4O0IA 2ZXIA 1JLGA 2DO4A 5F0WA 4QPTA 2I6WA 2GQ2A 5EGYA 1U5TB 2FU4A 3NP5A 2DKOB 2Q3PA 1QSSA 2BGCA 1U1LA 1WJCA 1I6JA 3RR8A 3ZQIA 3PJWA 4RO0A 1X1AA 2X6WA 4EEYA 3UNGC 2OKQA 1KNZA 2JQ7A 3VR1A 3JQKA 3TQEA 4IF4A 3D7SB 2DHSA 1DJ0A 1HBNA 3ZOBA 1N6QA 2MKYA 4P9SA 3KDOA 4NRTA 3GILA 2YKNA 1HHSA 2DU9A 2ZKZA 2DNRA 4IPAA 5K5MA 4B3RF 2J7WA 2Z30B 3EDPA 2RH3A 2JMWA 3OTOJ 4YHHF 3DXJF 4URSA 4F0MA 3X2QH 2QM3A 1HL6A 1MGTA 2M5YA 1WDTA 3T1HJ 1YW7A 4UY8T 2R92J 2OPQB 4PYDA 1J75A 4I76A 4M3FA 1RLCL 1B70B 4KY3A 4FCYA 1E0EA 4XSZF 1PSDA 4B43A 2BACA 3CJ8A 4ZVHA 5FLXU 1ZM2A 1R1TA 1Z67A 4WK1A 4RM2A 4TQRA 2KM8C 3OXGA 3AA8A 4WIQA 2R8KA 2KL8A 5IT4A 1NKBA 2PBIA 5DYMA 4U6PA 1KYWA 2MXYA 3POTB 1R7IA 4L9VA 3ZZUA 4MFBA 1S48A 2B7BB 5KFEA 2V94A 3E8OA 4XPCA 1EQMA 4MQVA 1F36A 4WXDA 5CYMA 4D7MA 1DGRM 3M32A 4KO0A 3H9QA 1MWQA 4G6VB 3LO3A 5E3PA 3K4NA 2B43A 3GSIA 1UVNA 3I55S