1LG1A

Crystal structure of human chitotriosidase in complex with chitobiose
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
365
structure length
365
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Human Chitotriosidase. Implications for Specific Inhibitor Design and Function of Mammalian Chitinase-Like Lectins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords chitotriosidase
total genus 114
structure length 365
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1lg1A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1lg1A01
3NDZA 5HPCA 1D2KA 1BHGA 1EHNA 4E8DA 1WDRA 1JAKA 3MV11 1UWQA 2YBUA 3SUUA 4ZFMA 2V3GA 2V38A 4UZSA 5A6AA 1GW1A 1UKSA 3AMLA 3AYRA 3OZOA 2CCRA 1UKPA 4M80A 2WC3A 5LA1A 3JUGA 1C7TA 5EFFA 3HMCA 1XSJA 2GK1A 2A3AA 1QNOA 5JBFA 3W24A 3PZMA 3GH4A 1WNOA 3AJ7A 1FHDA 2F2HA 4OZOA 1H2JA 1HF6A 1MFUA 1R7OA 1OM0A 5C71A 2ZUMA 3IK2A 5E0CA 3GYCA 3NSXA 5A69A 3AMKA 1UD3A 2ZXDA 5HDRA 4AXNA 1AQHA 3IANA 3VNYA 1RD6A 2D0GA 4PMNA 5IHRA 2A3BA 4XZBA 2VZVA 4J3WA 4GQQA 4P8VA 3BGAA 1EDGA 1V08A 1JZ6A 2GDVA 1Q4NX 4KRTA 2ZUSA 3SUSA 3WEZA 2VX7A 4TOQA 1XRVA 5E70A 2JEPA 1JAEA 3VIPA 2PB1A 3OGVA 1HKIA 4J27A 1QI0A 3PBGA 2XIIA 1SFSA 5EBAA 2HISA 1WDPA 2XJ7A 1YQ2A 2J8FA 2JALA 1ITXA 3IAQA 1TFVA 4Z2KA 3MMUA 3NCOA 5CSYA 2E3ZA 3KE0A 2W63A 1W9PA 1HJVA 1GORA 3T2PA 1UKQA 4XV0A 4MB5A 5C70A 4JKKA 2OLHA 3MUAA 5A2BA 4CVWA 1WAWA 1BVNP 2BVTA 4LQ1A 4DWSB 3U7VA 3RO8A 1JZ7A 1FFQA 1W9XA 4V28A 1PAMA 2WVTA 1BSIA 4QP0A 4MAZA 5CXPA 2X05A 4GZIA 1JF6A 3CTTA 3N15A 1HKKA 1E71M 1GZJA 1V3JA 2BY0A 1WZMA 3GXDA 2ZUUA 1KCLA 3VX1A 2IXUA 5A95A 2JFEX 5IFTA 2WWDA 3ARTA 2FH8A 4QLKA 4AMCA 2VCBA 1LF1A 4ZE5A 1JYNA 3K8MA 4HA1A 1C92A 1JD7A 1H3GA 3VU2A 4Q7NA 3WD2A 2JF6A 3MSDA 1UWRA 5KEZA 2UY2A 1CXHA 1CTNA 3BC9A 4IPNB 2PC8A 1E4IA 3FAXA 1KWKA 5HNNA 4MB1A 4K68A 2Y4SA 3OGRA 4ACZB 5LA2A 5AYBA 1CNVA 2ZUVA 3T2OA 1PEZA 3CMGA 3AMDA 3WNNA 4NI3A 1QHZA 1ZBKA 2CBVA 3W27A 4WK9A 4YPJA 5I3DA 4AZBA 3KL0A 2YLAA 1UKOA 2G8ZA 3DYOA 3POHA 1IZKA 1MQQA 3CUJA 5KZ6A 1I1XA 2XVGA 7TAAA 1UQYA 2OWXA 1JDCA 3W25A 1LJYA 2QF8A 3L4VA 1V3MA 4HZ6A 2XSAA 3EDKA 1E6XM 4Z2LA 2WC7A 3WELA 3VNZA 3DECA 3K8KA 1UH3A 4MNKA 4F9DA 2UY5A 5FL1A 1EA9C 3CGTA 3SCTA 2J7EA 2IXVA 2WCAA 3AHZA 3NYDA 2WZIA 2VX6A 2VUYA 4QDMA 1QNPA 4B3LA 3WNKA 1MW1A 3CMJA 1UWSA 3VDAA 1M53A 1WP6A 4UQBA 5EFDA 4W85A 5A8NA 3O2LA 4UNIA 1XYZA 3GDBA 4FK9A 1X1NA 2OSWA 4DUXA 5CG0A 4JFWA 2YBTA 1GVYA 4BQ3A 3ARRA 1I1WA 1PIFA 4JFVA 4HA4A 4BS0A 1BTCA 3RIKA 2G3NA 4DWSA 4IPLA 1FA2A 3L2MA 4S3JA 2JIEA 2QLYA 4CKQA 2FDMA 3FAWA 3L2LA 4HMCA 2CKSA 3W53A 4PMOA 3SEPA 2EXOA 2WMFA 4DM1A 4FLRA 1JZ5A 3I3BA 1TE1A 5CPSA 3SCVA 4KGJA 4AW7A 2XWDA 3IJ8A 1LLOA 1H1NA 3O9NA 4J3VA 1GOOA 1GQKA 1CGTA 3N12A 3TTYA 1VB9A 3VGHA 1LL6A 2XHYA 1MWOA 4ZENA 3BXWA 2XVPA 2CYGA 3TTSA 1LWHA 4PEEA 3WD4A 5M3WA 3RDKA 1DWJM 1FOBA 3HJEA 1XCWA 3AQUA 2J7CA 4OOZA 2BS9A 1LWJA 2EEXA 5CLTA 3MUY1 4NRRA 2AMGA 1JFXA 4RL3A 1E4LA 4GINA 1V0NA 4UR9A 4J3SA 3RM4A 5JBDA 2PWHA 3CHCA 2ZX9A 4QAWA 1MVYA 1GVIA 1HXJA 3ARVA 2OSXA 3KZSA 3WUFA 4W89A 1EO5A 1U30A 1ZU8A 3AMCA 3ARUA 4NRSA 1FH7A 1BGGA 5IXEA 3VDHA 1VENA 1HN1A 4JFSA 5A8MA 4JZ5A 3KL5A 1UZ4A 3ZR6A 3U5YA 1CPUA 2J75A 1ZL1A 2ZOXA 2ZUNA 2WWCA 1ZS2A 2J7FA 3QGVA 3EDFA 3CZJA 5CGMA 3WF2A 2DGAA 5A8OA 3KEHA 1GHRA 2EO7A 3VGGA 2XM2A 4RE4A 2J78A 4X0NA 1PIGA 5A1AA 1J12A 5BYWA 1CBGA 2DSUA 1XV8A 3OG2A 3G6LA 4JAWA 3SURA 2AOSA 3W0KA 3NIYA 4MB3A 1XSKA 1GHSA 4OKDA 2J62A 3DYMA 4D1IA 4BA0A 3BAKA 2CITA 4IUGA 4UFIA 3ZSSA 3ARZA 3WDRA 1C8YA 3W38A 5BXTA 1CLXA 2WMGA 2NSXA 1V6VA 4W5ZA 1GJWA 3BLPX 3RJXA 1BVZA 2DDXA 2WKLA 4PUDA 3VILA 2ZUTA 1QBBA 2DH3A 1A3HA 1WB0A 1B0IA 2GDUA 1KFWA 4GI6A 4H8VA 2YL6A 2VRJA 3MMDA 4BQ2A 1JG9A 4W86A 4AWEA 2XVNA 4IISA 1QW8A 1QI5A 4CD6A 1J0IA 1SMAA 1B3WA 4C7GA 2CETA 2J7BA 1EIBA 3GBEA 1XGZA 1SMDA 1KGWA 6A3HA 2DSWA 1G01A 2QPSA 1CXEA 3G6MA 4GKLA 1GNXA 1V0LA 4JCMA 5I2UA 2D24A 5CSUA 4PBGA 3SCPA 1ITCA 1HVXA 1NOFA 2YJQA 3VIKA 1BYBA 4HPHA 4CCEA 1HNYA 1B9ZA 5D9NA 3WDIA 1E3XA 5LYRA 3CIVA 3BMVA 4P8UA 2YL9A 4AC1X 2X2YA 2QPUA 1W9DM 1J0YA 1E5NA 5D9OA 2YL8A 3ECQA 3PTQA 4TTUA 4HOWA 1XH0A 2ZX6A 2VR5A 1UHVA 2XFFA 1RPKA 1S46A 2J77A 4YHEA 4XX6A 2VZOA 2VRQA 1JIBA 2XTKA 2X1IA 1H09A 2PBGA 2GJRA 4AZ6A 4WKAA 1EXPA 1UR0A 1OIMA 2VL4A 4D6FA 3FXYA 3PZOA 4PMDA 2GVYA 3FN9A 1EOMA 5A8PA 4TVDA 3TONA 3B8SA 3SCRA 2EPLX 3PZGA 1HT6A 2OSYA 3WH5A 4CN6A 3CUIA 1HJUA 3B9EA 1TA3B 2ZX7A 2YOCA 5E0FA 1KXVA 1BPLB 2QMJA 3WQ6A 2BHYA 2BXYA 3TP4A 3U57A 1B30A 3NDYA 3UEQA 4AZCA 3IAPA 1XD1A 2F8QA 4WIWA 1GJUA 2GUYA 1B1YA 1C8QA 2F61A 3NSNA 3K4DA 3VM7A 2GJXB 3WQ8A 5FL0A 3I3EA 4D6HA 2WCSA 1CEOA 3N17A 1M7XA 4PUEA 1JZ2A 3WDHA 1RH9A 3SUTA 5DEZA 1ZBVA 2ESCA 4AZGA 4UOZA 1E55A 3SCUA 4ZXOA 3ZQ9A 3AIVA 2A3HA 3AOFA 3T0AA 3F4VA 2OWWA 1LG2A 1TVNA 3APGA 4PMQA 4PMRA 2W66A 3VGFA 4M29A 1NWTA 3CPUA 3KL3A 4LX4A 3WUBA 3A4XA 1J0ZA 1C3FA 1Q6EA 2WAGA 1E1FA 2E40A 1HL9A 4B3KA 3ZJ8A 5A6BA 1FH8A 5I6SA 3RM9A 3WMBA 5ABFA 1EH9A 1DWIM 3GXIA 4GZEA 3BAWA 3WQ4A 3CZEA 3PZTA 3MMWA 1W1PA 3AXHA 1ISYA 5JIWA 3VIJA 6CGTA 2DH2A 1GOMA 3PZVA 4PSPA 4Q22A 1NOUA 1O7AA 3ZMRA 1G1YA 1NH6A 3ZOAA 1K9DA 3QOKA 4D6EA 2ZXBA 1L0PA 1Q6FA 3HU7A 1VEMA 4AD1A 4W7WA 1V02A 3ARYA 4B9YA 4DWSD 2A3EA 2BVYA 4URIA 4N0RA 3QR3A 1OD0A 1E6NA 2D20A 3AS0A 4CD7A 5GPRA 3OIHA 5HXMA 1GOQA 2WKGA 1HKJA 1VFOA 3ZT5A 1HX0A 4TUFA 2VRKA 2XGBA 4D71A 1F4HA 1V3KA 1VJZA 2ZXAA 3QHMA 3VGDA 2ZIDA 3EDDA 4UFKA 2VURA 4DUVA 4FLSA 5D8ZA 3AIWA 4L4OA 2XIBA 2E8YA 1QI4A 4FMVA 4W8BA 3ARQA 2TAAA 3S2CA 1E1EA 4ACZA 1NP2A 1VIWA 2VMFA 4OUEA 1H0GA 1W1TA 1GCYA 2WBGA 3E1F1 1UA3A 3EMQA 4W8AA 5D4YA 4GIAA 5D9MA 1WKYA 2XFYA 4J3TA 5HPOA 2D2OA 1I75A 3GZAA 1DWHM 4EANA 1NM9A 1BFNA 1VBRA 5IHSA 2DQXA 1KXQA 4WSJA 1CGVA 4WLCA 1O6IA 3UR7A 3AZSA 4UTFA 1JZ4A 2GFTA 1HVQA 2WHKA 1B31A 4ATLA 3CUHA 1ISXA 3N13A 1V02E 1UH4A 1JNDA 1NARA 5I24A 4PMUA 5CQ1A 2GJXA 4AZ7A 2WMIA 1XHGA 4CUCA 3OLDA 2BVDA 3UERA 2OYLA 2VI0A 2BY2A 5GQBA 1UYQA 4ZXLA 1H41A 4D6DA 3ZR5A 1JXKA 1JYWA 1ZBCA 4QLLA 4D6IA 4J3UA 4W7VA 4CN4A 1XD0A 3SUVA 4V27A 3J7HA 2WMHA 1MQPA 1E73M 3OA5A 2VC9A 1CZ1A 4E4PA 4JFUA 4CU8A 4OBSA 4JCLA 3PHAA 5A6MA 2WCGA 1W2VA 3CH9A 2WB5A 1MXGA 1OB0A 4TX6A 3VIOA 3EYPA 3L4ZA 2C8NA 5D9PA 4MJ4A 1L8NA 1E6RA 4U2ZA 3SUWA 2BY1A 5JUVA 4UFJA 3ARPA 4KWUA 3EDJA 1E6PA 4LGXA 4KMQA 3PZNA 2NT1A 1DTUA 1BAGA 1E3ZA 3ZM8A 1CXFA 2CKRA 3AHVA 1MYRA 4PMVA 3WQWA 4AY1A 5AC4A 1W3JA 4UFMA 1RP8A 3K4AA 1JYXA 1EO7A 3AROA 4UFLA 2ZWYA 2PBOA 2V3EA 3ZJ7A 2VX4A 3BSGA 1HL8A 3ZT6A 5JH8A 4U2YA 3W26A 4C7DA 1V6YA 2O9RA 4HZ7A 4MNLA 4CD4A 3OLIA 1OGSA 2PI6A 1HP4A 3N04A 3VMOA 1J0JA 3WD3A 4LXFA 3UG5A 2CPUA 2DIJA 1BYCA 1AVAA 4NZCA 1HP5A 2ZICA 2YKKA 2W4XA 1VF8A 4BCEA 1UD2A 1E0XA 5I78A 2J7DA 4UZUA 2QV4A 4HOZA 2VCCA 3T2QA 2CERA 5AYIA 4BF7A 3AS3A 1E0WA 1JZ3A 2W62A 3VO0A 4QCEA 2EJ1A 3A4AA 3MUZ1 3M07A 4MDOA 1JXJA 1J0KA 1TCMA 2WANA 1B3VA 2CNCA 1OIFA 3W82A 1GOKA 2J74A 1WPCA 1VBUA 4IM4A 1B3XA 1K9EA 4MNMA 4QLJA 5CLWA 1QHOA 4XUYA 3WN6A 3T0BA 2DT1A 2EPKX 4MTVA 4J3XA 4OJYA 3T09A 1R86A 3ZSTA 3PZQA 3GXFA 2FHBA 2NW0A 4P8WA 3SCQA 2UY3A 3WNLA 3T0DA 2WSPA 5ECUA 3B9DA 2XGIA 1NQ6A 2E8ZA 3D5HA 4AD4A 1J9YA 4PMYA 1LL4A 1GOIA 3PTKA 1BGAA 2WSKA 3W81A 4AIOA 1BYDA 2WMJA 5A2AA 3MSGA 3WH9A 1WCGA 2VR4A 3FHAA 1JGIA 1CGUA 4GO8A 1WDQA 4H04A 2ZWZA 2O9PA 1PZ3A 3RMEA 4MNJA 4WKHA 2WYSA 3SCOA 3ARXA 4M82A 1FH9A 4PCTA 1ZBWA 2CHNA 3CUGA 4TVUA 3RM8A 1PPIA 2VTFA 3BSHA 4M8UA 3WFZA 1UWTA 2WLYA 4JKLA 3N9KA 3VDBA 5ABGA 1XCXA 1CXLA 3EBVA 3A4WA 1W9VA 1ZJBA 4UFHA 3WDPP 3IJ7A 3WH7A 5CPQA 1GUVA 4D6CA 4J28A 1U33A 3AMGA 3EMZA 1V0KA 2E9BA 4AD3A 3A6OA 1KWGA 3CZLA 3VDCA 1WDSA 3THCA 3UR8A 4ATDA 4P8XA 1M03A 4QFUA 1OINA 1UA7A 5BCAA 5BRQA 1Q6GA 2WLZA 4H41A 1JYVA 1R7AA 3VD9A 3M6DA 2YDSA 1RP9A 2DSKA 1WZAA 3VMPA 4ML4A 1XH2A 2CHOA 4P7OA 2VZUA 3UG3A 2X0YA 2V5DA 5M5DA 4DWSC 5LA0A 1X6LA 3BH4A 4GI8A 4AD0A 5A3HA 4F9JA 4H2CA 5DFAA 4EK7A 3PZUA 1B2YA 5BXPA 5BWFA 2XUCA 2EBNA 3VD5A 1BYAA 1KB3A 2NT0A 1OWQA 1KBBA 4F79A 2WHJA 2FGLA 4F66A 1A47A 1XSIA 4E2OA 1W2PA 3AICA 2Z1SA 4KH2A 2E9LA 3ZJ6A 2ZE0A 1HJXA 2EPMX 4CU7A 1DHKA 1TG7A 2D3NA 1US3A 4OIFA 1OT1A 4LYRA 2G4FA 1B90A 3FHQA 3UETA 5E6ZA 2PWFA 1PX4A 2VX5A 2J8GA 4CU6A 2DSZA 4UQDA 3GNPA 1DWGM 3N18A 4AEFA 2DT0A 4D6GA 2GK1B 2J7HA 1YHTA 5E9AA 2X8RA 1W3HA 3AI0A 1WZKA 1W1VA 1MW2A 4LPCA 4DM2A 5M03A 1ZB5A 2O9OA 1D3CA 1MW0A 1TVPA 3I3DA 3WF3A 1AQ0A 3VD4A 3CHEA 4CVUA 2WM0A 3B9AA 1CGXA 4W7UA 2D1ZA 3GNOA 3RCNA 1Q6CA 2W67A 2CXGA 2G41A 1CECA 3CLWA 1SR0A 3F5KA 1OBAA 2CEQA 3CHDA 3VPLA 1UZ1A 2BFGA 2XM1A 3VVGA 3L4UA 1QOXA 3WD1A 3L4TA 3TA9A 3NUKA 4AISA 9CGTA 2J79A 2O92A 4P7QA 1JFHA 4MAVA 5DT5A 1E70M 3AS1A 4PRWA 8CGTA 2JIWA 3K46A 4FF5A 2W5FA 5CPTA 3VINA 4P7LA 1GPFA 1UQZA 2D22A 4KRUA 3T08A 2V5CA 3AHTA 1QNRA 2DT2A 3VD7A 2WVVB 3OBAA 3THDA 1BLIA 2VZTA 1UD6A 4Y7EA 4AZIA 3U5UA 1PJ9A 2BXZA 3WQVA 2IUZA 4H7VA 1H49A 1FP9A 3WDJA 1CENA 5AY7A 3RJYA 3WBAA 3WNMA 1ISZA 1UOKA 3HN3A 1W3LA 3W6MA 2G3JA 2WHMA 4CCCA 1R85A 1FP8A 3WD0A 3WQ5A 4Z2IA 3GM8A 1E4MM 2VQUA 4GZJA 4HOXA 4HMDA 2E0PA 2J7GA 4X9YA 4AIEA 4CGTA 4D6JA 4EAMA 1UR8A 4AIUA 3WUEA 1MQRA 2FGZA 2UY4A 1JF5A 2Y24A 5BXSA 2XG9A 1KQZA 1H0IA 2GSJA 4HP5A 1MXDA 5A94A 4PMXA 5I0DA 1KGXA 4A4AA 4LYQA 2E9MA 3GXMA 1TMQA 1E15A 1HIZA 1OGGA 3VMNA 4PTXA 1J11A 4GO9A 2PF0A 1C90A 5DMYA 5DF0A 3A47A 1UR9A 2BHZA 1GOWA 3AHXA 1CIUA 1C91A 1K6AA 1CGWA 4R27A 2YIHA 3W6LA 5IFPA 4TTGA 4XZWA 1ISVA 1QI2A 1UWIA 4WKFA 3EDEA 3ALFA 3WUGA 2YA2A 2VNCA 2WMIB 2XVLA 4MB4A 2WW5A 2VCAA 1V3HA 1N82A 4UOQA 3AIBA 1OT2A 1J10A 4E8CA 2J25A 3DC0A 1UD8A 2C7FA 1MFVA 3WNPA 2JF7A 1ODZA 5D8WA 3MS8A 5A2CA 2YL5A 1BF2A 5A8QA 2WMKA 1NP0A 3BCFA 3CZGA 5A6LA 3POCA 3WH8A 4PTWA 1IZJA 5FOOA 5BROA 3TTQA 4B16A 1G0CA 1CXIA 4P7NA 1UG6A 3L4WA 4ACYA 5A6SA 1XYFA 1FHLA 1VEOA 5EB8A 1NWSA 3A3HA 3W29A 3O6AA 1C93A 4HZ8A 4UCFA 1CLVA 3WY1A 4CN1A 1LL7A 3F5JA 4AD5A 3AIEA 3GBDA 4PN2A 3WMCA 3PZIA 2V3FA 1HKMA 2XSBA 4AYSA 5ABFB 4PCSA 3W4RA 2VOTA 3AHYA 1OGBA 3ALGA 4U5IA 2OWCA 1GQJA 4PMZA 4J7RA 2CBUA 5C8BB 1SYTA 1DWFM 4JFTA 3WL0A 1J0HA 5FCZA 1U2YA 2BY3A 4AEEA 3LPOA 1HJQA 1C7SA 3WF1A 1UR1A 2VZSA 6TAAA 2VT0A 1QNSA 3WH6A 1KBKA 4Z2JA 2YDQA 4PSRA 3AISA 4HU0A 4U3AA 7A3HA 3UG4A 1CWYA 3VIGA 1M01A 1LQ0A 1KCKA 2G3IA 2BV9A 1E6QM 2WXDM 1UD5A 4B9ZA 1MW3A 1H4PA 7CGTA 1DEDA 2EQDA 4U33A 5JBEA 1V0MA 3SCSA 2WZHA 3OZPA 3W28A 1H11A 3GTNA 2MANA 3VX0A 5CGTA 1WZLA 1Y7VA 2A3CA 5A6KA 3AYSA 3MKKA 3QHOA 3VD3A 1E6ZA 1TUXA 3WENA 2WBKA 5DO8A 3QOMA 1V3LA 2EPNA 1W32A 8A3HA 2WZEA 1XH1A 1HJSA 4HU8A 2VJXA 3OLEA 3FY1A 3VGBA 4WF7A 2GJPA 3OGSA 2DEPA 3LPGA 1VRXA 2O9TA 4H8UA 3VOCA 3M7SA 5I23A 4CD8A 1TZ7A 1JL8A 5IDIA 3VKKA 1W3KA 3UCQA 3VIFA 2XWEA 4Z2HA 4TXEA 1FFRA 3WKZA 1EQCA 5A6JA 3VM5A 4QCFA 4AZHA 2XPKA 4UOJA 1KQYA 3AXIA 4AZCB 4XB3A 1J01A 2X09A 3FNDA 1F4AA 2XYLA 2Y8KA 4W8LA 1UUQA 3II1A 4GQRA 2W92A 1PZ2A 2AAAA 3WNOA 2DIEA 4HA3A 1ECEA 1C8XA 1UKTA 1HJWA 1EGZA 1EDQA 4FLOA 1VEPA 1UR4A 3RILA 4ZEPA 3AXXA 3AZRA 1US2A 3ZIZA 4UQ9A 2YDRA 1E56A 2PWEA 1AMYA 1P6WA 1M04A 3U7BA 1IV8A 4BZYA 2UWFA 3WSUA 1TR1A 4KGLA 1E72M 5GNZA 2RGMA 4UQAA 4MJ2A 1JDDA 4EE9A 1V3IA 3MO4A 1W91A 2RGLA 3AFBA 3AZTA 2DPEA 5I79A 3WIJA 1E43A 2YLLA 1QW9A 4H8HA 1V6XA 3DYPA 1W9BM 3GNRA 3M46A 2OYKA 5E09A 2WPGA 1E4NA 4CD5A 1Q6DA 4OBRA 5I77A 4JL1A 2PWDA 4WJXA 1UH2A 1QI3A 1EDTA 4UQEA 1PX3A 3VIHA 5CJ5A 4UQCA 1GONA 4M56A 1R87A 2VVNA 4HMEA 4L4PA 1ISWA 3CBWA 2D0FA 3WDQA 1E9LA 1CGYA 2EPOA 4FLQA 1VFMA 3AIQA 4NSBA 5BRPA 2E4TA 1E0VA 3NJ3A 2J4GA 4W87A 3VUPA 1OCQA 1K9TA 1KR1A 4W5UA 3BAJA 4M24A 4D1JA 1WO2A 4JL2A 1EOKA 4W88A 1E5JA 3WL1A 3SIMA 1EHAA 3FW6A 3RPMA 2X0HA 1H5VA 4M81A 3VIIA 5CZKA 4RE3A 4W93A 4GPNA 2YA1A 4GXPA 3KWXA 5E6YA 2D3LA 3BLKA 4U3CA 4JHZA 1G5AA 3TTOA 3ZO9A 3L4YA 2PWGA 3WEOA 3K1DA 1PBGA 3DHUA 3CUFA 2W91A 4YHGA 4PTMA 3WMSA 4EKJA 1JNEA 5FKYA 4P7RA 2C0HA 2WC4A 1KXTA 4F8XA 1V03A 2WHLA 5HOSA 1JI1A 2XVKA 3PZ9A 3ARSA 5HBFA 3QHNA 5FIPA 2QMKA 1JZ8A 4Z2GA 1QPKA 4GI9A 1BG4A 2V3DA 2G3MA 1J18A 4ZE4A 4X0VA 4HPGA 4CCDA 4V2XA 4MDPA 3W37A 3BMWA 5GNXA 3N11A 5ABEA 3N1AA 5I5RA 2D23A 1UR2A 3MV01 4U5KA 2CIPA 3CZ8A 3D3AA 2WVUA 2CBJA 1XC6A 2W61A 4AZ5A 2HVMA 2Q8XA 3BAXA 2BHUA 1UWUA 1KR0A 5DT7A 1IT0A 4B15A 4HTYA 5TD4A 1WE5A 1Z32X 1JDAA 4A3HA 3WEMA 1OSEA 1QHPA 2YA0A 5JIPA 4MPKA 3GH5A 1CXKA 2Y2WA 3VIMA 4S3KA 4DUWA 2BNJA 4OOUA 2JEQA 1R8LA 1UD4A 5M17A 3CHFA 1V6WA 2DT3A 4W84A 1NWRA 3VGEA 3OLGA 4R5EA 1ZJAA 1VJSA 3PTMA 2ZUWA 5ABHA 4A3YA 4NF7A 1G94A 1G9HA 1BQCA 3LMYA 1NWUA 1QBAA 3WF0A 4WSKA 3S6TA 2ZX8A 3TOPA 5FD0A 1JD9A 3VTRA 4PYSA 3LPPA 3BAIA 1E40A 2D0HA 3MUIA 3L4XA 2OYMA 3UESA 3MANA 3DHPA 1D7FA 2CBIA 5AC5A 3GH7A 2VVSA 4BQ5A 3MU7A 2WK2A 4JHOA 1CDGA 4LYPA 1ODUA 1V6UA 1VFFA 2WVSA 5BXRA 2WVVA 1JI2A 3EMCA 2DSVA 1CYGA 5F7UA 2B31A 3IJ9A 4ATWA 1PX8A 2XFRA 3NSMA 2ZX5A 3WFLA 3BCDA 2FH6A 3OB8A 2ZXQA 1GQLA 1QVBA 3LPFA 4U31A 2FHCA 4D72A 4M1RA 4RE2A 1W1YA 1X6NA 1AQMA 3CZKA 1VAHA 1B3YA 3F5LA 5GNYA 2FHFA 1KXHA 1GQIA 3AIUA 2JE8A 1EQPA 1QNQA 3AS2A 2J47A 4YN5A 3ZJKA 1W9UA 5A6BD 4N42A 1B3ZA 1BG9A 2VO5A 3BAYA 1K9FA 4JIEA 4BQ4A 3WF4A 1OD8A 3CO4A 3ARWA 3AIRA 2Z1KA 5EMYA 1ESWA 1TA3A 2Y5EA 2VQTA 1NOWA 4AD2A 1VFUA 1DWAM 1E6SM 2CESA 2Y8VA 4TVCA 3K8LA 2WNWA 4PTVA 3SCNA 3SCWA 4JKMA 4MADA 1KGUA 3ZT7A 4TX8A 3WBEA 1LG1A 4C7FA 3PN8A 1DP0A 2QHAA
chains in the Genus database with same CATH superfamily
1OCNA 1TPWA 1D2KA 1BHGA 1EHNA 4YYCA 3R0UA 1ZZMA 2YBUA 2YXGA 1P5BA 3STEA 1GW1A 3W70A 5K4ZA 3L7RA 2VC6A 3C0JA 2WC3A 4AVFA 1JDEA 4LCRA 1S1PA 5EFFA 3HMCA 2A3AA 3NGFA 1QNOA 4RDYA 2V5KA 5C5YA 4EVZA 3T4CA 1DJHA 1WNOA 3AJ7A 5KETA 5AHFA 4EXAA 1HF6A 3N2XA 3FSUA 2CWNA 2QUVA 1UD3A 5HTGA 4JNZA 4AXNA 4CNOA 2PWVA 1SZGA 1AW2A 4XKMA 4PMNA 2A3BA 3QR0A 1JUBA 3H70A 3M43A 3ONCA 1Z6KA 1U5VA 1WUEA 1NSGA 4NQ1A 1Q4NX 1NTHA 3WEZA 2ZCGA 4QBXA 5E70A 1JAEA 3VIPA 3GZ3A 3PBGA 3BV7A 1SFSA 4OV9A 4HIBA 2J8FA 1HZYA 3LGGA 3CAKA 3MMUA 4C90A 4XZHA 4TNSA 5CSYA 4UTUA 2W63A 1GORA 3BOXA 3OBKA 4US5D 5A2BA 1MZRA 1PINA 2PPGA 4GUFA 1MDRA 1BVNP 2XIMA 1QMLA 4WZHA 4JY8A 1OYCA 1FFQA 3QTPA 1EWEA 4V28A 3QV7A 1PAMA 2WVTA 4JOMA 2OZ8A 4QP0A 2Z00A 5CXPA 3RGCA 1HW6A 3UYCA 1K70A 1XBZA 3EPMA 1B9BA 3NWRA 3CTTA 1HKKA 5LGZA 4LFYA 1GZJA 1V3JA 2BY0A 2PF8A 3GXDA 4QGCA 5B8IC 2IXUA 3GPKA 5IFTA 5F4XA 2WWDA 4NJIA 1DE6A 4JICA 3ARTA 2PDLA 1QK2A 3ITOA 1LF1A 1ZJHA 1HG3A 1TPUA 3K8MA 3HTWA 2NXHA 3NVTA 1H61A 3U2ZA 4IJCA 2JF6A 3G1HA 5FJJA 2J9YA 5KEZA 2PC8A 3GW3A 2YCKX 3N6QA 1PTGA 2YYUA 4KFOA 4J35A 3WQEA 3DESA 4L1WA 5RUBA 4XZMX 2PRHA 2PS2A 4UTHA 3WNNA 5K3VA 4DRIA 4HA0A 4HNCA 4WK9A 4QDWA 3KL0A 2YLAA 3EOSA 2IKGA 3PBMA 3KS6A 1OCBA 1TE6A 2XH7A 1V6TA 4BJHA 2ZA3A 1IZKA 3B03A 1S2UA 2VN1A 3KWSA 5G1YA 1FWAC 1MEHA 5C6MA 1VHCA 2R9RA 2JK2A 3W25A 4Y90A 2XSAA 3EDKA 4EXQA 1UPMB 1A80A 1OFQA 3T1GA 2V5JA 4L6HA 3ATZA 3VNZA 3DECA 2ZRWA 1Q6LA 1Y5WA 1IEWA 4FAMA 5FL1A 2FTPA 1EA9C 3SCTA 1JRCA 3NYDA 2C91A 4AMAA 3TYDA 4V1XA 1QNPA 3FXGA 1Q6HA 3VDAA 1M53A 1WP6A 3WQDA 5EFDA 4ADTA 3IRDA 4UNIA 3LUTA 3M0ZA 1YPFA 1X1NA 2OSWA 3W88A 3G1FA 4G7FA 3IIVA 3ARRA 2FGBA 1I1WA 4IIHA 1PIFA 1X1ZA 2CLEA 3QSTA 3KRZA 4O1FA 3NEHA 3Q67A 4B92A 3DHDA 4IJBA 5CH9A 5D2TA 2QLYA 1FWHC 3W7CA 5HAOA 4K7VA 1TKKA 5AHLA 4S23A 4FLRA 1W5QA 4GE8A 5G2WA 2E6AA 3RMJA 2OT0A 3P14A 4XZLX 2QIIA 1LLOA 2XP4A 1H1NA 3WJYA 1GOOA 1GQKA 5K9XA 3TTYA 3I7QA 5E0KA 4QQUA 1LL6A 5FEWA 2XHYA 3GKFA 3TZFA 4ZENA 4F0RA 2F84A 3TTSA 1LWHA 4P5UA 4Y9PA 2ZA2A 5I98A 3GWQA 3W7JA 2PEVA 1FOBA 3HJEA 3EB4A 3UWVA 3H26A 3CTLA 4O17A 3KP1A 4FPSA 1OX4B 2PA6A 4BF5A 4D8AA 1GPWA 2R82A 5JBDA 2ZX9A 5EMMA 1HXJA 4YJ5A 2QW5A 3KZSA 3WUFA 4W89A 3L9CA 3ARUA 3AYTA 2F2KA 4M6PA 4NRSA 4MGVA 3O5DA 3ITVA 3VDHA 4Z17A 1W5MA 4BF8A 4G2PA 1UZ4A 4L64A 2CLOA 1P6BA 3L2IA 3TQVA 5E9XA 1SW0A 1W54A 1JCHB 3H21A 4TW7A 4CQAA 3NI6A 4RE4A 2J78A 4F2UA 4IG2A 4GQBA 5H6HA 3C2FA 2PDQA 4JAWA 4PCFA 2J27A 1XSKA 1GHSA 3HG3A 2J62A 2CITA 4UFIA 3H24A 2PURA 4K7YA 2KI3A 5DX7A 2NSXA 3MI3A 2ZR5A 3EOLA 3HM7A 3KCLA 3N2BA 3DBPA 1GJWA 4F0LA 3BLPX 3GVRA 3KDOA 3VILA 1XXXA 1QBBA 3T81A 1A3HA 2W6RA 4GI6A 3N19B 3UQNA 1R3SA 3OOBA 3JRKA 4W86A 5CZTA 5IBXA 3MBFA 3N25A 3OHIA 4JFJA 4QJ1A 4XKYA 1J0IA 2OEKA 2XPAA 1B3WA 2XN1A 4LBRA 3NL2A 1U1HA 2KR7A 4GQ0A 3GBEA 1XGZA 1SMDA 4OBTA 1N1AA 1KLYA 1FDJA 3O3RA 4M6UA 3VE9A 2QPSA 3G22A 2EG7A 3G6MA 1Z69A 2BWGA 4JCMA 3GTFA 4X9SA 1O5KA 5H8PA 1HVXA 1NOFA 2YJQA 1BYBA 4IPJA 4HPHA 1QU4A 4CCEA 4DPPA 5GVJA 1D6OA 5LYRA 1REQB 2YW4A 2VEIA 3V0SA 1QRQA 2QPUA 1J0YA 1NELA 3ECQA 3PS7A 4HOWA 3GRIA 1XH0A 2AAMA 4KKXA 2VR5A 3ZZ1A 1UHVA 1S46A 1FQ0A 3S8HA 4YHEA 5CG7A 1YBQB 5H91A 3W7QA 1JIBA 2XTKA 3UGRA 4WKAA 1EXPA 1OIMA 2VL4A 5DMLA 3A9IA 4D6FA 3BPWA 4M6VA 3TONA 2NVCA 3B8SA 4A3UA 4RDWA 2VFFA 4ZFCA 1Z44A 3WH5A 4ZL1A 4CN6A 3CUIA 4G1KA 4DPQA 3QVQA 4GISA 1TA3B 1N8FA 3IVUA 3KHDA 3PRDA 1A3WA 2YOCA 6TIMA 2KGJA 2BHYA 2BXYA 3M1ZA 3IV3A 3F1QA 4DRKA 4IMEA 1OC5A 4QDPA 3B4UA 2GUYA 1C8QA 4XO7A 4RZ6A 1LCOA 1XIEA 5FL0A 2WCSA 3UI5A 3MKCA 2XN0A 1JCLA 3SUTA 1GVQA 4IL2A 2ESCA 3ES8A 4DVOA 3GLCA 2XFWA 3O07A 3SCUA 1VFLA 2A6NA 3ZQ9A 2P0OA 3TR2A 3K5XA 4AWSA 1PBKA 3E38A 2ACRA 1A50A 5HMEA 4E3TA 4I6KA 1NWTA 2QDEA 3SO7A 1GQNA 3PG9A 4M7SA 1X7IA 1EUNA 2E40A 4B3KA 5A6BA 3WMBA 1DWIM 4EPKA 3LQLA 1W1PA 1UIPA 2BODX 4H4IA 5AKQA 4QQ3A 3P60A 1B4KA 1EEPA 2Z4GA 4Q22A 2FB3A 1O7AA 3BLOA 1G1YA 1NH6A 1TJ1A 4DBDA 3QOKA 2ZXBA 3VNDA 1L0PA 1Q6FA 1W26A 4IQLA 4B2DD 3BLLA 5I7GA 2A3EA 4URIA 3FDGA 1XR2A 1VR6A 4CD7A 3OW1A 5HXMA 1VFOA 4X2PA 3ZT5A 4KFPA 3ZVIA 3TOYA 3LI1A 4LAZA 4WQ6A 2Q02A 3STCA 1TPH1 4D71A 1G4EA 1XG4A 4FXJA 1EX1A 3QHMA 4UFKA 2VURA 3A4JA 3I7RA 3OEXA 3B9OA 1F3TA 4FMVA 4W8BA 3D47A 2FIQA 3U2OA 3GB6A 3H4WA 3EMQA 4O1EA 4TX0A 4GIAA 1R3YA 5D9MA 1WKYA 2XFYA 2YSWA 1ZK6A 3GZAA 3KOXA 1NFGA 1BFNA 1MEIA 4LVAA 3NNTA 1KXQA 1W8SA 4ORMA 2BGSA 2CFFA 2KFWA 4Z1BA 3AZSA 2GFTA 3UCCA 4LAXA 2WHKA 4H6RA 3A23A 1D7IA 2HK0A 2WNQA 1IR1A 1DBTA 2G0WA 4QX4A 1DPMA 3PB0A 4L1XA 4L6DA 3OLDA 1IEIA 4NKCA 1ONXA 4B5WA 2OYLA 4L56A 2BY2A 3NTPA 5CSSA 1H41A 3ITCA 4FNUA 1FWJC 3MI2A 4CN4A 1Z3NA 3VOIA 3GU1A 1MQPA 3H2OA 4O2TA 2VC9A 1SJBA 5DXXA 1CZ1A 4JFUA 4OBSA 4F2TA 3BOFA 4WY0A 1WXJA 3CH9A 1XRFA 2F2DA 3TWAA 4HNOA 1TVLA 2Y8UA 2I14A 2OODA 4ZSUA 1MDLA 3EWCA 3EY6A 1L8NA 4U2ZA 3WK0A 3SUWA 1SU5A 1T8XA 5JUVA 1E0TA 3ARPA 4KWUA 3W7OA 4LGXA 1JVNA 3LRMA 5JH1A 4KMQA 2NUWA 5CPNA 5DQPA 1E3ZA 2VEGA 2PE4A 2CKRA 3AHVA 3BCJA 2V5BA 1EC7A 4WDUA 4AY1A 1PKNA 5AC4A 3STPA 3W1RA 3QEZA 4WDWA 4QXIA 3TJLA 3F4WA 1TREA 4Q8MA 4RZ5A 2QKFA 4TQTA 3T78A 3VKJA 2QCGA 4BWLC 1UR3M 3FDKA 3ZJ7A 2ZZ5A 2FMNA 4H9MA 3BSGA 2PDGA 1HL8A 3ZT6A 1IEVA 1FUYA 5I3GA 3W26A 2W27A 4C7DA 1ROUA 5AOUA 4HZ7A 4N6FA 1W1ZA 1Q6IA 5HJLA 3ZVHA 4TU1A 4NU7A 2FVLA 2EG6A 3MWAA 1J0JA 4XIMA 3T07A 5IDZA 4HSHA 2CPUA 1BYCA 2NQ9A 4XKYB 1DIDA 3M41A 1HP5A 2I57A 2YKKA 3KOYA 1TJ0A 3UJSA 5C9RA 1XIIA 4JFIA 4YTSA 1I8JA 2CLFA 4Y8EA 5AYIA 3FEQA 4DRNA 5BNKA 1FWRA 2RKXA 4UTKA 1Q1CA 3WJSA 4GGQA 4AFYA 1EP1A 3MUZ1 1A5MC 3M07A 1E51A 1RALA 3W86A 4KPLA 1B3VA 1OIFA 2ZQSA 2J74A 4ZOCA 2WZMA 3VNLA 3B8DA 2IPFA 1R3QA 4R88A 4QLJA 2HRWA 1W5OA 2DW7A 4XUYA 2Y61A 3QYSA 3T09A 1R86A 4I9JA 1EC9A 2OVLA 2RDWA 1L6FA 3GXFA 1NQKA 3F2DA 2ZRXA 1QPNA 4UXDA 4HKPA 3KVLA 2AL2A 1KV5A 4KW2A 5ECUA 3HPAA 3D5HA 4UTTC 3E0VA 4PMYA 1LL4A 4CQDA 4PUUA 3F4NA 4KR0B 1YLVA 4IGNA 4XVDA 3C0SA 5CC3A 4FNQA 1VLWA 4FR6A 3C61A 3SN1A 3WH9A 3MVIA 3FHAA 3H55A 4WVXA 5FF0A 1Q65A 3RMEA 1P5QA 1IZCA 3TZNA 3CUXA 2MNTA 1G4TA 3WCZA 2CHNA 1PPIA 1DJXA 3CJPA 3LV6A 4J1OA 4M8UA 3NO1A 3WFZA 2QDGA 4JKLA 5D09A 4KWVA 1GVFA 3EOOA 3ZWSA 4IFRA 3B8VA 4X22A 4YMZA 1YDNA 1XCXA 2Y7FA 3P5ZA 2E5BA 1QPOA 4RV3A 4PULA 4UFHA 3N2TA 3WDPP 3L66A 5CPQA 3DKJA 4WGXA 4D6CA 4HARA 2QYGA 3AMGA 1FCVA 3NZ1A 3NEVA 4O57A 4AD3A 4XQ6A 1EP2A 3A6OA 4EPEC 4NILA 1UC5A 1DL3A 3EOUA 3T44A 4S1FA 3KACA 1S3HA 4ATDA 4QFUA 1UROA 1OINA 4H7ZA 2PDFA 5HW8A 1CB2A 1H7RA 2ZYFA 4NASA 3HB9A 1WDWA 2DQWA 3VD9A 1VJIA 2YDSA 4IF2A 3NM3A 4DX3A 3W2UA 3O5LA 3C2VA 3UG3A 2X0YA 1R2RA 4DWSC 2NZLA 5DCEA 5LA0A 1X6LA 2NLYA 2E09A 4UMAA 5A3HA 3IARA 4S3BA 4UTTA 4EK7A 4O19A 4O53A 1DOSA 1L9WA 1PHQA 4ROPA 5BWFA 4ZQRA 2ZR4A 5FJTA 1KBBA 3VNIA 2WHJA 1DJWA 2FGLA 2QCHA 3AICA 3O5IA 4EF8A 1FDZA 1DHKA 4PUWA 3BLIA 1TG7A 2D3NA 3MCNA 5HT1A 2VENA 3UW6A 1GG0A 4C1NB 3PVFA 3VXGA 1MUMA 3P80A 5E6ZA 4B5XA 2PWFA 2PCEA 1PX4A 3T7VA 1TR9A 1V93A 2J8GA 4UTLA 4CU6A 2DZWA 1FD9A 2RDTA 1SO4A 3GNPA 3WBWA 3QM3A 5F4SA 4Q7BA 1DQXA 4AEFA 4RNIA 4NX5A 2GK1B 3UG8A 1W3HA 3AI0A 4UNLA 4PUNA 3ITGA 4LPCA 3I6TA 1EGMA 5M03A 3I3DA 3WF3A 4IQDA 1JCYA 1XDMA 4CVUA 2WM0A 2PPNA 5F1UA 3RCNA 2W67A 2A85A 5DN1A 1F3EA 2NLIA 3UYIA 1NDYA 4FN2A 3VVGA 1EGVA 3L4TA 3TUUA 8RUCA 1B57A 9CGTA 2UBPC 4DIAA 3W7MA 4PRWA 1UASA 1QNRA 3VD7A 1KFKA 2LLEA 3CHVA 2WVVB 4IMDA 3UNTA 1ZCOA 4DF0A 1BLIA 4Y7EA 4RUBA 3NPXA 4O11A 1PJ9A 3U5UA 3PPFA 3WQVA 2R8WA 2R1MA 1FP9A 5FF7A 1CENA 5AY7A 4LVGA 3L5MA 3WBAA 3M16A 2O7QA 3DIPA 3CV6A 4L9ZA 1UOKA 1LT7A 4EPDC 4KCVA 4Z2IA 3GM8A 3KBJA 4HOXA 1X6UA 4JR5A 3RGTA 1FKIA 2GVJA 4GVIA 4CGTA 4D6JA 3RU8X 4XISA 1ICQA 2AWGA 4LV4A 3T6CA 5BRBA 4PMXA 5I0DA 2O56A 4LYQA 1OGGA 4PTXA 1I2PA 1FWEC 1QOPA 2RDUA 1J11A 1C90A 4S3AA 2WM1A 2GWGA 3A47A 4GNJA 5LNWA 1UR9A 4QJ4B 2R91A 1CIUA 1IYXA 3ANUA 1QI2A 2HPMA 4WKFA 4JD4A 1R47A 3MA8A 2ZTKA 5CBJA 3M47A 2VNCA 2WMIB 3JXVA 3R89A 5AC7A 1POKA 3MUXA 3U48A 1A5LC 3BURA 3V5OA 2C7FA 1MFVA 3SJNA 1ODZA 1MSSA 3L12A 5D8WA 4JHMA 1MNSA 3G1AA 3NPUA 3CZGA 3POCA 1G6CA 4CNSA 4PTWA 4CEUC 1AFSA 4RK8A 4ENLA 1VEOA 2E5CA 1NWSA 1GOXA 3W29A 2NVAA 4QEEA 2QCCA 4GXMA 2QDHA 3WY1A 4CN1A 2JKPA 3TWBA 2LKNA 1FKSA 4G7EA 3R8HA 4LF1A 3WMCA 4NI8A 4E38A 1IE7C 1DQWA 2BZNA 2Y78A 2XSBA 5AN7A 5ABFB 1KA9F 1QT1A 3ALGA 2OWCA 1GQJA 2HV5A 1T41A 4J7RA 2BASA 1SYTA 1DWFM 1GVRA 4H19A 3WLQA 5FCZA 3MI6A 4AEEA 3LPOA 3QC3A 1HO1A 4Y8FA 3WF1A 3M9YA 2FPVA 1QNSA 5EPDA 4KS0A 1KBKA 2DJXA 4Z2JA 2YDQA 4PSRA 4HU0A 2NV1A 1QDSA 4RKAA 4O10A 1LQ0A 1I2OA 5TAOA 4GJJA 2G3IA 5DO2A 1QPRA 3MC5A 3MSRA 4RJEA 3SADA 2WOQA 7CGTA 3PSVA 3WFAA 3LGEA 1V0MA 4WR3A 2V5LA 1QXLA 4DBWA 3KTSA 4U86A 3DXIA 5CGTA 1WZLA 4O1BA 5D02A 3MKKA 3QHOA 1E6ZA 4C6KA 3WENA 1GK8A 3QOMA 2PZ0A 1SO3A 3CS2A 4JTJA 1HJSA 1AD1A 4HU8A 3A64A 3VGBA 5BOFA 2C15A 1LUCA 4PRTA 1TSIA 4Q6JA 4H8UA 1TZ7A 4LRSA 1PZ1A 2G50A 4HNTA 1B3OA 3DFSA 2BGQA 4FS9A 3RR4A 4Z2HA 4TXEA 1FFRA 3WKZA 5A6JA 1XIMA 2PLKA 4AZHA 2XPKA 4UOJA 1W1B1 1KQYA 2KX9A 1XF0A 3REQB 4PR4A 3WLRA 4J9JA 3TEVA 1J01A 2X09A 2QXWA 3Q58A 3FNDA 5AHEA 1F4AA 1XLHA 5HWNA 2W79A 1XLIA 1PZ2A 1QJWA 4KETA 2AAAA 3KRSA 4A2RA 1ZNNA 1JPMA 4QG9A 1EGZA 4ZEPA 3AXXA 3P0XA 1US2A 5IBXC 4AF0B 1E56A 2PWEA 3W7LA 1AMYA 3W74A 4PB4A 5AYXA 4DZ3A 4X61A 3U7BA 3ERPA 2FZBA 4BZYA 2NXIA 5ECVA 1ADSA 2NXGA 5GNZA 2G5WA 2PV2A 2RGMA 2ABBA 4FAPA 1JDDA 4I5XA 1TTIA 2VFGA 4AIBA 1W91A 3AFBA 1T7LA 1O94A 2PDXA 3QPZA 1Z7AA 5T91A 1IWBA 1W1IE 2DPEA 5I79A 3WIJA 1VCVA 4YNGA 4QE5A 3U3HA 3KABA 2YZRA 5I3FA 1V6XA 1ZGDA 1W9BM 4R9XA 3SJ3A 3O5QA 1E4NA 1OK6A 1Q6DA 1YBQA 4OBRA 2H3BA 4RDVA 4JL1A 2PWDA 3R0KA 3MVTA 1SM9A 1UH2A 1EDTA 4K39A 1DIKA 4M0XA 4IFKA 1M5WA 4M56A 3KAFA 1CX9A 3VI2A 3OP2A 4L4PA 3CBWA 2R1LA 3W07A 3QQWA 3UQBA 4PGLA 1CGYA 2EPOA 4MFDA 1I2RA 4C6BA 4QM1A 1JCTA 1EJ7L 4XSMA 2E4TA 1E0VA 3FV9A 2J4GA 4W87A 3FOKA 1S5VA 1J8VA 4JL2A 4MZ8A 2P3EA 3RK8A 1IF2A 1Q13A 2X0HA 1H5VA 4M81A 4ODKA 1TYGA 2C14A 4W93A 4MMWA 3I4EA 1ZAHA 3E0IA 2P4VA 3GYEA 3LBMA 3MZNA 2WQPA 4O4VA 2E28A 4PCPA 4DLMA 1G5AA 4Q8PA 3E0FA 3M0HA 1EFZA 1O1HA 3HA1A 4R3UA 2GZXA 3CUFA 4XAGA 5EL1A 2ZVIA 3P67A 2PP3A 2C0HA 5BMWA 2WC4A 4JQ1A 4O12A 2XVKA 5HBFA 4Z2GA 3FSTA 3OOQA 4UTIA 2A3LA 4CCDA 3LERA 2YCEA 3ABRA 3M0KA 4V2XA 4JEJA 3W37A 1K7FA 3QY6A 2C19A 5GNXA 5D30A 5ABEA 3FA4A 4RXFA 3KBMA 3MV01 1IQ8A 3MMTA 4U5KA 2CIPA 4V1YA 5DRIA 1X39A 2OZTA 3D3AA 1IX5A 1XC6A 2OKTA 3OJGA 1R9XA 3HG4A 2FVMA 2HVMA 2Q8XA 3BAXA 3M5XA 4B15A 5BXJA 3TYAA 3IUIA 1WE5A 5TD4A 4ALDA 1W3NA 5FJPA 1CXKA 2E67A 2ZDSA 4S3KA 2ZZ1A 4OOUA 6REQA 2JEQA 2PDHA 3T40A 2G4JA 5M17A 3KTXA 3LZ5A 1NWRA 3CWNA 3OLGA 1GZ1A 3D6NA 1EC8A 3PTMA 3EWDA 5HJXA 4A3YA 1A49A 3C3UA 3LNPA 3QR1A 3KZ7A 4FX6M 2Y5JA 5K9DA 2EPHA 2Q3RA 1QBAA 1UJPA 4JQ3A 3S6TA 3DGBA 4MLJA 3TOPA 1FWGC 3LI0A 4AVNA 2D0HA 3MUIA 2NSOA 3MANA 1FXPA 1YTDA 1D7FA 3A5FA 4GJIA 5AC5A 3VFCA 4IWWA 3GR8A 3GH7A 4GBDA 3MU7A 1CI1A 3PNZA 2WK2A 1AL8A 1ODUA 1A5KC 3RX3A 4N2YA 3W1QA 2WVSA 5BXRA 2WJFA 3VKCA 4DJDC 3BW2A 1ME7A 3C8FA 1PHWA 4RR4A 1PX8A 1SVDA 3TYEA 1YNQA 2ZX5A 3RXZA 1RA5A 3F7JA 1GVSA 1KM2A 3CASA 5LIUX 2WZTA 4DZIA 1GQLA 1XLJA 5H8MA 3LPFA 1L2QA 4WX2A 1TZZA 2SFPA 4FXFA 1KRMA 4RE2A 4NY2A 4RW5A 1FWWA 3RN6A 3F5LA 2FHFA 1RCQA 3AIUA 5H1WA 2JE8A 3OYZA 1KV8A 1I2NA 2Z0IA 2OKOA 3NRKA 4NAEA 4NJGA 3L65A 3DG7A 3I7SA 2QCMA 1W9UA 2ZC8A 4M3PA 5A6BD 1JGMA 1RK6A 4IX0A 1A4LA 1OD8A 3AIRA 2VKZG 2RJHA 3N4AA 1HXVA 2X1RA 3RCMA 1RJQA 1M65A 5EMYA 4IIGA 1LBMA 1EUAA 4NAFB 3W72A 3E5PA 4AD2A 1E6SM 3BJTA 1UP3A 2PAJA 1Q66A 4PTVA 3MP3A 4JKMA 4S2CA 3ZT7A 5LXEA 3RPTA 4ZGYA 4A22A 4C7FA 4TYOA 3ISIX 3KBSA 4A8LA 1OFBA 4EF9A 2QF7A 5AVHA 5A6AA 1UKSA 3KDNA 3GR7A 3AYRA 2INZA 5LNSA 1A0CA 3KAIA 2CCRA 3IJDA 4POCA 1QO5A 2OZ3A 1KFBA 5KTLA 3W24A 4YCPA 1N2VA 1R7OA 5E0CA 4XAZA 3GYCA 2ZXDA 3TLQA 4G8TA 3IANA 4W9OA 2PDBA 2V68A 1VQTA 1JULA 4PBEA 3A13A 4P8VA 3BGAA 1EDGA 1V08A 3UF9A 2B7PA 1Q6UA 2GDVA 4KRTA 1HUVA 4OHQA 1V77A 4BEUA 1XRVA 2Z1XA 1QI0A 1TTQA 3LDVA 1B6CA 1DXFA 3N9RA 3NM1A 4H9ZA 4BR1A 3PTDA 1OFRA 4Z2KA 2YFNA 5KZDA 4DI8A 4LS2A 4DXVA 3KADA 2HBXA 3H9RB 1NF7A 1HJVA 1PYMA 1XYLA 3PAOA 1UKQA 4XV0A 1AW5A 2JKAA 3GG0A 4YCOA 1JPHA 4RE0A 1WAWA 2J13A 4ECLA 3IUHA 1D8CA 2AQWA 4LQ1A 3U7VA 3TCZA 1M1BA 3PUOA 4HJFA 2X05A 4GZIA 2FJKA 3O63A 1JF6A 3MCOA 5HINA 2EG8A 3N15A 3WLJA 1MNZA 3G0UA 4Z08A 1UB3A 1KCLA 5I3KA 2UV8G 2JFEX 4QROA 3QY8A 4Q8UA 4H9XA 3EKGA 4XD3A 4QLKA 2A7PA 3KBVA 3ES7A 4IGMA 3ZFHA 5CC7A 4JN6A 1JYNA 1VCGA 3PUDA 1RBAA 4FX8A 4HA1A 3R43A 1C92A 1UWAA 1RPXA 5D05A 3WD2A 3MSDA 1UWRA 2Z27A 1JCMP 3BC9A 4IPNB 3TU9A 2Q09A 3FAXA 1U1JA 1XLLA 2QT3A 1KWKA 5HNNA 4K68A 4C1LA 1I2QA 1LQ2A 1RLCL 3HQOA 4ACZB 5LA2A 5AYBA 1VFTA 2OLAA 2ZUVA 3BGGA 3T2OA 5AECA 4UTWC 3CMGA 3KW3A 4KERA 3BG5A 3AMDA 4AY7A 4NI3A 3UXIA 2CBVA 3VDGA 4HBKA 4YPJA 1V79A 2HE8A 4MYXA 3N2OA 3DFYA 4PL1A 1O68A 3MDUA 4WOQA 4IT6A 1R6WA 1MQQA 1XC4A 4F0HA 1I1XA 3I6CA 7TAAA 2ZZ3A 2OWXA 1JDCA 1EJXC 3LCLA 1D3GA 4S2BA 1V3MA 4HZ6A 3H2CA 1E6XM 4Z2LA 3TNOA 3RRXA 3BSMA 4IZGA 3K8KA 4F9DA 1ZCCA 2WCAA 2IXVA 3VABA 1TIWA 3H6OA 4AXKA 4MWAB 4C6JA 3EA3A 4B5SA 3Q65A 4JTDA 1XL9A 3S9YA 2FZ8A 3WK2A 1MW1A 1UWSA 1VKFA 4LY4A 4OT7A 3GDTA 2ODOA 3VOFA 5A8NA 1XYMA 3O2LA 1HGWA 4DY1A 3AU2A 4FK9A 1CLKA 1W37A 4DUXA 5CG0A 2YBTA 4BQ3A 4HCLA 1R46A 1U22A 4BS0A 5DXYA 1BTCA 1SZRA 1HKVA 1LP6A 3IRSA 3FJLA 2G3NA 3WK3A 1FA2A 1SO5A 3FVMA 4S3JA 2JIEA 3ITXA 3L2LA 2QR6A 2BSLA 2EXOA 4DM1A 2ZQUA 2WV8A 3SCVA 2FQIA 1F3WA 3OBEA 2XP6A 2XWDA 3IJ8A 3H54A 2ATMA 4O15A 2YDAA 3O9NA 4J3VA 1BEUA 3N12A 3JYMA 1MWOA 3S5NA 3PWAA 1XG3A 4KQZA 2XVPA 3HBLA 3EWWA 4QJ5B 3WMLA 4PEEA 3WYZA 2VFHA 1X7FA 2BLEA 2Z2UA 1FKKA 2J9XA 2EHHA 4OU1A 4HHHA 2J7CA 2XINA 5CLTA 1BKHA 4NRRA 2VWTA 1V0NA 5G4HC 2CU0A 5AB3A 1GYLA 2TPSA 2ZZ7A 1GVIA 2DZPA 2OSXA 1EO5A 1U30A 1TCOC 4Q4QA 2B7QA 1FH7A 1BGGA 5IXEA 1VENA 4Z1DA 4AWUA 4JFSA 4JZ5A 1NAL1 3U5YA 2W0UA 2J75A 2ZOXA 2VUNA 2WWCA 2ZUNA 3GHTA 1FKTA 1ZS2A 3S42A 4R7OA 2XM2A 4KEZA 1OX4A 3DN5A 5BYWA 1WYIA 1QTWA 4TR9A 3UWUA 3RO6A 3XINA 3OG2A 3PJUA 2AOSA 3W0KA 3NIYA 3TA6A 2RAGA 4HPJA 4J40A 1P1MA 5FAJA 4D1IA 3BAKA 4W9PA 4WHBA 3NQGA 1XLDA 4ZVJA 3GG1A 1C8YA 2I9EA 3LXCA 3RUBL 3SGGA 5BXTA 4HNNA 4W5ZA 4DJFD 2Y7GA 2ISFA 4LCQA 2WKLA 4PUDA 1XX1A 2P5NA 4JTEA 1IEQA 2VHLA 2QJIA 2GDUA 4H8VA 3M5YA 4JX6A 3OYXA 3MMDA 4U10A 2I17A 3NZGA 4GC3A 2OG9A 2XVNA 4IISA 1QW8A 5D2VA 4FP1A 3I4KA 1SMAA 2CETA 2V82A 1K77A 1EIBA 3H22A 2PDPA 5CPLA 1DIOA 1Q8JA 1F05A 3GDMA 5I2UA 1WX0A 2Q6ZA 4PBGA 1S5WA 1ITCA 2QCDB 1YIXA 3KVJA 3IUDA 4DELA 1TTPA 5DY2A 5D9NA 4Y6GA 1NF0A 4CNPA 1F9CA 3TR9A 3W7GA 4TMBA 3HV8A 4B5UA 4PH6A 1LZOA 2YL9A 4PFHA 2X2YA 1W9DM 4ZQPA 4TTUA 2CZEA 1QCWA 2POTA 5J04A 3ABZA 4XX6A 5JU6A 5XIAA 2VRQA 2X1IA 1FBAA 1SZEA 3V4BA 3FXYA 3L68A 3PZOA 4H6EA 5B7ZA 1ZJIA 5XINA 2NWSA 2PPOA 1HT6A 3UD6A 2JGQA 2OSYA 2PC4A 1HJUA 2FLIA 4P61A 3BMXA 5E0FA 1KXVA 3U57A 4AZCA 3G1YA 3IAPA 3QZ6A 2XP7A 3LUOA 1XD1A 2F8QA 4DYKA 3W6YA 2QUMA 3IV8A 1D7HA 5BOOA 2DVUA 2PTYA 4QHRA 2QJJA 1YATA 1I4NA 5CPMA 3V16A 3N17A 3QW4B 4JX5A 3NQ6A 2ZRVA 4IQEA 4GUJA 1KM6A 2ACQA 4HNVA 1XLEA 1I0DA 3QLDA 3K4WA 1ZBVA 3BARA 3GTXA 3BUVA 1E55A 1QPQA 3WZ0E 3CT7A 1OFDA 2A3HA 5BMXA 3S6DA 3G0XA 1LUCB 2DIKA 4PMQA 3IACA 4H7CA 2M2AA 5HW7A 4M29A 4J4KA 4ODPA 3STFA 3RG6A 4YYFA 2G95A 3KL3A 1X1OA 5M2FX 1J0ZA 5CPOA 4DJFC 1P4CA 2DUZA 1VRDA 3NZQA 2QNEA 9XIAA 3SAZA 4JFMA 4RLIA 3GXIA 4GI4A 3W7PA 3BAWA 4NNRA 3CZEA 4ZMGA 3MMWA 2CLHA 2Z6IA 3DERA 4WOZA 2DH2A 1J6OA 2I5IA 3PZVA 1NOUA 3TX9A 4KQNA 3ZMRA 3ZOAA 1K9DA 4GX8A 3HU7A 1PUDA 1LRNA 2NUXA 4W7WA 4ZZ9A 1IR2A 4HQVA 4B9YA 4LW7A 3FKKA 1VCFA 1OD0A 1E6NA 1HL2A 3AS0A 1VBGA 1TQXA 4HHMA 4QJ3B 1HKJA 3CQIA 2PTWA 4MG4A 2VDIA 1HX0A 3FLUA 4TUFA 3N3TA 2VRKA 5T8GA 3GU0A 3QJAA 3UP8A 1OQFA 1V3KA 3GX9A 2ZA1A 1NDZA 3VGDA 4HVXA 3E2SA 1O5RA 4FLSA 1A5SA 3B9NA 4REQB 1QI4A 2TAAA 4NT0A 1NP2A 1VIWA 4OUEA 3IKDA 3PY2A 1GCYA 2WBGA 3APYA 4J3TA 1P6CA 4AAJA 3LRKA 1DWHM 4EANA 4MSPA 2PDUA 1EWDA 1H7PA 4BI7A 3MTWA 1VBRA 4GY0A 1PWMA 3NQ7A 4S39A 4EIVA 4UTFA 1HVQA 4F0MA 1B31A 4ATLA 1ISXA 4XVEA 3LG3A 3N13A 1V02E 1U79A 2OZ0A 4I5RA 3TV8A 1SW7A 3KCOA 5CQ1A 2PFHA 5TBOA 4HU4A 3B4YA 5CJNA 3TMLA 3CQJA 3UERA 3N2CA 5CBBA 1UYQA 4ZXLA 2GVLA 4MFEA 4FIQA 3IGHX 4D6IA 1FCBA 4W7VA 1VBHA 1XD0A 3SUVA 1QNVA 4V27A 1M3UA 3R79A 3OA5A 4CU8A 3GTHA 5A6MA 3W7RA 2WB5A 3SZ8A 1KD0A 1REQA 1K03A 4ZODA 2PV3A 3MDYB 3O5RA 3EYPA 3L4ZA 2R14A 3IHZA 5C9UA 3EX4A 4DO5A 4UFJA 4HMNA 1KBIA 3FYPA 1OABA 3G8RA 3CU2A 5IM51 2NT1A 3N3MA 2VGBA 5DANA 1MYRA 1K02A 3ZWTA 3WQWA 1N8WA 2GGJA 4UFMA 1H60A 2WNNA 3AROA 1PL9A 3PULA 2ZWYA 4JTHA 2PBOA 3C86A 5I06A 2V3EA 3V5CA 2VX4A 5HWJA 2P0IA 4Q4SA 3WQPA 4DNHA 3ANYA 4HCHA 5JH8A 1V6YA 1EYWA 4IJRA 4CD4A 4S3CA 1THFD 2BOGX 4K2SA 2QQ6A 4UTWA 4I8YA 3N04A 3CYVA 4QT3A 5DITA 2ZDRA 3WD3A 3B8TA 4LXFA 2DIJA 3C6CA 3SM0A 1FTXA 2RHGA 3EWXA 3T55A 3BZGA 2QS8A 1RQEA 1AZ1A 1UD2A 2ZQVA 3U0HA 5AYZA 3T2QA 1YDOA 5CGQA 1WA3A 3C8NA 4GXWA 1CB7B 4RZBA 4BF7A 5GPGA 1S1RA 2W62A 4QCEA 3A4AA 1XI3A 4MDOA 1JXJA 4GZ7A 3BQ5A 1GOKA 3SR7A 3W1XA 4HPNA 1KM1A 1K9EA 4HCDA 1ROTA 3MP5A 4Q8TA 5CLWA 1QHOA 1KW1A 4MWAA 4IIDA 4DRQA 4J3XA 1RVKA 4N7QA 2Y0FA 3PZQA 4L80A 1XLCA 1PKMA 4P8WA 1AMKA 4US6A 3KOFA 3T0DA 1IT7A 3IK8A 2E8ZA 1Q45A 1J9YA 4AX6A 2ZZ2A 3S46A 2K8IA 4BWLA 1GOIA 3AUJA 3VOHA 1SFJA 1H51A 3W81A 2VD8A 2PDNA 3L5AA 4NJJA 3CLMA 2VR4A 1JGIA 1WBHA 2ZVRA 4GO8A 4JX4A 2XPBA 1WDQA 2ZWZA 1H50A 3JVAA 2CLPA 2DZAA 1PZ3A 1RVGA 4PTDA 4IMAA 3WLNA 4MNJA 2WYSA 4I5UA 3DU0A 3SCOA 3ARXA 1Q7ZA 1B54A 4ML9A 1L1PA 2F38A 2VEKA 5LNRA 3A22A 3S0CA 2VGFA 1FH9A 4OWGA 4TVUA 2VTFA 1FJDA 3N73A 4JTAA 4CNTA 3PG8A 4RX0A 5ABGA 3HIJA 1CXLA 4S38A 3EBVA 3C0QA 4DO4A 3RITA 1ZJBA 5LIYX 3IIZA 3TSBA 3B0XA 3AWNA 4J28A 3QFEA 2IF4A 2DY3A 4L4MA 1EF2A 1KWGA 4FNTA 3CZLA 4M1BA 4JN7A 4IHCA 4HHLA 4K1GA 1YPXA 4L3NA 3THCA 4DJDD 3Q45A 1BL4A 1XKJA 3QF0A 2RFGA 1UA7A 5BCAA 4H41A 1R3WA 2O7SA 4LS1A 3GU2A 1R7AA 3PK7A 3M6DA 1RP9A 2DSKA 1T8QA 2GSHA 1G7VA 4EX4A 3VMPA 1A7XA 3TC6A 1HKWA 3PJXA 4P7OA 3IGXA 2PGRA 2VZUA 2MPHA 1ADOA 1GKQA 4HT3A 4F9JA 3UZJA 4I7UA 1B2YA 2GYIA 5BXPA 4YS1A 2GSEA 3EX2A 2YFOA 4JFLA 2XUCA 3VD5A 2YCIX 1BYAA 2NT0A 3LGDA 4O14A 3FGCB 3FKRA 3UXLA 4B3ZA 4QEHA 1A47A 3GDKA 4E2OA 4GFSA 3WJWA 1QAPA 2E9LA 2ZE0A 4FO4A 4JNMA 1QFEA 3K2GA 4TMCA 3M64A 4ZBCA 2B7NA 2G4FA 4LYRA 2YYTA 2PV1A 1B90A 1KRBC 4PODA 1RCOB 2VX5A 4E3VA 3LRLA 1EPVA 4OE7A 3NGJA 4JTCA 4OQVA 2OMAA 4UQDA 3N18A 4S3FA 3T0CA 5K2ZA 4AF0A 1FKDA 4D6GA 1YHTA 5E9AA 1W1VA 1MW2A 2D2JA 4EAYA 4DM2A 2PMQA 2O9OA 3OTRA 4MGGA 1AQ0A 2I7GA 4JIQA 5I3HA 1T96A 1Q6CA 3TCEA 1VFSA 3RLVA 1WOAA 2G41A 1CECA 3CLWA 3F5KA 4GYPA 3IPWA 1OBAA 3PB2A 3UZ5A 3URBA 5MKGB 3XISA 3LHUA 3CHDA 3VPLA 1UZ1A 2WO5A 4FHAA 3R4IA 4KT2A 3BO9A 1QOXA 2C3ZA 1VD6A 1DJZA 1L6YA 1FKWA 3QYQA 2Z24A 3USBA 2OQHA 5MF5A 2GWNA 4P7QA 1JFHA 2YX0A 5DT5A 2NQHA 4IT1A 3SQMA 4L5ZA 3K46A 2P8CA 4ZQMA 5CPTA 3RFAA 2D22A 3TQKA 3I6EA 2V5CA 3CV2A 2O4MA 3R2GA 3VZYA 6REQB 4AZIA 5HNUA 6ALDA 2IUZA 4H7VA 1H49A 1EEXA 5JQ9A 1R9HA 3R12A 3W7KA 1W3LA 3R8RA 2PGWA 4CCCA 3WD0A 4E4UA 3D0CA 5B80A 4GZJA 1VZWA 3NYZA 4IG2B 4QE4A 4JY9A 1OCJA 4AIEA 1TWZA 4EAMA 4KIEA 3AU6A 1UR8A 2GVGA 4AIUA 1K8CA 3OODA 1EF3A 1NIUA 1F73A 3DFHA 4NZFA 2QCDA 4G9PA 1F3XA 2XG9A 1KQZA 4HP5A 1MXDA 4ZO9A 4XBJA 4A4AA 5CC6A 4FNRA 1V4YA 1G69A 2PF0A 4GO9A 4LUTB 4B90A 2X1SA 5HUAA 2BHZA 1GOWA 1WBJA 1C91A 1K6AA 3SN0A 1ISVA 1UWIA 3P93A 5HNTA 2PTZA 3L5LA 2XVLA 2WW5A 2VCAA 3DBNA 4D8LA 1N82A 4UOQA 3WNPA 1UD8A 2JF7A 1UC4A 4EXBA 5HR6A 3W9ZA 1ZALA 3MS8A 5A2CA 3O8AA 1BF2A 1LOSA 5A8QA 1NP0A 3BCFA 2PDJA 1JVWA 2HSAA 3WH8A 4ZS6A 1IZJA 5FOOA 3TTQA 2DG3A 2WPBA 1G0CA 1QASA 1TJPA 2QCLA 3FA5A 4N4PA 3U8GA 4B2DA 4CLMA 1OFEA 4HPXA 1FCUA 4JTKA 5EB8A 3O6AA 4HZ8A 2CC0A 2B5UB 1CLVA 3ZLFA 5HQLA 3AALA 5DCBA 3F5JA 4TX9A 3AIEA 1VPYA 3GBDA 4PN2A 3PZIA 5T9BG 1HKMA 3W4RA 4GG9A 3KAOA 4PMZA 1FKFA 2C79A 3GK0A 5FJUA 4LAVA 1RAKA 4DROA 2PZNA 3O6YX 3A21A 4X2RA 4GLEA 5CEWA 2GOUA 2VZSA 2VT0A 4H8NA 3AISA 5AC6A 3UG4A 2VD9A 2PDYA 4MM1A 2YGYA 5HQEA 4C6QA 1KCKA 2BV9A 3TYCA 2DP3A 2WXDM 1UD5A 3H4XA 1RJPA 1MW3A 5HMFA 1DEDA 4PMJA 4U33A 1GEHA 1VP5A 3SCSA 2GVEA 2WZHA 3H7VA 3OZPA 3RU6A 5EBUA 3GTNA 3VX0A 2F21A 2A3CA 3IIOA 1E9ZB 1PSCA 3VKBA 3TLLA 1KBJA 2VGGA 1TUXA 3PUGA 8A3HA 2WZEA 3CV7A 2VJXA 4RCXA 3EEGA 1EB3A 3FY1A 4WF7A 2F7FA 3GR4A 4DJFA 4R34A 1FWSA 1VRXA 1PO9A 4TIMA 3M7SA 5I23A 3S9ZA 3RF9A 1JL8A 1Q63A 3VKKA 1W3KA 3ELFA 9RUBA 3GQYA 2MLXA 4Y9MA 5C9XA 4W4QA 1TCDA 1EQCA 4DZ5A 1F07A 2A6LA 1RQHA 1UIOA 4KEUA 3TSMA 3CAVA 1XQLA 2EAWA 1NFBA 4F4RA 4H6QA 4NAFA 4O1AA 3TXVA 4R53A 4HA3A 2HS8A 4TV6A 1C8XA 4DQWA 3HPZA 4XO6A 2OO0A 3NPVA 2BBFA 2DVXA 3KBWA 1UR4A 4CEXC 2I9UA 1DVJA 2GGGA 3OVPA 1GT8A 2OOFA 1C9DA 4DBSA 1P6WA 7REQA 1FX6A 2YB1A 2PDWA 3RLHA 1IV8A 3N34A 2W9MA 4KGLA 1K8XA 1TIMA 2PU0A 4WDTA 4L72B 4MJ2A 4EE9A 1DTNA 3E74A 3EGJA 4J5NA 2PCQA 3GHSA 1SZFA 3GNNA 4NXSA 4LUSB 1E43A 1QW9A 2GQ9A 1XFBA 4HYRA 3VK5A 4JDYA 3DYPA 3GNRA 4JYEA 3SDOA 1W31A 1WKEA 3IJLA 3HURA 4CD5A 5JVLA 5CZSA 3PUEA 4A05A 3CL7A 1QK0A 2H90A 3IJIA 4MY8A 4ZO6A 4V15A 4HMEA 4U84A 2NUYA 3LLXA 4NSBA 1PCKA 4ZO7A 5BRPA 2ABAA 3L21A 3L67A 2JBMA 4UTMA 3MBDA 1F40A 3JYJA 4UMCA 1KR1A 4W5UA 4NVTA 3WO8A 4KEVA 3BAJA 5H2ZA 1WO2A 4I7VA 3DENA 1TV5A 1E5JA 3WL1A 2GGEA 3TVAA 2ZC1A 1VFHA 1SPQA 4ERIA 4GPNA 1KM0A 4MWAC 3SQLA 4DXXA 4MJZA 3ITYA 3NQ8A 3A24A 2ZZ4A 3SGZA 2D3LA 3BLKA 4H6KA 3SSZA 4GVGA 3L4YA 3QQ0A 4H9UA 3WEOA 1EPXA 3K1DA 4OVXA 4C1KA 3DHUA 4I9TA 1FXQA 1KO0A 4YHGA 1QATA 3WMSA 4EKJA 5HUPA 4UBPC 5I00A 3K13A 1KXTA 2WHLA 3XIMA 5HOSA 3GUGA 1UW9A 1J79A 3QHNA 2A0NA 2QMKA 3UGVA 2PU1A 3TSDA 1J18A 2XISA 3WQOA 1XP3A 5BU9A 4XAFA 1L8PA 4IIBA 4X0VA 4HPGA 3VC6A 3GXTA 2A7NA 4IPXA 4QITA 5C0QA 4ZCWA 1F6KA 3N11A 1SFTA 1C9HA 2D23A 3SY5A 4JYFA 2X1TA 4E5TA 1K1DA 2CBJA 4C6IA 3FYOA 1PZ0A 4AZ5A 4AB4A 2BMBA 1TV2A 2I56A 1UWUA 3M0VA 1IHIA 4IL0A 3PP7A 1Z32X 2HQAA 2YW3A 1OSEA 1XBVA 2YA0A 3BGJA 5JIPA 4MPKA 1JUKA 4JN8A 3N14A 5D2YA 3LS9A 3VIMA 7TIMA 2ADAA 4DUWA 3ID7A 2WJZA 2CWXA 3CHFA 1V6WA 4W84A 4R5EA 4AVOA 3T8LA 1O66A 1G9HA 1BQCA 1BRLA 3WF0A 4WSKA 5FD0A 1R3VA 4EOUA 3GNXA 3L4XA 2OYMA 3ZVHB 3H53A 1OYAA 4WEVX 1XYCA 4BQ5A 4GA8A 3EIPA 4IPPA 1GKPA 4LNCA 4LYPA 3HGRA 4XZ9A 2XN2A 3EMCA 3NFUA 1KTBA 2PTDA 4HYVA 1CYGA 3TAKA 4DI9A 4FA3A 4L65A 1OYBA 4WJ8A 1F2JA 2O0TA 4ZO8A 3NSMA 3TC5A 3WLSA 1UMYA 2GGHA 3W83A 3QH2A 3BCDA 1OFAA 2X30A 2ZXQA 1GVEA 1QVBA 4NZJA 1MEWA 2CXEA 4FZIA 1CW2A 4C60A 4DYEA 1W0MA 4GK8A 1YDVA 3I6RA 1R38A 4J3ZA 2CW6A 2PGEA 1JPIA 4YN5A 3VOJA 3CB8A 4HHPA 3LA4A 3KAGA 3FX4A 3BAYA 1K9FA 3DKLA 3NL6A 3WF4A 3ARWA 3CWHA 1WDDA 5G4EA 3W85A 2HWGA 2Z1KA 2VEFA 3UJ2A 3URQA 3M0JA 4MIMA 2VWSA 2Y5EA 4BF9A 4IX2A 3SIZA 4PFMA 3QV6A 4KF1A 2OO6A 1ICSA 4A21A 4LAYA 1P0BA 3OPSA 2E68A 3SCNA 4TX8A 4JTGA 5A5WA 3WBEA 2QHAA 4E2DA 3P7YA 1WDRA 3NZPA 4MKSA 1JAKA 1TV3A 1UWQA 3SUUA 5AC8A 4GGBA 2V3GA 2V38A 4FF7A 1L6GA 2E6FA 4YWSA 1Q85A 4M80A 1QO2A 1J4HA 3JUGA 1C7TA 1OX6A 1XSJA 4XG1A 5JBFA 2XP9A 4PUKA 3IK4A 4W9TA 1TMLA 1UJQA 2Z7KA 3GH4A 3PZMA 5C9ZA 1FHDA 5D03A 3V1HA 3O1NA 1MFUA 2ZUMA 5A69A 3AMKA 3V5FA 1XJBA 1EJSC 1RD6A 4MZYA 2D0GA 5IHRA 4XZBA 1R30A 3HPXA 2Z6JA 4JIIX 3ZLHA 3U6WA 2X2GA 4J3WA 2PBCA 1JZ6A 3G3DA 3E2QA 2NX9A 1TWDA 2WSQA 2F23A 1FDYA 1GW9A 3G18A 4TOQA 3SUSA 3USZA 2BDQA 3OGVA 5CSRA 2XIIA 1WDPA 1ITXA 1T11A 1TFVA 3A3WA 4LAMA 3TYBA 2VP8A 1I45A 1TWIA 2EJAA 4C6FA 4MB5A 4JKKA 2OLHA 3MUAA 5SWUA 4DBEA 1NJJA 4DO6A 5LXXA 3B40A 3TQPA 3QTGA 4K8HA 1P7TB 2J9ZA 1XPGA 2BVTA 3BQ6A 3W1UA 4DWSB 8XIMA 3RO8A 1JZ7A 4B4FA 1W9XA 3IVTA 3NQ2A 3PAJA 4QE1A 4HN4A 4ZTXA 4MAZA 3QMTA 1MUCA 1JCJA 4IIEA 5C55A 1ONWA 4QZVB 1E71M 4DZAA 5KZEA 1WZMA 2PSNA 1S38A 4HBEA 3RHGA 2ATSA 3WLKX 4J4OA 2HK1A 4HB7A 2PN0A 2FH8A 4Q4PA 5REQB 1X8CA 2VCBA 1Y5VA 1MUWA 4PA8A 2FTYA 3FEMA 3LBCA 1JD7A 1H3GA 4Q7NA 4ODNA 3ZR4A 1TRDA 2UY2A 1CTNA 4DRHA 4DB7A 5I07A 2BG5A 1XLGA 1NDWA 4LS0A 1YW5A 1K3UA 3Q2DA 4GUIA 4MY9A 4IP7A 3OGRA 1CNVA 1PEZA 2POZA 3QQ1A 3UPMA 3MJYA 2OR2A 3UY8A 1QHZA 4Q7IA 4AZBA 1ZSXA 2ACSA 1Y0OA 3DYOA 1X8FA 2RDXA 2IKIA 3FJNA 3ITTA 3CUJA 3NQAA 5EKYA 4ZB0A 1UQYA 5J5DA 3RFWA 1XIFA 3L4VA 1IXOA 4X3ZA 2C71A 3LHTA 2WC7A 5FACA 4AY8A 2OU4A 3WELA 2P8BA 1UH3A 4MNKA 2UY5A 2ZQTA 1OY0A 3CGTA 3AHZA 2RQSA 5LNVA 3QLLA 4QDMA 4B3LA 4JTSA 3SRKA 3CMJA 4UQBA 1KT0A 4W85A 2FTWA 3HGSA 3GDBA 1V8EA 1OJXA 2V63A 3ZYZA 1W3TA 5JXQA 1XM3A 4JFVA 3LMZA 2PUZA 4WXYA 4Q8VA 3W7IA 4GX9A 3RIKA 1TB3A 4DWSA 4IPLA 1FRBA 2FDMA 3FAWA 2DZBA 1DXEA 2CKSA 4PMOA 5MKGA 3I3BA 1TE1A 3BG9A 2KE0A 4KGJA 2AKZA 1ZHAA 2A4AA 2DU2A 1LTDA 3KRUA 1Z89A 4D8ZA 2PDKA 4Z42C 1GYMA 3W71A 2IQDA 2DG9A 3V36A 1F74A 2Q8ZA 3UWYA 3BXWA 4H01A 5BU6A 3WD4A 1C8VA 5M3WA 3RDKA 1DWJM 5GJNA 2QDDA 1PB0A 1XCWA 3AQUA 4OOZA 2ZADA 2EEXA 3S5ZA 1R2TA 4GVHA 1O12A 1PCWA 5FF3A 2AMGA 1JFXA 4RL3A 1E4LA 4YVPA 4J3SA 2PWUA 3RM4A 2PWHA 2CHRA 4S3EA 3CHCA 1TPC1 1NU5A 1FWBC 2BGNE 1FKGA 4PEKA 1ZU8A 1PDZA 4XWUA 2PDCA 3HF3A 4XD5A 4MLRA 1XPYA 3GSMA 3MZ2A 1L2UA 2TMDA 3GAYA 2XSXA 3ZR6A 1TPB1 2Z25A 1ZL1A 1TPVA 3BV4A 4UUIA 2J7FA 4IOTA 1S5MA 3CZJA 4UMBA 5CGMA 2Y1HA 3W2LA 2DGAA 5LSMA 1I6NA 3KEHA 1GHRA 4LUYA 3WLLA 3SFKA 5A1AA 1J12A 4DHGA 2NQLA 3C2EA 1ONEA 3T8QA 1CBGA 3R58A 4ODRA 4KWSA 2Z2AA 1S2WA 2OFJA 1JPDX 3DOPA 5HWBA 2GJNA 1JRBA 3H12A 1BTMA 4LTSA 3BG3A 4W9QA 1AUSL 4C5ZA 4KCTA 4IUGA 4NZ4A 4PC8A 3ZSSA 3ARZA 3OU8A 4GFIA 3W22A 2AKMA 2Y7DA 5HULA 5FF4A 1LT8A 2PLJA 5FESA 4ZPWR 1IXPA 3U4AA 4CNUA 1BVZA 2G96A 4ZOBA 1LROA 3H2EA 3V3WA 1WB0A 4BY3A 3IGUA 1QUMA 4D2JA 3UA4A 2DVTA 3PFRA 4YVVA 2VRJA 3HGOA 1Z48A 4LUSA 4CQ8A 2C13A 1JG9A 5KSWA 3E5BA 2NVDA 3C2RA 3WX7A 1QI5A 4CD6A 2REQB 2UZ5A 1YYAA 1Q5MA 3UZYA 1TJ2A 4IP4A 3NO5A 1OEPA 2DSWA 3G3MA 3WLPA 4O0QA 1G01A 1CXEA 1GNXA 3W2NA 4ERGA 3VIKA 1PKLA 1B9ZA 3GO2A 1PVNA 4U28A 3WDIA 3KTCA 1E3XA 1DHPA 4XZIA 4WXZA 1F5ZA 3BMVA 4KBXA 3CEPA 3V7PA 3EOEA 4AC1X 3CQ0A 4A29A 1E5NA 3UZXA 2YL8A 3A12A 2MNRA 3U2CA 5AVNA 2XFFA 3QMRA 3UBPC 1RPKA 3C2YA 2J77A 1S5NA 5LHEA 2VZOA 2EGZA 1M7JA 1H09A 4AZ6A 1NY1A 1SSDA 4JIPA 4I3GA 1Z9AA 4NAEB 4I8DA 4PMDA 4HZMA 2GVYA 3FN9A 4Z0SA 1HTIA 5A8PA 4TVDA 4B5TA 3TYZA 2EPLX 3DEQA 3PNUA 2NQZA 2Z7GA 4A3RA 5A8GA 4DRSA 6XIMA 3EB3A 4O18A 2X7VA 2ALRA 1BPLB 1FWCC 3RNDA 3SB0A 3VUSA 3WQ6A 1B30A 5EMLA 1BWKA 4DRMA 4YVXA 1JCNA 2ZRUA 1RY8A 5C9WA 1BRLB 4WIWA 1FKJA 1B1YA 4LAOA 4QTGA 5M1TA 4BI6A 1W8GA 3K4DA 3NSNA 4XAPA 3VM7A 2GJXB 4NJHA 1TZ9A 3I3EA 4US5A 1CEOA 4C6CA 3V0UA 4ZOAA 4NYUA 1M7XA 1RH9A 4YLWA 3GDRA 4LEFA 4YTUA 3WG6A 2N87A 4UOZA 4PZVA 3TN6A 1G4SA 2G3FA 3AOFA 3IWPA 1LG2A 4UIOA 7REQB 3EX6A 7ODCA 2W66A 3EZ4A 1A4MA 3ABOA 3IIPA 1F8IA 3UT0A 3C4UA 1JQVA 1JPKA 1C3FA 1Q6EA 4IMGA 1E1FA 1HL9A 1ZP4A 4GYKA 3YPIA 3ZJ8A 3S1UA 3RM9A 5ABFA 1EH9A 1JR1A 5D04C 5G2IA 2FB2A 4JYDA 2C1HA 4AHQA 1OVDA 3PZTA 3UI4A 4H1ZA 4JQAA 1GYNA 1RHCA 3VIJA 4AHOA 1GOMA 3TJ4A 5BOEA 4PSPA 4D6EA 2PP0A 3VE7A 5AHNA 1GTEA 1Z8AA 3W76A 3ZXWA 2JKEA 4J2MA 5CC5A 4DWSD 3TDBA 2BVYA 4N0RA 5D37A 3THUA 4OGZA 3OIHA 1GOQA 2WKGA 3BJFA 4JIHA 3PJWA 3V35A 1ELSA 5EA9A 2XGBA 3CL8A 3DFNA 3P74A 3W7HA 1YPIA 1EJVC 1YTKA 1J4RA 3CQHA 3R13A 4CQCA 2ZIDA 3EDDA 2CLMA 4DUVA 3W1NA 5F1VA 3AIWA 1XYBA 2XIBA 3I10A 5TQLA 3RR1A 3H4GA 4R9OA 4R7WA 4GBUA 3W1MA 1E1EA 4ACZA 3NPWA 3PPGA 1SZNA 1RCXB 1W1TA 3N4FA 3KCJA 5I09A 2OTDA 4F48A 4W8AA 3UR5A 1LQAA 5HPOA 2D2OA 1I75A 1EJUC 1XCFA 3E0WA 1R3TA 2OGJA 4FOUA 1A5UA 5IHSA 3LLDA 4WLCA 4NX0A 1O6IA 1QWGA 3Q94A 1Q4WA 2XH0A 3G1RA 4N9DA 1UH4A 4Q4RA 3UZWA 4OECA 4H9YA 4PMUA 1GZGA 3CEUA 2GJXA 3LCIA 1QPLA 1TX0A 2ZKMX 2YCLA 4O0KA 3HPFA 5F2GA 3HOJA 2BVDA 2VI0A 1GEQA 1XIJA 1RV8A 4PBFA 4D6DA 3ZR5A 1JXKA 1JYWA 4ODMA 3MT1A 4QLLA 2Z28A 3J7HA 2WMHA 3VNMA 4ICMA 1E73M 1VLIA 4WCJA 2C6QA 3ZS4A 3U9IA 2NWRA 1MMFA 4JCLA 3LOTA 2WCGA 1AH0A 4GUHA 1BXCA 1MXGA 3UQAA 1DYSA 3PM6A 2XP5A 3K1GA 4MVAA 3HV9A 3TW7A 4TX6A 5EMKA 3VIOA 1TQJA 1YDYA 2B4GA 2NX3A 5D9PA 2A7RA 2ANUA 1E6RA 2BY1A 3R6IA 1ZRQA 3W1PA 1E6PA 4ITZA 3UU0A