1LFPA

Crystal structure of a conserved hypothetical protein aq1575 from aquifex aeolicus
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
243
structure length
243
Chain Sequence
SHWAQIKHKKAKVDAQRGKLFSKLIREIIVATRLGGPNPEFNPRLRTAIEQAKKANMPWENIERAIKKGAGELEGEQFEEVIYEGYAPGGVAVMVLATTDNRNRTTSEVRHVFTKHGGNLGASGCVSYLFERKGYIEVPAKEVSEEELLEKAIEVGAEDVQPGEEVHIIYTVPEELYEVKENLEKLGVPIEKAQITWKPISTVQINDEETAQKVIKLLNALEELDDVQQVIANFEIPEEILQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein AQ_1575
publication title Crystal structure of conserved hypothetical protein Aq1575 from Aquifex aeolicus.
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Rna binding protein
total genus 68
structure length 243
sequence length 243
ec nomenclature
pdb deposition date 2002-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01709 Transcrip_reg Transcriptional regulator
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.200 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1lfpA01
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lfpA03
3.30.70.980 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lfpA02
1KONA 3HPHA 1MW7A 1WJEA 4F3QA 3F9KA 1WJBA 1WJAA 1LFPA 1WJFA 1WJDA 1K6YA 1E0EA 1WJCA 3HPGA
chains in the Genus database with same CATH superfamily
2HS3A 1KFDA 5KG7A 3OHBA 1HF0A 5I42A 1ZR2A 4RNOA 2I5UA 3I4NJ 5GAGI 1LJ9A 1ORKA 2IVMA 2NZCA 2QIFA 1LWFA 4E70A 3CIMA 2DY1A 3W62A 1FDNA 3OFFA 4AIDA 2W48A 1G3TA 3F72A 2RNJA 4MH8A 1WH7A 5HLGA 4F2RA 2ZHBA 4WBFA 4P55A 4DGWB 3TQEA 3HSGA 1MH3A 4OHWA 3KK3B 4RBOA 2Z2YB 2PMZA 2CNKB 2MQPA 4TU7A 2D3ZA 3JAMK 1Y11A 1SC4B 1RWUA 2FU4A 3RAMA 3BR0A 2HQDA 2BV3A 4DR4J 3LSPA 5E3MA 4LF5F 3EVMA 2L41A 3FBCA 4OHXA 4LLNA 3NMRA 4KBIA 2FJBB 4L73A 3HLUA 4ZTJA 2UUBJ 1KU9A 2ZOFA 5KG1A 3V6JA 2KVQE 1LKXA 4LREA 3M4XA 5KFQA 1RT5B 4YOEA 4XRFA 4U7BA 3PEHA 2HHTA 3VAGA 1Y0HA 5HP1B 2JC1A 3ET6A 4Q7AA 2AXLA 4FF3A 4RBUA 1Q16B 1U09A 4X2BA 2MA3A 4DCOB 4H4MB 2OCCH 1ZPVA 2J7WA 1RT7A 2DA1A 1E2XA 2VFVA 4QPQA 3ZGKA 2HHXA 4BHBA 3RKWA 3BCBA 1E0EA 2C3MA 3TUZC 1KN6A 4XORA 1FKOA 2RS2A 1ZYQA 2RAEA 3ILIA 1YITI 3OQ2A 2DT6A 4CT9A 2VD3A 1RT3B 4X0GA 2M3AA 3SQGB 4F93B 4RNHA 2DOFA 1MMNA 2BUNA 1TKXA 4F4XA 1L5UA 2VBWA 3CQZJ 4RW6B 1FCAA 2J6UA 1SQGA 3FBNB 2UVUA 2GGPB 2A5YB 4I98B 3SCIE 2DOEA 4OX7A 1VQSA 1R7JA 4ALZA 1JHFA 3JYTA 5EG0B 4C8YA 1OYIA 4ESBA 5DDRC 4UUXA 2RRBA 2NOGA 3ZQFA 3FEZA 3JRBA 2FLLA 1ZGWA 2RU9A 4KQZA 2QWWA 1GK8A 4PQAA 2KM8B 4JOMA 2KB2A 2O01C 3RB3A 1VRTB 1NHVA 2WAQN 3CC7I 5AXKA 4EYIB 1NZAA 2X3GA 3QT5A 1D3YA 5BNGA 3G8TA 4LF1A 3DKWA 2L9RA 5E3RA 2HVDA 4KT6A 3KWMA 1FK9B 1RHJB 1QTMA 2HOTA 3PJWA 3MMCA 3UW1A 2B9YA 3Q8SB 2CSOA 4DR5J 3DYAB 2XRLA 1UZCA 2JSCA 2QLJB 3UQSA 2FNAA 4NRUA 4KT5C 4QIWN 4LG3A 5DGAA 2AS5F 5H9EK 4V2GA 1SQEA 4OAZA 4Q43A 3MR3A 3UWTA 1R1TA 3CCTA 2AJFE 2FNPA 1Q5YA 2Y0SD 3NAHA 1HSJA 5GADU 1XGNA 3PNTA 4Q8EA 4G7ZF 3SSQA 1WQ2A 2UXDF 2C1EB 3VGVA 5J1RA 4CLPA 1S6PB 3EXYA 2R8KA 3CCJI 3H5AA 2VKDA 1JLGB 3BCAA 1RHMB 4ZVFA 4H4KC 1WC5A 3S1NJ 1OPZA 1NTCA 3D9BA 2HQRA 3BEGB 1JQGA 5B0AA 5KTQA 1O5JA 4LUBA 1NHUA 3DC2A 3C16A 2FGCA 5J40A 5D5XB 3VAFA 2EFPA 1DHMA 2MKCA 2DQLA 3SZGA 1HR0F 2DA2A 2HVRA 4YQWA 3GCWP 5M2RA 5EEAA 5J2MA 3DBRB 3H2VE 1HLVA 1STZA 2ZM6F 3V81B 1NDLA 4LG0A 2QLBB 3QZ7A 5E1WA 4DR1J 2KIFA 1WOPA 4KKOB 2DQRA 2KJVA 1PJ7A 2CXEA 3Q8VA 2IJRA 4IFVA 3SCKE 1JLCB 4QLCU 1RC9A 1CS4B 1V5VA 3MVPA 3CNQP 4M5JA 1HNVB 5HODA 4ZH4F 4NEZA 3IBWA 1VQPI 2C2RA 5JVGF 4P74A 2DK8A 1HKAA 1RWKB 2V4JB 1VQ6S 1RYSA 2V1DA 2YBVA 1B3TA 3DLHA 2PFDA 3QPLA 5KT5A 2XY5A 5F9NA 2ME0A 1PIEA 2M8DB 3RAXA 3LP1B 3PIOQ 3VWBA 1N56A 5EDWA 2VG7A 3MM8A 3OYFA 3GFHA 3HHKA 1EX8A 1RAIB 4O5VA 4MEXF 3GTOJ 3FCWA 5A8RB 1D1BA 3AOAA 4LF7J 2FHJA 1LDDA 1L3VA 2ZH4A 1R3NA 1TLHB 4CZCA 3M1VB 3DLKB 3W66A 4W98A 9ATCB 3V4GA 2NAZA 1FBQA 3GIRA 2HBYB 1TT5B 2FA5A 1FRKA 2R3SA 2HNHA 4YP3A 1ZARA 1ETQA 2I5JB 3D28A 4DX8H 3BG3A 2RKIB 2BVZA 2ILZA 3W2VB 4OOIA 2KKHA 4GGGA 4USWA 1T9XA 2UXBF 3MUVP 3CC4I 2MABA 3NGTA 5L3EA 4M72A 2E1NA 1LKZA 2Z0GA 2NS1B 4KYZA 2RRNA 1R71A 1EETB 1ZLJA 4USVA 2Y9YA 2LLKA 2CJQA 5T7LB 3VSKA 2H8WA 3OR2B 1Y39A 1XX5A 1REPC 3T1YJ 3ZQCA 1S8NA 5L3DA 2M9HA 4LRCA 3V4IB 5K14A 2JC0A 1WKKA 2NSCA 1X4AA 4WKYA 2E1RA 2YPYA 5K8PA 3OXLA 1HFEL 3VGSA 4L0ZB 3DGPA 4G94A 4OZ0A 3CJ3A 3TX0A 5A2QY 4ESJA 1X4EA 4HZFA 2HVSA 2DMQA 3CD7A 4O4GA 1RT2A 4DV6F 3X1LB 2I2YA 4GCVA 1DU0A 1MD0A 2P81A 2HK2A 5F3ZA 3T6BA 4GYGA 5DQIA 2R8JA 3BH7B 4N77A 3V2UC 4RS8A 3KP7A 4UZBA 1T03A 1ZTTA 5EWFA 3G87A 1FZPB 1FNNA 1HNWF 1G3YA 1YZ6A 3B6CA 2RF2A 3DI6A 3KLVA 2CV2A 3QSYB 3MECA 4LT6A 4ZS6A 5HO4A 2AHOB 5KFNA 2EG1A 5D6GA 4I68A 3KHHA 3O2IA 3LAJA 3R5BA 2MZRA 2KT3A 1V9OA 3HHDA 4HLBA 2HLUA 2RDDA 3HCXA 1FDAA 1BM9A 1QVUA 2YKNA 2DK5A 3ELHA 1RUOA 3BBCA 2E1AA 1OCTC 3H3UA 4CYCB 2OPQA 4E4HA 4G6QA 2RKHA 2JEIA 3PG9A 4NLUA 3DEUA 2BQRA 2E1MB 4PZVA 3MI7X 2YWKA 2W8KA 2DXFA 1S9EB 2WB1N 1TFWA 4L9TA 2ZXWH 4MFDA 4PWDA 1RBLA 2JL9A 3MMAA 3KNAA 4JV5J 2C3YA 4W4MA 4BY1J 2X6XA 1NEEA 4XDCA 3FRZA 4IG0A 1EQMA 1F4KA 2XV4S 1JB0C 1RPWA 2HTSA 1S1VB 5E3PA 1OCCH 4AFFA 3GBGA 1O7LA 2MJNA 1NPRA 1TBXA 4URGA 5TGTA 3J81K 1HD0A 1KZHA 2DNHA 2LMIA 4HLYA 4FX4A 1OLTA 4PG4A 2V34A 3B54A 3U1LA 1WGXA 1RTDA 1WHYA 4NA1A 2GQCA 2W9BA 2P9CA 1H73A 4B08A 2BBEA 2QSGX 3S1RJ 1UEKA 1NJIT 1T39A 1KONA 3T19A 2W24A 2ZXIA 3MHYA 3HOWJ 5T14A 4AIHA 2BVLA 4R5PB 3MQ0A 3W8PA 4OMFG 1UVIA 3VB2A 2XZDB 3RJPA 2V8HA 2CQ0A 1U7LA 1HPZB 2KT2A 2YNFA 1NSPA 3GFMA 3HKZD 3FCVA 1OQ6A 1G1XA 1KVIA 2XY7A 2LD5A 3UDCA 1WJFA 1GX5A 1RNLA 3T1BA 2V6AA 4YR3A 5I42B 4H4OA 3DDIA 2CZ9A 4IHYA 1RB0A 4DPOA 5L1LA 3OYDA 4ZVQB 5F0FA 3SV3A 1MJBA 3CJQB 4LK0F 5CPRB 1RTZA 5DV5A 2MQLA 1S9FA 1JKHA 4EV0A 1TKDA 1PG5B 2DR8A 3MKLA 4J9OA 3JR9A 2Z16A 4FE4A 2QMXA 1X58A 3NGKA 4F4KA 3QU3A 1BJAA 3H90A 5D3GB 1RZMA 2CUEA 3PACA 4ZP9A 5HL7Q 5D0RA 4BNCA 3F41A 3LFUA 2I6WA 2K27A 4NZ0A 4DX5A 3AL0B 1RWWB 3OMYA 4IPAA 3BGLA 1PYOB 3M7VA 2EPIA 2B4UA 3D0HE 4FPIA 2XB5A 4MKVA 3GV7B 5ICGA 1YJRA 5E8GA 1LQ9A 1HNIB 3NS7B 4JI2F 2C2KB 1PYVA 3FK4A 1KHWA 1WEZA 4F50A 1V5IB 4IH6A 1ZHFA 1ZS6A 3D0GE 3MURP 3HPHA 2L9DA 2VE9A 2NQPA 4K4TA 2AKWB 4XMYA 1P9YA 5C5JA 1RT7B 4EZ9A 4LRFA 2WONB 1XQIA 4II3A 2W7NA 3ZPLA 3M2RA 2HBZB 3J7ZI 4HHUA 2ZSIB 2IGNA 2ME6A 1TL3A 1FX2A 2VQFJ 2XS5A 2R7FA 1VQOI 2CKWA 3QYYA 1RT4B 3CDBA 3I4HX 2B5JA 3CJ2A 6PAXA 1KR4A 1D0XA 3ABUA 1XD7A 1FKOB 4LBPA 4KISA 1WC3A 4EZ6A 3WU0A 2A1BA 4YDXA 2V2ZA 1X4OA 3OFGA 4ZPCA 2GIQA 4DXLA 5FD1A 1QRYA 4QW8A 4TQRA 4EYHB 4RB3C 3L2CA 3V8LA 5C44J 4QR0A 2L2OA 4CYDA 4FHTA 3G6EI 4AC0A 1RT1A 3A1YG 4JX6A 4Y33A 1O3RA 5DCMA 2MQNA 2QA4I 2BXJA 4GKJF 5FKOA 1HQCA 5D4RA 1T0TV 2W4PA 2JLEA 2DYAA 3PNVA 3T5LA 3HHNB 3JCUC 1IAWA 3HI9A 3SI8A 2X4HA 1QSYA 2IVFB 2EFWA 2NNNA 2ZD1B 1LFPA 2G2OA 1MIJA 3KIOA 3QGPA 3ZNJ1 4WFAQ 3FWEA 1RAEB 4KA4A 1ZOTA 2GLOA 2V8PA 2EB7A 2ZC4A 2N82B 2VG6A 3BGRA 4RGSA 3TZZA 2L9SA 2EA2A 1JGGA 4NC8A 5E17F 3VWSA 2J8AA 4BH9A 3JSRA 1QZZA 3Q8PB 3QO9A 5ETSA 4Q2MA 3RQ4A 1HA1A 2J0WA 2LEAA 1FJCA 1Z2ZA 3EWGA 2EFOA 1R6YA 2BY1A 3TEGA 3MR6A 2DPIA 2ZDPA 3PEJA 1DGWY 4IG3A 3HG9A 3H0DA 3I71A 1T6SA 2M45A 2K5CA 4RB1A 2OKQA 1RU1A 4GKKJ 2Z3YA 1FE0A 3GFXA 2ECBA 2ROPA 4Q48A 1C0WA 4NQWB 1I39A 4LRBA 2AW0A 4KO0A 3BR8A 4LIWA 3D5RC 4KE5A 4ZDNA 3LP0A 3MZYA 4Y2KA 5CQGA 1WHWA 1ZQ3P 1NHKL 2N4DA 2IRFG 3GTKJ 1YJTA 5JJBA 4XONA 4E7ZA 3CJ0A 4CA0A 1XMAA 5DRKA 2L7KA 2C2OB 3DCAA 1XMXA 4OAYA 3BTLA 4DV0F 5I3PA 4II2A 4RGUA 1WEYA 4XICA 3C16B 4JI7J 4X4UA 4B1RA 1WI9A 1OYWA 2CPFA 2IA0A 1I6XA 3ZMUA 1HQ2A 4KJZA 3ZOBA 3CLQA 4MEYF 4AQYF 3WGHA 2QX0A 1IBMF 4F91B 3MR7A 3C3WA 4DV1J 3LL7A 4DSLA 3MFHA 1MN7A 3S14J 1FTZA 2B7BB 4OIQF 4IFVB 1WG4A 3M8PB 1XMOJ 5FLXK 4A4JA 1XSXA 2HFVA 2YX4A 4UUTA 4KPCA 1IR2A 3FKJA 1SV5A 1OYEA 4FE7A 4ITVA 3D3CJ 5IP7J 3Q9SA 2UUAJ 2K9QA 2EG2A 3P3DA 2BHZA 4LIVA 2VG7B 3C66A 2W25A 5EGYA 3ULQB 2AJQA 4F52A 2Z9OA 4PXEA 2ZXHA 2HHVA 2R5YA 2KM8C 2XAJA 2K1RA 1JXVA 5H20A 1AYEA 1BA5A 1WF1A 3OOPA 2DXIA 3OYMA 4FZVA 5IP6A 2V8GA 2IA2A 1SANA 2U1AA 3EDQB 2YNIA 1RHUB 2NOJB 3QRFF 2ZO4A 3CCRI 1N33F 1FRLA 1NKCA 1LW2B 3B78A 2PI5A 3DOLB 4MQ9F 3BYRA 3LSMA 4DR6J 5KFVA 3Q83A 3PW4A 3IH2A 1QPMA 1U8RA 2FHOB 1XNRF 3RCOA 4IRHA 2Q43A 3LF0A 4DZJA 2M2EA 3F44A 4IOCF 2PX9A 4M6XA 4A8SA 3FXOA 1P1LA 5B0GA 4FF2A 2F9JA 2JA2A 3RIRA 3OL3A 4OIXA 2J5PA 3RYRA 4UW2A 1RJJA 2KJCA 3B4DA 2BKPA 2E34A 1FIAA 4IQMA 1AZSA 2W7OA 4DV4J 3QWUA 4AUKA 5M5YJ 1B0TA 1CVJA 3ZN0A 3WTWC 1DQ8A 4YIRX 1APSA 1S6QA 4Y00A 3P5BP 4HL9A 2LKPA 1SIZA 1F5AA 1FWKA 1NJXA 2R9LA 1AHDP 2QA2A 5E3CA 2HLTA 5B0BA 4DZPA 4HW0A 3MZHA 3OS1A 1RT2B 2CQ2A 1S1TB 2DR5A 2RAQA 1U6ZA 1JJCB 2NS7A 6FD1A 1T03B 3DQVC 3FNNA 1JXLA 3IM9A 4HACA 4I69A 3VAKA 3HKZN 3OSNA 3N4MA 3BG7A 2RF2B 3DI6B 2AJ4A 2LK2A 2BEFA 3PW2A 2HZTA 1AROP 3RU0A 3WHIA 4AE5A 2GJFA 4OV1A 1H9GA 3S2WA 3CXCR 2B9WA 5IS2A 3BB5A 2MLGA 4NLWA 2DYRH 5CCLA 2YKNB 3W61A 4N4OB 3R5CA 5AE1A 1VIOA 5KFJA 2V4JC 4NOHA 2EZIA 4RWWA 3CMEI 3RG6A 4KMFA 1PKUA 3VTIA 2BKNA 4K5SA 2MLZA 2GHVC 1YJ7A 5F8GA 1HNZF 4FBTA 2M30A 2AYBA 4ZVUB 3Q8QB 1R27B 3COAC 2D1CA 2X6OA 1X1AA 2MMYA 3M3YJ 2QMUB 5EEGA 2VQGA 3K4CA 1KP6A 1NK8A 4DL7A 1W0UA 4RLFA 4PWDB 1ON1A 3DLLQ 3E6BA 3MGJA 4YFKF 1QVTA 3CSKA 4NUBA 2HZAA 5DQGA 2NRAC 4O3NA 3V5RA 4A8XA 4X64F 4ZCMA 1FTTA 1IN7A 2OZUA 1TQLA 1GNKA 4E7KA 4CCJA 5E3NA 1V4RA 2R92J 2VFTA 2ZBIA 4DUZJ 3I59A 1X2NA 1UMJA 4QU6A 3BF4A 3H1CA 4IFYB 3DHXA 5DM6F 5FDLB 4Y6IA 3IR5B 3HF5A 5FROA 2MXYA 4HX4A 4IRKA 3HSJA 3OYAA 1CQNA 3OR2C 3NEKA 3K5OA 2OD6A 2DIVA 1PVEA 1A31A 4LF9F 3GJQB 4U8VA 2LDIA 3FMSA 4AVPA 1RWVB 2HK3A 3ZZPA 3DRXA 2DU9A 5HS9A 5JHFA 4PG7A 3BV8A 3KX2A 2Z5UA 4X6AJ 4ZC3A 4XRSG 1TAUA 1ONVA 1YYVA 3C8YA 5AE2A 3UNYA 4A3FJ 4Z2YA 1U5TA 1TL7B 1V5EA 3KYDB 2XPVA 2HQIA 2WADA 3QT6A 1JGSA 1R49A 1DUXC 2E9TA 2D45A 2MPUA 2X7IA 3JRFA 4LBHA 3PSFA 2EFGA 1Y3KA 5LRSA 2AYGA 4J37A 4EEYA 1KLMB 2LDUA 1EZZB 4H4OB 4DZDA 4BYYA 2HRUA 3MM5B 2H6CA 1V5FA 1BJZA 5C24B 3BTCA 4EM2A 2DHSA 2Y0BB 3EYIA 3LQVA 1IDYA 2VA3A 4M5NA 1VQLS 1Y1WJ 4J9PA 1ZZFA 5JHUA 3HVTA 5KT6A 3PV8A 5L8RC 1GXTA 2EVZA 1RWXB 3BGOP 4PRFA 2IAJA 1IN8A 4UY8I 4UB8C 1APLC 3HKWA 2RDIA 3HD2A 2ID6A 3FKBA 2F4VJ 3SFGA 3NMAA 4WF9Q 1U1KA 3F9KA 2C22A 3KLOA 4W92B 1FOKA 5ETVA 1N52B 4ATNA 2O0YA 2V1NA 5F8JA 1W7PD 5C42A 1ELOA 2DJIA 2E1MC 1FVSA 4TYAA 4Y52J 3KP3A 3MUMP 2XSJA 4C9DA 4LMZA 4K2XA 4P1WA 2UV8A 4J90A 4GRIA 1QQIA 1OMIA 5K1YA 1D0YA 1WKMA 4XLAA 3MEEA 4FETA 4O3RA 2CZ4A 3JTPA 2DPDA 2X9DA 3LGMA 3TDUC 3M05A 1M1EB 5LOQA 2OU2A 3L00A 3I56I 3F6OA 3I54A 3MR2A 3LGNA 1WD6A 4FCYA 1BMQB 3WU2C 3KJVB 3RRHA 4NBQA 4B3OA 3U02A 3JXOA 3G9CA 3RYPA 5D5UB 2UXCJ 3G82B 2LXIA 1VISA 4BAYA 2YSRA 1UFMA 3W6KB 1SFEA 1NJWA 2CGPA 3BGFA 5EEHA 4O44B 3A3PB 1IM4A 5ETTA 4QTRA 3HZEA 4M73A 2KZZA 3C14B 4QWCA 3NBPA 1BIAA 7FD1A 1U0HA 2RB7A 5AIQA 4BBYA 2CWXA 3FISA 2ZJRF 3Q0VA 3KP2A 3U1DA 1RT1B 4D9JA 5DCMB 3GWCA 2XDVA 3FCHA 1I5ZA 3CJSA 1FT8A 2Q8KA 1XDSA 3VEPA 1RTJA 1W5SA 3KDOA 4U96A 1S12A 3A01A 5HANA 4DBRA 3GR0A 4ECYA 2ASJA 3B4MA 1Q0NA 3TW6A 3BH6B 4UVAA 3CJNA 1CG2A 1L0OC 4E7JA 1AFJA 4GXOA 4ANCA 2DGUA 2QUFA 3MAJA 2B7EA 3MM7B 4Z7CA 3RTRA 2CUYA 2VG6B 2VQHA 2MY7A 1SVDA 2XYGB 3DXSX 1ZAWA 2QZ8A 2HDCA 2IBOA 4JV1A 3RTVA 3TAPA 2UUCF 1W25A 5K8NA 3PQJA 1WACA 4NLSA 3QO9B 4HBLA 4J9UE 3PO3J 1C4CA 2MQ8A 2BVMA 3GIMA 4C0OC 3F8CA 4ZCIA 4IOAQ 3GZ5A 1XCBA 1SC6A 2WV1A 3D6TB 3RQIA 2CJXB 2E29A 2JVOA 2NREA 2OCEA 4IG3B 4WCGA 3IM8A 4FXDA 2BJ9A 3D6MB 2FJEB 1V55H 2DHAA 4WK3A 1VZ0A 4ELUA 2JA6J 3G8SA 1FC3A 1X8DA 3JSYA 1NBEB 3AL0C 2BJ8A 5LM7E 4KO0B 4QZVB 4ZVSB 3LP0B 4NXMJ 3LTOA 4QIVA 4IDKA 2OMLA 2LEBA 4WP8A 3CZ6A 2OEKA 4DR2F 1GQEA 2PIIA 3KKFA 2H65B 3ZZYA 2OFGX 3TEHB 5KAKA 3MM9A 1TP4A 4ECWA 4AD9A 4D7NA 4MYTA 1Z3YA 2QYCA 4M74A 1T9UA 4IH7A 2VODA 2H1YA 4N0BA 2KDOA 3EE3A 1HCRA 4DR7J 1TU0B 1VS3A 1R0BG 3KJFB 4G1PA 5AJ3J 1PJ6A 1IKWA 2CJ9A 2GVZA 1OR7C 1I27A 1C0TB 2YKOA 2YKPA 3HD1A 4RW9A 1NPKA 2EILH 2WWYA 2A18A 2J9DA 1N8RT 1YBAA 3BDEA 1X4GA 2YQ1A 4B3RF 5C2GA 4X4SA 2PG4A 4CNYA 4KYWA 3CMAI 5AT1B 2A68F 2EI5A 1HQUA 1M5HA 5SZTA 4NRTA 4CLFA 4DJBA 4CTAA 2R7ZJ 2EJRA 4IJAA 4PGHA 1BC7C 2MKHA 3GTPJ 3R7SB 1JJ4A 2QF7A 4JI0F 3M9AA 1OIAA 4QR2A 4Z6YA 3GCXP 4HYEA 4HDGA 2XY6A 2MZSA 2PQ8A 3UE2A 4RBVA 4X4QA 5J6XA 1X5TA 4PXCA 5DTDA 1MMAA 3KZYA 4N4NB 3HOUJ 2BE9B 2EKNA 3BKTA 1KQKA 3AJDA 2FZCB 5KFYA 2FXAA 2RQPA 4LITA 3N6NA 2GJIA 3CP2A 3FZVA 1UVMA 5FFXA 1KD1T 1UHSA 1NKEA 2XRNA 3G2XA 2WW4A 4HSTA 4EUVA 2M5YA 1YI2S 1T0FC 1YX3A 4RGRA 1HBUB 4JI5J 2F8EX 2FZGB 2XIGA 1H0MA 2CQ1A 3US5A 3CO6C 4DYCA 5TRDA 5KFBA 1ODDA 5GADI 2BJEA 2E5LF 2A3JA 2F5VA 2HI3A 2M7BA 1DDNA 3L95X 4IKAA 4R0JA 4WXWA 3P4UB 2XKPA 2MDAA 3VYRB 1FYKA 1UL3A 2ZUGA 2F5FA 1IJWC 2ZUAA 5ILVA 1WWHA 3P6YC 3I87A 2J0SD 1DARA 2DJWA 3FVYA 1U45A 2HGMA 1AZSB 3WQPA 3H4BA 2QSWA 3UI3A 3EUNA 4KV8A 2WTEA 1ACIA 3UD3P 2MSTA 2LBFB 1SJ3P 2JEJA 4PSWA 5HS8A 3MD3A 2CJJA 3UDVA 3T1AA 4B43A 3HB9A 4KH0B 1M1GA 2HZVA 2BXYA 2DRBA 2NXUA 2IJNA 3OUYB 5D8HB 1VJQA 4G6VB 1LFBA 2NS8A 2D69A 3MF5A 3D1QA 2VASA 2ELHA 3ZZ0A 1YJWS 3HJVA 2OPRA 4HACB 2B56A 1IQZA 1SJRA 1B6AA 1F6TA 5IWAF 3G86A 4JI4F 3R2DJ 3DBLB 2QJ3A 3OV8A 5HOOA 4ETZA 1PAEX 3IWXA 3FMRA 2I8DA 3V4MA 1N36J 2R7SA 3FBIB 3BR3A 3KXDA 1IKXA 1BQNA 1LPQA 1YJ9I 2JX2A 2GIFA 3J7ZT 1QGPA 2CJKA 3OL9A 1BY9A 4J9LA 4M1KA 2W57A 4DN9A 4RM3A 5KFKA 2KXNB 1M90T 5F8IA 4OI6A 1DQ9A 1MW7A 3ZMTA 1H8AC 5J47A 4DYRA 1GLNA 4I7FB 1GEHA 2KT5A 1DRZA 4F67A 2Y31A 1HYSA 1SH3A 2ZZTA 3NAUA 1U1MA 4NZ6A 3RW7A 5HJXA 3VYTB 3RKXA 2WTFA 3W6JB 3CJ4A 4M5DB 4Q8FA 4AYBD 2KFZA 4RAGA 3DFGA 3IAM9 3C18A 1S0MA 1N34J 4IOCQ 4KICA 1I94J 5KFWA 2LNBA 3KLIB 2XLJA 4Y4RA 3DU5A 4DV3J 2BM1A 2VKVA 4DN0A 4LJMA 1U26A 2YWHA 3HDSA 4ZPTR 2UXNA 1E3HA 4MK7A 2JVHA 4X66J 3CJKB 2ATCB 2D1HA 3SCLE 1HW1A 4XN0A 3S2DJ 3R61A 3I59B 4Y15A 1Q78A 2JSXA 4CM0A 1R0CB 3N9UC 3B6AA 1SL0A 3LNQA 5E18F 1E6VA 2RRAA 5ETRA 2Q2EA 4AD6A 1DFDA 4F4WA 3THPA 1LXJA 2K8GA 3ECOA 5ETKA 3KK2A 3P9IA 2AX1A 3VZHA 2XQCA 1T2KA 3NGDA 1X4HA 2L48A 5CABA 3QRQA 1T8IA 2F2EA 1F9NA 1YBTA 4AT1B 5BXIA 3BLYA 2XLKA 3UO0A 2JLGA 1J5EF 1VI0A 2K7KA 3OYEA 5C7PA 2GAHC 4P52A 4PWWA 1FOXA 2J5OA 2ALYB 1T7PA 2IA1A 3T8TA 1CC8A 1WELA 3H98A 4P9SA 4GC6A 1FWPA 3IRRA 1VJWA 1RAAB 1OWXA 3CJRB 4LF4F 1V3RA 5GP9A 4MLOA 4X65F 1F1ZA 1SIWB 2VXDA 3A8JA 2ACYA 2X1BA 1U5TB 5HN0A 1DTQA 1XNQJ 4LFAF 3CTAA 3IGNA 3PRBA 3GLLA 4I6YA 3N01A 4USKA 4HV5A 1NK2P 1GMWA 3WC2A 3CDIA 2HZDA 4DZ6A 4DV2F 5H9FJ 3W5ZA 5CYMA 3TJ8A 2IPOB 3I5UA 1TQIA 3AB2B 2Z2LA 2FY8A 1T38A 1M5OC 3OTOJ 4HF2A 3ILLA 2JRMA 3HSRA 1EP4A 1R8BA 3OVBA 2COLA 3J7AO 4ICLA 2CG4A 2X0LA 1HWIA 2JN6A 4GDFA 3N6MA 3L9ZA 2JJ4D 3TOBA 4D3GA 2CUFA 5FKKA 3CD6I 2EW9A 2R4FA 2EZKA 1N0UA 4KFCA 3FBFA 3MM6B 3G1OA 2XZWA 1QAYA 5IPAA 1Q81T 4BS2A 3PO5A 3MMBA 2NVYJ 1NK9A 3ZNUA 3CCMS 2VT3A 2HQFA 2H6BA 2GM4A 1MNDA 5C42B 5MLCV 5DM6Q 3N5FA 1P7IA 2DNMA 3HGGA 3BQZA 3O8GA 3KYLA 3HHLB 3LA0A 2QSHX 3VYSB 2V5HG 4MT1A 3D6HB 2MD5A 4IHVA 2XSJB 3OHAA 1ZRCA 5HNHA 4OV6A 1TMMA 3ZQHA 3CD5A 3MEEB 5FLMJ 1SFUA 3QGHA 4YEAA 2F4OB 2FMLA 1TKTB 1C0UB 2OGUA 3K7AJ 4PJNA 3ZO7A 4B3AA 4WE1B 3NEUA 1VQMI 1W2BR 4N9HA 1IBLJ 3I0TA 2Y3YA 5HVHA 1ZKGA 5HDGA 4B3OB 2GXBA 1BI3A 2ADCA 3ZTSA 1OPIA 1ETXA 1MJ9A 2MC4A 3QIPA 2NUUG 5LHGA 2FEZA 2E9RX 5ETNA 2HHHJ 1K83J 4A6DA 1X9SA 2DMUA 2H1KA 3IRXA 3BPDA 1G6NA 5ILSA 1R8HA 3NBPB 2CQGA 2PMWA 1U0HB 4C7QA 2DFIA 4UZCA 3KTQA 3DRSB 3RR7A 2BY0A 1KWMA 2FRHA 4EM1A 1S5ZA 3TP2A 2O1PA 1SUQA 1U1LA 5A8WB 2R5ZB 4B9NA 1QO0D 4KMUX 2XHKA 3KHLA 2ZBKA 1R58A 1ETYA 3OYLA 2VQEF 1DQUA 3GONA 1YGYA 3O44A 3P5JA 1N6QA 3FX3A 1HWJA 4DL4A 4NE9C 4O23A 4D5FA 2XGCA 3A01B 1UG0A 1XK8A 3DOKB 4ZYAA 3F8BA 4D0PA 2H54B 4ECTA 4NXNJ 4JQFA 1BD6A 1ZPWX 3JSMA 2IFXA 3BOQA 2AZ3A 3ZQQA 2HNZA 4DFPA 3AQPA 4DF4A 2KIUA 2K7JA 2W82A 3SIPB 1X2MA 5A6WA 4DIQA 1YW8A 4LIRA 5SUHA 1JX4A 3H4DA 4OMZA 1R89A 1S57A 2XC7A 2OH2A 2CQQA 3ERMA 5LMUF 3HGYA 1UG2A 1Y0NA 3IKTA 4DV7F 3GLXA 4B09A 3IC7A 3OR1A 2ELJA 5D6EA 1W36C 3K0JA 2XC9A 1HBOA 4ZA1A 3EYYA 5EZHA 3IWNC 1TW3A 3WX8A 2A2DA 3WIUA 1T9YA 2HRYA 4RW7A 2QRRA 5K8MA 1TNTA 2UUBF 2ZE2A 2VZ9A 4P73A 2EZLA 5DDGA 2M52A 4V19K 5D4NA 2AEMA 2DBBA 2V68A 2X1AA 2PMZD 2DTRA 2DO4A 4OHZA 3HSEA 2MKIA 3IRWP 2GHPA 2ZJRQ 2IM2A 2RQ4A 4CO8A 2EWHA 1HSTA 2J7KA 3M8SA 3OJSA 1WC1A 1QAXA 3KUGA 1RUSA 5AXLA 2LECA 4ZJZA 2LVSA 2B9XA 3B02A 4MYUA 1IKWB 2OUMA 3NNCA 2GVZB 1G3SA 2RUGA 3CCES 3TL4X 1RISA 2L7FP 1XGOA 3RJMB 5ADZA 3IMQJ 2IS2A 1LOUA 3S6EA 2V0NA 4RW9B 2JTVA 5D0HA 2FVSA 3IKVA 3I9V9 3BJAA 4UQTA 5FIIA 2OSQA 2MZTA 2HEOA 2RHQB 2NZ4A 4DL2A 2FBIA 4YR0A 3QMQA 2H51B 4G6DA 2Y1LB 5J1EA 1FF2A 4M3GA 3HJFA 1P7JA 4KIGA 3CTRA 1WWXA 4PAAA 4ANDA 2QE5A 4KGMA 4IUFA 3G73A 1MJAA 1VQ4I 3MPUB 3RW6A 1T02A 3BQ2A 4TVAB 4I2PB 1E3PA 1RAGB 1FPQA 2MHEA 2JJ7A 4K5RA 3C6TA 2IMWP 3P49B 2IIHA 4WTYA 4I76A 5M2PA 2XWXA 4HSRA 3TANA 5KFGA 1FWZA 1LVAA 1YFHA 2XCPA 4NCGB 4LF5J 2CQ4A 1X4BA 3GW2A 2HFUA 2OLWA 5HJYA 3HUGA 3S3OA 1ERDA 1FDDA 3DPLC 2VFRA 3K58A 1LUJB 2QQBA 4J9KA 1CJVA 5LGTA 1NXIA 5KFIA 1MBJA 4M5HA 7FDRA 1IRXA 3KLGB 3I0SA 3SFIA 5LSLA 1FJGF 2IRXA 2IC3B 1FEEA 4ZDOA 2H1LA 4C8MA 5FGMA 4U67Q 3QFWA 3WHBA 4OHVA 3TO9A 2BW2A 4DQ2A 4JYAF 3G1LA 2ZBCA 3QLHA 4TYBA 1UFLA 4OZ3A 3KZIC 1RWNB 4ED4A 1J9IA 1HARA 3OYHA 2W1BA 1RCXB 2DAOA 2NXCA 2XTJP 2KISA 1SC3B 4C11A 4KITB 1RESA 4UY8T 1D5YA 1UWBB 1YJVA 4DFJA 3FM3A 1YITS 2M8EA 4G12A 2UUTA 4RAZA 3HM9A 1CPZA 4EMSA 1H72C 4BDPA 4G1QA 1LDKB 1M1HA 4C2TA 1TKZA 4ZPAA 2NR0A 3OIQA 3HT0A 4PUOA 5EGOA 1YTYA 1NRKA 3SYZA 1J2XA 3UCGA 2FF4A 4XBFA 2KG0A 1IM6A 4HR2A 4C0HA 3TMOA 4BXUA 4NLOA 5IC4B 5A8KA 1X60A 4AUXA 2ILYA 2DEJA 4OMYA 4FP9A 3IAM2 4JP0A 4ZCKA 2J9EA 4N47A 1FRIA 4BDYA 2KO1A 1F3VA 3BDDA 2Y0SA 3SSRA 3E01A 1AWCA 2V2VA 3O5TB 1NB7A 3JREA 5JFRA 3DGVA 1U0JA 4MNUA 1X1PA 3CO9A 5IYCJ 4FNHA 4X62J 3QPSA 1N48A 1TW2A 2BABA 1UJ4A 5HROB 2F3JA 4J9RA 1DZ5A 3FIWA 1S77D 3F73A 2B51A 5HMZA 4BXXJ 4A8OA 2ISYA 1R23A 2XAGA 3E0JB 4PFPA 2WY8Q 2EFNA 3FKIJ 4WZQA 5F8HA 4ILRA 1NK0A 1E3OC 4L76A 4CI0B 1H2VZ 3RRKA 2FVRA 4C30A 1Y0UA 4C3JJ 3ZZUA 5JR3A 4ZYEA 1B1BA 2UXDJ 3SBMA 1EHWA 1N77A 4IHTA 4RLQA 2V63A 2Z99A 2VN2A 3BZ6A 3M2UB 3G6YA 2G9WA 2VUMJ 4M5MA 2BZ2A 2FHJD 2M34A 4NLRA 4NA2A 1WCMJ 2PMHA 3KEYA 2STTA 4QU7A 3IHUA 3CCJS 4Y7NJ 3DXBA 3S32A 3U9GA 1RRJA 2W4DA 5D4SA 1OYDA 1EA3A 2V9VA 3WG7H 5A2QK 4UUWA 2RS8A 5DG7A 2PJRB 3KLEA 1E6VB 2Q2EB 2MQQA 2C6YA 1VBYA 1HR0J 2RV8A 3WZ0A 2IS4A 4RUHA 3KK2B 3NNAA 4KNYA 3DWLE 2WSCC 2ZM6J 5KAFC 2IDLA 4G9YA 1SD6A 1RBAA 2F4FA 4JK1X 4XR6A 4MTEA 2VU5A 5D0GA 3J7Z5 1TV6A 1FBSA 1W5CC 1FXDA 3FF5A 2EKYA 3GP9A 2HOSA 1TC3C 4QPTA 4BE2A 1JTYA 1MZBA 2DA3A 4LMYA 3HVWA 4DPXA 3DDKA 4FKYA 4ENMA 3CDUA 2V6CA 4XLNF 4DU8A 3ZTRA 4F8RA 1YLXA 2PGCA 2XMTA 2K9NA 1VQPS 3P96A 1Z1DA 4CO2A 1RT6B 2LQ9A 2G7UA 2UUZA 4I2OA 3K4LA 2BOLA 3JTOA 4P71A 4CCKA 4OYZA 5D4LA 1Z67A 2L3MA 3HULA 4L75A 3PJXA 3ENVA 1VQ5I 1JJ2R 1PBAA 2WVCA 3PHTA 4RM2A 1SKUB 4ZDLA 1V54H 4KIBA 1B4AA 2DNKA 4K0KF 3OWTA 1VBXA 3DF8A 3PR4A 3OS2A 2L9VA 2DNGA 3GIIA 3SEZA 4B44A 3BSAA 2MB0B 2OPTA 3L2VA 4RAYA 3DXJF 3S16J 2N3LA 4ZLNA 2F5GA 2VPYB 3ZFVA 4OJ3A 1SKRA 3C19A 2BRLA 4E98A 2L9WA 1CLFA 2O8KA 3AAWB 1FRMA 3MR5A 3VAMA 2VJVA 2UXBJ 4OWRB 4ZDPA 2JFDA 4W97A 5M3FJ 2YS9A 4C8ZA 1HBMA 3TWZA 1CJKA 2MZJA 3E3XA 2FVPA 1WHUA 3PNYA 3A8IA 4QWEA 4IH5A 5KFDA 3H59A 5IC6B 3VAIA 3OFHA 3CCVI 3CC4S 1XGSA 3K1NA 2VQLA 1F36A 3KP5A 1GV5A 1WOOA 4LFCJ 1EARA 3BDPA 4JV5F 1YS6A 2YKMB 2DMNA 3J80Z 1CJTB 4OIOF 2YUSA 4PZJA 5ETPA 1DPRA 1P4XA 4NNJA 4QPOA 2VJIA 4WCEQ 1YIJI 2CW8A 5GPAA 2IT0A 1LEBA 3M8FA 2VFSA 4FXWA 2PMZN 3DPUA 4BUPA 3D7SB 2ID3A 1W5TA 3W2WA 1HI1A 4LRDA 1I5OB 4CIOA 4WYLA 3PIOF 2LLZA 4ED7A 3MWMA 2ELKA 4OU0A 3D5LA 4KAIA 4HEA9 1JNRB 4J00A 2Y1RI 1ZBTA 5KAIC 4AWXB 4J9NA 1DLOB 1KU2A 3GMEA 4RNMA 1USSA 2NXJA 3W9HA 4CICA 3L7OA 4C9YA 3J7YJ 3GJSB 3K59A 1Q82T 4EJUA 1FKAF 5AIPA 2CQCA 4ED2A 1HNWJ 2DA7A 1OCZH 5EDNA 2GHWA 2A5WA 4LF6F 2EWNA 4KIFA 4OQJA 3KNGA 1SUQB 1B0VA 1RLDA 2WVBA 1A6IA 4KFBA 4DBQA 3R8YA 1S7OA 3R0JA 4K8RA 4IRIA 2IRYA 1N6QB 1VOMA 4LB5A 2EV6A 4P2XA 1TT0A 4M6YA 2DODA 3NWRA 3BS9A 3M1CA 2CJBA 2MH9A 1U5TC 1DTTB 2G1HA 2GX8A 5KG0A 4LBIA 1U2WA 2V1UA 3SFUA 1BR2A 2BHYA 4C2MJ 4E7IA 2Z2MA 3CEDA 1WTBA 1F0XA 2ZFUA 4DG1A 1KVKA 1TQPA 2HNZB 2DGQA 4M71A 3MPVA 2AXTC 1IBKF 1XMQF 3W6VA 4LSLA 3K5NA 2BE2A 2V67A 1HLWA 1BW5A 5DETA 1TWAJ 3KP6A 4ZLLA 4IQXA 1OFCX 3OR1B 4UOFA 3PVXA 1J5YA 4G8XA 4LGWA 2YPRA 4XLCA 1KKHA 4CO3A 1VQ9I 4A8WA 3WGIA 1IKVA 1FLIA 2WAQD 1KVJA 2DDAA 1REVB 4RW7B 3DRRB 2ZE2B 2ZWOA 5F0HA 3H20A 3GFJA 2HPUA 3F0CA 2E7WA 1W36D 1R31A 5FFZA 4BJ6C 2M9KA 3QQCD 1YRXA 4OI4A 3D1HA 4XKCA 3ZMSA 3CDWA 4BC7A 4BJ5C 3BSCA 1K8AT 4C0BA 1ZYRF 3TNVA 3HHLC 2PBIA 1Z3XA 3WC0A 2BDPA 5KFLA 3NARA 2QO3A 1HHSA 2PFFB 2XSJC 3JTGA 1ZH5A 3T5KA 2U2FA 4DWIA 4KSEB 1JUMA 1L3LA 4PXDA 3RYLA 3J81Y 3HO1A 2QL5B 1P4AA 4ANEA 3AKZA 3LSGA 4ZPDA 2XLIA 2VQFF 4N8OA 4KTQA 1T33A 1IWGA 1MBGA 1K78B 1X1CA 1Y3JA 5E2QA 2QYGA 1WZ2A 1YX5A 2YY3A 3LSTA 4V19X 1CJUA 2YX7A 3FUYA 3S7RA 2ZH9A 2MZQA 5LMNJ 2XGEA 4K4YA 3D67A 3PDNA 3GV8B 3BT9A 4CCNA 4R1HA 3OYKA 1L3UA 5IOLA 3IN5A 2BJDA 2M8GX 2H3EB 4OI0A 2BA9A 5KFCA 4BHCA 1TWFJ 1REGX 2BJ7A 1ACMB 1JT6A 1AW0A 2NVTJ 5HQMA 3IL2A 1BOBA 1YRTA 5IOZA 2O3FA 2XMMA 2QGFB 2DLLA 2XROA 5GAGU 5KT7A 2LY1A 2W8LA 3FDSA 5J1EB 2VKRA 3JAMZ 1RDRA 3M2VA 4DV5J 2VXZA 3DTIA 3KCCA 1J7KA 2PI4A 2FQQB 1NDKA 4HF0A 4BHQA 4ED8A 5BPIA 4ED3A 3VAJA 4M9SA 3RR8A 4N7TA 3EPGA 4ZP7A 5DDPC 3RPQA 3C6TB 1RLCL 3ZMDA 4ZYGA 3KG1A 4OYOA 1X5SA 2YNHA 3TOAA 1UEVA 4QWBA 1TTYA 2GVDA 4FASD 2HNDB 2FPHX 4P72A 3I82A 1MMLA 2DGTA 2CW7A 3F6VA 2KL4A 2X1DA 3H35A 1A5JA 4CNZA 3LSIA 2JH3A 3R5DA 1JLFA 3HUGB 5GAHI 3HBLA 2J6TA 1SJ1A 4B3TF 1JKPC 1FA0A 4JI2J 4BE1A 1CJVB 5L3BA 2VOOA 2LYVA 4GKKF 3FSXA 1J0RA 3LANA 2V7FA 4XNFA 1RSCA 2B7CB 2XNRA 4L5IA 2OEMA 4CO5A 2QL9B 3P45B 2QLFB 3UR0A 1FFSB 4UV9A 2KJWA 2Y9HA 1WOSA 4NZ7A 4Q47A 4Y3OA 2XEXA 4I0AA 1OJLA 5DS7A 3IR7B 5DM7F 4ZJLA 4EBCA 4C8NA 5G4DA 1VQNI 2JQ7A 1BR4A 1QLNA 1N78A 4ZOSA 5IP9J 5LGNA 5HBMA 2AU0A 3M9MB 3QLHB 4PEOA 1A9NB 2FVCA 1R8CA 3NCPA 3FSIA 1SKSA 2DYSH 3CF5F 1RAOA 2P8TA 1VQOS 4HVZA 1SJ4P 1OJ4A 1YJNI 2QT7A 3DLEB 2EFQA 3J7AY 2DY9A 3C6UB 2PE8A 1OY8A 5KG4A 2MGQA 2F5EA 4YB6A 4G1QB 2DNRA 1TKZB 2IGMA 4PUOB 1QAIA 3VYUB 3LOUA 3G6ES 4EU0A 2LEPA 2CQ3A 4UV8A 3UFCX 4GYIA 2V69A 5KG5A 4BBSJ 3TOQA 2K85A 1R00A 4K4ZA 1XMOF 3T8RA 5A8KB 3PFYA 4XDDA 1WJBA 4C3MA 2ZVSA 3BREA 2FQ4A 5ETQA 2AHQA 2Y9ZA 1J5OB 1YBUA 2M4GA 4JV2A 4HAMA 5B7WA 1RQ0A 1BE4A 3L7PA 1XTAA 2HFHA 5HMYA 1E6YB 1U2RA 5FKLA 1KQSR 3FFIA 1T08B 2ZHOA 2R7VA 2QA1A 2MYSA 2CFOA 1B8IA 5DLFA 4HTJA 1MGTA 1U0SA 4USJC 3OBIA 3TAMA 3MOJB 1NU4A 4R8UB 4QPXA 3CCWA 2EINH 4OINF 3HX9A 3MEGA 4YB7A 5CQEA 1HDPA 3GFIA 1UJ5A 1ULYA 4FF1A 1YLFA 1X9MA 4FKXA 1LW0A 5I3UA 4UY85 2Z4PA 3L2QA 1NH8A 3TUPA 4DR6F 1FP1D 2XG8A 3P5TL 3IS9B 3MMJA 2OEJA 3T6JA 4WF2A 3W2AA 3L09A 4RL1A 3OY9A 4CLUA 1FSEA 4L0YB 2IEKA 2KDZA 1JKOC 4MMOA 4DV0J 2HMIA 3E5UA 3FMQA 2LKXA 2QA4G 1WJEA 4ID5B 2MKKA 1URNA 1PP8F 2LVWA 1WORA 3KLEB 2KFNA 2IS6A 2WB1D 2L0KA 2FZKB 1IBMJ 5HDKA 4EJTA 3NQOA 3D0SA 3BN7A 1VIXA 2OTLI 1FRJA 4RU9A 4C4WA 5A0YA 2P7CB 3TW0A 4DQIA 3D1OA 2EK5A 3W9IA 2PT0A 3I6PA 3HC7A 3PYFA 1Z9CA 2OPSA 2F8MA 4KHMA 1IBCB 2DJNA 3I58A 2B63J 1O8BA 3BJYA 4LF2A 5A6PA 1XJWB 3ILOA 4RNFA 3FMWA 3QWPA 3QQAA 3OYBA 4NLDA 5C2CA 3FEXB 5LEJA 3LPEA 4H54A 5LL6d 1G3WA 4V1Ak 2HAFA 3CDAA 1VC6A 2RREA 4B02A 4IKFA 1RAHB 2E2JJ 3V6HA 4OLPA 3I53A 3DOMA 4MFBB 3J7AN 3ABTA 3MFKA 5CYQA 5BJRA 4B9MA 5D15A 3F8FA 4DPWA 4PYAA 2NSBA 3V6DB 4JI8F 2HWVA 1Q8KA 5J2PA 2PEXA 1TVRA 3CE8A 4L9VA 3JSBA 4G1IA 1ZM9A 4A12A 3REOA 1NAQA 5DO2A 2FD5A 4MFEA 2CQXA 2CG8A 4QJVA 1RK8A 4BQOA 4YG2F 1U9NA 3Q0UA 3QAHA 2HKOA 3A13A 1UJ6A 8ATCB 4Z37A 1JE8A 1IVZA 1YHQI 1XC9A 3I5CA 3V8KA 2GOMA 3QYEA 4EFAC 2VA2A 4J9QA 4HQMA 3IG1B 2KKOA 1HBMB 1WUUA 2LC2A 2R8IA 3CCRS 1QSLA 1HBNA 5L9NA 4HEA2 3NS6A 5IZHA 2KRBA 1XNRJ 3UN5A 1XTZA 3D0IE 1C1CB 1O7FA 4BS9A 2A3SA 2O66A 3M8ZA 1VDHA 1K44A 3ICLA 1CQMA 2BW3B 2V9PA 5DS9A 4BGDA 1BI0A 4B17A 1Q4RA 4GVBA 1JLBB 1UZHA 3FZBA 1A6QA 3OXFA 3MAAB 3FJ2A 4OYPA 3TR5A 2ASYA 2L5QA 1TR0A 1IUFA 1GDTA 4AM3A 2LYCA 3R6GB 1VCTA 1YG2A 4MKAA 1SXLA 5D5VB 2L3DA 4CSWA 1KQFB 2CPXA 4OYBA 3QPTA 3LWMA 1I51B 1Z77A 2C2MB 5E7OB 4UUVA 4HX8A 1S9HA 1X0PA 1LWCA 1SQFA 4F02A 1GT0C 2QENA 2FJAB 4I09A 1BQMA 2C42A 2B6AA 1CULA 4WTOB 2DNNA 2E7VA 2Z8QA 4AL6A 4B9UA 1W4MA 3O6QA 2QSFX 5DEQA 3QGGA 3GV5B 2K06A 3NP5A 2KJBA 3SDGA 3GSIA 2OUGA 3EZOA 1Q8LA 2IMOA 4TY8A 4I64A 2BOPA 4KFBB 4PPDA 1FNMA 4UOCA 2MKSA 3ZQLA 2BW7A 3J7A1 2GJ2A 1BQXA 2E19A 3CESA 2VG5A 3JRGA 3I0RA 2E5JA 1NKBA 4CXFA 5CAAA 2XMAA 3QP5A 3IRQA 1WKLA 5KFFA 4MGRA 2DT9A 2NCKL 1HNZJ 5EN1A 5BMZA 3R7NB 5KFSA 4GRSA 2EIKH 1RHKB 3CMES 3M7GA 2VDIA 4A3JJ 4BEHB 1N32J 3E6CC 4AVZA 4RBTA 3HRSA 1TUWA 2MQMA 5LJ3Y 5IXUA 5ETOA 5CVRA 2B0GA 1MNEA 4PJ0C 4LSLB 3LFKA 1W0TA 2BE2B 3I64A 1CEZA 4QYZK 4TQSA 2K3KA 2FD2A 1T9TA 4O3QA 5G0RB 3J81Z 3PSIA 5IM0A 3G4SI 1KU7A 4A3GJ 4ED5A 3ZTQA 1OQ3A 1DP3A 1IKVB 3HOSA 2ADUA 2CMPA 4FTHA 2YWGA 1FDBA 4F55A 3IO1A 2HVHA 1S10A 2KT0A 1SH0A 3PKYA 3K70C 4MIAA 1NM2A 4E7LA 1MBEA 4OZ5A 1IXSB 4QQBA 2MYFA 2NPFA 3SDBA 1R4MB 2XMUA 1Q8IA 1UKUA 3R97A 3E2EA 3KOAA 2Y8YA 2KHCA 1AOYA 3GB0A 1R4NB 1F43A 1QDUB 2FUG9 2HGLA 4LF9J 1Y4ZB 2ZH8A 3QOPA 3J80U 2ZZNA 4ECVA 4OYWA 2DHHA 2O8XA 3BBFA 5LFAA 3MCZA 4NEYA 2RDJA 3LSKA 1RA6A 1P27B 2CIMA 3D3BJ 1GVDA 4YR2A 2XULA 3H36A 3HHLD 4ANJA 1VLYA 2IYIA 3ZZRA 2D3O1 4ELTA 2VV5A 4KUMA 1GH8A 1RIOH 2DR9A 3PCOB 3TKYA 4QIFA 1RYRA 4YIFA 1G6BA 1ZG1A 2BBYA 2KRHA 5D78A 5F3TA 2DNOA 2W1OA 4ELVA 2AT1B 2JDJA 5HSPA 3CCQS 5B08A 4NB5A 2CQHA 2EXUA 3MPDA 3E8OA 1KNZA 3ZN1A 2YNGB 4X4TA 2QN6B 1VC0A 1RTHA 4B48A 3RZAA 1UVLA 1YRNA 5D4PA 3DLLF 2HHWA 1VC5A 1IN4A 3H2LA 1QAJA 3TO7A 1I6JA 4L3KA 2VICA 2G0IA 2P7VB 3PIPF 5F0UA 5KFRA 4YFXF 1NDPA 2XI2A 5LT5A 3GX4X 2YH0A 1PJRA 1ZR4A 1EKRA 3FXQA 1ROFA 2NXNB 3M2VB 4FYDA 3UNGC 3BPVA 3MEKA 5THWA 3U1KA 1R7IA 3F3XA 2KPMA 4Y13A 1TZ0A 1XN7A 3GFZA 3E6DA 5KFMA 5B1BH 1RACB 4ECUA 2E2IJ 2WOMB 3CUNA 1U1RA 1EH6A 3GFLA 4F3OA 3MCNA 4J91A 4I7HA 2MHNA 2RIJA 2YNHB 4LSNB 5U47A 3GTJJ 1M5SA 3M30B 4HOBA 2GVDB 2LKZA 1Z05A 3M6UA 3FHNA 1KHVA 4OZ2A 2IM3A 2ZB9A 4NYOA 1JLFB 4EGYA 3HHEA 2VONA 9RUBA 5FB2A 4BJTA 5DDQC 4C2MA 5HDNA 1N5SA 4BHPA 3WG9A 3OSFA 4O0NA 2BX6A 5CH7B 4F36A 2V4QA 3DP7A 1RWOB 2J9CA 2PN6A 3FC9A 2JRSA 4DCPB 2ZH7A 4ZVPB 4OJGA 1QPIA 3KZZA 3OR1C 1JLEA 2DCLA 5F0WA 4EMDA 1R8AA 1PDNC 2V4RA 2X6YA 2GS8A 3OTCA 2KHMA 3EPZA 4NXMF 4USUA 1VFCA 1R1VA 1T11A 1M5PC 3RGIA 3I56S 4UUSA 3T41A 2RVCA 3RB0A 4DDFA 3W5YA 2OJED 5KG6A 2XUBA 5EJCA 5FLVA 1ZG3A 3BSNA 4DUYF 3DLGA 3TUIC 4B4CA 4XK4A 3K2YA 3H9QA 4J9SA 2ZCWA 2QQ9A 2ZBRA 3GSDA 1X7VA 4DLGA 3UN2A 3KMSA 3RZOJ 4L5JA 2K3PA 2F9DA 2Z30B 3A0BC 3A1YA 2JZ5A 3ELKA 2R93J 1WJAA 4IQ4A 4A2UA 3S3NA 4IEJA 2E44A 1VRUA 3OIOA 3VGUA 1ITYA 3SFZA 1HW8A 3PRVA 2DNYA 2AQEA 4XKWA 1PILA 1PUFB 1FHTA 1HD1A 2CQ7A 2B9SA 4R8HA 2IDEA 1RZ4A 4ON0A 4Y2IA 4Z7YA 3LQRA 3EZ5A 2IW5A 4R25A 3GUDA 5ILUA 2QMWA 1S72I 3BM7A 3CJTB 2G4BA 2YXLA 3K7RA 2R7RA 2JA5J 4OHYA 2X1EA 3ENQA 2DD8S 2UUCJ 2CRGA 3EYZA 3DM2B 3FFIB 2ZSHB 4KB7A 2R2TA 4HRIA 3I5AA 2CPEA 4IO1A 3JAMU 4XTTA 5E8IA 1WF2A 1QHGA 2MEWA 1Q1VA 2BM0A 4NLYA 2OZ6A 1IRZA 4OI1A 5E0OA 2DB1A 4YHHF 2DT5A 2X1FA 2ASLA 2K4JA 3BGUA 4F0KA 2ROEA 4IL6C 3BO4A 5DM7Q 1IV8A 2FJXA 1K4TA 1QUPA 3RKYA 2OIHA 1X4PA 1WI8A 4CCLA 1FRHA 4TXSA 1U49A 1F5BA 1LW0B 1LWFB 1A36A 2J9DE 3CF5Q 5I3UB 1FP2A 2YH1A 3NY0A 2Z33A 1EJ7L 2K02A 3OSPA 2FBHA 1NZ8A 2Z58B 1Q5VA 5LHHA 2R2RA 3OPKA 5B0EA 2A6OA 2L54A 1JNZB 4WU2A 4HTIA 1Y56A 4F7ZA 2HMIB 2VUGA 2KG1A 4E7HA 4ECRA 2ZZMA 5F8NA 1EB0A 1SAUA 2BY2A 3C15A 2W85A 1DJ0A 4CO0A 2KL8A 3SQGA 3ZZOA 5FLXZ 3OD2A 4IXAA 4FYVB 3ITHA 4OZLA 2POKA 3Q2TC 2RNEA 4K59A 2EFVA 5LXYA 4RW6A 3BQYA 5A0YB 4EBEA 5HQLA 3HOYJ 2GIVA 2AYMA 4QOTA 3GPAA 4A8FA 2UZKA 4B3RJ 5B1AH 3ET6B 3BG6A 1YJWI 2CUZA 3W60A 3U7JA 4IOAF 2BV6A 3GIKA 1I6HJ 4U7CA 2O3DA 1UCNA 4G65A 4XQFA 3PW5A 2MSYA 2D5VA 3LAPA 2IPQX 3CMMA 3AJ1A 3CMAS 4JI0J 2WBRA 2H94A 4NCAA 4RB2C 3KJQB 1VRTA 1P92A 1G2HA 4ASNA 4EWTA 3QAUA 2MLKA 4AL5A 3PFEA 1S0VA 5M2UA 2X3DA 3KFWX 4FQGA 1EAYC 1WDTA 2JFKA 4PFOA 1QUVA 1FK9A 2XASA 5J2PB 1YVFA 1TVRB 1B9MA 4B3MF 5HQ8A 4L6V3 2JEGA 3ZZTA 3DYAA 1TKXB 1KFSA 1IV6A 1UELB 2DXEA 1SC7A 2VIHA 4F4ZA 1JJHA 4DR3F 2RNGA 4X4VA 1GXUA 2AGOA 1ZAVA 1RAFB 3JYTB 4OX9F 2QEXI 4KGKA 4OYIA 3H9GA 4AL7A 1H2TZ 5L39A 3N5BA 2Q6BA 3JS9A 3M6WA 3JRDA 1SJFA 2E5LJ 1RU2A 2CV1A 2XHCA 5ICEA 3TEDA 3BR9A 3CF2A 2E5IA 3H0PA 4GMKA 1S6PA 1VR6A 4HPQA 4K4WA 4JI6F 1TP7A 3VR1A 3TUJC 2A0FB 2JT1A 3GO5A 2FOWA 4EJOA 1RETA 2BEOA 2FJDB 3MMCB 4GVBB 3BKFA 4IO9F 2LA6A 1HDDC 1AXQA 3AG3H 4XIUA 2K86A 4M9XA 1YW7A 4CHUA 5E1ZB 1KSPA 3K9TA 2CADA 2BYVE 3TW7A 5JMNA 4BWJA 3EGNA 2DMTA 3K1MA 2KLOA 3HM5A 1A7GE 4OIRF 3EICA 4JI3F 2OP5A 3NRVA 3D54A 3A02A 4KKOA 1D8JA 1JXSA 3FXLA 1JLCA 3JSOA 5HLFA 1CS4A 2GNKA 1LWCB 5GMKa 3JTHA 4R79A 1HNVA 4CYUA 4HKQA 2Y2ZA 3WGGA 1GXLA 5IWAJ 1NHAA 4JI4J 1KS2A 4A69C 4AYBA 3MXHP 5FJ8J 4M3DA 1UW4A 1R43A 2V4JA 2KYZA 2IRUA 4YRVA 1TELA 2FQ3A 2ATLA 2YPZA 1GV2A 4HDVA 3W7BA 2UVRA 4TY8B 2RSQA 5HI7A 1RI7A 3IFEA 1LQ1A 1ICEB 5KFAA 1WG5A 4NLQA 5A8RA 3HFZB 3CPWR 1BI2A 4U6PA 3VPRA 5BYQA 4NLPA 5F8MA 3M1VA 3OTOF 2M4MA 5J2MB 2DOAA 1T3NA 2H27A 3U27A 2LF7A 5KHDA 3M6XA 4LG0B 2NVQJ 4NLVA 2NXEA 1D8YA 1HMVA 3AFGA 2ETHA 2E35A 2WZ1A 3W2VA 3EUHA 3BSOA 4EEFG 1V3SA 1S1XA 4UVCA 3TX8A 2DHGA 3DKDA 1HBXG 2FUG2 3OVSA 1FJ7A 5ETLA 2XF7A 2AJ0A 1GMWD 2M88A 1UPPA 2SXLA 2X6WA 3FBEA 2HR3A 3FQLA 3IWLA 3N6LA 1GMVA 1WH5A 3A4TA 1JI8A 1NO8A 1ZM2A 5IM0B 1I1GA 2HBRB 1K0TA 4K4XA 5T7LA 5F04A 5KFZA 1ZRDA 3MM8B 3HSFA 3GIJA 1Q7YT 3V4IA 1ZGAA 3D5MA 1Z7UA 3E3VA 1FEHA 4CH7A 3E97A 4ENJA 3IP0A 3SZTA 3R9LA 1KQ0A 3PFIA 5FO5A 3F56A 3Q9VA 4RLEA 1C1BA 1ZK8A 2K7LA 1FBUA 5J3LA 5GVQA 3M8YA 3LWFA 3NWSA 1Z0XA 3CDHA 2BACA 3K70D 3KG0A 2KVIA 2VJ4A 5HS7A 3N97A 4KGXB 3DEEA 3EQLF 4QR1A 4LFBF 5M3MJ 2YKQA 1FE4A 3TP0A 2DNQA 1XCVA 2P6SA 1PJ5A 2MY8A 2BQUA 2KFYA 2TRTA 2XVCA 1Y1VJ 3U2RA 4XRSA 4LF4J 4EGLA 3O3LA 1B7FA 4X65J 1T98A 1U1NA 2CPHA 2HFZA 4I6AA 1S5LC 4XPEA 1UHMA 3RZDJ 4LFAJ 2V26A 2GCFA 3L7UA 1P6RA 1HKTA 4HNVA 1EQ0A 1I3OB 4LR9A 2OI2A 4Y2CA 4LRAA 1ON2A 4IR9A 3QP6A 2CFXA 4CZZA 1NG7A 2HHUA 1ZTWA 4IRCA 2O03A 5K14B 3UCZP 1YRNB 2X51A 3HOTA 1M5VC 1U25A 1YS7A 1S49A 3GCMA 4TLQA 4FVCA 4DEZA 4E0DA 2EZHA 2L9NA 2ECCA 1LFWA 2G1DA 3EUKL 1VQKI 1VBKA 1O3SA 2F65A 2Y69H 3DGPB 4CYCA 3G2BA 2D74B 4O4GB 1IR0A 1MSWD 2ZH1A 1O57A 2ZJQQ 4F0HA 4HNTA 1UZDA 2H5EA 2CWKA 2GA7A 4GO1A 4XLEA 3ZQGA 5KG3A 3AHPA 2TDXA 4DQPA 1AKHA 2E1OA 1XWLA 2GWRA 3MECB 1S6OA 2AMCB 4DS4A 3GYGA 1T95A 2XO7A 3ABMH 1TUVA 2V8VA 2NNYA 1NDCA 1S4EA 2OAUA 4ZVGA 2R7UA 2GIRA 1WKJA 2HIYA 3HIFA 3V7CA 2HVZA 2KHDA 4B3SF 1XR5A 5K7ZA 5LSRA 3MAHA 2OPQB 3BP8A 2CZVC 2FC8A 4LD5A 1X4FA 3J81U 5FD6A 3M32A 1F9FA 2XGXA 1UWAA 3BKUA 3KPHA 2VLAA 2FLNA 3J7YU 4V19J 2R42A 1VQMS 3O3KA 2APOA 2RD5C 3VCDA 1GMUA 4M63A 2A69F 4Q44A 2M0MA 4YFUA 3DLGB 2R7XA 3U21A 1FNXH 5CVJA 3N79A 2Q66A 3MMAB 4RZRA 2JSPA 2D3OR 1QVGR 1XMBA 2L4MA 3QT8A 1NK3P 3QJLA 1YQHA 2LQ8A 3PIPQ 4PYDA 4HV6A 2M7SA 3OOUA 3ZXSA 1LNWA 2PC6A 4IG0B 2ZJ2A 3CDEA 2VQEJ 1IDZA 2HQAA 2C2ZB 3H5UA 4A0ZA 4HLXA 5CHCB 1VRUB 4XKBA 3ISPA 2VI6A 1RP5A 4CLLA 1FNOA 1IZ1A 3VOEA 3N28A 1B9NA 1S99A 3GILA 4ZPVR 1RTDB 1ZN2A 1U1PA 2W9BB 1MNMC 3CJQA 4BU2A 1BGXT 1S79A 2RU3A 3EMTA 3DMJA 5H1SV 4C3IJ 2F48A 1B7YB 1JWWA 1R6RA 1KTVA 2ZITA 5J1PA 2KIMA 3KE2A 4IR1A 4NASA 3ML6A 2LF8A 3EVOA 3BO3A 4BKXA 5D3GA 5K5MA 4UT4A 3BWGA 5B09A 1BC8C 3GTQJ 5F8LA 5LMUJ 4ETXA 5E79C 3BTJA 1OMSA 2C3UA 4DV7J 2WK4A 2RVJA 4EATA 4BCAA 2YNFB 2W2NP 5B0DA 3PO4A 2AQ4A 2KI2A 4PG8A 3S15J 1SL2A 4MO7A 3HZGA 2W4CA 3ENAA 4A3CJ 1TFYA 5TJJA 1HNIA 1U8BA 4KDPA 5BYRA 3CJ5A 5F6FA 4LLLA 1X9WA 2RQCA 3EPIA 2BYCA 2YWWA 1LK5A 5GAGJ 4ILMA 2RN7A 3OSGA 2YWFA 3OTBA 3TZYA 4WFBQ 1JKHB 2DI3A 1SI9A 1HW9A 1NLKL 1QA6A 2WONA 4HF1A 1U48A 1IC8A 2FX0A 4G7OF 5DD8A 2LFVA 3LMMA 3FMBA 3GTGJ 1D8ZA 1M0SA 1OR7A 1RT4A 1HNXF 2FY1A 1T9VA 1HOMA 4HT5A 3K69A 1EH7A 3PUBA 1QD1A 1VQ7I 7AT1B 5IT9K 3C15B 3O8HA 1W2IA 2W2QP 1SAXA 4AXJA 4D3HA 1I1SA 3GMGA 3TJ9A 2VBYA 4P6QA 3K1PA 2DRDA 1RAJA 4DLEA 3CO7C 3MTJA 2VT2A 3VV2B 4DQQA 3ILJA 3ITHB 1WHVA 4EQQA 1RBOB 2EQRA 3MPYA 3GTLJ 1WFXA 3BR6A 1JXEA 2HYJA 2UVVA 5F1JA 1EF4A 1WSRA 5E3LA 1D0ZA 4M3BA 4Q5VA 3ZC4A 4L74A 2D9OA 2LY2A 2RMLA 1K61A 4NLGA 1VK3A 1X4DA 1EV7A 1FYLA 1ULRA 3R5JB 4FYXB 2P4WA 4P96A 4U0YA 1A35A 3L1PA 2ZD1A 5DG9A 3M8RA 3ASNH 3M4OJ 3M2RB 5GAEI 1SMYF 3MFIA 4XIDA 4YELA 5IYDJ 1TL3B 1MWQA 1S6LA 3NKYA 1G8XA 3KG4A 4RA2A 4WWSA 2B5JB 1YOVB 4FS1A 1VQ4S 1A04A 1FJLA 1FYMA 2HKEA 3AXKA 2F5DA 1MWYA 1T0FA 3C2GA 2DCEA 5KFUA 4PQUA 5DCFA 2LXFA 4X62F 2FJWA 2IBDA 1VHFA 5CYJA 1WDDA 2ZH6A 5AXNA 4CRJA 2JWTA 3PM1A 1WC0A 3ULHA 3KHRA 3CGIA 3CD0A 1TL8A 3LSJA 4ZTFA 3CULA 2HBQB 1WG1A 2EC0A 3SQOP 2IS1A 2NVXJ 1D09B 4O3OA 3N4WA 3MPWA 3AODA 3HFVA 4PR6A 4WK1A 2WVEA 4NQWA 4ID8A 4OYMA 4KGVB 2ZH5A 1GAOA 4ED6A 1ZZNA 1MH4A 1FJGJ 1S7EA 3BC8A 1ZG5A 1H7XA 5H6QA 1S0OA 2LR8A 4K50A 4HH1A 2D7SA 3P8BB 3ZMVA 2CNNB 3HRUA 3C3LA 3AD9C 3HL2A 3KUEA 2DGWA 2QKMB 4JYAJ 1HKSA 5EX0A 4QSHA 1Q1HA 2UP1A 3BGRB 3BPXA 3RPUD 2K3FA 2E5ZA 2HXIA 3M9OB 5F1RA 2R2SA 1JUSA 4WFYA 2AO9A 3BY6A 1S1UA 1GUUA 2HQ5A 3DFEA 3FEYB 4DL6A 4O6JA 2FVQA 4WX9A 2DIUA 2W7AA 4R0EA 5EHHA 4FS2A 3O8WA 5L46A 4TN2A 1GHCA 2I0XA 2ZEJA 3IXQA 4LVOP 1HWLA 3HRMA 1IKYA 2IP2A 4C97A 4FYWB 5L1JA 3GTYX 2HS0A 1BW6A 1BLUA 3CWJA 4CUGA 4LF8F 3H5XA 3DPTA 1UFKA 2HOAA 2QGUA 4BWMA 5HLFB 2R7TA 3K8WA 3M8PA 2HFOA 4KGZB 4AIKA 2B9EA 1F9EB 2CNOB 1T9WA 3GZNB 1OSDA 4CYUB 1BWEA 4MQVA 5FLXU 2LTPA 1GVJA 3B8HA 3AG4H 1BOAA 1H88C 1R6VA 1OYYA 2DA6A 5L3CA 1RTIA 4WXHA 1KC8T 2NPIA 2XPUA 1WJ5A 2UZAA 1IR1A 1P8GA 4C3LA 1MBHA 4A8KA 2CUJA 4LFUA 3SV4A 4I01A 5EWEA 3DHWC 4CLYA 5LRRA 3GE9A 3VODA 4PSXA 1FMVA 3A0HC 3PHEA 2DFHA 4CT8A 4FISA 3TI0A 1HHQA 1G7CB 1FOWA 2LQBA 2QYOA 1HMVB 2DW4A 3GZ6A 5CCMA 3CCLI 5EUHA 2F63A 2XHWA 1UA0A 2LA4A 2RE1A 1UCRA 2LY9A 1S1XB 3R2CJ 5DDOC 3NWTA 3SXYA 1LW2A 5E41A 2EPFA 3QATA 4XO0A 3KLHA 3DOLA 2UWMA 3CCSI 4TKTA 1U1OA 2RHSB 5HAOA 4IO9Q 1SV5B 5C3EJ 4USMA 2F4MB 2L7ZA 3TDZC 2A07F 3MTKA 3W64A 2ERRA 3S93A 4RUAA 1NSQA 1XR7A 2C3PA 5DJBA 3I55S 4WFZA 4LFCF 5LGUA 2MH2A 2MTLA 2OTJI 1H98A 4XOTA 2VKZG 4C48A 4A3KJ 4P5OA 5I3QA 2R5YB 2CPZA 2XF5A 1MWZA 3OYGA 2K1RB 2WCXA 4JX4A 3TA1A 1SKWA 3DCFA 1C1BB 4HI2A 4D5CA 5GMEA 4DI6A 5IY5H 2CO5A 3NAIA 1YE9A 3M9NB 1IWAA 1AT1B 2YNIB 2FGOA 2IAIA 3O6BB 4DSIA 4MK8A 2DVIA 1KBRA 2DGXA 2JUCA 4U7UK 1S1TA 2OQGA 2N8GA 2E1CA 1WJCA 3F8NA 4HQEA 1OCRH 2XNQA 1USTA 2JVGA 2WAFA 1HWUA 1VBZA 1S0NA 4B9TA 3HTUA 3OL8A 4IF4A 2DISA 1FMWA 3CCUS 2I38A 2V6EA 3CDLA 1Y5NB 1S1WA 5CVIA 2V2QA 3LW5C 1LK7A 4ED0A 1BUXA 2LFBA 2CA9A 2K40A 1D1CA 4NHJA 2LU2A 1BWVA 5TISC 5CXTA 3OW2R 2DA4A 3BQ1A 3H40A 2VDHA 4K0KJ 1S6QB 1TWCJ 1JT0A 4ZJOA 1URRA 2E5GA 3GFYA 3K2ZA 1VQ5S 4X4NA 3AY0A 4DPTA 3R7BB 4DFMA 1K6YA 3P9KA 5KVRA 4N76A 4X4PA 1FD2A 2H4WB 4XL9A 5LHIA 2PA8D 4QW9A 1IRGA 1Y10A 1S9GA 1ZAOA 1SD5A 3OT9A 5D4OA 4ZVEA 4JX5A 2QTWA 5D5WB 3WX4A 1P9QC 3JRCA 1AKHB 4QCLA 3R0AA 2BJ1A 3BPSP 3JRIA 3SHFA 4ZKAA 5JI6A 3V6KA 4TLRA 3HJEA 3CCVS 3D1NI 4YB5A 4LK1F 1MMSA 3E6MA 4A3EJ 2CDQA 5BYSA 4MTPA 3I4PA 2C2EA 4NLTA 2E9ZA 3H25A 4P75A 4DQRA 1Z91A 1UETA 4WXOA 4A0XA 3ISZA 3EDRB 3DRYA 4IFYA 5FDLA 1XMKA 2CRLA 5EF6A 1YIJS 3TRGA 4X4RA 3OYJA 3M32B 1B72A 1YIOA 4Y2MA 4RUBA 2NVUB 3G3ZA 2XYPB 3OLAA 2MQOA 5T41A 4F2SA 1MG7A 1XS9A 1LFUP 5J1UA 2D3UA 1BN5A 3G71S 1VTNC 2CQNA 2RQKA 2RC4A 5HLTA 5CKTA 3FGVA 1M1KT 4WJBA 3CLOA 1I3AA 1QU3A 1B70B 2ASDA 1FT9A 4GFBA 1BHNA 4USTA 1ITPA 4LF6J 1Y6IA 2DRAA 4IOBA 5LJ5Y 4KHPF 1MROA 4C8OA 2GZOA 4JI1F 1WRJA 1TL7A 5FD5A 5ITHA 4DSJA 5LMNF 4PJLA 1TNSA 3D6FB 2P5LC 1CF7A 5DD4A 4QWDA 4RUCA 4URQU 2G9OA 3ESWB 1KLMA 3N05A 4N41A 3IR6B 5HMWA 3AD7C 3DEWA 2MC3A 4ZVOB 3E1SA 4DL5A 2Z2ZA 3DU6A 2ZMEA 3KMQA 2UV1A 3BJ6A 1IJEB 4TY9A 2V1XA 4OFZA 3MM5A 1NG6A 4PKDB 5C24A 2WAQA 4IX7A 1G59A 2HDDA 4DV5F 2HURA 3IH3A 3GTMJ 4NDLA 3DMJB 4PDKA 5IT3A 3VSLA 2OSRA 1XGMA 2DPJA 1H7WA 2JNJA 4X1EA 1IBKJ 1XMQJ 3AQOA 5KFHA 2G2ZA 1AFIA 3K4JA 3BR2A 5ED4A 3MWBA 1VQ8I 1OISA 1S7AA 2HQNA 3A03A 2B0LA 4K2JA 1Y00A 4OX6A 3WDOA 1U6BA 3GZ7A 2BE7D 1FKPA 5IT9U 5H6RA 1KRPA 3VVTA 3T9ZA 4FT8A 4L9JA 2CQBA 2P0WA 2EBEA 3B73A 3KJNB 4RB0A 1VMBA 2DNLA 2Y0SN 2LKSA 2G2YA 1VQ9S 4ECSA 3WTTC 5K5RA 2PEBA 4J5OA 3PYGA 3ETMA 5HATA 2VBXA 3MOZA 1SBRA 3L2WA 1R22A 5E33A 2LQ5A 3FK7A 3W5XA 1QM9A 2EEYA 4P9FA 1F60B 3HVTB 1SEUA 4C3HJ 3FXUA 2VC0A 5CD4H 3BJOA 3KJVA 1TK0A 2V79A 2IAJB 2WAEA 5GMDA 4XSXF 3G82A 4OZNA 1S97A 2CS3A 3HRTA 4Q45A 1AU7A 4KY3A 4OYAA 4Q2LA 4O44A 3HYIA 5M5WJ 4OYXA 3C14A 4QIEA 4Q5SF 5DQHA 4M3EA 1GX6A 3D4JA 3K6GA 2GO8A 5BR8F 2GMHA 2HYFA 1UTAA 4DW6A 2UU9F 3R1HA 1UFWA 1JLQA 2BXZA 1Y9OA 2FLOA 4A48A 2N3OA 5E3OA 4I56A 3WTSC 2HNYA 4IHXA 5BPDA 4CLZA 2GMLA 2DXDA 3THVA 2L02A 2BJ3A 2NYHA 4RKUC 3HMJG 1U1QA 2RQMA 2P9EA 3PTWA 3T1HF 3OL6A 1FI4A 3WTXC 1Z2LA 2V9KA 3J80Y 2A6TA 2DKOB 3MM7A 2MKJA 1RKJA 2MJUA 2LRDA 1ZREA 3C2BA 3LOCA 1QY7A 1EKSA 4QBUA 2PD1A 1LB2A 4HHJA 4PQUB 4YY3F 4CLWA 8RUCA 1F1BB 2AIRB 1MLAA 3GYXB 2ZXJA 4LQ9A 2VJJA 2JUGA 1H38A 4B3TJ 3PYEA 3DTEA 2E5NA 4XM3A 3K4MA 4I0BA 1RCOB 2CQPA 2GFFA 5AONA 1N4LA 4OIPF 1RTJB 3S2HJ 1ZAXA 2D2WA 2LH9A 3KP4A 4A3BJ 4F04B 4S0HB 1NMEB 1F2GA 4YIIA 1WI6A 3TO6A 3MEDA 2HQ3A 3A2KA 2MGZA 3E51A 2KIQA 3CIZA 4YS2A 3FXKA 5J1YA 3I32A 2IGOA 1VQNS 3PR5B 1H74A 1S1UB 2E36A 3AOBA 1ETWA 2GXAA 1XSDA 3LA2A 4RWXA 1RWPB 1UAWA 4NLXA 4S0MA 3S17J 2VFUA 4UOHA 4DR4F 1PYSB 3D68A 1VI7A 4ZP6A 1WC4A 1YJNS 1U78A 1IKYB 1MKMA 4ENKA 4U0WA 2XZTB 4M5IA 3A3OB 1D9FA 2A6HF 2RILA 1C0TA 2FDNA 2ZHAA 1VGYA 2JZYA 2VL8A 3K4NA 3DKYA 3R3TA 1OKRA 3CC2S 3MAQA 1H9TA 4BY7J 4WFNQ 1UVNA 4W1UA 4IDKB 4Y0FA 4Q0BA 1NK7A 1NSAA 2VH7A 4I4BA 4CQ1A 2XO6A 4NA3A 1XIQA 3Q89A 4EJWA 2CNLB 2FTRA 1RTIB 3W3CA 2HEKA 3MM9B 3RUBL 3TVZA 1O0PA 3SDEA 3K89A 2AD9A 2OF7A 1J09A 1R0AA 1XBWA 1TTHB 1S29A 3FXJA 4KR0B 5KOWA 1ETOA 5ERIA 3OS0A 2AWZA 3JRAA 2R2UA 4USIA 1SVLA 4U9RA 3W63A 1X1BA 2BKOA 3Q8RB 2Q6CA 4OZJA 4C98A 5CJ9A 1UPMB 3ZTPA 3L3CA 3HTSB 3B82A 1F5TA 2WB1A 4HH0A 1HBUA 4WFXA 2Y1JA 3K10A 1G4CA 3KLHB 2R4GA 1FFWB 1HQUB 1UEUA 3GG1A 2VPZB 3VZIA 4CTAB 3P9CA 2EK6A 5A2QZ 1X3UA 1LEAA 4JYKA 2FHMA 3VVUA 4ENOA 1IN5A 2WB4A 4NYPA 1T05A 4B47A 2OA4A 4ZYDA 2KRCA 1T8EA 1XC5A 1N5YA 4M5LA 1HI8A 5B66C 3KHGA 3O2PE 1O3QA 2P5KA 4HHHA 3QWLA 1N54B 1JLAA 3PRDA 2NYIA 4LQ3A 2XAQA 5K7FA 2YKAA 5HK4A 4A46A 2GAGC 4A8QA 1A6LA 3KYCB 4JOUA 4N8NA 4I6WA 4DR5F 2RUSA 2W4SA 3JAMY 2HGNA 1XERA 4ERDA 4O3PA 2HFSA 3CUQA 2IM0A 1Z6RA 1UJ8A 4DL3A 2LBFA 3GWZA 1RHQB 5JVGQ 3DTKA 2ZOGA 5H9EJ 2DR6A 2OTLS 3OUYA 1U3EM 1U2FA 3L7WA 1IUYA 2ZJPF 1P2FA 1EIYB 2Q79A 2LMDA 1Z6TA 2GZWA 1PCAA 4J9VA 1LDJA 2KRRA 1S1WB 4NMXA 1VF9A 4C2UA 3UD4P 1R5HA 3ZZZA 2QCOA 4A3IJ 2FOKA 1LEOA 4UOGA 3JQMA 3NRBA 2XS7A 4JI8J 1BL0A 1RR8C 5KOXA 3AXMA 4WYWA 2XF6A 5CA5A 3RBEA 2AP6A 2HRTA 2C2DA 2YQ0A 4KV8B 5CYVA 2DO0A 2AX0A 2GV1A 4I7FA 2MKYA 2IHR1 4FDFA 5L3FA 3A4CA 3HHHA 3EZUA 4PJMA 3HFKA 4BDZA 1IF1A 1MSEC 3DNCA 3LAKA 4M5DA 3T9NA 3OYCA 4QIGA 4DR1F 2OPPA 3GG0A 4CLKA 1Z7LA 3Q8UA 1N32F 1EH8A 1S9GB 4OLOA 2KH9A 3HOZJ 1YHQS 3KLIA 3TO8A 1VQ6I 5J4YA 4I6ZA 1TMJA 2OPRB 2HG4A 1CQTA 5KK1A 4B8XA 4FXVA 4DF8A 3ZXWA 2ZKZA 1XEZA 3CJKA 3JTNA 3I9ZA 1IKXB 1BQNB 3CC7S 2O5RA 3EUHC 4QYZJ 3HZJA 1RE1B 4U7UD 3Q23A 2KQRA 2L4AA 3F22A 3JW4A 1FTRA 4Y2AA 2ZDOA 4LF7F 2FSWA 1HQEA 1TK8A 1MMGA 4NC7A 1HYSB 1VRQC 2QFJA 2IY5B 1K73T 4WIIA 3AD8C 1IXRC 3CMQA 3F8MA 4PG5A 1B72B 5L1KA 2VF3A 3NGUA 2H09A 2OC6A 5LSOA 4D7MA 2Q0OA 2VBZA 3AB4B 2ESNA 4ZHRA 4DS5A 2X1CA 2RT3A 3ENWA 3JB9k 3WTVC 1WSVA 4X4OA 4XSZF 4CP5A 5E3QA 1MBKA 2R7OA 3CMYA 2I1RA 3CJRA 3CCQI 1N5VA 1N5QA 3MZIA 1HI0P 4PUSA 3HOXJ 2J0XA 1MROB 3V7RA 3FHZA 2AEFA 1H3DA 1QTNB 1WI3A 3ASOH 3K2AA 3JSPA 5C4JJ 3T1YF 1CF7B 1LE8A 2WRMA 3O1LA 4DQSA 2ADBA 2WY7Q 2ZVIA 2QSFA 1UB9A 2M4KA 4DPYA 1G3OA 3BO2A 2ZWPA 2ZMEB 3NWGA 5C4XJ 5J2NA 2KMUA 1LXNA 1F3FA 2M8HA 2NUHA 2OFHX 3CP8A 2VJ5A 1ENHA 1Q8BA 3ZQIA 3RBDA 1RKWA 4BQNA 1OPCA 1OCOH 4U7DA 5DZ6A 1BI1A 3C2PA 2FJ1A 2BY3A 4L18B 1ZTRA 1WNEA 3I96A 2HZCA 1IXCA 5DZ7A 1ZLKA 2JRTA 3PZPA 2ZOMA 2HS5A 3MM6A 2G0CA 2PFBA 4WWCA 5FKNA 3RRGA 2OJ3A 3WODF 2EV0A 1EJ9A 4OI3A 2XGPA 4KRWA 4M8LA 1DTQB 1PC4A 1FKPB 2B4VA 3T5JA 3M1EA 3HHLA 4JP8A 2FLPA 3LALA 1JMTA 3Q24A 3PFOA 5CYMB 4RAFA 4P2FA 3UCUP 1Z4UA 1SFOJ 3W9JA 3G4SS 4PABA 3HP6A 4ER8A 2YU9J 3OL4A 3C46A 4FYYB 2W7PA 2DR7A 3A3NB 3MD2A 1PO6A 3PX4A 3R4KA 3BZCA 3QPHA 1EP4B 2M0GB 2V8DA 1TKTA 1C0UA 4M95A 2XYHB 4ICLB 1VYAA 2J7UA 4WE1A 2CWEA 4NWBA 2G0EA 3S8PA 2HIQA 4JB8B 1B4SA 2P9GA 2DHXA 1RA7A 5AE3A 2M0CA 3J7YI 4FF4A 2XWYA 4JBCA 3MMBB 4DNCA 5C25A 5JVTA 2DGSA 1FERA 1H2UX 5K7HA 5F9LA 5HVGA 2YX1A 3BZQA 2A6MA 5DG8A 2JWNA 2JA7J 1FFGB 4F92B 3UN3A 1X1DA 3DRSA 3Q22A 3RDIA 1T3OA 3QODA 1JLQB 5E3AA 5A8WA 2R5ZA 3FK6A 3CJ8A 3DLBA 2B4PA 5CLSA 3H8YA 4ZPBA 1FTCA 1HC8A 1PUEE 2HNYB 1CSJA 3LP2A 2Y1IA 2JPCA 2F7VA 3BYPA 3DOKA 2WSEC 4DV6J 4EJVA 4ZN1A 2B3TB 4MHGA 3QT7A 1OS5A 4K2EA 5GAEJ 1D0EA 1UAAA 5M5XJ 4EI2A 1SH2A 5CVUA 1TL4A 2F8HA 5DLGA 3QIPB 2FE3A 3AA8A 3HDDA 2KN4A 1J2VA 2DTZA 1S48A 1ZETA 3TBIA 3MN2A 1AUSL 4WZMA 3H5NA 3TAQA 1PC5A 3M8QA 3IRXB 3VAHA 2F6CA 2CW0F 5D77A 5JXSA 3F21A 4WXCA 5GAHU 5IT4A 2RGVA 1FWLA 3KLFA 2HTJA 4Z2XA 3E5XA 1T56A 4A8MP 1XG1A 1KEKA 3EGZA 4J7CA 2ZH3A 2DPUA 4CCMA 5B3SH 1XR6A 2HOEA 1WEXA 1Q1KA 4ZN3A 2HU9A 1VLOA 1R9TJ 3NOGA 1R36A 3ZP5A 3W8GA 2A61A 2XS2A 2DDBA 2ZC2A 5LLQA 2DMPA 3MEDB 1Y7PA 1NH3A 3IAS9 2K4BA 2F5CA 2MGZB 1QE1A 3TA0A 3ISNC 4WPAA 3H9JA 3JSMB 1QNTA 3UR3C 2QBYA 3G96A 4CGZA 2E66A 1DGRM 4Y3CA 1X19A 4DUYJ 1QSSA 4UB6C 1L3TA 2VKHA 1HKQA 3EVWA 4NC6A 4DUTA 3AAFA 5A76A 3GLJA 2P6TA 1HBOB 2A6EF 3IH4A 2ACMA 2LU1A 3A8EA 4NX9A 3GYNA 3HT3A 4EGZA 5L38A 4AU7A 3ONQA 1PBUA 2UV8G 3UVJA 3IV5A 3VDXA 1SFXA 3Q0WA 1YO5C 3HKZA 3VF0B 3ZMZA 3IWFA 4Q0BB 5HMXA 4ZIVA 2EBIA 5KT4A