1LFPA

Crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
243
structure length
243
Chain Sequence
SHWAQIKHKKAKVDAQRGKLFSKLIREIIVATRLGGPNPEFNPRLRTAIEQAKKANMPWENIERAIKKGAGELEGEQFEEVIYEGYAPGGVAVMVLATTDNRNRTTSEVRHVFTKHGGNLGASGCVSYLFERKGYIEVPAKEVSEEELLEKAIEVGAEDVQPGEEVHIIYTVPEELYEVKENLEKLGVPIEKAQITWKPISTVQINDEETAQKVIKLLNALEELDDVQQVIANFEIPEEILQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of conserved hypothetical protein Aq1575 from Aquifex aeolicus.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Rna binding protein
molecule keywords Hypothetical protein AQ_1575
total genus 68
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2002-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01709 Transcrip_reg Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1lfpA01
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lfpA03
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lfpA02
1LFPA 1K6YA 1MW7A 3HPHA 1WJBA 3HPGA 4F3QA 1WJDA 1E0EA 3F9KA 1WJAA 1WJEA 1WJFA 1KONA 1WJCA
chains in the Genus database with same CATH superfamily
3MPYA 3RAXA 1DGRM 2XGCA 1BOBA 3P45B 1S1WB 2QQ8A 5K7ZA 2OZUA 5HDKA 5I4MA 2HQIA 3PV8A 5CXTA 2VA3A 1NK7A 1F2GA 3GCXP 2UUCF 3OL6A 4A0XA 4JI8F 4A8QA 3V8KA 2XB0X 4HSRA 5FLMJ 3M30B 1MMGA 3JTGA 3VYRB 1MDMA 5F1JA 5K1YA 1RTJA 1N56A 3OYLA 3ECHA 2KIFA 1UMQA 1AOYA 3AKZA 2QC3A 5K8NA 3DXJF 2O3FA 2XAFA 4XSXF 2VI6A 1LWCA 3JSRA 4IH7A 4CTAB 1Y9OA 5A8RA 3KLIB 1UAAA 3QO9A 4IH6A 4KO0B 3VVUA 1RDRA 3NRVA 4HF0A 5IQQA 2HVZA 4Y0FA 3A0HC 4DJBA 4IL6C 3H2VE 2DPJA 4UQTA 3N4WA 4EU0A 4NA3A 4RW7A 4CLKA 3HMJG 1HFEL 4Q48A 1IBKJ 2H4WB 4B3TF 2ZSHB 4DF8A 4J9OA 1QPMA 1K4SA 4LBPA 5DQGA 2ESNA 2HZCA 4WKRA 3HSDA 3I9V2 2YKMA 1TUVA 2EKNA 3H8YA 1XX5A 2A3JA 2HZVA 5KOXA 3VB2A 1Q81T 4C98A 1SFUA 3VYUB 2FRHA 4CSWA 5BR8J 1R0AA 3QZ7A 1M90T 4BAYA 3MM8A 3KLEB 2Y75A 1FXLA 5D4LA 4K4WA 2DHGA 4F91B 2CIMA 4RW4A 2MXYA 3NWSA 1FX2A 5CAAA 2Q0OA 3NCPA 2KT3A 4HX7A 2CQHA 2ZXWH 4ASNA 1QE1B 1EP4B 2ZJPF 3BSAA 3MFHA 4GKKF 3KG1A 4IG3B 3M2UA 4LFBF 4A3DJ 3CO7C 1HMVB 4BBSJ 1BR2A 3LGHA 4IRHA 3D0SA 4ATNA 3PDNA 3BBCA 1YQHA 1LWFA 4XRSA 1WSVA 5GAEI 5KT5A 4PXBA 5LJ3Y 1RAFB 1EH7A 1RTHB 2K3FA 5F0UA 5DRKA 1LKXA 2R2UA 4A2UA 1DPRA 3NY0A 2VD3A 4EEFG 1YHQS 1FT8A 4JQFA 1IKXB 1XCBA 1FD2A 3KLHA 3CDUA 3F72A 2E5LJ 1E6YA 4ETZA 3SFGA 3OVBA 3SHFA 2NZCA 5HSPA 2BDPA 2VKEA 1GMUA 1MBJA 4FETA 1L0OC 1WRJA 1QVUA 3BDDA 5C2CA 4DWIA 2XAHA 3GTOJ 1S6UA 2YQ3A 4R8UB 3J7ZI 4UT4A 1U1OA 3NOGA 1FKOA 4L73A 2P8TA 4OIOF 1S6PA 1U5TA 4A0ZA 4HT7A 4DV6J 4CNYA 3FBIB 2CW7A 4P96A 1HNWF 2XYPB 3GIMA 2EZLA 2G1DA 1JXVA 5HLIA 2YWGA 4DX8H 5KFNA 3FZVA 1HIYA 3DHXA 3FXOA 1Z21A 3MD2A 4MHGA 2CUZA 3CJQA 3W6VA 2IA0A 2K02A 1R7JA 2PMWA 3G4SI 1TNSA 1T9UA 2V1NA 1Y8QB 2IIHA 4DR7F 2AZ3A 4HZFA 3H42A 1RT6A 1N4LA 1TMJA 2G2OA 3HHEA 1M5PC 5FD6A 1U49A 2BHYA 4USVA 1WG5A 1NK5A 2V9PA 1KSPA 3OL9A 1W4MA 4HX8A 2CPZA 4IFYA 1RACB 1L3UA 2RDPA 4NX9A 1N33J 4GC7A 1FC3A 3LALA 1JKPC 2HHUA 2MW8A 3D5RC 2DAOA 2KU7A 2DGUA 3O5TB 3ZTRA 1RK8A 5GMEA 2R7WA 2I6WA 2IS4A 1IN0A 2GW8A 4AC0A 3GZ5A 1WJDA 1Q8BA 3DLAA 2ZXJA 3PM1A 3C19A 4K4TA 3SDGA 1HI0P 3FK6A 2HQFA 2CVIA 2QJ3A 2C2OB 3DGPA 3RTVA 3J80K 5F8GA 3K69A 3PFYA 3Q2SC 1TV6A 2GNKA 4QIWN 1F9NA 3K8VA 2LFBA 5FFZA 5D0GA 3DLEB 1AA7A 3B6AA 5F27A 3R5GA 4BEHB 2Z56B 4DV2F 1U0HA 3ZTSA 1AZSA 1H38A 2P9GA 2OPRA 1T7PA 4GKJJ 2R3SA 3JTNA 4ID8A 4A5NA 1S6PB 3MMCA 1VIXA 4QIEA 5C42A 1PIEA 2XGXA 4JOUA 1WHUA 1IZ1A 1Y6IA 4IG3A 1VQ5I 1YLFA 3HKZN 1FYMA 2HIQA 3KLNA 4K2XA 1YX3A 3RB4A 1UA1A 3LSPA 2WC2A 4KAIA 5GTIC 3OYGA 4O3MA 4HLYA 4FXWA 4N41A 5TRDA 1XK8A 3BGFA 5J2PB 4MKAA 2N8GA 3KIOA 1IUFA 2VDIA 1FTCA 2BBEA 3AD8C 3G6ES 4MYTA 1F9EB 2FUG2 2YS9A 1RA7A 4WE1A 5D4OA 3HX9A 3BG5A 3HXMA 2V4RA 1FJCA 3GYXB 1BY9A 4BC9A 2RMLA 2G7HA 4EJVA 3BR5A 2W9BA 5BJRA 3JR9A 5JVTA 2UP1A 2IRFG 3DTKA 1KOHA 4CZZA 1HNXJ 5ED4A 4ZJQA 4NA2A 3VVTA 2L0KA 3W5ZA 2Y8WA 3CT9A 3H9JA 3THTA 2MH9A 1T03A 4A3FJ 3QRQA 1FIPA 5LHHA 2COLA 5FJ4A 4PWWA 1IRXA 1T94A 3KMSA 1OPZA 3O2IA 1LQ1A 5ETKA 1S9EA 1U24A 1R1UA 5AT1B 3VFZA 3UQSA 3U1LA 1HWUA 1MJBA 2HNDB 3FXLA 4FF2A 1XBWA 1MNDA 5E5NA 3H5YA 3G82B 1EA3A 2JVOA 2L3MA 3OQ2A 2LY1A 3L3CA 2ASDA 4TN2A 1X0FA 3DDNA 4YG2F 1FLIA 2KM8C 3LP2B 3I4MJ 1BQXA 1PAUB 4ES1A 3GE9A 3BO2A 5J1PA 3CJ2A 1YJWS 2NOJB 1FDNA 2K9QA 3PRVA 3MOJB 4UV8A 2YPRA 4MEYF 2RNJA 1X2MA 4Y3CA 1RT1B 2KI2A 4O44B 3RJPA 2VFVA 2Z2ZA 3BREA 5DD8A 3TEHB 3IH4A 4ZP6A 1USTA 1R8AA 3ELKA 4DYQA 3N05A 3QGPA 3RI4A 1PC5A 3MMCB 1RCOB 3EJMA 3J7Z5 5A6PA 1FWZA 2WB1N 2I8EA 3GWCA 4J9SA 3GLLA 4K4VA 1ZN2A 3OV8A 1X4FA 1IUYA 1HBUB 2MJNA 4NC8A 2KN4A 3F56A 4B08A 4P72A 4BE1A 1MROA 3TRGA 4LFCF 3A12A 4BWMA 2R7XA 4B44A 4QU6A 5CYMB 1NK3P 1FOKA 3TUIC 5C7PA 1JLCA 4KFCA 2GIFA 2H48B 2XEXA 1RT5A 2VPWB 2L7KA 3O2PE 1OQ6A 2N7YA 4HAMA 4W98A 2AGPA 1OYIA 2JT1A 2ZMEB 3JRDA 1RTDB 4F8RA 1GAOA 5HBMA 3V2UC 2DHHA 2XPUA 5J2NA 3EUAA 2EA2A 3EVOA 2NXNA 2X1GA 2ZJRF 2MQMA 1HCRA 1BXNA 2L5QA 4UUSA 2CQKA 1FE0A 3K5PA 3IM8A 4JBAA 1UFWA 1DZ5A 2WCXA 2CQ0A 1JQGA 4LF8F 4UUTA 4LFUA 1YRNB 5E17F 5EX0A 5DDPC 2X0LA 3GO5A 3CLQA 1RZMA 4X4SA 1NKCA 1TLHB 5J1UA 3DTIA 1HWIA 3C8YA 3FBFA 5BS6A 2ACYA 5F64A 3GQCA 1YRNA 1R1VA 2VE8A 4IJAA 4OI6A 3P5JA 2D1CA 4G65A 1SV5A 3OWTA 2J5OA 3BG3A 4C97A 2L9WA 3L7UA 4PXDA 1MWZA 2A6HF 3DI6B 2JH3A 1XN7A 3I59B 1P9YA 2ASJA 4OJGA 4UOHA 2PGCA 2VKHA 4OI2A 4IHYA 1KDNA 2XUBA 2VQCA 1N33F 3EXCX 4IYQA 2R8HA 1XQIA 1HKAA 2XGQA 1UG2A 2YVSA 2EBGA 1BMQB 3WHIA 1M1EB 2DFEA 2BW2A 3JSYA 1ETQA 2GA1A 3HTUA 3KXDA 4GRIA 1JK9B 4DGWB 1K4TA 3JYTB 4EJWA 2K3KA 5A0YA 3R0AA 4IZZA 2DT5A 4ZCLA 1TWFJ 1I6XA 3CMAS 3HOSA 2BE5F 1P7IA 4PFOA 3TQNA 4FKYA 4OX6A 2ROPA 3MUTP 3C2BA 2BXJA 4KDPA 4OHWA 3EPZA 2XQCA 4KFBB 2ZH2A 5H9EK 4NLUA 2D69A 1Y5LB 4GVLA 2O01C 2F2EA 5EX3A 3HL2A 4IHXA 2Y3YA 5ILVA 1CF7A 1UPPA 1DTTA 4RS8A 5K8OA 1BOAA 2DA6A 1W25A 3BH6B 5ILSA 3N9UC 3CCMI 3MPWA 4CYDA 2B63J 1FESA 1OYEA 3KLVA 3HHKA 3G6VA 4NC7A 1LWFB 4OYAA 1F9FA 2MSTA 2DA3A 5D0HA 4RJVA 2F3JA 3LA2A 4C3HJ 2VKDA 3FSYA 3OFHA 3KYCB 5D8KB 4QIFA 1SFEA 4ZLLA 3C6UA 1APLC 2GGPA 3VGVA 3FJ2A 2FZGB 1X4AA 1VQLI 1HQEA 2RT3A 3CUQA 5LGUA 1R43A 5E1XA 2BV6A 5LGTA 3BT9A 2D3ZA 3FQLA 3A8KA 2KXFA 3M6UA 3C2GA 2Y9ZA 2J0SD 2VG6A 1B0PA 3HXLA 1DLOA 4JI5F 3I3LA 4USUA 5JMNA 4LSNA 2HHHJ 3BY6A 3UE2A 2YWFA 3HJEA 4K4UA 2PEXA 2CZVC 1VGYA 4PG6A 4ZOSA 4HW0A 3LPYA 4X65J 3OYFA 1W2IA 3WGHA 1UVMA 4PSXA 3IN5A 4K50A 4YIFA 2VBZA 1YRXA 5M3MJ 2IMWP 3HOTA 4WK8F 3S17J 4UVCA 5KFVA 1C2PA 1S57A 1FPQA 3OJSA 2K85A 4I98B 1H9GA 1DURA 4WIIA 1YJ9I 3MKLA 4O4GA 4DYCA 5BPIA 4GMKA 4IFVA 2YNIA 2ABYA 4I6WA 3AOAA 3QYFA 4NLXA 4DEZA 3BTLA 1REPC 3PVXA 3N0VA 1F3FA 3GV7B 5E79C 5IM0A 1W0TA 4Y28C 3G73A 4HDGA 4WTOB 1X4BA 2GIRA 5LMUJ 1VC0A 3OSPA 2C42A 2MSYA 5H6QA 4E0DA 4IOCF 4FYXB 3PXGa 2BE2B 2W9CA 5A2QZ 2NYXA 5ICFA 4LBHA 4AVPA 2ZH3A 1VRUA 1WJ5A 2MC3A 1KR4A 5LXRA 2IM0A 2IS2A 3NCQA 4LK1F 3OXLA 1Y1VJ 3MEXA 3Q9SA 1FNXH 4EGLA 4F3MA 5KNLA 4PG8A 2ZJQF 3M8WA 4A0YA 4F50A 2R4GA 1X1CA 4DU7A 1KTVA 3Q8RB 1R0CB 1TAQA 4Q43A 3F8NA 2XS7A 3DYAB 1U8WA 2GOXB 5KFRA 1RUOA 1UVLA 2Z2LA 1UVJA 3ZMZA 4OX9F 4O5VA 3B6CA 2HWTA 2G0EA 3Q22A 2F4VF 4DV0J 1YHQI 3DCFA 2MLGA 2NAZA 3KK2B 2Q43A 4ZJLA 4KV8B 3CTRA 4TLRA 5CYMA 3TZWA 2GV1A 1KQFB 1FOXA 2P9EA 3JRFA 1U1RA 3DOMA 3K9TA 3DQVC 3D1HA 1AW0A 4Y17A 5HBMB 2OMLA 5J4YA 2KRRA 1TT0A 3RYPA 3D28A 1R6RA 4PXCA 2ME6A 3MM7A 2HPMA 2CJBA 2PI0A 2R8IA 1EJ9A 1VDHA 3HCXA 3J7AY 4KHMA 3KZIC 3S3MA 4AUKA 3BPXA 4U0YA 1IBMF 5HN0A 2HNZA 5EDWA 2G7UA 2UUWA 5KG4A 4CIOA 2GLOA 5IV3A 3T0YA 2CDQA 1GMVA 4WXCA 4XLFA 1T9VA 3DLJA 1USSA 3FM3A 4Y7NJ 1K1SA 4J9KA 4EGYA 2C2ZB 1B70B 3OL7A 2LQJA 3W5YA 3CD6I 2OC6A 3WU0A 4KT6A 4AUXA 3O6BB 1CSJA 1U0SA 3I64A 3D67A 5HLFA 2WV1A 1OQ3A 4FP9A 4NYPA 4Q2LA 3J80U 3RZOJ 2FZKB 2MMYA 2QN6B 5D4NA 3M8SA 3ABMH 2FDNA 2XF6A 4XBFA 2Z9OA 4PJLA 4UZCA 3R5DA 2GFFA 2DA5A 1K61A 4JI3J 1ZZNA 3PR4A 3DDIA 2ID6A 3DEUA 3D4JA 2A61A 1LVAA 4EYHB 3C16A 2AJ4A 4USMA 2P9CA 5B1AH 2FJAB 2PI5A 1IR0A 3KEOA 1ZELA 1SXLA 3EMTA 2FB0A 2KH9A 1H72C 1Q1KA 1REVB 3OOPA 1VQOS 1SC3B 1S1XB 4ZPVR 1X5TA 2CJKA 1JNRB 3MCOA 3CP8A 3OVAA 3S7RA 3C6UB 1YIJI 4DX5A 3PIPF 1IKYB 3PUFA 2FQ4A 4RL1A 3FMRA 4W90B 3MWBA 1LEAA 2E9ZA 5F41A 1K83J 1CULB 3B4DA 1EARA 5DZ6A 2QVOA 1TL1A 4FDFA 2O8KA 3UD4P 4CH1A 3IAS2 3I58A 2E29A 1YJNI 2JMWA 2LYVA 3S01A 4DX7A 2WOMA 2EG2A 5C44J 3ML6A 3R4KA 2H54B 1HHQA 1UP1A 5LMNJ 1J5YA 4BJTA 3NP5A 1C1BB 4J91A 5J2PA 1HNIB 1RHKB 1HXDA 3M8FA 4HF1A 4UW2A 3AA8A 5B66C 4HDUA 5KG2A 3QRPA 1VBKA 2RS8A 2LEBA 5KFLA 5EUHA 1JTXA 1R5GA 3ZZRA 4GKJF 2KZGA 3UN5A 3NAUA 2KHCA 2K4JA 2I8DA 3I5AA 3ZQLA 4NASA 3CCMS 1WD6A 5D5XB 2QA4S 4F55A 1TKTA 1VBYA 4HBLA 4M5KA 1NCLA 4Y6IA 5GVQA 1ZRFA 3H5UA 2PDAA 3CQZJ 4KR0B 3TVKA 5CVJA 1RISA 2J9DE 2KYXA 5D5VB 2H9ZA 3K4CA 1U26A 1JT0A 3H5XA 2E19A 2OU2A 2VV5A 4RGSA 1G4DA 1MN9A 4UXNA 1YVFA 2N3OA 2RD5C 4AQYF 4PK4A 3VAHA 5IWAJ 5B7WA 2R4FA 1JGGA 3BO4A 4OI3A 2DODA 2JJ4D 1F43A 1XSXA 2KP6A 2AU0A 5F9NA 2XBPA 5AIPA 2GZOA 4DBQA 1PJ7A 1U2FA 1RKWA 2O1PA 3HFKA 1RRJA 3RPUA 3BZ6A 1SJFA 3IRXB 1G2HA 3P96A 2ADCA 2XLJA 1Z91A 2HVRA 5EDNA 3B4MA 1NJXA 4DR3F 1XMKA 2CSOA 2HBQB 2NPIA 3HYIA 2HXIA 1J09A 3BZCA 3NS7B 4E8UA 3K6GA 1OMIA 2C6YA 2BJ3A 3HT3A 5HQ8A 4DR7J 4GXOA 3T1HJ 3SZPA 3JXOA 2G2YA 4DSLA 3PTWA 2CUYA 2QKLB 4BHPA 3FUYA 1WC6A 3RDIA 2NXNB 5BXIA 4DPUA 3HP6A 4ES2A 2X6YA 4N77A 1JKHA 4XDCA 1ZAWA 4UY8T 1TK0A 1RKIA 5K14A 3GFHA 4NEYA 4RB2C 5CCMA 1ETYA 4KYWA 4M3BA 2AYMA 4U7UK 2A2DA 2PG4A 2JFDA 2KB2A 3PNYA 3RU0A 3OUYB 2OCEA 3TANA 1IO2A 1URNA 2HVDA 3SI8A 2C3PA 1Q8IA 3D6TB 3TEGA 5K7FA 2CADA 1D9DA 4AWXB 1S1UA 4XK4A 2FLPA 1O6XA 1ETOA 4L0YB 4DI6A 2ZSIB 4PEOA 3TI0A 1S0OA 4D0PA 5LMUF 1WOOA 4FYYB 1JJCB 3KCCA 3TMOA 3HM5A 1N5YA 4FNIA 2F48A 4ER8A 5CVUA 2L4AA 4PFPA 3LSMA 2CUFA 2OZ6A 4PG4A 2JA2A 2BE7D 2B6AA 3QOPA 3H5SA 4NXNF 2XZWA 3LPEA 1JTYA 5LHIA 2B3TB 2YU3A 3JS9A 3M8PA 4OFZA 3E5XA 2MB0B 3CCEI 3E5QA 4BE0A 1ZAXA 4LFCJ 5DD4A 3N6LA 5KAIC 2QE5A 3ZQQA 4M6XA 2LC2A 2JWNA 2B9SA 2IVYA 2HKEA 4HACA 5CYQA 1U5TB 3GFJA 3M1VA 3RAMA 1F5CA 4ZP8A 3D2WA 4C0HA 3TL4X 1WJCA 4DSEA 5KT4A 3SSQA 4MIAA 1F0XA 2JUCA 3VAJA 1AB8A 3WQPA 2F9JA 4TQSA 3C14A 5E0OA 4CLYA 3AHPA 3J81Y 2QLJB 2ZVSA 3U7JA 3J81U 3FF5A 4ZPAA 2DA7A 3NMRA 1NNDA 2L2OA 3KG0A 4BLGA 4B3TJ 3PCOB 2VODA 2C2KB 2NVYJ 2AKWB 2QZ8A 1ZREA 2D41A 5HVHA 1EP4A 4WP9A 5M2RA 3ZN1A 1JXLA 5IYCJ 2A10A 2AMCB 1A04A 3CMES 2JSXA 3K1NA 5EN1A 5BQTA 1U6ZA 1FKOB 2HBZB 1HL6A 3M32B 2Y0SA 1VQPI 5L1JA 1W36C 5T14A 3FMBA 2GAGC 2Y0MA 1R0AB 1JIHA 3MKWB 1OJLA 3TEDA 2XGDA 5D6GA 3JRGA 1MMDA 2LECA 2HYGD 4G1PA 2IAJA 2DT7B 1IKWA 3ZTQA 3UDCA 3DKDA 2Y1JA 2GJFA 3BZKA 4YDDB 4G7ZF 4C3LA 2EFNA 3BGUA 1QBJA 3CF5F 3ZQGA 3IKVA 4HVZA 1Q95G 2FVCA 1HQUA 3PHEA 4EM1A 3DLBA 4I2QA 2DOAA 2QRRA 2XNQA 1LPQA 4EFAC 2DA4A 4AYBD 4R5PB 2AQEA 5FFXA 2B43A 1SI9A 2UUZA 3HKZD 3HHLD 1GXUA 1ZM9A 4DPYA 2ROEA 1IG7A 5KAFC 2VBYA 5IT4A 3T9ZA 1OYWA 4X4PA 2MQQA 3IWLA 4OV6A 3ZZPA 1HWLA 1XR5A 4TVAB 3ZC4A 3KYLA 4JV5J 3PZPA 3AJ1A 2IPOB 1D09B 1UWAA 1NB7A 1QM9A 5ICEA 5IXUA 1NHAA 2COBA 1F1ZA 2OBPA 1SJ3P 2O5DA 1GEHA 3H0DA 1OS5A 2A6MA 4J9NA 2Z8QA 4BBRJ 1BW5A 1J5OB 5CQGA 3HRSA 4YELA 4JI2F 3K4BA 3AOCA 4JI8J 3IM9A 4CCHA 4AM3A 4CCLA 1H0HB 4G1IA 4FX4A 1RB0A 3UKGA 1FRLA 2M1BA 1KTQA 5KOWA 3MQ0A 1QDUB 3HHLC 3T9NA 2OPRB 2BM1A 4W4MA 2EK5A 5T7LB 2KRHA 3F21A 3OSNA 1DTTB 2HMIA 2R5YA 5E20A 1R4MB 2VONA 4USKA 1SD5A 4U6PA 4ZTFA 2CQGA 2QO3A 2XROA 2XO6A 2Y0BB 4KFBA 2IT0A 3CD7A 4BHBA 2BJDA 3OTBA 1S0NA 2R5ZA 1P1TA 2OSQA 4TYBA 2XHCA 5HLFB 4ZYDA 1J9IA 4MMOA 3M8YA 1D1AA 1NB2A 3P49B 2L01A 2HS5A 2B7BB 3PNIA 4KPCA 3O44A 1GNKA 1TMMA 4CYCB 3QFHA 2D45A 4I7HA 1KYZA 5CYQB 3MM7B 1XIQA 5JXSA 1VOMA 4P5OA 4UZBA 4M9ZA 2P81A 1I3QJ 2F4FA 3PNTA 4F52A 3A3NB 4B9NA 1HWKA 3TOAA 2UXDJ 4UQGA 2IJNA 2BANA 1X5PA 2EFGA 4HOBA 3VGTA 4L0ZB 2XSFA 3OL8A 1HBNB 5E3NA 3NG8A 2HHSA 1MBHA 1I39A 1GT0C 4C9DA 4OJ3A 3L09A 1H89C 1DAXA 4KHPJ 2CQXA 4CDIA 1T0FC 4DS4A 3M9NB 5CYJA 2BVZA 3FXQA 2W7PA 2V34A 2RE1A 3O3KA 4PZJA 5KFHA 1E3OC 2DHXA 1SCJB 4PYAA 3K2AA 4RO0A 5JR3A 5D8LB 1ZS6A 3RGIA 1RUSA 3DV8A 5FRMA 3L2VA 1DQ9A 1P8GA 2J6UA 2JA7J 3CJ0A 1I51B 1ZQ3P 4BACA 2VUGA 4DLEA 1TQMA 2E5NA 3AD9C 3KZYA 2HGCA 1NTCA 4L9TA 4YFUA 1B8IB 1HNXF 4F25A 1IBMJ 2FEZA 2XGEA 2F9DA 3TOBA 2NVQJ 1U6GA 1RT3A 4Y33A 1FKAF 2DFHA 3BCBA 1KC8T 4ZZDA 2FQ3A 3V6JA 1G3OA 1VRUB 3QPSA 2V1UA 4EZ9A 3VGSA 1KA8A 1H7XA 3IA0A 3QWPA 1IDYA 2W2MP 3MKZA 1W7PD 1AWCA 5CVRA 2HHPA 1MN7A 3PY8A 2EV6A 4LMZA 3JRAA 1IN4A 1G59A 4B43A 1UWBA 1K78B 3DRSA 3OR1A 2E5IA 3MPVA 4ECZA 4JI5J 2H27A 2Z30B 2E71A 3R27A 3H5AA 1U8SA 2CG8A 2BUNA 2NPFA 4LSLB 2OTJS 4WFXA 5HJXA 2B5JA 1KRPA 1IV8A 5MAOA 2VG7B 1SVDA 4GFBA 3FEZA 4DPOA 1D5YA 4FVMA 4ZYEA 2YU9J 2HYFA 4L3KA 2IA2A 3CB4A 3OLBA 2IC3A 3I4PA 4AFFA 3KMQA 2ADUA 1YG0A 1PDNC 1FNMA 3N28A 5D4PA 4LLGF 2LMIA 2DMTA 1WKKA 4ECVA 2VPYB 2ALZA 4LLLA 4Y2IA 4JX5A 1J75A 1AT1B 4TY9A 1GVDA 1B6AA 4WXDA 2I9SA 2W48A 4MFBA 1XB4A 3H2UB 3K7RA 2QTWA 1U6FA 5LMNF 1QUVA 3CCVI 2X7IA 3CCVS 3L4BC 1IXKA 3H4BA 2M8GX 2LVSA 2ZB9A 1NDCA 1Z7LA 4I4BA 2QEXI 4BXXJ 1FYLA 1TNTA 2MKIA 3KK1A 3BSOA 2R3VA 4JUZA 3R6SA 4ED1A 2I38A 5DJBA 2HOEA 1CS4A 3TNVA 3QIPA 2KT2A 1PYSB 2E35A 4IOCQ 2DKOB 2HFSA 3RBDA 1FDAA 4O3SA 5D8HB 2C3OA 3KYDB 5FKNA 3BKFA 2A6EF 3I56S 3C14B 4QOTA 4MFBB 2H65B 1N5VA 2NRAC 2EPFA 1KQ8A 4LF5J 2IGOA 2PMHA 2FE3A 3LA3A 3QJPA 4HLXA 1S76D 1O5JA 3QPLA 3K59A 4M3DA 5HMYA 3GTYX 2XY7A 3S2HJ 3NWRA 1S49A 1YOVB 2KT0A 1FCAA 2FVPA 2LFVA 1E3PA 4F04B 4OU0A 2FIUA 3N5BA 4JV5F 2HOSA 2BY1A 3M07A 1PKUA 1IJEB 2FLOA 4F3OA 4ZP7A 2HFNA 4CP5A 3VV2B 1QAIA 3S3NA 3GB0A 4IHVA 3RAQA 1ZTRA 4I1TA 4C0BA 1C1CB 3EZUA 4F0HA 4LSLA 1EV7A 1UZCA 2MDAA 2I0XA 2LA6A 4BS2A 3OYAA 1BI1A 2L3DA 2EV5A 4ECUA 5AE3A 3HRUA 4B9UA 1NBEB 4YP3A 2O8XA 4OL8A 4DV2J 3D3CJ 1TVRB 3A1YA 2LDUA 3KLGB 2EZIA 3MPDA 4DR4F 4OYXA 2IJFA 4AIDA 2OQGA 3D3BJ 5IP9J 4RNOA 3N5FA 4YIIA 2UXCF 3OD2A 2IBKA 3CO6C 2QV6A 1ZR2A 4B8XA 2C2DA 2ZBPA 1J2VA 2KYZA 4IO9F 3KUEA 5A0YB 4DV7F 3Q8SB 3I54A 4P55A 1EZZB 4J9QA 3LQVA 3T8TA 3OR1B 4UY8I 1MIJA 5L3DA 3S2DJ 2HRTA 1EQMA 3DGVA 1S5ZA 5D77A 4DR6J 1ZH5A 3CULA 3OYBA 3N6NA 4ELVA 4ZLJA 3PG9A 3HHDA 2DGSA 2DRAA 1RHJB 2RIJA 1Q7LB 1WHVA 2BXYA 3AXKA 4YRVA 3LAMA 1NSPA 3TA0A 4G6VB 2Y0SN 4DR1F 1UAWA 5BMZA 1UZHA 2EXUA 4DBRA 2FZCB 2IMOA 4A3CJ 3DRSB 3ZN0A 2K8GA 2Q1LA 4M9XA 1ON1A 2ZCWA 4UUSB 2DCEA 1Z9CA 2DH9A 4QYRA 1QVGR 4X4OA 3V6KA 4Q0BB 4PWDA 2X1CA 3CJSA 4C8ZA 1XNRJ 2R7ZJ 4FXVA 1IF1A 3EICA 4A3MJ 3WIUA 5HP1A 1H8AC 1TQLA 3EGNA 4HACB 2BYCA 1E17A 1FK9B 4UB6C 2IS6A 3QP5A 4QQBA 3T1HF 1D1CA 3BR8A 2JVGA 2XS5A 5L1KA 1KLMB 1REGX 1PUEE 4CT9A 2V8VA 2ZKZA 3CDEA 1Y0NA 3W5XA 5IC4B 2GZWA 4AL5A 2DYSH 1X60A 1T9XA 2V79A 2ZMEA 4Z2YA 2PX9A 1S0MA 2VXDA 1N0VC 5H9FK 2HMIB 3M2RB 2KRFA 2LNBA 2LA4A 3S15J 1UL3A 4RBTA 2D1HA 2VU5A 3LSTA 1VQ5S 1KS2A 1UZDA 4UOCA 2MZSA 4B47A 4B9LA 2FJ1A 3HUGA 2KVQE 3HO1A 3IHUA 3PIPQ 1FMWA 1TP7A 4FQGA 1IJWC 2UUBF 1WDTA 1OCCH 3S1NJ 1SQGA 4MK8A 5L3EA 3I71A 5F8LA 2LF7A 4CCOA 4OZJA 5EJCA 4X4NA 4IKFA 1FHTA 2VF3A 3D1NI 2F1FA 2UXXA 2KMUA 3W2VA 2VB6A 1IKXA 3PACA 4JV2A 3I0TA 1S6QB 3RYRA 5IC6B 4CA0A 2OCCH 2G2ZA 2IEKA 4RA2A 1F2HA 1OKRA 2K9NA 4HNVA 2JLEA 5K20B 1NK8A 5D4RA 2FUG9 2A69F 4DUYF 3MM9A 1UEUA 2RUSA 3EYZA 4BE2A 1XMQJ 5IT3A 4OMYA 3L2QA 3WGGA 4X65F 5GAEU 4XOTA 3I5BA 4IHSA 4C8YA 3H40A 1VFJA 4EBEA 2O67A 3LH2S 5TGTA 3AB2B 4XRFA 2DNOA 4LIVA 3L9ZA 3EGVA 4LJMA 4Q2MA 1ZRCA 2K86A 1QQIA 4R0EA 3GVAA 1FWKA 5BNGA 4U7UD 2DCLA 2ZE2A 3RBEA 2P2CB 1TWAJ 3H36A 1ROFA 5EGOB 5IOLA 5DEQA 2PEHA 1D9AA 5HS8A 4HI2A 1S1VB 1IKWB 7FDRA 4N4OB 4QPXA 2DIVA 1OYDA 3N4MA 3S32A 2HNYB 3OYHA 2YX1A 3FHNA 3IG1A 2YH1A 3KWMA 1WJ9A 1HQUB 2L02A 1Y5IB 3W61A 5E1WA 3CJRB 2Q8KA 5EWEA 4P52A 3ZZ0A 4DL7A 2Q2EB 2ZH8A 4Q7AA 2DBBA 5EGOA 4DJAA 1VQOI 1SL0A 2FD2A 1AZSB 4X2BA 4C8KA 3CDWA 3EYIA 4DV5J 5F6FA 2GOMA 1YS7A 3QLHA 3ZQCA 1NSKL 1XS9A 1CJKB 3W60A 3B02A 2CV1A 5K8MA 4BHQA 4MK9A 3GF2A 2D7SA 4KRWA 5I42B 3VAFA 1QTNB 1KD1T 1KU3A 4OYIA 2M4MA 2Y9YA 4EJTA 1KWMA 3VR1A 2HDDA 1RLDA 4C11B 4ABZA 5D5WB 5DDOC 4C8OA 1KGSA 5FROA 2ZDPA 4PYDA 4HQMA 3MF5A 1UHMA 2HBRB 3BGLA 3X2QH 3I5UA 5HVFA 2L48A 1T33A 2AT1B 4U87A 3MXHP 1TW3A 4BNCA 2VQGA 1CJUB 1WFXA 2M3AA 1LW0A 2UUBJ 2X6WA 2WSEC 2DEIA 2CO5A 1PCAA 4WFYA 2HS0A 1CVJA 2RH3A 2HHVA 2OTLI 1HQEB 2FX0A 1R23A 3UD5A 2HVIA 1F36A 3LAJA 2D3UA 1G3SA 2X85A 3O8GA 4KH1B 3PUBA 1TBXA 3OFEA 1VS3A 2YPZA 4KSEB 5GADU 3WX8A 5CLSA 1XSVA 2H5IB 3PRDA 2NS7A 2QSFA 4B3OA 1REVA 3D5LA 4TV7A 2HNZB 1R8PA 4X1EA 2B7EA 3H3UA 3M6XA 2BVMA 3E6DA 1VI0A 1MLAA 1O7FA 1Q86T 2FGCA 1GQEA 3ABUA 4K2JA 2Y69H 4N9HA 4XN0A 3DGPB 3G87A 3ERED 4NCBA 1N48A 3ULQB 2HS3A 4E7ZA 1U6BA 3KP3A 3L7PA 1QGPA 1R49A 2UUAF 3QAEA 3KK3A 1O7LA 1N6QA 1PP7U 2ZKTA 2IVFB 2R0QC 2ELKA 4P9SA 4NLTA 2TCTA 2Q1ZB 4PABA 4ECXA 4EBCA 2DYAA 3ZO7A 1AUDA 4IX7A 2NS8A 4QIWD 1YRUA 1ZLJA 3S3OA 2FTRA 3CJQB 2Z2YB 2EILH 1NK9A 1DDNA 2OJ3A 4QSHA 3M7GA 2DN0A 1NEEA 2UU9F 2NZ4A 2B0GA 2JWTA 1Y8RB 4YEJA 4UVBA 1N0UA 3TWZA 3CP2A 1VQSA 2HDWA 2UXNA 2DDBA 2Z99A 4OX8A 4G3IA 2YKOA 2GMHA 3ZZUA 2FVSA 2QWWA 1LB2A 3E97A 4NMLA 3LO3A 1ZG3A 4ECSA 2KT5A 2XC7A 3KKFA 1FVQA 3OPKA 2DGWA 3K1PA 3SFUA 3RB6A 4C0OC 2XSJB 2R92J 1Z7UA 3H98A 4I68A 2Y48A 2VL8A 2K1RB 5DM6Q 3MEDB 3SYTA 3T5JA 3HC7A 4ESJA 1KOOA 3LP0A 1IC8A 2X48A 5KT6A 4Z2XA 3E0JB 4HR2A 1H0MA 2RRBA 1S12A 2OD4A 1UHWA 1VCTA 3OTEA 4FYWB 3UW1A 2OPTA 4WFBQ 2AJQA 3VSKA 4NOHA 1ELOA 3OFGA 4E7LA 2ME0A 4KC5A 2UUAJ 1Q1VA 3OOUA 2GIVA 4USHA 4U96A 4HDVA 3DLKA 4DN0A 3TJ9A 1T39A 5K14B 3VF0B 5ICCA 1Z6TA 4N0BA 4LGWA 2M4GA 3AG1H 3S8SA 4B3AA 1W1WE 3LP2A 5L3CA 1FWLA 2MJUA 1ITPA 2ZVIA 2RNGA 3CCRS 5DCMB 2DU9A 3TP0A 4DCOB 1MZBA 3MMBB 1G3WA 1EAYC 3WODF 4GO1A 1XN9A 3GTPJ 2DJWA 4I01A 3OY9A 3P9KA 3CCES 5J8FA 4FCYA 4EJOA 1WC1A 2GC8A 4CCMA 1QUPA 3CMQA 1N54B 4IG0A 3IFEA 3JSBA 3R61A 1ZM3A 1MW7A 2ZZTA 3V6DB 2LXUA 2VBWA 2LQ5A 3DLLF 2VFTA 7FD1A 5D5UB 1MBGA 2BJ8A 3HSGA 1TL3B 2ASLA 2WAQA 2C2NA 1DHMA 5C3EJ 4Q44A 2R7DA 2LXFA 2F8EX 3FSIA 3TBIA 4BKXA 3BPDA 5F8IA 4H4OB 5L1LA 2BJ9A 2V8DA 2WOMB 1IR1A 1S1XA 2GCFA 3UCGA 5DCFA 1Z6RA 1SIZA 4CLLA 4NLPA 2R7QA 4TY8B 4X4UA 2DITA 3BQYA 4II2A 3H59A 3EETA 4IHTA 1BD6A 1U0HB 1Q4RA 1BQMB 2AWZA 1T8IA 3EXYA 5A8WB 2ZHAA 6FDRA 5M2PA 4WF2A 4DV1F 1FP2A 1R6YA 1Q8KA 2ZUAA 2HYIB 2KZZA 2O61A 3TW0A 2VC1A 5KFMA 1W26A 3PFOA 3F22A 1LVKA 2VG7A 3E2EA 4LR7A 1V54H 2PJPA 2CPXA 3CJRA 5FLVA 4XLAA 2W4DA 2DO0A 2FHMA 2UUTA 2PMZD 2ZBQA 1WKMA 2V8GA 1HNIA 2XAUA 3G8TA 2A0FB 3LOCA 3OYNA 1HBMA 2XWYA 3OYMA 3WTSC 3PJRA 4E7JA 1YJUA 3IC7A 3CD6S 3DKXA 2DB1A 4I02A 2EKYA 4FS1A 4DR2J 5BPDA 1SC4B 1WH5A 2STTA 2FBHA 3RG6A 1FRJA 1FDBA 2H1LA 5CCLA 2JTVA 2VC0A 1KP6A 2JN6A 2MQ8A 2GHPA 1G6NA 3CJ3A 2MG4A 2B6AB 1KQ9A 2KJCA 1TW2A 4MTEA 1BR4A 4TKTA 3NGRA 4LITA 1B9NA 1JLCB 2BJEA 1YJVA 2BRLA 4C30A 1WI6A 3NGUA 3EUNA 2XKPA 1JKRC 1TFYA 1S77D 2ZNYA 1M5OC 4NA1A 1HOMA 1I27A 3GILA 3BDEA 1G8XA 5K7HA 4KTQA 3PRBA 4JBCA 4HKQA 1TUGB 4R0JA 1WI9A 4ANCA 3F0NA 1UELB 3OS1A 1S7EA 1G6BA 3AT1B 4MKVA 4PRFA 4K4ZA 4IFYB 3M05A 1I94J 4XAKA 3FCHA 4CHUA 1B4SA 3D0HE 4JP8A 5EZHA 1RAOA 4OYZA 3AG3H 3NMAA 1B7FA 5A2QK 1RAHB 1TL7A 3F8FA 1ZA1B 3PHTA 2RVCA 5FKKA 3ZTPA 3LA0A 2CRLA 4QPQA 1Y56A 2BM0A 2VKVA 4CO1A 4KPYA 1S72I 3OHAA 1A36A 1RR7A 1HBNA 4DR5F 1BIAA 4JI6F 3O1LA 4LIUA 4Q8FA 4OIPF 2I2YA 1Y7PA 3V4MA 4RW8A 5GAHJ 3DFGA 5EEAA 1LFBA 2G0JA 2K9LA 3R0JA 4RKUC 3G82A 1T2KA 4IEJA 3W62A 2ZBKA 3GWZA 4D3GA 3MUVP 4ECYA 3P9IA 4AD9A 1U02A 3CIZA 2DRBA 3K4MA 2F5VA 1RUNA 3ZR8X 5AXMA 4NCGB 1P1LA 3PYEA 1XC5A 2QQ9A 4II3A 4N7TA 1QLNA 1G1XA 1OYYA 5CVVA 1RHUB 3HPHA 4USWA 5IYBJ 3EGWB 1HA8A 1OISA 2XLIA 1PUFA 2DR5A 1K6OA 3QGGA 1IQTA 1OSCA 1POGA 5HP1B 3ZXSA 2QENA 4HG2A 2ILZA 3X3UA 2A05A 1RGVA 4P75A 4OX9J 3GMGA 2LMDA 3LSHA 4YEAA 5KG3A 2KKHA 2BE2A 4CQ1A 5IV4A 1HKQA 1ON2A 3NCRA 4EM0B 3OMYA 2E2JJ 2NNNA 5B3SH 3HSRA 2LY9A 2QEXS 4FPIA 4DR2F 3H7HB 4YY3J 2J9EA 2HGLA 4CYCA 4RUCA 3RW7A 4GYIA 1TWGJ 1DQUA 4AD6A 4M71A 3EVMA 4ZJOA 3MEGB 2E7WA 1LJ9A 4B3MJ 2PE8A 1FF2A 5JVGQ 4IFVB 1JLGB 5LEJA 1WVRA 4C7QA 3DP7A 3Q5FA 3HM9A 1VQ8S 2D9PA 1FXRA 4N76A 1V55H 2L9SA 1ZG1A 2DLLA 3O6QA 1SC7A 4LRDA 1QSSA 1OQYA 4CO0A 5IM0B 2NNYA 4OHVA 5LT5A 2CJYB 2A1BA 2QUFA 2LCWA 1NDLA 2XNRA 4G12A 1TT5B 3Q9VA 1IRZA 3K8WA 2Z3YA 2CQPA 1XNQJ 3VGUA 1FSEA 2QMUB 3UR3C 3MEEA 4RGXA 4RAFA 3SEQA 2CUEA 1FERA 2QLZA 2V6CA 3PW7A 4PPDA 1V5IB 3SSRA 4ZDLA 4B17A 1ZETA 4LF7F 4I6YA 4MNUA 4J9LA 4M73A 2K3IA 4LRBA 2M34A 2Y1LB 3L2CA 3LFKA 3KTQA 2ESHA 3VAGA 5DZ7A 1XMQF 3CO9A 5FLXU 2V4JB 2R9LA 1NDPA 4EMSA 4WP8A 2M8EA 1LNQA 3AJDA 2FXAA 3RIRA 4KISA 1BI0A 1P27B 4JV1A 3IP0A 5HAOA 1VQ4S 5E1ZB 4NCGA 3IGVA 1XTZA 3IAS9 1A6LA 2NYHA 2G0CA 1HYSA 2L41A 2XAQA 2QSGX 2IRUA 3LF0A 1EH8A 5JHFA 3ZQ7A 1DPUA 2VJ5A 5DG9A 3BO3A 1UVIA 5C42B 3KHLA 3CCTA 2FPHX 2IGNA 4F02A 1Z67A 4CH0S 2PQ8A 3HGYA 1VK8A 4OYOA 4X62J 1L3TA 5HNHA 1WELA 3DPLC 1U8RA 2C28A 3J7AN 4HYEA 1RWXB 1JT6A 1IKVB 3I82A 2LLKA 3J7YJ 3MFIA 1R3NA 4A8FA 4QW9A 4M95A 3PX4A 1SJ1A 2GBYA 2M52A 4C3MA 1J2XA 2CQ4A 4RNFA 1IBLJ 4RW6A 3TUPA 3CO0P 1QAYA 2HK3A 4RB1A 3F8MA 5FB2A 1HPZA 4I7FA 5KFYA 3DPUA 2C1EB 1TL4A 1N34J 1T08B 1TQIA 2QG9B 2V1DA 3HZGA 2HOTA 1HR0F 2J0XA 2IBOA 1QAJA 1F5BA 4A8KA 3SV4A 4A8YA 3SYZA 2KZMA 5LRSA 4ZVOB 5J1NA 2Y31A 2CJAA 1S1UB 1CQTA 3BSNA 4LF9F 2PO4A 5KFIA 1PGZA 5C4XJ 3FMSA 2YPYA 1IUJA 2R7RA 4ZIVA 5IY5H 1ZAVA 4BXUA 1P9QC 5K9FA 3C6TA 2YWKA 4WYLA 3CDBA 4ERDA 3OS2A 1ZR4A 4DQIA 2DT9A 4NZ7A 2HKXA 1QO0D 1JLGA 4RW9A 1JKOC 1VZ0A 1D3WA 2WVEA 1WF1A 4A3EJ 1AUSL 4F26A 3FK7A 8ATCB 4DR1J 2IA6A 4IQMA 2Z33A 2E44A 3GUDA 5LJ5Y 4G6TB 1HHSA 2W7NA 2DPIA 1IRGA 4U88A 1FKPB 3BQ1A 1JKHB 2H1YA 1SUQB 1WF2A 1JHFA 3D0IE 4GDFA 2H4YB 3FEYB 2J0WA 2WWYA 2UWMA 4PWUA 3H35A 5F8HA 3NRBA 1RYSA 2Q66A 2OPQA 3TDZC 3JQMA 4CO2A 3EDPA 4CT8A 4YUDA 2DPDA 5TISC 4KT5C 3GZ6A 2B4VA 3F6VA 4JI4F 5DLFA 3GTGJ 3LMMA 4C9YA 4ELTA 2JLGA 2IYGA 2RS2A 3BCAA 3WDOA 3GTMJ 4HEA2 2BEFA 3R5CA 2R2TA 3BH7B 3MWMA 1O0PA 1BI2A 1RR8C 2F6CA 3ENVA 2QA4G 4RDUA 4DZDA 1K0VA 4PG7A 4XM3A 4KV8A 2KM8B 1NG7A 2HSEB 2CQCA 5M2UA 3WTWC 4DSFA 4FE7A 2HLUA 2ECCA 3HBLA 2LF8A 3T1AA 2IRXA 2R7TA 4F92B 3I5CA 3CDAA 4IR9A 4OZ5A 4Q0BA 4X0GA 2JPCA 2AW0A 3NXZA 2DFFA 4PQUB 4HSTA 2QBYA 3NS5A 3T5LA 4G7HF 1K9MT 1WNEA 1FIAA 2L9DA 4A8XA 1NJYA 4CYUB 1T0TV 3QOEA 3PO2J 4RWWA 1JMTA 1NRKA 3RKXA 4ETSA 1N34F 4ELUA 1D3YA 4RGUA 3CCYA 1NKBA 1APSA 1RWMB 1N5SA 4BY1J 4EO8A 2J8SA 3RQIA 4ZVTB 5K5OA 1IV6A 1DU0A 4RW9B 1SEUA 2R5ZB 1LEOA 5LHGA 4ZVSB 3HB9A 1R1TA 2QSFX 4PGHA 3S93A 5DGBA 4DV6F 4DV5F 3BG6A 3WTZA 1LE8A 2RN7A 4Y4RA 1U25A 3GFYA 3MAAB 3KLEA 2QQBA 3DRPB 1B99A 2EZKA 1PVEA 1I50J 2JA6J 4ZLNA 3G1OA 2W9BB 2YNGB 1KLNA 4D3HA 2XASA 1W36D 2HEKA 3FBCA 1B0TA 4B1RA 2MH2A 3US5A 3TUJC 4W92B 1VLOA 4NMXA 2P8IA 4PQAA 3POTA 1K8AT 2B9YA 1MBFA 1O51A 2XY5A 1WQ2A 2GVZB 4ZVGA 3V81B 2HWVA 3WC0A 1TL1B 4CLFA 3BR9A 3CCUI 1CS4B 2HBYB 2KPMA 3DCAA 3BQ0A 2D9OA 2PMZA 1SJ4P 4CICA 2M87A 4BS9A 3HRMA 1T8EA 5KFXA 4Y2MA 3K5NA 2AYEA 3KLFB 5FKLA 3CC4I 4QIGA 2Q2EA 1EJ7L 1YE9A 3NGDA 3GSDA 2XMMA 2ERRA 1FRHA 3V6DA 1YJNS 3ZZZA 3QZ8A 2IJLA 5E3AA 4RGRA 2Y9HA 5L3FA 3D6HB 2WV0A 1BQMA 2XF5A 4BQOA 2HNYA 4ES3A 4HNTA 3V5RA 2YX7A 3DRYA 3Q3SA 5FD5A 1NAQA 2AEMA 1M1KT 2DR8A 4OYWA 5ETLA 2GGPB 4YFNF 2VFUA 2FC9A 2E1PA 3GCMA 2LRDA 2VT3A 5KTQA 1SKSA 2GHVC 4H4KA 4RX6A 4YHHJ 4YR0A 2VA2A 5BR8F 3CJNA 4JYKA 1JGSA 2GX8A 1AFIA 1CJTA 1SFOJ 4HHHA 2LH9A 3U21A 1C4CA 3RRHA 1WC0A 4DIQA 4RM3A 3RRGA 4AIKA 4DU8A 4DFJA 3TW7A 1FRXA 2DQLA 3KJNB 2MQOA 4M6YA 2JRMA 1XD7A 3IWFA 1SQFA 4NLQA 3EX7B 4M3EA 1WJFA 3WHBA 1Q82T 1G4CA 2R7VA 4CCJA 4IH5A 4RR5A 1VF9A 1KVJA 5HLTA 3M1VB 4RUHA 3SJMA 2RU3A 1RT2B 1MD0A 5CQEA 2DNYA 2KXNB 3Q0AA 4HHUA 5CYVA 4J5OA 3DLKB 3CMMA 3D5MA 2XRNA 2DXIA 3L1PA 2WVCA 3TAMB 1H6KX 3TA2A 1KONA 3HVTB 1H2VZ 2DGQA 1UVKA 2Y2ZA 2RDDA 3DF8A 3ULHA 2HQAA 3G1LA 3NKYA 3R3TA 4KGKA 5JUMA 2W85A 1E6VA 4DL2A 3S1TA 3P6YC 1JXSA 1U1NA 4NWBA 1YJTA 1L3VA 2OTJI 1UJ5A 2QSHX 4AE5A 2Y1RI 5B0GA 5DQHA 1KQSR 2EW9A 3LFUA 3OYEA 3DYAA 3NQOA 3PO5A 2DA2A 5F0WA 4ZVHA 3I4NJ 1IWAA 1D1BA 1HW8A 3Q0VA 3M8ZA 3S1QJ 2W1OA 3TYTA 1B3TA 2NOGA 3BYRA 2L9NA 3RPQA 2ZXHA 3F6OA 4KYZA 1PILA 4G8XA 1CJVA 1WEYA 5CD4A 2HNHA 3R6LB 1RT3B 4OIQF 5DS9A 1UKUA 3TAMA 1JXEA 1T95A 3S1RJ 4AL7A 2VL1A 1NJZA 3MTJA 3IWZA 4LR9A 3WU1B 2JA8J 5AXNA 5LOQA 1RPWA 1S7AA 3E6BA 5E3LA 1GHCA 5D6EA 3D0GE 1QZEA 2VOPA 3KPHA 5EWFA 2MGZB 3JREA 2MKSA 3GJSB 3LP0B 1G2EA 4QWQA 2KO1A 4UB8C 3GFLA 4ZHRA 2J7KA 1NZ8A 1H7WA 1MSWD 4DR6F 4ZN3A 2CQDA 1U7LA 2OPPB 3OUYA 3IXQA 4PWDB 2VUMJ 2I10A 4X4VA 3AODA 4O3PA 3HOWJ 2FLNA 5J2QB 4QJVA 1MNMC 3H9GA 4NI2B 1P7JA 4XPCA 3LQRA 3M8PB 5JLWA 5CHCB 3M2VA 2Z16A 3TKYA 1TVRA 3CJKB 4ED7A 4ILLA 2E5HA 1TK8A 3ZFVA 2HEOA 3UWTA 3GBGA 2YWWA 3A3PB 3TGNA 2AEFA 1RT7B 2U1AA 2HZAA 4I6AA 1L3SA 1FMVA 2F63A 4S04A 3KNAA 1YITS 2E7XA 2EIMH 2J7UA 1EHWA 4M1KA 2WAEA 3RKQA 3LWLA 1DUXC 3QATA 2VH7A 1RHMB 1KZHA 3JSOA 2H09A 2O9LA 3FWEA 3SQOP 1MH4A 1ETVA 3HLUA 2R7UA 3CCUS 4IQ4A 4DL5A 4FASD 5GPAA 3CMEI 1RESA 4J01A 4ENOA 5C24B 1ENHA 1FBUA 4DV3F 2LEPA 4QWCA 3OYJA 4NRUA 4DN9A 3CF2A 1IW7F 1P2FA 2OA4A 1RIOH 2AX1A 4OHZA 1KNZA 1LFWA 4KGMA 3E1SA 2LU1A 5AXKA 1FO1A 3AY0A 2Y1IA 3KG4A 2BVLA 2IM1A 2FYXA 3UO0A 2ACJA 1GXQA 1M5VC 4EI2A 1LK5A 5D3GA 1BW6A 2IFXA 1S48A 3I53A 3TO6A 5E18F 4X64J 2O66A 1GTHA 4EWTA 4L5EA 4OZ3A 1P6RA 1F60B 3LGNA 2AF6A 3HF5A 3G6YA 3RRKA 4UUVA 4TNOA 4O3NA 1QJHA 2HVEA 5D6FA 4BC7A 4MQ9F 1VQNS 3CWJA 2YKPA 4WK3A 5E2QA 4FYVB 4N8OA 1Q8LA 4GYGA 2ZOFA 3OL3A 4WP3A 5IYDJ 1RWWB 2HG4A 1IN6A 2HFUA 1S6QA 3DN9A 3OTOJ 3CD5A 1Y39A 3DPTA 2GVDA 2DNLA 4P2XA 3CD0A 3RR7A 2CYYA 3VAMA 4L74A 5M5YJ 1ZYRF 4K2EA 5DDQC 1WEZA 2A07F 1O3TA 3WTYC 5BYRA 1MMSA 2P0WA 4Y2AA 5HS7A 4IUFA 1Y00A 2X3DA 1N77A 4TY8A 1WZ2A 4Y2CA 4X84A 2CZ9A 1DTQB 3WTTC 1MH3A 4NLYA 2XWXA 3KEYA 1WHXA 4F4ZA 5G0RA 2HTJA 4U9RA 2KXHA 3THPA 3CPWR 3TP3A 2BE9B 5KT2A 4HV5A 2LSOA 2CS3A 3B54A 2XB5A 3K0LA 4PSWA 3ZOBA 1R4NB 5GP9A 4OOIA 2Z5UA 3GJTB 2CKWA 1NMEB 1HSTA 1GMWA 2FHJA 4L5JA 3DOLA 4IHWA 2ZJQQ 3CC2I 3FVYA 1P4AA 4N56A 2KRBA 3QGIA 5B08A 5ETNA 4P74A 2XPVA 1RADB 5L46A 1T3NA 3DHWC 1FK9A 2IRYA 1CLFA 3KX2A 3L95X 5IS2A 1UA0A 2XMVA 2K06A 2KIQA 5HS9A 3HG9A 3PW4A 4ALZA 4PAAA 4IR1A 2UXBJ 5DGAA 3BKTA 3DMJA 3CCLI 1IGNA 3F8BA 3P5BP 1RTDA 2YSRA 3QPTA 2JEJA 1RAJA 2QLWA 2VIXA 4Q47A 3BPSP 3MAJA 3OR2A 4WFNQ 2F5EA 4QZVB 3LNQA 4DL0C 1SV5B 4PDKA 5B1BH 3WGIA 3DEEA 5CH7B 2E5LF 1KLMA 4OMFG 2VFRA 3OVSA 5E3MA 2OPPA 2ICWG 3TZZA 3QPIA 3JRCA 4K0KF 2P5LC 3IS9B 3L7OA 1A6QA 4ON0A 3MAAA 3I0SB 3UCUP 1W7PB 4Y34A 1I94F 2M5WA 1X1AA 1R9TJ 1Y5NB 3QMQA 4MIMA 3VYTB 4OI0A 3SEOA 4LF9J 1RBLA 1RZ4A 1S8NA 2YR2A 1T11A 4NQWA 2L08A 5KK1A 2B9EA 1TU0B 3ICLA 3S16J 3PQKA 2DTRA 3GTJJ 2FVRA 2MD5A 2MD0A 2V9WA 1LDDA 5C4JJ 5AE2A 3EUHA 2W9CB 2F7VA 1U2RA 2QIFA 2B8PA 3NWGA 1EKSA 4OLPA 5B0BA 3M9OB 1LFPA 2ELHA 2FNPA 2MKCA 3MCMA 2JL9A 3FBBA 4K7QA 3WG7H 2M0MA 2YWHA 3C2PA 1N8RT 2FGOA 1FJLA 3GZ7A 2WY7Q 3G2XA 1NLKL 4NLRA 1KU7A 4E98A 3LQQA 3Q8UA 2HU9A 3OTOF 2PA3A 1U2WA 2W1BA 4UV9A 4NLGA 4RU9A 4IF4A 3MR6A 2QQAA 1D0EA 5H20A 4XMYA 2YUSA 2HXOA 2RC4A 1RETA 1G7CB 5EEGA 1OLTA 1RWKB 2FVQA 4ANDA 2PI4A 1FTRA 2B4OA 4HRIA 5LL6d 1V3RA 3LL7A 4I67A 3FM5A 5HLHA 4RW6B 1IBLF 3VAKA 2A68F 4F7VA 3A03A 4O4RA 2I5JB 1ICEB 1A0OB 2DNRA 4URGA 2W8KA 1DP3A 1C0UA 2ZFWA 4WWSA 2Z0GA 4KGXB 4O4GB 1X8DA 5F8NA 4LB6B 2AS5F 2BW7A 2XG8A 1X1BA 3D1OA 2EZHA 2LQ9A 5KT7A 1U9OA 3MD3A 4DOZA 3WTVC 1WORA 4N5SA 1YG2A 2JSCA 1F9HA 4D7NA 2ZBCA 2HK2A 3RYLA 5HL7Q 5FGMA 2VQFF 4F2RA 2VDHA 3R7NB 4C4WA 3MZHA 1QVTA 1BQNA 1KQGB 1E3HA 4OAZA 2CQNA 1R5HA 3OT9A 2P7VB 2WAQD 5B0CA 3ISNC 1MU2B 2V7FA 2EJRA 4JYAJ 5DETA 4WZQA 3PW0A 1ULRA 3K17A 1ETXA 3QSIA 3W7BA 1DQAA 1QZYA 1VTNC 5E8IA 3WG9A 5M5XJ 4LREA 3CE8A 4FNHA 4QPTA 4F7ZA 1G3TA 4OINF 2PN6A 3GFIA 4EYIB 2AP6A 2ZOMA 2YKMB 1MSFC 1X19A 2JVRA 3G96A 1FWPA 3F8CA 4MEXF 3LSIA 2UV8A 1IN8A 3KLGA 1QA6A 4XLHA 3AFHA 4N47A 4A48A 2PMUA 2CGPA 1S4EA 4LRAA 1BQNB 3RBZA 2ILYA 3ISPA 1K47A 4F0KA 3VZHA 3KJQB 2OHDA 5GMKa 1WI3A 3DRRA 3E5UA 1A6IA 4F67A 3W9IA 2FQQB 2FF4A 3H9QA 1Z05A 2CUJA 3ZQFA 4ZDNA 2XGPA 1ZPVA 1WJEA 1N36J 1ZPWX 2UUCJ 2RHQB 1VNDA 1Q7YT 3OFFA 2ZKUA 3KFWX 1YJRA 5K5QA 2FSWA 2DGTA 1K44A 4FZVA 5IQ6A 3BJYA 2CFOA 1F5AA 5FD1A 1SQEA 2CPHA 2PFFB 2DHSA 1VIOA 2HQDA 1FEEA 3JQKA 2XMJA 1BBYA 3FXRA 1HNZF 3A01A 2F8HA 1BWVA 1SVLA 3BN4A 4E70A 2I5JA 1ZOTA 5J8CA 3CSKA 1MBKA 4BEHA 2OSRA 4UF4A 2DNZA 3H5RA 3QQAA 5LGNA 2V8HA 1T0FA 1NPPA 2XY6A 2N4DA 2AV5A 1AROP 2D1VA 5LD2C 4ILMA 2A18A 2X51A 3E3VA 2DFIA 4FHTA 3VOEA 4YIRX 2OLWA 3F73A 3S8PA 4NZ6A 1JLFA 4YR3A 2VBXA 2RF2B 2DNPA 1DQ8A 5C25A 5BOXA 1RI7A 1FEXA 2PMZN 3E7LA 4L72B 2CPJA 2DNNA 4ZHRB 2L9VA 1IVZA 2MLKA 3W9HA 4HYKA 2RVJA 1TL5A 3C15B 1IXSB 2OFGX 2AHOB 3CESA 4I09A 1WGXA 4WXWA 3PM9A 4QYZK 4MQVA 3W8GA 3HSJA 1CQMA 3JAMY 3S6EA 1S0VA 4D9JA 2GO8A 1D1UA 4UNOA 4WTYA 5AJ3J 4YN3B 2BY3A 2NCKL 1AA1B 1SVMA 1RT7A 2M2BA 5T41A 2VN2A 1RTIB 1VQKS 2V4JC 2HQNA 4IRDA 1X4PA 2MABA 1RTHA 2MLYA 4W1UA 3W3CA 2QX0A 1W5CC 5E3OA 3KZZA 2JA5J 3CC7S 2KDOA 3CC7I 4DFKA 3MTKA 3R60A 2P5VA 4KIGA 1VQLS 4M5IA 3Q2TC 1M5HA 2W8LA 2EBEA 2V67A 2HNDA 2ZZNA 1VQMI 4UUXA 2MGZA 4HH0A 2NR0A 3KJVB 3ABLH 2K40A 2MZQA 3HVTA 3QT7A 2H6CA 1NU4A 3CCQI 4QR1A 4USIA 4NCAA 1WACA 1KU2A 1M5KC 4FE4A 1U47A 1JJ6C 2E2HJ 3QT8A 1RT4A 2V2QA 4DFMA 2V1XA 3AH6A 3RQ4A 4BDZA 1QZZA 2IP2A 4NDLA 1OY8A 2JNJA 5KFWA 3KP5A 3I9V9 3ECOA 3CJTA 3GR0A 4QPOA 3AAFA 3FQKA 4J7CA 2PEBA 3S14J 2UVRA 1JLEA 1XR7A 2DISA 2X6OA 3F44A 2W2QP 3JTOA 3ONQA 4CLUA 4DSKA 2YQ0A 4TU8A 1N5QA 4AYBA 1DTQA 1J5EF 3RSNA 3ZCOA 3BM7A 4OZNA 2DO4A 5A6WA 3V4IB 2QLFB 1OPCA 2XB2D 1I3AA 2CQ3A 3IMQJ 2EINH 4C8NA 4IKAA 2RQCA 4RLFA 2XVCA 2XDVA 3H20A 1EX8A 4WU2A 4ZS6A 1BC8C 2ROGA 3HKZA 3K70C 2CNLB 4LBIA 4AIHA 1SIWB 1Y3KA 3TJ8A 1Z77A 3QYYA 2G1HA 4XDDA 5J2MA 1RTJB 2DD8S 3QT6A 3G4SS 4KIFA 4CWBA 1FRKA 2VJVA 1S6LA 2QYCA 3ET6A 3OL4A 3N6MA 1YQAA 3PYGA 3IP4B 1R8BA 2NXCA 2IAIA 1TTHB 3J7YU 4L18B 3CUOA 1YRTA 4JI2J 3EGZA 4C3JJ 3LANA 1DP7P 3C66A 2E1MB 1J27A 5GMDA 3T6JA 2WA0A 3DOKB 2NUUG 1JE8A 4K4XA 1AXQA 2PJRA 2W01A 2DO7A 5HO4A 4AYBN 1HA1A 4TQRA 2V2KA 5KFAA 1LWEB 3VQSA 2QA2A 3FXMA 5DG7A 2OELA 3MAHA 3A4CA 1TKTB 1BL0A 1DGWY 1B0VA 5FLXY 3DXSX 2RJZA 2UXCJ 2AYBA 4WFZA 4B48A 2NVTJ 2NYIA 2ZH9A 2EV0A 2IS1A 4YMEA 4NEZA 3HT0A 2CVEA 3OHBA 1UCRA 2JX2A 3KHRA 1N32J 2X3GA 3QPHA 3UPFA 4ENJA 2DK8A 4ICLB 1YJWI 4EM2A 4M94A 4N8NA 4DQ2A 2WBMA 3CEDA 3CZ6A 1OCRH 2V50A 3DBRB 1LFUP 4C8MA 4MGRA 3RUBL 4U7BA 2KRCA 4X4RA 5M3FJ 2BBYA 3PIOF 2ZWOA 5IWAF 2V68A 2CDRB 1MG7A 1RT6B 1OCPA 1LNWA 1VQ6S 2IBDA 2XAJA 2BW3A 1HBOB 4IRCA 4DPWA 2A5WA 2G4BA 2QGFB 1EQ0A 3JW4A 3BP8A 2MSSA 3P4UB 3BEGB 1NK6A 2LEAA 1VJQA 3GFMA 1J5EJ 2B7CB 4DPTA 3GIKA 3OYIA 2WVFA 3C16B 1RU1A 5IP6A 1WI8A 4EO6A 3ET6B 2F40A 5DUIA 3CC4S 3PX6A 2OPSB 2JLFA 1BC7C 3DXBA 4F3QA 1OR7C 2UZKA 4WFAQ 2K1RA 1HSJA 1FOWA 2GA2A 2RREA 3OS0A 3DLLQ 3V4GA 1SC1B 4BJ6C 1W2BR 2CG4A 3VZIA 3DI6A 4P7TA 3TDUC 4ZVRB 2EFVA 1H74A 3OXGA 4Q5VA 2M4KA 4NBQA 1STZA 1T05B 1Q16B 3TW6A 4NPOA 4D1QA 5D0RA 2EH3A 3NEKA 1VQ6I 1PG5B 2M7AA 3IR5B 1V6HA 2LYCA 4N4NB 4WWCA 2RUGA 1PYTA 3VYSB 3FKBA 1UB9A 3PW5A 1HWJA 2PIIA 1HD1A 5DM7Q 4UOFA 2YKNB 3BYPA 2Q6CA 1ZGAA 4PZVA 2YH0A 4EMDA 3P9CA 1HLVA 5A8KA 3HFZB 1ZBTA 3AA9A 4BHCA 5L3BA 4ITSA 5J2QA 2CU7A 3M8JA 3EE3A 4C3KA 3C1DA 1MSEC 5L9NA 1V5VA 1U2CA 2RKIB 3I55S 3MVPA 2LBFA 1FFWB 3B8HA 3WX4A 2HVSA 1R5ID 2IGKA 2W25A 4XLCA 2VHGA 5DDRC 1RA6A 1HDDC 1LWXA 2RQMA 3R5BA 5ITHA 1IAWA 4V19K 1N88A 1YIOA 1X3UA 3EYYA 4LG0B 3SQGA 4NI2A 3KEQA 2CPEA 3MMJA 2GIZA 1ZYQA 3GFZA 4AXIA 2DTZA 3JCUC 4A3IJ 1FEHA 1IRFA 3D54A 3W2WB 1VRQC 4OZ0A 3DC2A 2PA8D 2ZC4A 2H8WA 2EK1A 2SXLA 1YZ6A 4DZJA 2E1NA 2K5CA 4NNJA 4RLQA 4PG5A 4E7SA 2M88A 3H5NA 4H4KC 4ZDPA 3OIOA 2ZFUA 2A5YB 3PYDA 2CJJA 3NLCA 1LXJA 2YNIB 3Q23A 3Q83A 1R89A 4BWJA 3A8JA 4LG0A 4NZ0A 4L3NA 5AJ3F 4RMNA 3RJMB 2KG0A 4FTHA 2W7OA 3EVWA 3BG9A 2HFOA 1FBQA 3K2ZA 4LB5A 3N01A 3S2WA 1X5SA 5HNFA 2HHWA 3BR6A 4LIRA 4HDHA 4I6ZA 3W65A 2CQIA 3HVRA 4KICA 2V4QA 1WWHA 2MTLA 1J59A 4RBOA 4RB3C 4RW4B 1EIYB 2DEJA 2V6AA 3LSKA 2VJJA 2M0GB 5KFZA 2KZVA 3OYKA 4XN3A 2IM3A 1Q1HA 3NL0A 4IOAQ 3DM2A 1H2UX 2XMKA 2DXEA 1W7WA 5IT9U 4S05A 3BB5A 2WHOA 2RQ4A 3SDEA 3WTUC 2BZTA 2HWIA 3OR1C 2DJNA 1URRA 3ELHA 5CZXA 3GEZA 1TP4A 2XULA 1BM9A 1XJWB 1T9TA 1E6YB 1UW4A 3E51A 2QCOA 3T5XA 3DDKA 1OSDA 4YHHF 5JJBA 2QLXA 1JLBB 3C18A 1NHKL 3SCKE 2Z58B 2POKA 2E1MC 5D0EA 3MCNA 2QMXA 3ERMA 4WZMA 2ZZMA 1O8BA 5L1IA 2DDAA 5ETRA 2W57A 4HX4A 1VYAA 3E6CC 2CZ4A 2BR0A 4XIUA 2FBKA 1EH6A 1K0TA 5M5WJ 3HIFA 1R8HA 1RSCA 1SANA 2XRLA 1NSQA 3MZYA 3MMAA 1XTAA 2Z1DA 2XI3A 1KFSA 2OTLS 4CO4A 3TX8A 2OAZA 2CPYA 4QLCU 1LV5A 5FKOA 4QWDA 3TA1A 1NH8A 1JJ8C 2DY9A 1O3QA 5E33A 1S3JA 2D3OR 2ZC2A 2UXBF 5EZGA 2OEJA 2GJ2A 3Q0UA 2QGUA 3OTCA 1DRZA 4N9IA 1NH7A 1HLWA 3EZOA 2W24A 2B4UA 3OIPA 4I76A 5DUKA 4RAZA 1UVNA 1X3WB 2FBIA 1M0SA 3LUYA 3HOUJ 2VPZB 1JLQA 2HRYA 4DCPB 3DU6A 2EBIA 3BG7A 2M9KA 1JI8A 1R27B 1WOPA 3FKJA 2BGCA 5L9XA 4G6DA 4C11A 2CWEA 4RW7B 1U1MA 2NXEA 5KFTA 2W84A 2ZHOA 3M8EA 2NSBA 4H4OA 2ZFHA 3OR2C 3M8QA 4PUOA 3G9CA 3KOAA 3PX0A 1I1SA 1MBEA 2XZDB 1PC4A 5KG6A 2BXZA 2JEFA 5CABA 3GV5B 1JLBA 3ISZA 2XHKA 1YDLA 4IDKA 1FTTA 1ORKA 2F5CA 2BOPA 2QYGA 2CXEA 2ACMA 1WPKA 1CULA 2R2RA 4QU7A 3H3ZA 4IG0B 4NC6A 4P10A 3J7YI 3DLGB 2B51A 3QAUA 5K5RA 2VJ4A 2EA4A 1U1QA 4DUYJ 3SQNA 3HOZJ 3K0JA 2AJFE 3AD7C 4HL9A 4ZCKA 4UVAA 1D0ZA 2FJBB 3BKUA 4B4CA 5D15A 3NBPA 2OGUA 1XG1A 2FD5A 2V0NA 4ECWA 3G8SA 2NSCA 1ZTWA 2LDIA 1WDDA 3FEXB 4RW8B 2WZ1A 3BDPA 3CDLA 1RU2A 2J8AA 3RB0A 3T41A 2Y0SD 3M2RA 4WYWA 4CO3A 2XIGA 2BHZA 2Q3PA 4M8LA 1WHYA 2YWEA 2XMUA 4B3SJ 3CCRI 4URQU 3UDVA 3NGSA 4BQNA 1PUFB 3FDSA 4I69A 2OF7A 3PKYA 2WB1D 1YBAA 3HPOA 1TKZA 4PPZA 4YQWA 4U0VA 3EZ5A 2AX0A 2WAQN 3AJ2A 4TYAA 4ZH4F 2LKSA 3SDEB 1RYRA 2VFSA 5H9FJ 4DR3J 3CC2S 1LEBA 1GXLA 1EB0A 1LOUA 2MY8A 2ZH7A 2L7MP 4A8WA 4DG1B 1F5TA 1JJ2R 2AYGA 1FOYA 2RRAA 3B78A 1Q78A 3DFEA 3ZZYA 4KITB 3H3VK 1IJFB 3GSIA 2HHTA 4GRSA 2B4PA 2DHAA 1D0XA 5KFBA 4DV3J 1UFMA 1DY3A 1WC3A 4XOPA 2ISZA 4PR6A 3SQGB 4ANEA 1XCVA 4B9MA 2HZTA 1SUQA 4M5DB 3K70D 2QT7A 5KT3A 4YY3F 2Q6BA 2J6SA 3JAMZ 3IH2A 4E4HA 1B1BA 4JI7F 3I4HX 1VQ7I 4PKDB 1NG6A 1S7IA 3CDIA 2JUGA 2MHNA 3SCJE 2W4PA 2X1AA 4LT6A 4C6AA 3TJAA 1SC6A 3GIRA 4LMYA 4RB0A 3TO8A 4WXHA 3V8JA 4EJUA 1FSHA 3R9LA 3U27A 4LF6F 3QWLA 2F4VJ 4F4AA 3MMYB 4KNYA 3NBPB 3LOUA 4DQQA 2BA9A 2YNHB 2XYHB 5HMWA 1MWQA 3RBXA 3EDQB 2DOFA 5ETVA 4F2SA 2MLXA 1I5ZA 1KKHA 4C2MJ 4DR4J 4HT5A 3E01A 2J9DA 1GXPA 1FA0A 1PJRA 4U7DA 1XMBA 2TRTA 1NHUA 2E9TA 3TR5A 5HODA 2QSWA 3BGRA 1VQMS 2BY0A 2JK3A 3TVZA 4KHRA 3C46A 1RTZA 2DT6A 4Y3OA 4DYRA 3O8HA 2ZBRA 1P6TA 2IVMA 3IO1A 2FY1A 2FMLA 1SAUA 3G71I 3T6BA 3HHLA 1UG0A 2VLAA 1KFDA 4QR2A 1RWNB 5J6XA 2R7FA 1QD1A 4DQSA 1H9TA 3CCLS 4JV0A 1WH7A 2GMJA 3AOBA 5LSLA 3HDDA 4LLNA 1Z2LA 1JLFB 4KGZB 3J81K 4A6EA 2M2EA 3EWGA 2GO9A 4OHXA 1IN7A 2HLTA 3FDYA 2GXAA 2MKHA 2H1KA 2H8RA 2IY5B 1FE4A 3KE2A 4F0MA 2WSCC 4LJZF 3U1KA 1AKHB 2BYVE 2W2PP 5DTDA 2DPUA 3DOLB 1Z3YA 5E3QA 1Z2ZA 3SCLE 1UEKA 1PJ6A 2Q79A 3ZTOA 4JI0F 4B9SA 3M8QB 3CDHA 3VEPA 1NPKA 3LAPA 4M72A 1PO6A 2W00A 3HZJA 4LG3A 1SB6A 1Z0XA 3M32A 2LK2A 5L3GA 2GIQA 4V2GA 4ZC3A 5KAKA 1OY6A 5LSRA 2X4HA 4Z6YA 4IVNA 4UOGA 3A0BC 2AJ1A 4OI1A 5DCMA 1XWLA 2JRTA 3BS9A 4IQXA 2FJXA 5F9LA 1S97A 3HHNB 2AO9A 1T3OA 3KLFA 2FA5A 4DXLA 3R2CJ 4R5PA 2LU2A 3ENWA 1U1LA 1X5OA 4DV1J 3FRYA 5AXLA 4BDPA 3GG1A 2HURA 1QSYA 3RTRA 1N32F 5I3PA 1IBCB 2RILA 1N52B 4NHJA 4CDGA 4RNHA 3ZGKA 4CO5A 1X7VA 5H1SV 4UUWA 3PQJA 1YIJS 3TAQA 3M30A 3SEZA 3MUMP 3SFZA 3ZMDA 3DWLE 2OUGA 1DU6A 1FJ7A 2JZYA 3I96A 3LA7A 2DH8A 3KJFB 3MZIA 4B3RJ 2DY1A 2FOKA 1LQ9A 4A8SA 3QSYB 4JI1F 2JSPA 4Y13A 2AIRB 2XZTB 3JQJA 4O0NA 2JC0A 3QU3A 4K5RA 2AZ1A 3I31A 5J3LA 2NLWA 3BQ2A 1C0TB 4R25A 2DMNA 2WB4A 3FNNA 3L2UA 4NE9C 4NYZA 2CV2A 3REOA 2J7WA 2UV8G 1U4BA 2GVZA 3SZGA 1TAUA 3M6WA 2CQQA 1VQ4I 2CJXB 2CMPA 2H3EB 2MLZA 3JTHA 3IUOA 2XF7A 3J81j 1XGMA 3MR5A 2WAFA 2KG1A 2G9WA 1U8BA 1V3ZA 1N78A 1DFDA 1E0EA 2RAQA 1G3YA 2HVQA 2KISA 3TARA 4RUBA 4HV6A 2ZHBA 4KE5A 3BC8A 2YX4A 1X4DA 2MKJA 4BUPA 1GMWD 2FHJD 2N4CA 5F04A 1MKMA 2XS2A 4X4TA 2DMUA 4A3KJ 1TKZB 1HNVB 4K8RA 5E3CA 4OZ1A 5LEKA 1VQKI 4PJNA 3KP6A 1HW1A 3PO4A 2M0CA 1ACIA 4JI3F 3WBZA 1W7PA 4QR0A 2CQ2A 1OCZH 2DQRA 2JEGA 3QAHA 3A13A 5BYQA 2YNHA 4HNUA 2FHOB 3WTXC 4OYMA 3HUGB 2QLBB 1VQ9I 5ICGA 3K10A 1KN6A 3WIVA 1GX6A 2DNGA 1HNWJ 3LP1B 3CW2C 4O0IA 1I5OB 4CNZA 2F65A 4KH0B 9ATCB 3EUKL 1ERDA 1F3VA 3MURP 5D4SA 1UW9A 2ID3A 1CC8A 4ZKAA 2IHR1 5I3UB 1YJ7A 4G9YA 3ZQHA 2X9DA 1ZM4A 3EDRB 2VZ9A 2ZH6A 2MC4A 2DH7A 2E1AA 5F08A 5HI7A 3R97A 4FXDA 1V3SA 3GFXA 1XR6A 5ETOA 4ZN1A 4LRCA 1PYVA 3MR2A 4A3JJ 1CJVB 4GO5X 1V5EA 3OYDA 4JX4A 2GQCA 5A2QY 3M7VA 3CIMA 5THWA 5J4VA 4KJZA 3NOCA 4NLDA 5KFOA 3HFVA 2AJ0A 3W1YC 1WUUA 1RWUA 3I6PA 3L2WA 1LW2B 5EHHA 5T7LA 1XGOA 1OY9A 2IDLA 4L9NA 2CNOB 2EWHA 2P6TA 5IT9Y 4XICA 2HIYA 4U0WA 2F4IA 1WOSA 3NNCA 2VQLA 1NM2A 4RNNA 2MFZA 3IH3A 4CCKA 1R6VA 3QODA 4F4XA 3P3DA 5I42A 5CA5A 3QIDA 2V8PA 4OLOA 2MKKA 1V5FA 2WW8A 2F5DA 1GFWB 4ZPDA 1TZ0A 3CUQC 1SFKA 1FX4A 3UCZP 3BROA 3AB4B 4DZ6A 1EKEA 1T05A 1MROB 1KBRA 2O3DA 1N36F 2NQPA 5J1YA 1RAGB 1L3LA 2ASYA 3IAM9 1U45A 2K4BA 4P9FA 4M5NA 2VQHA 3WU2C 1RC9A 2IAJB 4BDYA 1F6TA 2QKMB 3DKYA 3CCWA 1X9WA 1LW0B 1H2TZ 5A8WA 1OWXA 3H1CA 1FXDA 4X62F 2EWNA 2G0IA 2XKOA 3BQZA 2CWKA 3FHZA 1FNNA 2NVUB 3KP4A 1Q53A 3IKTA 5KVRA 1FFGB 3LW5C 3QGHA 4A3LJ 4LFBJ 3MKYB 4YB1P 1KQ0A 4URSA 5FIIA 4FF4A 2K27A 2KFDA 2LDYA 4EZ6A 1TC3C 3H2LA 3PNVA 1RHRB 4OZLA 1RAAB 3VODA 3JB9k 2CQBA 1NJWA 2HTSA 1B7YB 3IBWA 2EFWA 1CPZA 3PFIA 2H51B 1L5UA 3MMBA 4J9RA 3MI7X 3BJOA 5D3GB 3NGKA 1LW2A 4E2FB 1QHHD 2D3O1 1X1DA 1Z1DA 2ETHA 1CF7B 2DR9A 2W4CA 2ZMEC 1HBXG 1N25A 4F36A 2GVDB 4G94A 2OI2A 2BKNA 2C3MA 3FZ2A 5D78A 4C2UA 1FRIA 3LGMA 2A2CA 2HQRA 2R7SA 5F8MA 3QU6A 3HTSB 1B72A 2XCPA 1WJAA 4HA8A 3FX3A 5DM7F 3KDNA 2Y8YA 3B6BA 2M8DB 5EEHA 4ESBA 2WK4A 3AG2H 1HDPA 2ZJRQ 1S6OA 3EQLF 4ZITA 3VALA 1EKRA 2HAFA 3RKYA 2DRDA 3X1LB 2XSJA 1BIBA 3I9ZA 2EVZA 3LTOA 2CFXA 3I0RA 4A3BJ 2GXBA 4XNFA 5AIQA 4OHYA 3U1MA 3G8QA 4KY3A 3HI9A 1BA5A 3J7AO 1HF0A 1YK9A 1T9WA 2JDJA 1YW9A 1Q79A 2HGMA 3H4DA 4C3IJ 5IT9K 1OCOH 4H4MA 3CUNA 2HHHF 3Q86A 1YX2A 1GLNA 3ZZTA 2CJ9A 1ZGWA 1S7HA 1JJHA 9RUBA 5MLCV 1X1PA 4EVIA 2VQEJ 1MJAA 2DYRH 1MNEA 2HOAA 4YFXF 3VAIA 4IXAA 2MPUA 4CXFA 2J9CA 4NLWA 3DEWA 2AXLA 2KIMA 2HPIA 1R0BG 1Y0HA 1X0PA 4CZCA 4ZA1A 3RZAA 4J9UE 4L9VA 1V5GA 3QFWA 3TQ1A 2H5EA 2E1OA 4GVBB 2DNKA 1A9NB 5ETMA 1VQ8I 4YS2A 2RRNA 3CXCR 1VC5A 1FT9A 1UFLA 9ANTA 4J19A 3IWNC 4I0AA 1KQKA 4K4SA 4E7IA 1W5TA 4MO7A 2K7LA 3RKWA 2DW4A 1S9GB 3LSGA 3ZZOA 1JUSA 2ZEJA 3HKWA 1OO0B 3MDFA 4P71A 3PEHA 1K7AA 3UDLA 2X1EA 2OP5A 4JB8B 1Y3JA 4KMFA 4BBYA 2QL9B 1GUUA 2HRUA 3DU5A 4DZPA 2L4MA 3PW2A 2DNHA 3TVYA 2YNFA 3M2VB 3P8BB 1LKZA 2OUMA 3V7CA 4AVZA 8AT1B 2E5JA 4U7CA 2C3UA 2VKRA 4NUBA 1NK4A 5JVGF 2XC9A 3HHGA 1TR0A 4XLNF 3KETA 2F5GA 1RWOB 4XONA 4Y2KA 2JJ7A 5K5MA 3CCZA 1B64A 4K4YA 1RQ0A 2YKNA 4B3SF 4DLGA 4LFAF 3OJUA 4EGZA 1S79A 5HVGA 3IV5A 3JTPA 4XTTA 2Z2SB 5F1RA 4MLOA 4ZYAA 3FC9A 2IYIA 1YW7A 3HPGA 1XMOF 4OI4A 1RBAA 1UCNA 3ENAA 1T9YA 3GU0A 4MTDA 3KNGA 3C7JA 2OQRA 1HPZB 4I7FB 4B09A 4DW6A 1Z1ZA 4KHPF 4ECRA 2XSJC 2CQ1A 3R7SB 2ZITA 3A4TA 4BJ5C 3TP2A 3K4NA 3ZMVA 3SZ2A 2WVDA 4CLWA 3FBNB 1PP8F 4B9TA 2Y30A 1MJ9A 2AJ2A 2DR7A 1XC9A 1O3RA 4L9JA 2OEMA 2FJVA 3IRWP 4BYYA 4OYPA 3J80Z 3OYCA 1TK5A 4EATA 3M1EA 4YDXA 5KFDA 1DJ0A 2XI2A 4ICLA 3MEKA 4I0BA 4NXMF 1PAEX 3MCSA 1R7IA 5DQIA 3FBEA 1KVIA 2BQUA 3FMWA 2P7CB 3PSFA 2L54A 5GAGI 3GV8B 2EB7A 4O23A 4LQ9A 2VQEF 5EG0A 1YBUA 1BLUA 1S10A 4K0KJ 1FY7A 1JX4A 3GX4X 3VWBA 2KHMA 5A2QU 1OFCX 3ESWB 5E8GA 2LVWA 3DRRB 4OV1A 1HW9A 1X9SA 1VRTB 1Y0UA 5HATA 2BW3B 3L9FA 2VKZG 4GC6A 5HMZA 2ZH4A 1JNZB 4XKWA 1IKYA 5KFFA 1H98A 4J00A 4PUSA 4UTGA 1X4OA 1FTZA 5HJYA 4KT0C 3ETMA 4V19J 4IO1A 5ETPA 5KFPA 1IDZA 2YKAA 3D6MB 5IOZA 2DMPA 4DX6A 4OIRF 3W66A 4FVCA 4J37A 2EQRA 4IOAF 4A12A 1R8CA 4RM2A 2E60A 2QM3A 1LWEA 5FLXZ 3P5TL 2HFHA 3K58A 2EFQA 2Z2MA 1ZAOA 4JP0A 4Q5SF 2IC3B 4AXJA 5ILUA 2J0QD 4FBUA 5IPAA 4MH8A 2C3YA 3TZXA 4XKBA 2YXLA 2W2OP 4YB5A 4ESFA 1IM6A 5FDLA 2ADBA 3COAC 2EEYA 1SKUB 1FJGJ 3FGVA 2ZH1A 2MY7A 1OJ4A 1ZARA 1JWWA 2MZRA 4M5LA 2MZ1A 4Q8EA 2DR6A 4D7MA 3E3XA 2E34A 4ZYGA 2DGOA 1RP5A 3DRPA 5LBQA 4DHVA 1NH3A 1U1KA 1S1VA 2ZJ2A 1XMOJ 2OD6A 2V9KA 3VQTA 4PQUA 1D8JA 1KEKA 2N3LA 1IQZA 3HSEA 1T56A 1RAEB 4CGZA 2ZC3A 4LQ3A 4X6AJ 4XRMA 2R42A 5B5EC 2WW4A 3CVKA 8RUCA 3KHHA 1B9MA 5GAEJ 2K2PA 4CTAA 1Z4UA 2H5JB 3V7RA 3UVJB 5JHUA 4WU3A 3QP6A 2K3PA 1K1QA 2B0LA 1A7GE 3BGRB 3H92A 4ED0A 1MDMB 3ETOA 2D2WA 4ED4A 1GH8A 2K7KA 2O5RA 4IQJA 4XIDA 3HRTA 1X4EA 4OIXA 2ZM6J 3KJVA 1R58A 4WIQA 5E7OB 2QL5B 4C2MA 1D8KA 3BJAA 1WKJA 4F93B 3M4XA 4JI4J 3EM1A 1ACMB 1WJBA 1QVFR 1WF0A 4LF1A 4Q45A 2OD5A 5KFUA 2WTFA 4BCAA 1X4CA 2E36A 3G3ZA 5GAGJ 3RZDJ 4J9PA 2O6GE 2PT0A 3C3LA 1VI7A 4QBUA 4RZRA 3O3LA 1OMSA 3JRBA 3R8YA 3A8IA 4KKOA 4ECQA 2R93J 3UNGC 1JB0C 2WB1A 4ZMMA 3FCVA 2HZDA 2V5HG 1XGSA 2JPBA 1BE4A 3K1MA 1PYOB 1SL2A 4JX6A 3SCIE 3UR0A 3BN7A 1UEVA 4PJJA 3R7BB 3T8RA 4E6KG 3MECB 1N75A 2QBYB 1KHWA 1ZRDA 4A3GJ 1TFWA 4XRSG 2HWHA 1B4AA 1HHTP 2QF7A 3R5AA 3BTIA 3SSSA 5ETTA 5JLXA 1R22A 4R1HA 3SBMA 3QYBA 3C15A 2U2FA 4F4WA 1QAXA 2WVBA 1RNLA 3T1BA 4V2FA 4DNCA 2XYGB 3ITHB 2DA1A 3I55I 3P7NA 1HD0A 3PO3J 4BQQA 2MEWA 1RHQB 4WKYA 1KVKA 4G1QB 4P2SA 1RT4B 1RT1A 4CO8A 1X4GA 2VJUA 1H73A 3PEJA 1FI4A 4P73A 1HR0J 4MJKA 3IL2A 3F3XA 3ZP5A 4H54A 2GQ2A 1VR6A 3KK2A 4NYOA 4LFAJ 3AQPA 5FJ8J 4Y00A 2BANB 2JRSA 2KDZA 4FS2A 1RKJA 2WRMA 1VQ9S 4LR8A 2RKIA 4ED6A 4BXFA 1TL7B 3FRZA 3A1YG 3E6MA 3FFIA 2JEIA 1IKVA 2XMWA 3LWMA 2VXZA 3D5SC 4CLZA 1UMJA 2FY8A 4I2PA