1LG1A

Crystal structure of human chitotriosidase in complex with chitobiose
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
365
structure length
365
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Human Chitotriosidase. Implications for Specific Inhibitor Design and Function of Mammalian Chitinase-Like Lectins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords chitotriosidase
total genus 114
structure length 365
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1lg1A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1lg1A01
2VC9A 4D72A 3FNDA 3VKKA 1GVYA 3WD4A 1H1NA 1UR9A 2ZUUA 1VBRA 2TAAA 2G4FA 1KB3A 4P8UA 1E5NA 3K8LA 3I3BA 3PZOA 2PBOA 4Z2JA 3SCSA 5GNZA 2D3NA 2JEQA 2GJPA 5BXTA 1UHVA 5ABFA 1J0HA 1E1FA 3NDYA 4NF7A 3A6OA 2VZUA 6CGTA 5CZKA 3AIQA 2OYKA 3W37A 2EO7A 3DECA 2X2YA 2WYSA 2WMJA 3AMLA 2WW5A 1FP8A 4PCSA 1GHRA 4WKHA 1QNRA 3MU7A 4CVWA 1V0MA 3ZSSA 3S2CA 5LYRA 1E56A 4PMUA 2CKRA 2QV4A 3FAWA 5CLWA 1V3KA 4PTMA 3AXHA 4GPNA 1E9LA 1ISXA 3AHZA 2YDQA 5A8NA 4PMZA 3VD5A 5CJ5A 4JFWA 3NSXA 3WF2A 2B31A 4CD8A 2JALA 2F2HA 4R27A 3WKZA 3M6DA 1CXEA 2ZUWA 4XV0A 2W62A 4TOQA 3J7HA 4AWEA 1CTNA 2A3BA 1UH4A 3W0KA 3TP4A 5A3HA 3VD7A 1GCYA 5A2CA 1ZB5A 3OGSA 1J12A 1GOMA 1G1YA 1B31A 3IANA 1Z32X 4J3TA 3AMCA 9CGTA 1EA9C 3DHPA 2V3DA 2ZOXA 3UCQA 2E4TA 3A4AA 1B3ZA 4JHZA 3K4DA 3W29A 3KZSA 5C70A 1DWIM 4KRTA 1XH0A 2D2OA 4LPCA 2V3FA 3HU7A 3WNLA 3MUY1 1JFHA 1GJUA 1XYZA 3N18A 4AISA 5E6ZA 1CBGA 2YA1A 2J7BA 1NOFA 1E6QM 1OT2A 2OWWA 1JAKA 3UR8A 3N11A 4N42A 2BNJA 4FMVA 2DSZA 1W9UA 4D1JA 1I1WA 4PMOA 1EHNA 1EIBA 1V0LA 1C8YA 1JZ6A 2VZTA 2YBUA 2F8QA 4LQ1A 2NT0A 1NARA 5EBAA 2J8FA 1PBGA 1UQZA 1VF8A 3ECQA 1BQCA 2JE8A 3GTNA 4YN5A 1JZ2A 2DT2A 4HMDA 3VIFA 3AI0A 1JYVA 3WEMA 1HIZA 5E0CA 3OLEA 2FHBA 4UCFA 3SUSA 3EDEA 2XTKA 1K9EA 1E5JA 2C8NA 1VEOA 3BAYA 2CYGA 1KBBA 1TA3B 3RILA 3VDBA 3I3DA 3WNMA 2XVKA 4TXEA 4MB5A 1OINA 2X1IA 4MB1A 2DT0A 5CSUA 4C7FA 5E9AA 3SIMA 3EMZA 2J74A 2PWDA 3CMGA 4XZWA 4PRWA 5AYBA 1ECEA 1RH9A 1UG6A 3GXDA 1HP5A 3PZGA 3OGVA 1MWOA 3WUFA 2XVNA 1OCQA 3BMVA 5TD4A 2A3CA 1DWHM 1WDPA 5CPTA 2IXUA 3RM9A 1C7SA 2BVYA 1UWRA 1WDSA 1W9VA 3MMUA 5BRQA 4U5KA 2WVTA 3SUUA 4HU8A 1RD6A 3GDBA 1BG4A 2UY3A 1KR1A 1QI0A 5HPOA 2VZOA 4D6DA 3WUEA 4DUXA 2ZXDA 1PX3A 1H5VA 3HN3A 3DC0A 4GZJA 2YIHA 1JD7A 1HXJA 2ESCA 2PB1A 2XHYA 1US2A 2E40A 1J0JA 3M07A 3VIHA 4MAZA 3OLDA 4JKKA 3GNRA 2ZUSA 1KQYA 2YBTA 1SYTA 4CU8A 5A2BA 2EPKX 3GZAA 4UFIA 4BZYA 2DH3A 1W32A 4U5IA 4TTGA 4CN4A 1BVZA 1E3XA 4W89A 3U5UA 3RJXA 1GZJA 5CGTA 4PUEA 1JZ8A 3L4UA 3U57A 4GI8A 4CU6A 4OKDA 1JNEA 1DEDA 3IK2A 3VDCA 3SCTA 1E0WA 5GNXA 5JBEA 1J18A 4CD7A 5I2UA 3NIYA 1UWSA 2GJRA 2C7FA 3LPPA 3RDKA 3FAXA 3N17A 1XGZA 3GNOA 3RMEA 1SMDA 4AZCA 3LPFA 2WCSA 3IAPA 1AMYA 1E4IA 3GH4A 1KXQA 1H4PA 4AD1A 5IDIA 1ESWA 3ARXA 2WC3A 2G3MA 4HZ8A 1JDAA 3QHMA 4QLKA 3BAXA 4LYRA 1O6IA 3VM7A 5DT5A 4UFMA 4LYQA 4W84A 4P7NA 3CTTA 3CZKA 1UR0A 2Y2WA 5LA2A 1QBAA 3LMYA 1Q4NX 2GJXA 4JFUA 1TA3A 5FIPA 1B3WA 3AMGA 4GIAA 3K8MA 4Z2HA 3HJEA 3FY1A 1CGUA 1VRXA 3WDRA 3VIKA 2YA0A 1J9YA 1CGVA 1UD4A 3KEHA 4EK7A 1KWKA 2W63A 2WHKA 1UKPA 2Y4SA 1ZBWA 2GJXB 3CUFA 4HA3A 4X0NA 5AY7A 4PTWA 4X9YA 2FGZA 5JIWA 4CUCA 1OWQA 2YA2A 2QMKA 3MKKA 2G8ZA 1QNOA 4B9ZA 1CENA 4WLCA 3WY1A 2ZXBA 4ACYA 2CHNA 3UG3A 2C0HA 4LXFA 1C7TA 1ITCA 1JI2A 3ZM8A 4BQ2A 3WDHA 1YQ2A 2VURA 2GUYA 1TE1A 2RGMA 1ZBVA 4S3KA 1JD9A 4PMRA 2E9BA 1UD8A 5E70A 1QPKA 5CPSA 1E6XM 2VQUA 1AQ0A 1JF5A 1OGBA 3B9DA 1WAWA 3MUIA 1K9FA 4HOWA 3LPGA 2YLAA 3W26A 2XSBA 3POHA 4W8AA 1OGSA 1ZL1A 3K4AA 4BS0A 5DMYA 2DIJA 4QAWA 3ARSA 1BTCA 1PIGA 3WMBA 3WDPP 4J3XA 3SCOA 4TX8A 4H04A 3L4WA 3WQ5A 3QGVA 1UWTA 1XH2A 1KGWA 1HVQA 1W3JA 3SCRA 1CLVA 1E73M 2DQXA 4M24A 2E8YA 2WNWA 3L2MA 4A4AA 4Y7EA 3VOCA 6A3HA 1JZ7A 4ZENA 3W81A 2QLYA 4W7VA 1J01A 1M03A 4KGLA 5A6KA 3VD3A 1OGGA 1QNQA 5BCAA 2JIWA 4HOZA 5DT7A 3VUPA 1WZKA 1QBBA 2OLHA 3DHUA 1E6SM 3O2LA 1PX4A 1U30A 3F4VA 3U7VA 1UR2A 1PIFA 1LL4A 2J78A 2J77A 3VGGA 3GNPA 3FXYA 3CZGA 2J7FA 1V0KA 4AZGA 3M46A 1GOWA 3AHYA 3W24A 5CPQA 4LYPA 3ARPA 3WUBA 1BLIA 3GYCA 4JHOA 4OIFA 3WL0A 1M01A 3VIPA 2DSWA 1CEOA 3VD4A 4ML4A 4ACZB 3VIJA 3W27A 3VIMA 4D6FA 3WH7A 2VCAA 1GOOA 5D9NA 3WFZA 3W53A 2DSUA 1K6AA 3AXIA 1V6VA 1GORA 2WB5A 4YHGA 3TTQA 2ZUVA 3WDIA 3GBEA 4P7LA 3AOFA 2VI0A 4D6IA 2O9RA 4GXPA 3RO8A 3ZJ7A 3N12A 5F7UA 4W8LA 3MV11 2VOTA 5E0FA 5HNNA 3L2LA 3WDJA 3OIHA 3SUWA 5BXSA 1V6XA 1E70M 1R87A 2O9OA 1M7XA 1WCGA 2QMJA 3L4XA 1JZ4A 5EFFA 4HZ6A 4UQCA 3VD9A 5JIPA 2FHCA 1KFWA 3OGRA 3TTYA 1V02A 5A6BD 1XSKA 3AISA 3WEZA 1HJXA 5FL1A 1MW1A 1E71M 3ARYA 3WFLA 1E43A 1VJZA 4M1RA 2ZX9A 3UESA 1E4MM 4ACZA 3B9AA 2FHFA 2YJQA 4UOZA 5A8MA 1HKKA 4P7RA 2XUCA 4CN6A 4EE9A 2OYLA 1OB0A 4TUFA 4Q22A 1NH6A 5A8PA 2ZXAA 3ZJ8A 1TMQA 4AZCB 4JFVA 1R8LA 4UFLA 1XCXA 2PF0A 4JKLA 3WL1A 1WP6A 4AXNA 2BV9A 3GM8A 2VO5A 3AROA 3MANA 3WDQA 3NSMA 4WK9A 2JIEA 5I5RA 1ZU8A 4W7WA 1QHPA 1QNSA 4QLJA 4KH2A 1G01A 4OZOA 1HJQA 3CH9A 1MQPA 1UWQA 4ATWA 1BHGA 4RE2A 1JYNA 4MNKA 4JCMA 3WH8A 5KZ6A 4KRUA 5JUVA 3OB8A 1E6NA 1EDQA 3BLPX 4OOUA 3ZO9A 2XM1A 4AD4A 1KXHA 4E8CA 4JAWA 2OSYA 4UNIA 1UKOA 1CZ1A 3ZR6A 4L4OA 1FH7A 3T09A 4FF5A 3ARZA 1MXGA 1JIBA 1AQMA 1KWGA 1GPFA 2UY4A 1J0IA 1CDGA 4Z2KA 1CIUA 3WQ8A 3EDFA 2J4GA 2VL4A 2GSJA 1W3LA 3VIIA 1FA2A 1GNXA 1H41A 4RL3A 3WD2A 2XWEA 4MTVA 3AS0A 2G41A 3EDKA 1LQ0A 3O6AA 4GQRA 2WXDM 3WBEA 3W38A 1DTUA 1EXPA 4PTVA 4KMQA 3APGA 4PYSA 4AZ5A 1H2JA 4PUDA 4BQ5A 1CPUA 2FH8A 1HN1A 3KE0A 1W1PA 4ZXOA 2BHUA 1XHGA 3VO0A 1BF2A 2J7DA 1C91A 2Z1KA 1UR8A 4BQ4A 2WZEA 4A3HA 5IFTA 2NSXA 2ZX7A 2DGAA 5A94A 3FW6A 4L4PA 2IUZA 3T0BA 3WH6A 4EAMA 1JFXA 3IJ8A 4F79A 3WF1A 2WANA 2EXOA 2J79A 3U5YA 3AIBA 2BVDA 4WIWA 4IPNB 1C3FA 1KGXA 1BVNP 1US3A 4H8UA 3VMPA 5A69A 3CHEA 2EJ1A 1CXHA 2W91A 3WQVA 1V03A 2E9LA 3MUAA 1V02E 3ZJ6A 1VENA 4TTUA 3ALGA 5A2AA 4AD2A 1C92A 4HTYA 1OM0A 5KEZA 3GH7A 1W9XA 5E09A 3KL0A 2V3EA 3CUIA 5A6MA 8CGTA 1V3MA 1CXLA 2WMIB 4HPHA 2XM2A 3MMDA 4M8UA 3WNPA 3WD3A 1UKSA 3SCPA 1NQ6A 3VM5A 5HOSA 5GQBA 1CXKA 3PN8A 1BFNA 4MPKA 5ECUA 3AYRA 4XB3A 1KBKA 1VFUA 3E1F1 2Z1SA 3GBDA 1IV8A 1HJVA 1NWSA 1E1EA 1DWAM 3CGTA 5DFAA 2WWCA 2A3EA 3WNNA 1QVBA 3WF0A 4AIEA 3SURA 3TOPA 2WAGA 3CZJA 3CIVA 1B2YA 3BAJA 5JBDA 2OWCA 1CWYA 3T2PA 2G3NA 4PTXA 5ABHA 1EDTA 1WZAA 1UWIA 1FFQA 3AIEA 7CGTA 4D1IA 4P8VA 2EPNA 4N0RA 2D23A 4J28A 4JL1A 1R86A 1ISZA 1VIWA 3PZUA 1ZS2A 5D8ZA 1CGTA 2D0GA 4HMEA 5ABEA 3VX0A 4P8WA 1NWRA 1HJWA 2BVTA 1HF6A 1WDQA 2J7CA 2WCAA 2CETA 2O92A 3AXXA 3GXMA 1HKIA 2XIIA 1OBAA 4PBGA 1WPCA 1PX8A 1B3YA 5EMYA 2JEPA 4FLOA 4D6EA 3AIUA 1X6LA 4CVUA 1HKMA 1TR1A 3WH5A 1BPLB 1KR0A 4W93A 2NT1A 5BYWA 4F8XA 4QFUA 5I0DA 1H0IA 3OBAA 2BY0A 3AQUA 3A4WA 1XYFA 2GK1A 1X6NA 3ZIZA 5A6SA 4MB4A 1W3HA 5I3DA 2DT3A 1H49A 2VT0A 4NRRA 3ZT5A 2V38A 1E4LA 5BXPA 1KGUA 2W67A 4P7OA 1JGIA 5JH8A 2BY2A 2WVSA 1RP9A 2CXGA 2VR4A 3UERA 2J25A 3F5LA 2W4XA 1JG9A 4GI9A 4GQQA 4XX6A 1PPIA 4HOXA 3CUHA 2AMGA 1HJUA 5I77A 4P8XA 1HJSA 1M04A 3CBWA 2V5CA 2OSWA 2YDSA 2A3HA 2BY1A 1SMAA 2X0HA 4PMNA 3W25A 2YL9A 1R7OA 2DPEA 1AVAA 3L4YA 5M3WA 3W6MA 4K68A 2VR5A 1M53A 1TCMA 2YLLA 3F5JA 3WQ6A 1ITXA 4KWUA 4RE4A 3D3AA 1J0KA 2CESA 1J11A 1W2VA 2CBIA 1UZ1A 4FLSA 4LGXA 1TG7A 4H2CA 3BAIA 4YHEA 4Q7NA 2PWHA 4H7VA 2XFYA 4F9DA 2VVSA 4FLQA 4TVCA 1DHKA 1FP9A 1Y7VA 4HU0A 3WELA 4AZIA 3BAKA 2CEQA 4DUWA 1UD3A 1WNOA 1CYGA 3A47A 5FOOA 1BGAA 1O7AA 3PBGA 3VDAA 3VGDA 2E8ZA 1XD1A 2YDRA 4J3WA 1G5AA 3M7SA 1PEZA 3OZOA 1E6PA 1N82A 3AZRA 1DWJM 4B15A 5A1AA 1I1XA 2D1ZA 4UTFA 2J7EA 4B3LA 1J0YA 3WD1A 5GPRA 5I6SA 4AD5A 3WNKA 1E6ZA 3T0DA 4AEFA 2Y8VA 2WK2A 3GH5A 3K46A 5A8QA 3BCDA 5IXEA 4GZIA 1WDRA 4HPGA 3K1DA 5D9OA 3ZMRA 5LA0A 3VMOA 4NSBA 3WEOA 4B3KA 3RCNA 3ZT7A 1V0NA 2Y24A 2ZICA 4JZ5A 1XSJA 3W28A 4ZXLA 3BMWA 3WMSA 1LJYA 3TA9A 3G6LA 2J7GA 3SUTA 1BYDA 2BS9A 4D6GA 4CU7A 4C7DA 2DEPA 1MYRA 2XVLA 5D4YA 5EB8A 2WMGA 3SCWA 3AIVA 5I23A 4V28A 4IPLA 4F66A 3HMCA 1B3XA 4U3CA 1H09A 1A47A 1GQLA 4H8HA 1GOKA 1GOIA 1V3LA 3EDJA 2WLYA 1V6YA 5AC4A 1QI5A 2WHLA 3CZLA 4W5ZA 4D6HA 2W5FA 1I75A 1Q6GA 4HA1A 3QOMA 5EFDA 7TAAA 2VQTA 4HA4A 2QF8A 4J7RA 1EQCA 1EGZA 3BLKA 2W66A 2GFTA 2WMFA 1IT0A 3BSHA 3EMCA 2GDUA 3UEQA 5FD0A 3FN9A 2PBGA 4M80A 1OD0A 1GVIA 3SCQA 3WNOA 1W3KA 1Q6CA 1MQQA 2VX7A 4PEEA 3OLGA 3PZMA 2WKLA 4TX6A 1W1TA 3QHNA 4NRSA 3ZSTA 3N9KA 2QHAA 1FHDA 1K9DA 4H8VA 4PMVA 3CUJA 3CHDA 5C71A 2UY2A 1BYAA 1MQRA 4MJ2A 5I24A 5IHRA 2VUYA 3T08A 3PZQA 1L0PA 3L4VA 5I78A 1JDCA 4AYSA 5M03A 4E4PA 1UA7A 3VGBA 2HVMA 4GO8A 1QW9A 1NP2A 3TTOA 1QI4A 2XWDA 5CSYA 2FDMA 1B90A 4J27A 2GK1B 1MFVA 2CBUA 1H11A 3ZOAA 2FH6A 1HVXA 1QHOA 3FHAA 1B9ZA 2ZE0A 1IZKA 1XH1A 3T0AA 1JYXA 5ABFB 1PJ9A 2XFFA 2WC4A 3ARQA 2A3AA 1GHSA 5FL0A 3L4TA 1FFRA 1EO5A 1UKTA 2VX6A 4J3SA 4CN1A 1W9DM 3VIOA 1FH8A 2VCCA 1XCWA 1XV8A 4PCTA 4QCFA 4MNMA 1JDDA 2WZIA 4DUVA 2CPUA 2VRKA 1VAHA 3WQ4A 4F9JA 3AFBA 3F5KA 4ATDA 3WIJA 3NUKA 5A6LA 1HNYA 2BHYA 1R85A 3CMJA 1D7FA 2CKSA 1ZJBA 1GOQA 4UZUA 5FCZA 3S6TA 4AW7A 1EO7A 3AJ7A 3QHOA 2YOCA 1G94A 3UETA 1SR0A 3U7BA 1OIMA 3AS2A 4JFSA 1EHAA 3ZT6A 1QOXA 3RM4A 1QHZA 2CBJA 4MB3A 4KGJA 4AIUA 5BROA 4UQBA 1JNDA 1ZJAA 1KCKA 3CUGA 3VILA 2PWFA 1C93A 1OT1A 3VX1A 3MSGA 1V3IA 4M56A 3VVGA 2BFGA 1UKQA 3VDHA 3ZJKA 1NOWA 1E40A 1PZ2A 4CD6A 5CLTA 3CZEA 1MVYA 3PZ9A 1X1NA 1NM9A 4WSKA 3EBVA 3LPOA 3BCFA 3W4RA 4DWSD 1J10A 3SCNA 2NW0A 4AY1A 1E4NA 3THCA 1U2YA 3GXFA 1UYQA 1RP8A 4J3UA 1F4AA 2D3LA 3BC9A 4NZCA 8A3HA 2W92A 1VEMA 1CGXA 4MDPA 2WC7A 4TVDA 3TONA 2BXYA 2WHJA 3NJ3A 4OOZA 4CGTA 3BH4A 4ZE4A 3PTKA 3A4XA 2CERA 3T2OA 4CD5A 4WF7A 1JZ3A 2BHZA 5JBFA 3ZQ9A 1GW1A 2VX5A 2J8GA 2BY3A 1UA3A 4PMYA 4PSRA 4U33A 3OA5A 3II1A 2QPSA 4PSPA 1QI3A 4WSJA 4U3AA 2WSKA 4OJYA 4Z2GA 5A95A 1BSIA 1VEPA 2MANA 3ALFA 1OSEA 2E0PA 2EEXA 1F4HA 4U2YA 4UQ9A 3D5HA 3BAWA 1U33A 1MW3A 1XD0A 1KXVA 1RPKA 2XIBA 2VVNA 3L4ZA 3PZVA 1QW8A 4DM1A 4E8DA 5LA1A 1CECA 2V3GA 5A6JA 1MW2A 2X0YA 3THDA 3N04A 3FHQA 3NYDA 1JAEA 2WWDA 1B30A 5A6AA 4X0VA 3MMWA 2ZXQA 4MNJA 4AIOA 4IUGA 3B9EA 4UFKA 3WN6A 4W86A 4CCEA 4CCDA 1TVNA 4W8BA 4ZFMA 3WUGA 3RIKA 3UR7A 1B1YA 1JI1A 1CGYA 3WQWA 5BRPA 4R5EA 4H41A 3AYSA 2WKGA 5M5DA 2E9MA 1LG1A 2JFEX 3POCA 1FH9A 2XVGA 2O9TA 4W88A 3G6MA 1V08A 1UOKA 2BXZA 4Z2IA 1XRVA 3PZIA 3CO4A 1EH9A 4W85A 3AICA 1TZ7A 2XGBA 2VTFA 4E2OA 3UG4A 2DSKA 1OD8A 1JL8A 2DDXA 1XC6A 2VCBA 2DT1A 1ISWA 2OYMA 4GZEA 3WMCA 2W61A 2J47A 1HX0A 1GQKA 1W9BM 3N15A 1GJWA 3IAQA 3WF3A 2CCRA 4U2ZA 4J3VA 5D9PA 4PN2A 1V3JA 3IJ9A 1BGGA 2V5DA 3MV01 1H3GA 1HL9A 1YHTA 2HISA 3SCUA 5A8OA 1ISVA 5ABGA 3MSDA 1VFFA 2GDVA 3W82A 1ZBCA 3ARWA 3MO4A 3BXWA 2WMKA 4AZ6A 4W5UA 2D20A 2RGLA 4M29A 3TTSA 1TFVA 1ZBKA 3AIRA 4W7UA 4PMQA 4EKJA 3CHCA 1UD2A 4QLLA 3OG2A 1MW0A 2WLZA 1D2KA 1CLXA 2Y8KA 2J75A 4B16A 3EMQA 2WBKA 2VZSA 2YL5A 1NWUA 1VJSA 3AS1A 5BWFA 5CQ1A 5CGMA 3CHFA 1JXKA 3GXIA 2PWEA 3QR3A 3SUVA 1C8XA 1UZ4A 3SCVA 3VGEA 1A3HA 2PC8A 3AZSA 2AOSA 3SEPA 3KL3A 4DM2A 3ARRA 4Z2LA 1NP0A 1E0XA 1MFUA 4D6CA 2WVVA 3CPUA 3RPMA 4AMCA 2CHOA 2X05A 1UD5A 3EYPA 3B8SA 1TVPA 5HDRA 4D71A 2OSXA 1VFMA 4MAVA 1B3VA 1UR1A 1CGWA 1SFSA 4OBSA 4MDOA 2XPKA 2WMHA 4RE3A 3KL5A 1HT6A 1LLOA 5E6YA 5HBFA 3VIGA 4UR9A 4HP5A 3WD0A 4ATLA 4BCEA 4DWSC 3AHVA 1JZ5A 1ODZA 3PTMA 1W1YA 4JIEA 1FOBA 4BQ3A 4V27A 5DEZA 3VNYA 2WPGA 3T2QA 4AEEA 3NCOA 1JYWA 2CBVA 2J7HA 3AZTA 3QOKA 2D0FA 1LL6A 4AZBA 2EQDA 4WKAA 3OLIA 1WZLA 3O9NA 5D9MA 1HP4A 1WZMA 1G9HA 3VNZA 4U31A 2VRQA 5GNYA 3ARTA 2CITA 2EPOA 1C90A 5DF0A 2UWFA 2O9PA 2ZUMA 3NDZA 4WKFA 1Q6FA 1GONA 4HZ7A 3A3HA 5HPCA 4CCCA 1Q6DA 2ZX8A 2XVPA 2WVUA 1E0VA 5DO8A 2JF6A 2UY5A 1CXIA 2DSVA 2VX4A 3AHTA 1KXTA 3VU2A 4URIA 1UUQA 1HL8A 2ZX5A 2PWGA 4ZE5A 3NSNA 3JUGA 2ZWYA 1VFOA 4QP0A 1E6RA 4GO9A 2AAAA 1GUVA 4BA0A 4MJ4A 1W2PA 1WE5A 2EBNA 1OIFA 1XSIA 1BYCA 2WCGA 1NOUA 1PAMA 1D3CA 1BG9A 4M82A 3WF4A 3BGAA 4MNLA 1BYBA 3KWXA 1KCLA 1WKYA 4D6JA 4PMDA 4AD0A 4V2XA 2IXVA 4TVUA 2D22A 3DYMA 1W91A 2FGLA 3DYPA 3N1AA 2PI6A 3PZTA 2X8RA 2OWXA 3WSUA 2XSAA 2WSPA 4B9YA 1EDGA 3PZNA 1UD6A 2XGIA 3W6LA 1QNPA 1BAGA 2EPMX 5C8BB 3AIWA 1WO2A 2YKKA 1CXFA 1ODUA 1H0GA 4UQAA 4HMCA 1UR4A 4GI6A 2XFRA 2ZUNA 2WHMA 2CIPA 1IZJA 4XUYA 3RJYA 3AMKA 5A6BA 5IHSA 1MXDA 3VGHA 5AYIA 4GKLA 4ZEPA 1QI2A 2VZVA 4UZSA 4EANA 3VPLA 2ZUTA 4YPJA 4QDMA 3ZR5A 1B0IA 1W1VA 2JF7A 5CXPA 3IJ7A 1GQIA 1LWJA 1K9TA 1UWUA 2XG9A 1R7AA 4MADA 2DH2A 1GQJA 1LF1A 3CZ8A 4OBRA 2WZHA 4IISA 1CNVA 1VB9A 1EQPA 1ISYA 2WM0A 1FHLA 4FLRA 3MUZ1 1DWFM 3AHXA 2ZX6A 7A3HA 3EDDA 4CD4A 1E15A 4JCLA 2D0HA 5CG0A 4WJXA 3WBAA 2CNCA 3WENA 5AC5A 5IFPA 3BSGA 1DP0A 4PMXA 2VJXA 1W9PA 4JFTA 1J0ZA 1DWGM 1UH2A 1AQHA 2GVYA 1G0CA 1VBUA 4FK9A 2VRJA 2X09A 4QCEA 1LG2A 3UG5A 1LWHA 4BF7A 4UQEA 3CLWA 4GINA 2F61A 2YL8A 4C7GA 1PZ3A 5BXRA 3RM8A 1E72M 4AZHA 3WH9A 2XYLA 4AC1X 2EPLX 2WVVB 4UQDA 4JL2A 2XJ7A 2YL6A 3AMDA 3ARVA 1WB0A 2D24A 4CKQA 3VMNA 3VTRA 3MS8A 4JKMA 1V6UA 3PTQA 1P6WA 4AZ7A 4S3JA 4IM4A 1V3HA 3DYOA 1EOMA 4UFHA 1C8QA 2WMIA 2G3IA 1EOKA 3AS3A 3ARUA 6TAAA 2VMFA 4DWSB 4UOJA 4NI3A 1JF6A 4LX4A 4UFJA 1TUXA 1LL7A 3PHAA 5FKYA 3K8KA 2ZIDA 1E55A 4OUEA 1KQZA 4W87A 2WBGA 3I3EA 5HXMA 2G3JA 3VGFA 4DWSA 2ZWZA 5I79A 2Y5EA 5D8WA 1V6WA 1Q6EA 3N13A 1E3ZA 4A3YA 4XZBA 1HKJA 1JXJA 4AD3A 2QPUA 4P7QA 2DIEA 2E3ZA 2Q8XA 1S46A 2J62A 4UOQA 3OZPA 1L8NA 4M81A 1UH3A 2VNCA 3VINA 5M17A 1NWTA 1UQYA
chains in the Genus database with same CATH superfamily
2OKOA 3VKKA 4ODOA 4PUKA 1H1NA 3IUIA 3LCGA 1VBRA 1JPDX 4KWVA 2TAAA 2G4FA 3EWUA 4XIMA 3I3BA 3PZOA 1NDWA 4J4OA 1EUAA 2PLJA 2Z1BA 2VEPA 1YNYA 2GJPA 4FOJA 1QASA 3IJDA 5BXTA 1UHVA 1K4GA 5ABFA 1J0HA 1E1FA 1RXOB 3NDYA 6CGTA 5CZKA 4DN1A 5DITA 3I6RA 2QYGA 3GHTA 1EEXA 3I7RA 3BOXA 5H91A 2ZQVA 1VH7A 4WKHA 1I2PA 1F9CA 4O0QA 4RPQA 3N2TA 5LIXX 4CVWA 3GR4A 2PWVA 3S2CA 4K8EA 2QV4A 3AXHA 4DRQA 1FWJC 4PMZA 2B31A 4JHMA 3EX6A 4R27A 1RQEA 3NTPA 4DYEA 4US6A 4REQB 1ZPTA 4W9QA 1CTNA 2A3BA 1UH4A 2H8ZA 3HPSA 1ZB5A 5C9RA 2OCZA 4H1ZA 1B31A 1VQTA 3IJ6A 4Y2WA 1EA9C 3DHPA 1KFCA 1FKKA 1QPOA 2BDQA 4UR7A 2ZQSA 2AAMA 2X2GA 1QW7A 4JHZA 3UWYA 2ODOA 3SN4A 4KRTA 1NELA 2D2OA 4XTIA 2HVOA 2RSEA 1GJUA 2AGTA 3B3DA 3N18A 5C2CA 2C71A 5E6ZA 1CBGA 1YXDA 1NOFA 3S1UA 4MMWA 3N11A 3UR8A 4I8DA 1Z3NA 4J40A 2BNJA 1DORA 4PMOA 1EHNA 1JZ6A 3KCJA 4LBUA 1A49A 1NARA 2BWGA 3GNDA 5EBAA 1PBGA 1KM2A 3LMZA 4BF9A 1YKWA 2XP7A 3VIFA 4C6PA 3W84A 3AI0A 1JYVA 5EGRA 1SSDA 1S2UA 5E0CA 2FHBA 3W83A 3P8IA 3AU2A 5DMMA 3EDEA 3TSDA 2XTKA 4ORIA 1E9ZB 3UQBA 4WGXA 2C8NA 3R6IA 1UW9A 2BGQA 3QXBA 1M9HA 3UZXA 2CYGA 1TA3B 1A3WA 3WNMA 2XVKA 1OINA 3R43A 2A4AA 1TJRA 2O4QA 3W01A 2G37A 5D38A 3TCSA 5AYBA 3W2UA 2D2GA 4RXFA 3N14A 3GXDA 2AL1A 3SSJA 4I6VA 5F4XA 4TNSA 1XLIA 3BLEA 5DCBA 3E9AA 4TQTA 1Q7ZA 4WVXA 3WUFA 2B0MA 3BMVA 5BOOA 1ZGDA 4L64A 2A3CA 1SJDA 3DESA 1DWHM 5H8UA 4DO5A 5CPTA 1C7SA 3STPA 2X41A 1WDSA 3KVKA 4JTEA 4LF1A 5HKGA 4I6KA 2HXTA 3GDBA 3H53A 2UY3A 4DRJA 4CNOA 1TTJA 2IMRA 3MMTA 1BD0A 3GU9A 4GQBA 2GDQA 3DC0A 1R9HA 2QW5A 3NZPA 3E0WA 3AYTA 5C5YA 1XINA 3U9IA 3WLPA 4MAZA 3OLDA 3GNRA 1DIKA 3QV7A 3HV9A 3C52A 4GH3A 4CU8A 4LANA 3GZAA 3OOQA 2QCEA 1O5KA 1HKWA 4KCWA 2PDHA 2OODA 4TTGA 4N02A 1RUSA 3U5UA 3RJXA 2MUCA 5HNUA 2B7OA 4FR6A 3LBCA 1P48A 4DNHA 2ZRWA 2DIKA 3N2OA 3EWXA 4OKDA 5JH2A 1JNEA 4XAGA 3SCTA 1E0WA 3FGCB 5CC5A 3FKRA 1UUOA 2F84A 2Q3RA 5U4NA 4ZPTR 5I2UA 2C3ZA 3NIYA 1UWSA 3EKGA 2C7FA 4H9YA 3FAXA 1EJTC 1XGZA 1CB2A 4EPDC 3RLHA 3OVQA 3GDLA 3S9IA 1IR2A 3ARXA 3UY8A 4QROA 5CGQA 1A5LC 4JTRA 2DV0A 2Y63A 5DT5A 2QUMA 4ECLA 5AFDA 3CZKA 4N19A 1X39A 3LOTA 4N2YA 2QAFA 3B06A 4ODNA 4UTWA 4DROA 4GY1A 3HGRA 1WKEA 1UMYA 3QW3A 4NT0A 2YA0A 4DT4A 1FBAA 3QKEA 5I3FA 3CQJA 3FEQA 4HA3A 3VZYA 2PEVA 1WOAA 1Z41A 1SM9A 2YA2A 4IMFA 4E2DA 1T5AA 2VFHA 1R6WA 2YZRA 5H8PA 1TV7A 3WY1A 1NDVA 3L67A 2GPTA 2C0HA 1RK5A 2OQYA 4AVFA 3E74A 1TE1A 1ZRQA 2GUUA 1JD9A 4PMRA 4Q8NA 5CCZA 3DFTA 1E6XM 2C91A 3PAOA 4US5D 5EPDA 3VKDA 2ZC8A 2XSBA 3CIWA 3POHA 4ICMA 4W8AA 1ZL1A 3K4AA 3LA4A 5DMYA 4RUBA 4QAWA 1X6UA 4EXAA 3MUXA 2BB0A 3BK0A 3SCOA 3WQ5A 3V75A 1UWTA 1XH2A 5HR7A 3UCDA 4C91A 3OA3A 3FFSA 3AXKA 1W3JA 1R3QA 4XBKA 2WNWA 1THFD 3S6OA 2YR1A 3W81A 1QAPA 4DRNA 3VD3A 1OGGA 2GGEA 5DN1A 5DBTA 3FCPA 5HANA 3DHUA 3PWGA 1N2VA 1PX4A 3DU0A 3QQ1A 4JTJA 3S83A 1UWAA 1XCFA 4G9PA 3KBMA 4CQ8A 3NOYA 3QZ6A 2J77A 3STCA 3VGGA 3FXYA 4GOAA 3CZGA 4E2VA 3TC7A 3SECA 3RG6A 2KR7A 4O1FA 1FKSA 4L1XA 5CPQA 2BTMA 2C19A 3L21A 1R9XA 4ZPVR 3UW6A 3CUZA 4DBWA 4W9OA 3WQCA 1QUMA 3EAUA 3N19B 4QEHA 1SUXA 4YHGA 5EMJA 3TYBA 3WDIA 4P7LA 5CJNA 4Q8QA 3RPTA 1V7AA 2C1IA 2RUQA 4GXPA 3RO8A 5F7UA 4LUSA 4GWEA 4KWSA 3MV11 3EXSA 3KVLA 3MVTA 4NX5A 2VOTA 6TIMA 4LAXA 4ODQA 3OIHA 3EPOA 1M7XA 3FJ4A 3NQDA 4LW7A 4JGDA 1VFLA 4Y9OA 1JZ4A 1M3UA 4B5WA 1SJBA 3U2CA 1ZY9A 4UIOA 1KFWA 1VBGA 3GVWA 4TIMA 1XSKA 4H2HA 4KEVA 5FL1A 1GZ1A 1E43A 4M1RA 3B9AA 2FHFA 2YJQA 5A8MA 2QF7A 3W88A 4O2TA 4B3ZA 4P7RA 4EE9A 2DFAA 2OYLA 3S2LA 1AJ0A 4RE0A 1QOQA 2PF0A 1I2RA 3TCZA 4Q8WA 3M0JA 3KBVA 2V2DA 4JKLA 4X2RA 2HZGA 2VO5A 3MANA 1HL2A 3WJYA 3TWBA 4P2VA 3SY8A 3V0TA 1WOBA 1BHGA 4NIRA 4RE2A 3PRAA 2AGKA 5KZ6A 3SGZA 3RLGA 3OB8A 1E6NA 4OOUA 3ZO9A 1R9YA 4LY4A 1KXHA 4E8CA 3E2RA 4FXFA 1UIPA 1UCWA 3LHTA 3UR2A 3ZR6A 2OEMA 2R94A 1NMVA 1FH7A 4MSPA 3T09A 3WLNA 4UMBA 2R9RA 1MXGA 1B57A 2QKFA 1KWGA 3WK1A 3OO2A 1J8VA 1CIUA 1GVRA 2PWUA 3EDFA 2J4GA 1XFCA 4MJMA 4HGXA 4L4MA 2INFA 4A22A 1NU5A 2CZDA 2G41A 4UTHA 2Y62A 3TMQA 4QR6A 3O6AA 4WOZA 3CYVA 2G4JA 1IR1A 2NWRA 1R2SA 4ZO6A 1MSSA 3ES7A 3H4GA 3A13A 3N4EA 1H2JA 4HSNA 4FNRA 2FH8A 4NXKA 3KE0A 1QR7A 1XHGA 2Z1KA 5CBIA 4MSSA 4IQEA 2WZEA 3LY0A 4H6KA 4KFPA 2NSXA 3UWZA 2DGAA 2XPBA 1NFGA 4FO4A 5A94A 2IUZA 3T0BA 4QDPA 1TPB1 3KLKA 4HJWA 1EEPA 1FKTA 4XZLX 3H54A 4NXSA 2R1PA 3BTNA 4GXWA 2EXOA 3U5YA 5DY2A 2M2AA 3RITA 4R33A 1C3FA 1PZ1A 2P5NA 3LCWA 3B05A 5IM51 3WQVA 3MUAA 1UIOA 2PRMA 4JTSA 1V02E 3ZJ6A 4PUJA 4AD2A 5A2AA 4HTYA 4H01A 3GTYX 3VAVA 5E09A 3U0HA 1Q2RA 4DAIA 3G18A 4LBSA 3R0KA 3V1PA 2YGYA 1FCVA 4N9EA 2YCEA 3PJWA 4HPHA 3WD3A 3P80A 2GGHA 3KW3A 3SCPA 2E1WA 1VYPX 5GQBA 3UXLA 1TZ9A 2YCIX 4RX0A 1BFNA 3AYRA 4JBRA 5B80A 1VFUA 5JU6A 2F2KA 1HG3A 3TOYA 1GTEA 1OYBA 4FNQA 4X61A 5ABTA 3MPGA 3R58A 1TCOC 3PBWA 2D73A 3UP8A 1YPIA 1L6SA 3EIPA 1OVDA 2A3EA 3GU2A 4J2MA 3UGVA 4AIEA 3TOPA 4GLEA 4UC5A 2OWCA 2PCQA 5LNWA 3T2PA 2ANUA 4JN6A 4GCAA 3DFPA 1IT7A 4DXKA 1WZAA 3URBA 3AU6A 4XG1A 3G1FA 1R86A 1XX1A 1RZMA 1H63A 3PZUA 1DYSA 1ZS2A 2D0GA 2PDJA 1CCWB 3VX0A 4P8WA 1NWRA 1HJWA 1WA3A 4TX9A 1M6JA 2CETA 2O92A 2QVHA 3SW6A 1OABA 4R34A 3NXLA 3CO8A 1SO6A 4PBGA 1WPCA 1JDEA 3B8UA 1RVGA 1W0MA 2Q3OA 2ZZ6A 1F7BA 4QITA 5REQA 4D6EA 1X6LA 1UBPC 4Y9NA 1BPLB 2EHHA 1ITUA 3SAZA 5I0DA 3S8HA 1XYFA 1G4EA 1X6NA 5A6SA 4JTDA 3TEVA 4JFMA 1W3HA 3QKZA 2DT3A 2DU2A 2YXGA 3A12A 4YL2A 3IARA 4WGHA 1KGUA 1FKXA 3NEVA 1JGIA 4OT7A 4LVGA 3G1YA 3R12A 4NJKA 3KAHA 3WFAA 3EZ4A 1GGOA 2J25A 3NQVA 5CC7A 1W5NA 4BEQA 3E5BA 1JG9A 1JUBA 4GI9A 4S3GA 1L6GA 4GVFA 3NPUA 1ZFJA 4HOXA 2CLLA 2OMAA 2F9RA 4LJ3A 2YX0A 5HQEA 4P8XA 3CBWA 3O8AA 3E0FA 2OSWA 1ZENA 4QDWA 2IPFA 4RV8A 5EY5A 4EWJA 2OG9A 4ODLA 3ODKA 1IE7C 5LGZA 3P60A 1VYSX 3UNDA 4K68A 2VR5A 2YLLA 1ZP3A 3EOEA 2FPYA 3D3AA 1J0KA 2CESA 2P0IA 1J11A 1W2VA 4WY0A 2CBIA 1J93A 4QHRA 2KI3A 1XIDA 1KKOA 3FYPA 2CW6A 2PWHA 4F9DA 4FLQA 4TVCA 3AUOA 5KETA 1FP9A 3RLVA 1GW9A 1Y7VA 3VI2A 1XYMA 1S5NA 2DUXA 1CYGA 2B7QA 1H61A 4I7WA 3PBGA 3VDAA 1GWJA 3ITOA 3KAFA 3AJXA 2ZQ0A 1XD1A 4HK6A 1G5AA 3D6NA 4DPQA 3VABA 5FAGA 3W22A 3C86A 4L5ZA 1XIJA 3CWNA 4B15A 2Z7KA 2C6QA 4X63A 1TV2A 2D1ZA 3O5JA 1J0YA 1YTDA 2PDQA 1QPNA 2Q71A 4AD5A 1LWIA 1BQGA 1D7HA 4NYUA 5BU6A 1P7TA 2Y8VA 2WK2A 3Q37A 2Z28A 1H7NA 2PZ0A 1VD6A 2PGEA 4GZIA 3V36A 4IQLA 4HPGA 3KBNA 3VMOA 2WPBA 4NSBA 3WEOA 3RCNA 3ZT7A 4ADUA 1K8YA 3N2MA 1V0NA 3C2EA 2Y24A 4MLRA 2EKCA 4JZ5A 4DRIA 4GUHA 1K8XA 2YZ5A 3SUTA 3UG8A 4D6GA 2ZZ7A 2XVLA 1Y0OA 3SN1A 3ENLA 3NVDA 1Z8AA 3KACA 3MYOA 3DUGA 1O4UA 4LC8A 1IT8A 3S6DA 5FJTA 2DVTA 1EUNA 3TJIA 5J5DA 1H09A 3GKFA 8XIAA 1GQLA 1GOKA 4HSOA 3W2NA 3KDOA 5G2IA 5AC6A 1QI5A 2WHLA 3TSBA 3R5EA 2I5GA 4D6HA 1I75A 1Q6GA 2QXWA 2VGBA 2VD9A 4HA4A 2QF8A 5T9CE 3BLKA 2W66A 5F2MA 3B7XA 2GDUA 3UEQA 4EXQA 1OYAA 3EOOA 3S9YA 4LSBA 3ITGA 1XJBA 3Q45A 1KRMA 3V35A 3IJLA 5HMDA 1HTIA 5SWUA 5AN7A 5CAHA 1W1TA 3QHNA 1T99A 3N9KA 4MKVA 3TE9A 1KBLA 1K9DA 4UTWC 3LNPA 3ZXWA 4O4WA 1I2OA 2UY2A 2BMBA 2VUYA 3VFCA 3T08A 4NASA 2NX1A 4MKNA 3RX3A 5I78A 2F7FA 4GVGA 4GC3A 3I4EA 4E4PA 3VGBA 2PD9A 3GAKA 4GO8A 5RUBA 2FZ9A 2GK1B 1MFVA 5CBBA 1I2QA 4M3PA 3DG7A 1PL9A 3OPSA 3JXVA 1D3HA 3A5VA 2H9AB 3ARQA 4Y9AA 1GHSA 4CNPA 4S1FA 4L3NA 1IWAA 1EO5A 2VX6A 4J3SA 4N9CA 5LNRA 4YTQA 1XCWA 1K6WA 3GTIA 3JZEA 4ZB5A 3M0IA 2FJUB 2CLKA 3F5KA 3HPZA 4L4LA 2NLIA 3FXGA 6REQA 3NQ6A 1EIXA 1ZJBA 2PSNA 1GOQA 4UZUA 4YU1A 1SGJA 5CPLA 4AW7A 1EO7A 1LROA 1TRDA 2HDJA 3TWAA 5IBXC 4CNTA 2G97A 1G94A 3UETA 1SR0A 2XU2A 3VUSA 5CSRA 3CWHA 3ZT6A 2BOEX 4J4NA 2C16A 2ZA2A 2VDGA 5AHNA 5BROA 1BXBA 4AIUA 1JNDA 4UQBA 2ZFAA 3L2IA 4BR1A 5AHLA 3WLKX 3MSGA 4LCSA 4M56A 3VVGA 5L6UA 3VCRA 1V77A 4C6OA 4LU0A 4CD6A 1F3EA 5TBOA 4JYFA 4R3UA 3CQHA 3NVTA 5CLTA 1MVYA 2I14A 1X1NA 3ERPA 3BCFA 2GWGA 3SCNA 2NW0A 4NAEB 1UYQA 3APYA 1RP8A 3O5GA 4J3UA 4NZCA 4JFIA 1ITQA 3AO0A 8A3HA 3T1GA 3R10A 4Q6XA 3TFXA 1JUKA 4GA8A 5CH9A 1A0EA 1OCJA 3MBDA 3EPNA 3TR2A 3GE7A 3MZNA 2WC7A 4QT3A 4NU7A 2X30A 5LXEA 2NQ9A 4OFCA 3A4XA 2CERA 4LALA 3QZEA 3S42A 1GW1A 3IKGA 1Q45A 1QI3A 4MGVA 3LGGA 3MY9A 5C2GA 4Z2GA 1PO9A 3M0HA 3ALFA 2EEXA 4U2YA 4DWDA 3VZXA 4WUIA 1XD0A 5FJJA 1KXVA 2XIBA 3PZVA 4C1KA 1QW8A 5LA1A 2HWGA 3GC2A 2E1DA 3CL6A 1OJXA 3OEXA 5FACA 4MY1A 1MW2A 5AHFA 2RFGA 3GAYA 1MO0A 1B30A 4I5UA 4X0VA 3R79A 3TVAA 2ZXQA 1QFEA 2RURA 4MNJA 1T41A 2VM8A 3TC6A 4CCEA 4LUIA 2GYIA 4YCPA 4W8BA 2Y7EA 1SJAA 3W1PA 3UR7A 1B1YA 1JI1A 1CGYA 3PG8A 5BRPA 4XAZA 4HJFA 3A23A 3AYSA 2VC6A 3POCA 3E0LA 4POCA 2YW3A 3P14A 2X7WA 3AICA 3NQFA 1IXOA 2VTFA 5FSEC 3K5XA 3W2KA 1OD8A 1XC6A 1XL9A 3RU6A 2NLYA 4HT3A 3HMJG 3QMSA 4IMEA 1KC7A 3WMCA 3HGSA 3S2JA 4DJED 3EWYA 4ZQRA 1GJWA 3IAQA 5CZSA 3WF3A 4J3VA 3THUA 2OVLA 4I5RA 1HL9A 2ZE3A 1AK5A 3MYPA 1SZNA 2HISA 2BX7A 4RXGA 5A8OA 5K4ZA 1ISVA 3V5CA 3C2VA 1Q6QA 4YTUA 1VFFA 2KAUC 3W82A 3ARWA 4HNUA 7TIMA 3G5EA 2H6RA 3UNTA 3NEHA 2EJAA 3T81A 4NX0A 3TTSA 3C4UA 5G2WA 4M19A 5D37A 3W07A 3F4WA 1OCBA 1BRLB 3OG2A 4QLLA 2QUUA 3B9OA 5C55A 2FZMA 1FWRA 3EY6A 1VC4A 2J75A 4PFMA 4B16A 1QRQA 3IIXA 3EMQA 2OX4A 1QTWA 1POJA 3HQNA 4DJFA 1VJSA 3S1VA 3KP0A 3OHIA 1QT1A 4AH7A 2Q09A 4I9TA 3WQDA 2ITKA 2VFGA 1TJ1A 3F4DA 1A0CA 3UA4A 3SCVA 1XLJA 2OPJA 2DG4A 1LORA 2PC8A 3AZSA 4G7FA 5B8IC 3PB2A 2KO7A 4JYSA 4IGMA 1NP0A 2XIQA 4O1AA 3KOXA 1MFUA 3ZLGA 2FZBA 4V15A 2FJKA 2CLPA 3O3RA 1B3VA 1W1IE 4C5ZA 4OBSA 3ZLFA 3VOHA 1HT6A 5G5IA 4KKXA 2J66A 2VEGA 2WJFA 5HBFA 1MZRA 2VENA 3NQ8A 5FJRA 5T26A 4HNTA 4H9MA 3WD0A 4HP5A 3NZRA 3KAOA 3BW4A 4BCEA 1Y5VA 3BG3A 4C6NA 1W1YA 4W4QA 1FOBA 3T55A 1GG1A 4BQ3A 4YWIA 4AY7A 3BG5A 3T2QA 3CUXA 2J7HA 4MWAB 1DVJA 3TW6A 1L6WA 3O5QA 4WKAA 5C6MA 5D9MA 1WZMA 1G9HA 3VNZA 4U31A 3ZWSA 4JIPA 1C90A 1BL4A 3OJGA 1L2QA 2UWFA 4GCXA 1TPWA 3EWBX 1RSCA 1GONA 2PP1A 2OELA 4HZ7A 3B97A 3TYUA 3A3HA 1Y65A 1Q6DA 3MB9A 4DJDA 1E0VA 3CAKA 3EX1A 2UY5A 1CXIA 1XQLA 2VX4A 1E9YB 3AHTA 4B5UA 4UMCA 4URIA 5FSDC 2DZTA 2ZX5A 1H7WA 1X7IA 4GUFA 3UF9A 4ZE5A 1J5TA 1JRBA 2DORA 1VFOA 4C6BA 3PM6A 2A0NA 3QLDA 1GUVA 1W2PA 4IIFA 4C02B 3UWEA 2BBFA 3OHMB 1OIFA 4UTLA 1BYCA 2YYTA 4LUTA 1Q63A 1PAMA 3W87A 2RUSA 3R4IA 3TLLA 2V5KA 4MNLA 1BYBA 2E77A 3ATYA 2CWXA 4J3ZA 5C2XA 2PU0A 4GXMA 4FXSA 2D22A 1MUWA 2PI6A 4E4UA 3GD6A 3UWUA 5F1UA 2A21A 4WD0A 4YVXA 1TJ2A 4C90A 1KRBC 3CEPA 4PCFA 5DRCA 1LQAA 4L56A 4YMZA 2XINA 1MEHA 3CNYA 1LT8A 3P81A 1WO2A 3GLCA 2YSWA 1GYLA 5AHMA 2ZUNA 2PE4A 3UZZA 2WHMA 4F4RA 2J8TA 4CNUA 3BV4A 5A6BA 1FKBA 4NI8A 3MI2A 1IEQA 3VGHA 5J5RA 1MNSA 1US0A 4ZEPA 1QI2A 4ZQOA 4YPJA 4DRKA 3M44A 1HO1A 5D2YA 2BASA 4B2DD 1ZAHA 5HW7A 3TROA 3CGMA 1GQJA 3N29A 2NXIA 3PBYA 4IISA 1VB9A 1LYXA 3VAWA 2ETNA 1IWBA 1DWFM 1KLZA 3H2CA 4EP8C 2FVLA 2QAPA 3M0LA 2V0TA 4Q8OA 2ZX6A 1RLDA 1EJVC 5F2GA 4Q3MA 2GLKA 2DZXA 3I68A 4IT4A 3E3HA 3WBAA 1B54A 3CV1A 9RUBA 1FKDA 3BSGA 2I5IA 1LLWA 1XPGA 1W9PA 2JQXA 1ZAIA 5HQMA 2GVYA 3H12A 2CLHA 1G0CA 1VBUA 3UG5A 1JPIA 2E6FA 5MKGA 1RLCL 4C1NB 4GI4A 2F61A 1QPLA 4HCHA 1QZ2A 2X0SA 4RNFA 1SVDA 1FWEC 3KP1A 1GVFA 3IPWA 3HB9A 3W1AA 4TMCA 1E72M 3NZGA 4AZHA 3WH9A 4PUUA 1AH0A 5EMKA 2Q6ZA 4NNRA 2E68A 3MWCA 3OP2A 1W1ZA 2XJ7A 1WB0A 3VTRA 3LCXA 2NV9A 4AZ7A 1V3HA 3DYOA 1EOMA 4UFHA 1C8QA 2G3IA 3FDKA 3MP3A 1YBQB 4GNJA 3AS3A 4UNKA 3VE9A 4DWSB 2Y7DA 4GJ1A 5DCEA 2TSYA 1TUXA 1XLBA 3SZ8A 3K8KA 2ZIDA 2VR2A 5U7SA 1T8QA 3ONCA 3SJ3A 2WBGA 1MUCA 1R3YA 3I3EA 3FYYA 4LV4A 1BTMA 2Y5EA 1V6WA 1HKJA 1CLKA 5K2ZA 2ASHA 4JXCA 4P7QA 3VCNA 1JEZA 4Q8TA 2E3ZA 3LZ5A 2Q8XA 1S46A 3PUDA 3I7QA 1WDDA 3FNDA 1GVYA 1R3RA 2HRWA 4QG6A 3BANA 1S38A 1EC7A 5HJXA 1G4TA 4NJGA 3HO8A 2PFHA 3D0CA 3LB0A 5AC7A 2ZADA 2OZ0A 3L65A 2NQLA 3R8HA 4B5SA 3GYEA 4ZMGA 4I9MA 2VZUA 3ITLA 1EBHA 3LI1A 2A1YA 2OYKA 2V63A 4RPPA 2WYSA 1H1ZA 3STFA 3DN5A 2QCLA 4PCSA 1DL3A 5CZJA 3JYJA 2ABAA 3B0UX 3TYZA 1V0MA 4H3DA 3EPMA 2RQSA 5CLWA 1V3KA 4DXVA 3OZYA 1SR9A 5E1QA 3AHZA 1E9IA 3VD5A 2OQHA 4JFWA 1TWSA 4CD8A 2F2HA 2YXXA 2NV1A 3ANVA 4JX4A 3H23A 3M6DA 3IV8A 3J7HA 5AC8A 5I03A 4WSHA 4L80A 1EPVA 2YYUA 3LERA 3TP4A 5A3HA 4K1WA 1GCYA 1NFBA 3OGSA 1GOMA 4H6QA 9CGTA 3CGNA 4IXHA 2OJPA 1F8MA 2HNHA 2ZRUA 3F2DA 1DWIM 2XH4A 1XH0A 1OFEA 4LPCA 4UTIA 2V3FA 3KX6A 3WNLA 1ME8A 1XYZA 1M7OA 4AISA 4US5A 1U1JA 2J7BA 3O5DA 1OT2A 4IIGA 3DERA 3L68A 1DTNA 1W9UA 2PTDA 4A3UA 1I1WA 4D1JA 2PDWA 1RAKA 2OR2A 1V0LA 3LHZA 2YBUA 2NT0A 3OOBA 3R89A 1YPXA 2J8FA 1VF8A 4JTGA 3EEZA 1XIHA 3W23A 4YN5A 3DEQA 3ABSA 2FKEA 3E38A 4UCFA 3EA2A 3BMBA 1KO0A 4ES4A 4NJHA 1LUCA 2AL2B 1VEOA 4ZODA 3BAYA 3QY7A 1Q5MA 1KBBA 3RILA 3W1TA 2Y61A 4UR8A 2X1IA 4MB1A 3T44A 3SIMA 4I5XA 4K38A 1V79A 4PRWA 5GJPA 4KQNA 4DF1A 1RH9A 4DXXA 2QUNA 1UG6A 1J5SA 1HP5A 2XP5A 1W3NA 3MO7A 2ACUA 4OWGA 2WV8A 2XVNA 1OCQA 5LGXA 4Z0SA 1WDPA 3H7VA 2IXUA 1KM6A 4KW2A 1BEUA 3MMUA 2GUBA 2QNEA 4DELA 4U5KA 3IK8A 3NO3A 4D2JA 1RD6A 4YTSA 2LKNA 1QI0A 1W3IA 1OZQA 1IGSA 4O54A 4RKAA 4NILA 1P4CA 4DUXA 5TQLA 2ISVA 2ZXDA 1PX3A 4P61A 1BWLA 3T7VA 2RJHA 3HN3A 2Z4GA 1J96A 5EMMA 2Z00A 2YIHA 1JD7A 4LFYA 3DGRA 5I98A 1US2A 2E40A 3LS9A 1TSIA 2PDUA 1D7KA 3MC5A 2BVWA 1WUFA 4PUMA 5A2BA 2EPKX 1W32A 1V5XA 3PJUA 3NM3A 3MDUA 4CN4A 1E3XA 3NQ7A 1TIMA 3M0VA 3PWIA 3H2OA 4G1NA 5KSWA 4YS1A 1SO4A 1JZ8A 1PVNA 3KBWA 4DHGA 1EPXA 3VDCA 5JBEA 2J13A 4U85A 2HPMA 3LNMA 4ZFCA 1NJJA 5G2HA 4ICNA 5C9UA 2GJRA 1Y5XA 3LPPA 3RDKA 1B4KA 4GMEA 3C3NA 1F3TA 3P5YA 4AZCA 1SMDA 2WCSA 3IAPA 2NUWA 3QM3A 1LRNA 3WMLA 2PDYA 3PFRA 5IDIA 4IGNA 1ESWA 4HZ8A 4AX6A 1GVEA 1UOZA 4QLKA 2A3LA 3TW9A 4HNOA 3NQGA 1Q6HA 1PKYA 1O6IA 1XG4A 3VM7A 4F2BA 1C9WA 3BQ5A 4P7NA 5J8LA 1UR0A 3M5XA 2FZNA 4AG0A 2GJXA 4LCRA 3GIYA 4JFUA 1TA3A 3UA3A 3AMGA 1EJXC 3H9RB 1TTQA 2J6VA 3FY1A 2IPGA 1CGUA 1VRXA 3HBLA 3VIKA 5AYXA 3UD6A 2TMDA 1KWKA 2H90A 2W63A 3P61A 4AHQA 2V2HA 2GJXB 4X0NA 3DFNA 2PDIA 1JCMP 5AY7A 4PTWA 2FGZA 3GXTA 5JIWA 4UTJA 4JTAA 4KERA 1WBHA 2QMKA 4NAFB 1JRCA 1QNOA 4ZA0A 4GBUA 1OX4A 1DOSA 4QAIA 3K4WA 3BJFA 4ALDA 1VYRA 1ITCA 4PZVA 2WO5A 5CC6A 2VURA 3V16A 2NV2A 2GUYA 2WSRA 4O17A 2ALRA 4S3KA 4JDYA 4MWAA 4I9JA 1K7XA 2VQUA 2Z0IA 5C0QA 4UTUA 3B9DA 3NL3A 1UB3A 3T0CA 1RV8A 4ZZ9A 3LPGA 3W26A 2QJHA 2PPNA 1OGSA 3C0SA 4BS0A 3SADA 1FAPA 1UJPA 1PIGA 4J3XA 1QJWA 1PIIA 3QGVA 4QEEA 1KGWA 1SW7A 2R1KA 1L6FA 1E73M 3UJ2A 1XUZA 4L6HA 4A4AA 1UP3A 4Y7EA 6A3HA 3RPDA 5HWCA 2YCLA 4KFOA 3O16A 2CXEA 3M6YA 5A6KA 3N4AA 1QNQA 3TX9A 3A3XA 1BWKA 4XTDA 2I17A 1VLIA 2I9EA 3Q2DA 3BW3A 2LLEA 5T91A 4TX0A 4IG2B 1E6SM 3W72A 3O2LA 4ZBCA 1UP2A 3U7VA 3EWZA 4DRSA 4LAVA 1FWGC 2BG5A 1LL4A 4Q4MA 3U2ZA 4Y8FA 3DI0A 1SFLA 3RNDA 2J7FA 3LLXA 1GOWA 2VUNA 2O4MA 3AHYA 3BLFA 5DXXA 1BLIA 3CU2A 3LXCA 3OG3A 1EGMA 4JQ1A 3VIPA 3VD4A 4H8NA 4D6FA 1Z42A 4IMGA 4QS6A 4JTIA 3W2MA 5C54A 1L6YA 4C6KA 1V7YA 3GG0A 1K6AA 3COTA 1RVKA 1V6VA 2WB5A 3TTQA 1SPQA 4Y9MA 5DMLA 1FKIA 2ZR5A 3DGBA 1XLGA 4HK5A 4O1DA 2VI0A 2BGSA 4D6IA 1CB7B 3KS6A 3TQPA 5AZ0A 1M41A 1TVLA 2Y89A 3KZPA 4XO7A 3VNIA 3P0WA 1D3GA 3KABA 2HNEA 3MTWA 1F05A 3WDJA 4Z1BA 4GIVA 1V6XA 5D02A 1IIGA 3TTEA 1AA1B 5EFFA 4A29A 2DVUA 2PBCA 3TTYA 1V02A 3WEZA 4XUGA 4GQGA 4Z1CA 1MW1A 3WFLA 1VJZA 4MHBA 4YCOA 1P0KA 1HKKA 2V9DA 3BOLA 2Q5AA 4J5NA 1HXVA 4AWTA 3N2BA 1AMKA 1W17A 4H7CA 4LOCA 1UJQA 4AZCB 4JFVA 3ZVHA 4HU3A 2BP1A 1SZEA 4HSHA 2Y5JA 3S47A 4N9DA 4PC8A 3GHSA 3AROA 5H8MA 3BSMA 1QHPA 1QNSA 3GFXA 2Z25A 1DBTA 3CH9A 1MQPA 3EGJA 4MNKA 4J2PA 1LP6A 2XP6A 1EQ3A 5JUVA 3W2JA 4LV9A 1Q7MA 4AD4A 4ZS6A 5LNSA 4Q8PA 1IZCA 3JU2A 1E44A 4XWUA 3EX2A 1CZ1A 2OFJA 3NI6A 1DQXA 4FF5A 1XDJA 3H2AA 4DO7A 4AF0A 1JIBA 2E67A 2HV5A 1GPFA 3KAIA 2UY4A 2NQZA 1XM3A 3PJTA 1J0IA 1W5QA 2XZ9A 4Z2KA 2VD8A 2GZXA 5ENLA 5HWJA 5AVNA 3WQ8A 1QNVA 1GNXA 1H41A 4HHHA 1OCNA 2NVDA 3AS0A 4EACA 3R25A 3P67A 1S5WA 3W38A 4DBUA 1JCXA 1DTUA 1YEYA 1AH3A 4PTVA 1F3XA 4Y90A 1R30A 1EP2A 1TR9A 1TQXA 3H7RA 3W1RA 5IBXA 4QQUA 4B5NA 2RDTA 4C6IA 1TPFA 1W1PA 2PLCA 4ZXOA 1H51A 3KCOA 3VO0A 1Q65A 4EPBC 4IXXA 4XD3A 3IGHX 2ON3A 1DJGA 1QO2A 4WX2A 2ZX7A 3QH2A 1WYIA 1PDZA 4PCPA 1YLVA 2V82A 4L4PA 2PD5A 3W7DA 3UVAA 3TJLA 4AB4A 6ALDA 3IKDA 1ONEA 3WF1A 2WANA 3HF3A 3KM8A 2YFOA 5HUOA 1M7PA 1KGXA 1US3A 5ECVA 3REQB 2EJ1A 1DJXA 1CXHA 2E9LA 4TTUA 3H70A 4RDZA 5KEZA 3GH7A 1O1HA 1O5QA 4O53A 3KL0A 2V3EA 2ACRA 8CGTA 1V3MA 1CXLA 1VPXA 3M0KA 4I7UA 3MMDA 3WNPA 1CX9A 1XLAA 1UKSA 4Y6GA 3VK5A 4JIRA 5D32A 3VM5A 2QCMA 1ALDA 2R82A 1VCVA 4HU4A 1KLYA 3NPXA 3PN8A 4MPKA 4PBEA 4XB3A 3A9BA 5F1VA 2ZVIA 1ADSA 1IV8A 3G8RA 4FF7A 3IGUA 1FRBA 4MYXA 4E3TA 3BOFA 1WKDA 3EKLA 4LRTA 1BVWA 1TJ0A 2TRSA 1QVBA 3WF0A 3SURA 3MUCA 3CZJA 2K8IA 3CB3A 1B2YA 2ZZ2A 3EB3A 5JBDA 1U5HA 1K3UA 1IGWA 4R7WA 3RGCA 2G3NA 1H7OA 4UB9A 1FUYA 4BWLA 3M1ZA 1GVSA 2EPNA 2D23A 1TQJA 5DANA 2CZEA 4ENLA 4JL1A 4C60A 1VIWA 1KRAC 1AG1O 1CGTA 1XISA 2WCAA 4U28A 1MXSA 1M5WA 2XIIA 3URAA 4O16A 1B3YA 4ZTYA 3M64A 2H9AA 3IVTA 1FCBA 3AIUA 1ONRA 3DFQA 4YYFA 4W93A 2NT1A 3XIMA 1H0IA 1RK6A 2GK1A 3NQMA 2VOMA 4TW6A 5CC3A 1JCTA 4DEFA 1B6CA 3ZT5A 5BXPA 3QMRA 3TZFA 5JH8A 4LBRA 4FEZA 2XP4A 4LAMA 4HBOA 2YB1A 2WVSA 3W1NA 2BODX 1RP9A 2CXGA 2JKPA 1TX2A 3GPKA 1G67A 4LAYA 4XX6A 3RCYA 4B5TA 3CUHA 4QS5A 3LBMA 2YDSA 2BY1A 3ZYZA 4PMNA 1A53A 2YL9A 4S2CA 1XUUA 4MUZA 1P43A 1R7OA 3CIXA 2DPEA 3HG2A 3L4YA 4I90A 4MUPA 3VXGA 3W6MA 3R8RA 2ISFA 1O1ZA 4IPPA 2JBMA 4KWUA 4RW5A 1S5TA 4RLIA 2Y85A 2XN2A 3EOLA 2X16A 4LGXA 1TG7A 3ZR4A 3PUGA 4XKMA 1XS2A 2VHLA 1XLCA 4AF0B 2H8XA 4Q7NA 1PS9A 5HNTA 4HPJA 1WX0A 2XFYA 2PGWA 4M6QA 4Q8VA 1TPUA 2POTA 2ZVRA 3PPCA 4XISA 4HU0A 4QSFA 5JMUA 4C5YA 4CEXC 4CQAA 4DUWA 3BGJA 1UD3A 1WNOA 5FOOA 1ZCCA 7ENLA 2E8ZA 3B40A 1G7UA 3CL8A 3IUHA 1PEZA 1Y5WA 4XZIA 4FNPA 1FWSA 3L5MA 5KZEA 1E6PA 4IJRA 3ANYA 2UZ9A 1A7XA 2FLIA 4FPSA 1KV8A 2J7EA 3O0KA 4B3LA 3WD1A 3LM3A 3T8LA 4LEQA 4LEFA 4AC7C 3FSUA 2CZ5A 4Q7BA 5KZDA 1E6ZA 1NVMA 2VN1A 3SFWA 3SN0A 1TWIA 3QPYA 1XGDA 4IFRA 3BWWA 3QR0A 2QJGA 2WM1A 4TYOA 3GH5A 3BCDA 1H5YA 3OBEA 1QATA 3K1DA 3Q58A 4YIWA 3F4NA 6XIAA 5LA0A 3D3FA 3ITCA 1EA0A 4RNHA 2GVLA 1VFSA 2ZICA 4JTHA 4ZXLA 3UXAA 3UGRA 1ZNNA 1LJYA 3W75A 4TMBA 3TA9A 3G6LA 1I4NA 4PTNA 3ITTA 4HCLA 1MYRA 1EP1A 3QC0A 5EB8A 5AB3A 4Q4SA 2WMGA 1EYEA 3AIVA 2DZVA 2PV2A 3RRAA 4IPLA 3HMCA 3TQ0A 2UBPC 3TNBA 3T42A 4U3CA 2MPHA 1A47A 4L9ZA 1H50A 1Y8BA 4H8HA 1GOIA 4A05A 3E2SA 3EDJA 2EULA 1IXPA 2POZA 1V6YA 2RDUA 5AC4A 2RDXA 4L9XA 5AVHA 1D7IA 4N6EA 1OK6A 4W5ZA 4HA1A 1PKNA 1O68A 5EFDA 7TAAA 2VQTA 4J7RA 1JDFA 4O18A 4NZ3A 2PPOA 1PHWA 2WMFA 3BSHA 3PS7A 2OX1A 3LCIA 3FN9A 3PRBA 3C3UA 1JVNA 3EOUA 1OD0A 2GSHA 4KWOA 1W3KA 2VX7A 4JX5A 1SFTA 5I00A 2HTMA 3OLGA 1U83A 3PZMA 1I9CB 1S39A 2OLAA 4TX6A 3ABRA 2VDIA 1S3TC 4NRSA 3NO5A 4M5PA 4H8VA 4AYGA 5CEWA 4AQLA 2ZTKA 2XH2A 3MHGA 4L6DA 3PZQA 4FHAA 3FS2A 2C14A 3G1VA 1L0PA 5E93A 3QPEA 1JDCA 3G1RA 5M03A 3O5KA 1TYGA 1QW9A 1MNZA 1NP2A 3DIPA 1GG0A 2XWDA 5CSYA 4MZ8A 1B90A 4J27A 5CBJA 2DW7A 2CBUA 3CQ0A 3O15A 1H11A 2FH6A 4RDVA 5I3JA 1QHOA 1S2CA 2ZE0A 3B0XA 1QWGA 3HFTA 4H83A 3UVIA 3MSRA 5FL0A 1FFRA 2O0TA 1OX4B 1SZGA 4QGCA 3VIOA 1XV8A 1XBYA 2X40A 1XG3A 2WZIA 5HR6A 2VRKA 3WQ4A 4GYPA 2C18A 3WIJA 1EP3A 3RR1A 5TNVA 3NUKA 4ZTXA 1R85A 2ZYFA 3O1NA 1O66A 3H2MA 3S6TA 2Q8ZA 1RA0A 1Z44A 2CLFA 3GU0A 3QHOA 5FJOA 3JZUA 2O7SA 7REQA 3U7BA 3VDGA 1OIMA 4Q32A 3FK4A 3AS2A 4JFSA 1O12A 1QHZA 3TMLA 4XKYA 4PMJA 3BPWA 1YTEA 4AMAA 5FJPA 1ZJAA 2GOKA 4B92A 3DOPA 3CUGA 3VX1A 3FJNA 1N8IA 1JCHB 1LOLA 1A5KC 1GTHA 4PB3A 2VFFA 4RV3A 3IVUA 3O5LA 1E40A 4G56A 3C0LA 4WOQA 1ZAJA 3VFLA 1N8FA 5JH1A 5CSSA 3CASA 4L1WA 4MZ1A 1PHQA 3TAOA 4DWSD 2INZA 1E4NA 4RZ6A 1S2WA 3THCA 1U5JA 1Q85A 3SRFA 4H00A 4WY0B 1F4AA 4HIBA 3ITVA 3W7GA 2Z6IA 1VEMA 1P0BA 1YATA 5HW8A 4TVDA 1GKQA 4CGTA 2W6RA 3BH4A 4ZE4A 3PTKA 5AYZA 3E49A 3W7OA 4AHPA 3NTYA 3DG6A 3ZQ9A 1Q1CA 1ICPA 3WZ0E 4U33A 4B4HA 1YIXA 1YW1A 3LHWA 4N9BA 4DYJA 2WSKA 2X1RA 3UXIA 1BSIA 4OVXA 5I06A 4B91A 2E0PA 4HNCA 4L61A 5D30A 4FNTA 1AW2A 1R3WA 2Y70A 3VOIA 2OKTA 2QJNA 1M65A 1MW3A 2PDMA 1RPKA 1YXYA 4E8DA 3KCLA 1KA9F 3P7YA 4DM1A 1SZRA 4LS0A 3UT0A 3THDA 3N04A 3FHQA 5BOFA 2VXNA 1V51A 3QY6A 3G0XA 1F6YA 5A6AA 2XIMA 3MMWA 3QTGA 2P50A 3C8FA 4IUGA 4UFKA 2NX9A 3QPZA 1TVNA 1V93A 4CCDA 1UC5A 3F1QA 1AW5A 2YPIA 4UNLA 1EL3A 3RIKA 3ZZ1A 5HAOA 3GC4A 1VR6A 1GZGA 3W7EA 4FI4A 4S3DA 2E9MA 2PV1A 1Z9AA 4W88A 4ZSUA 3G6MA 2BXZA 3DH7A 1XRVA 1YADA 4D9PA 3MI6A 4E2OA 3UG4A 1JL8A 3NGJA 5I7GA 2DDXA 1JGMA 4MKSA 3FJ6A 3SQLA 1MEIA 2MLXA 3KXQA 2DT1A 1J2WA 2W61A 2CU0A 2VGGA 2J47A 1GQKA 3M41A 1XYBA 5LHFA 4XZNX 4L6OA 1VCGA 1O95A 4HPXA 1V3JA 3IJ9A 2ZRYA 3IEBA 4TU1A 3TDFA 1YHTA 3A64A 3SCUA 3M16A 3LGDA 4DAFA 3QEZA 2PDXA 1Q13A 3OU8A 5ABGA 2Z26A 2AQOA 4AZ6A 1FKGA 4W5UA 2D20A 1TFVA 3C2OA 3H2FA 3DKJA 1LCOA 4W7UA 1UD2A 1D2KA 1CLXA 2Y8KA 1GEHA 4P5UA 4NAEA 3JVAA 1BKHA 3QRHA 3GUGA 2PRHA 2WBKA 2X1SA 2YL5A 3BL3A 5T8GA 4A6GA 3VCCA 2WZTA 1NWUA 3NA8A 3AS1A 2IKGA 5BWFA 2CLMA 5CQ1A 3GXIA 4LAUA 1QOPA 1C8XA 3LXBA 1FKJA 3W7KA 5BZAA 1Z69A 3LCLA 2Y78A 3B8DA 2L5HA 1XC4A 4Q8UA 4MZYA 1OZMA 1EZ2A 2XPAA 2WVVA 3CPUA 2ACSA 2OGJA 4ZL1A 4QJ1A 4AMCA 2ZTJA 2E6DA 1NFPA 1PKLA 5HDRA 2ZBTA 1DE6A 2MLYA 3JS3A 1CGWA 2HE5A 3A3WA 2DZWA 2HK1A 1SFSA 4JN8A 4V33A 4MDOA 4RE3A 3WH0A 3TYDA 3EWWA 2TYSA 3CQIA 4QE4A 3FV9A 3AWNA 4HARA 4UR9A 2QCNA 1FKFA 3NDOA 1F3WA 3NRKA 1KTNA 4NJIA 3ES8A 3AHVA 1JZ5A 1ODZA 3PTMA 4ADSA 1Q6IA 4XZMX 1MRQA 5D2VA 5LSMA 4V27A 5DEZA 3VNYA 1ZHAA 1QPRA 1DXEA 4PR4A 1LL6A 1XLKA 2GSEA 2FTWA 3OLIA 3O9NA 3JYMA 5GNYA 2CITA 2EPOA 2QT3A 2G96A 5DF0A 2OO0A 4WXZA 4V1XA 4B90A 1P0EA 3GDTA 4GYJA 2QDDA 4CCCA 2ZX8A 2WVUA 5J04A 5DO8A 1IHIA 2JF6A 4JQ3A 3H55A 2IKHA 4BWLC 1RQBA 2IS7A 4RNIA 1KXTA 2V69A 2FTYA 1UUQA 3PSVA 1HL8A 4I3GA 4KEZA 1HQTA 2PWGA 1YPFA 3NSNA 4ODRA 3WLTA 1E6RA 4GO9A 3V4BA 3W9ZA 1FD9A 4BA0A 2QDHA 1XSIA 3RX4A 3KOWA 3TN4A 1D3CA 4M82A 2HJPA 4WZHA 4WDTA 3BGAA 4KIEA 5JQ9A 1KCLA 1WKYA 4D6JA 4PMDA 3TLQA 2IXVA 4O28A 2FGLA 4LCQA 3PZTA 3VOFA 4DI9A 2Z6JA 1G7VA 1HFBA 2D9FA 3N4FA 4LT9A 3DCPA 3S5SA 2JGYA 4A3QA 4B5XA 4IJBA 3FVMA 3TSMA 3CV7A 3N6QA 3PZNA 1UD6A 3V1HA 2P8CA 3W6LA 1QNPA 3AIWA 4FX6M 1CXFA 1ODUA 5FF3A 1FXPA 1H0GA 1UR4A 3PR9A 3QTPA 5F2IA 1C9HA 1G6CA 1DJZA 3W74A 4LVBA 3HOJA 5REQB 4NZJA 4NNBA 3HTWA 1MXDA 4X9SA 2OLSA 2PTXA 4GKLA 2PCEA 2VZVA 4EANA 3VPLA 4DRPA 2VDHA 4QDMA 3ZR5A 1B0IA 4JR5A 2F21A 3HV8A 2E6YA 2JF7A 3KADA 5CXPA 1LWJA 1R46A 1VS1A 1BKSA 1TE6A 4MWAE 1W31A 4GIYA 1V6TA 4PBFA 2DH2A 4X22A 2W27A 5DIVA 2PDGA 1ISYA 4JD4A 2EG8A 4LAOA 2DW6A 5IOBA 3LQGA 3R2GA 5C9XA 4O12A 3LHYA 1XRTA 4NYYA 1B9BA 4CD4A 3C2RA 3DENA 3LU2A 3V18A 4FX8A 3WYZA 1W56A 4AUBA 2TPSA 4M51A 3E0IA 2D69A 5IFPA 4PMXA 2WSQA 1W3TA 3NPVA 4JFTA 1J0ZA 1UH2A 1DV7A 5FI8A 1FWIC 4NZ4A 1WV2A 1XDMA 3INPA 4IP5A 1B3OA 4TO8A 1J6YA 2YL8A 2QV5A 3L0KA 4RNJA 4HKPA 4M7SA 3TIMA 2XYLA 1EJRC 2J24A 4IT1A 4DLMA 4NKCA 4KPLA 3UJEA 4JL2A 2BZNA 3GHRA 3MJYA 3AMDA 2C0AA 3N3TA 4QSHA 2OOGA 2IKIA 1TPEA 1OG6A 1P0NA 4O1CA 3G1AA 3IRSA 3WK2A 3RN6A 3PBMA 4A2SA 2VMFA 3HPFA 4GYPC 1IQ8A 4UOJA 4DJDC 4UFJA 1A5MC 2Q02A 1LL7A 5FKYA 5KZMA 2ZCGA 4LVFA 1MEWA 3G3MA 3L23A 3IIZA 3LV5A 1XKYA 3APTA 1H60A 4PL2A 5D8WA 3N13A 4A3RA 4OUIA 4A3YA 2QPUA 5F4SA 4DF0A 4L9YA 1PDYA 3PFMA 4G7EB 1NAL1 3B0PA 3OZMA 5G1YA 4UOQA 4QIUA 4ILSA 1XICA 4G8TA 1UH3A 4PODA 3IVSA 4PTXA 2VC9A 3VKBA 1DIOA 2E6AA 3CWOX 4S3AA 1F61A 3IHZA 1ZCOA 2Z24A 1UR9A 2ZUUA 2WKJA 3EB4A 3YPIA 1X7FA 1KB3A 2XN0A 1E5NA 3ZVIA 3K8LA 2ZR4A 4Z2JA 2GQAA 3KRZA 4UTTA 5GNZA 1R3TA 2JEQA 4Z17A 3Q65A 1YYAA 3L5LA 4GY7A 3S2NA 3R94A 1NY1A 3GSMA 2QEZA 3C2FA 3W37A 2EO7A 2X2YA 3AMLA 2WW5A 4CNNA 2WOQA 1FP8A 3BW2A 3RGTA 5T9BG 3MU7A 3RFWA 3MKVA 2Z27A 4PMUA 2CKRA 4IG2A 4GPNA 1E9LA 2QDEA 2G5WA 1TJPA 3GG1A 2YDQA 5A8NA 5CJ5A 4IL2A 3A21A 3WF2A 3ZLHA 1B5TA 4J9JA 2JALA 2YCLB 2R1LA 3WKZA 3QBUA 1N55A 5M1TA 2ZUWA 4XV0A 2W62A 4H9UA 3PUEA 5G4WA 4AWEA 1W8SA 3W0KA 1MZHA 3VD7A 5A2CA 1KFKA 1J12A 3KTSA 4PFHA 1G1YA 3VNLA 1EWEA 1Z32X 1HUVA 1FWDC 3G3DA 2V3DA 3V3WA 2ZOXA 2E4TA 3A4AA 1U22A 3W29A 5HINA 3W76A 3FKKA 3GDRA 5HWMA 5C70A 2HROA 3H8AA 3HU7A 3MUY1 1JFHA 2WQPA 2FTPA 2PS2A 3F2CA 2B5UB 1E6QM 1TV3A 2OWWA 4UUIA 1JAKA 3WK3A 4R53A 3GVRA 4N42A 4UWMA 4FMVA 3SR7A 2DSZA 4CNSA 2OZ3A 3UYCA 3U4FA 1C8YA 2GQ9A 2VZTA 3CK5A 4IMCA 4NL1A 4MWAC 3KFTA 5BXJA 1QPQA 9XIMA 3GTHA 4IJCA 2DT2A 4HMDA 1VLWA 4JEJA 3QR1A 2Z1VA 4AHOA 1K77A 4IFKA 3RXZA 4ITZA 3UQNA 3VDBA 3I3DA 3W73A 3P62A 3S46A 1VP5A 4ZCWA 3G0UA 5CSUA 5E9AA 5I3GA 3LBOA 2J74A 3CMGA 1QMLA 4XZWA 5KINA 1ECEA 5C7VA 5EL1A 4FN2A 3MWAA 1ROTA 5HA7A 2AKZA 2EKGA 3OGVA 1R9ZA 1RCXB 3BVJA 1VBJA 9XIAA 3DAQA 4QZVB 2HBVA 1F74A 2Z1WA 5TD4A 4XKYB 4QBXA 2PTWA 3RM9A 2BVYA 2OZ8A 1UWRA 2WVTA 3PPHA 1VHNA 4H6RA 1BG4A 4HPNA 4Z08A 3R8GA 1K70A 1Q6LA 1TO3A 4D6DA 4IX2A 1QCWA 2Y5SA 3HG3A 5BRBA 2ESCA 2XHYA 3LQLA 4LH8A 4JFKA 2XP9A 3N2XA 5AHIA 4KCVA 3VIHA 3ME3A 4C6MA 4JKKA 4XQ6A 1C9DA 3F4CA 1SW3A 1PTDA 2YBTA 3RYSA 1SYTA 1A0DA 1MUMA 2W9MA 2DH3A 3SQMA 4BF5A 4MVAA 4U5IA 5LIYX 1BVZA 3VOGA 2P0OA 2NQ5A 1GZJA 5CGTA 4PUEA 3BDKA 3L4UA 4GI8A 4ML9A 1ENUA 1TV8A 3I6EA 3BQ6A 3W1QA 1A5CA 4CD7A 4EIVA 4ORMA 3SY1A 1XBZA 3C6CA 2XISA 4H6EA 4DQWA 3GNOA 3LPFA 1AMYA 3A4JA 3UY7A 3UCCA 1H4PA 4AD1A 2ICSA 3QHMA 4JY9A 1T8XA 3CV2A 4UFMA 4LYQA 4W84A 4O52A 4KCTA 3CTTA 2Y2WA 5LA2A 3ID7A 2QIWA 2DG3A 3LMYA 1X98A 4FALA 1EYWA 1B3WA 4GIAA 3K8MA 4Z2HA 5BMXA 3HJEA 5H2ZA 4O50A 3WDRA 4HNVA 4EK7A 5HTGA 2WHKA 1UKPA 5HMSA 3ATZA 3QYSA 4XK2A 3VOJA 3CUFA 3BJTA 4DUOA 2XDFA 4CUCA 2ALDA 2GL5A 3GG8A 4GNVA 3KZ7A 3B0VC 3VZZA 2G8ZA 3FA3A 4E4FA 3L5AA 1CENA 4WLCA 2ZXBA 4ACYA 3O5EA 2OQLA 3EWCA 3UG3A 1QK0A 4QJ3B 2Q01A 3CTLA 1C7TA 4LXFA 4UTMA 1JI2A 1EXBA 3NOEA 3ZM8A 3UZJA 1WAUA 2JK2A 5D2WA 4WDWA 1KKRA 3F7JA 4XAPA 1D8CA 3O5PA 3W1XA 1DQUA 1UD8A 5E70A 1ONWA 2QGHA 2IF4A 1FKWA 1KNWA 1WAWA 1K9FA 4HOWA 2YLAA 3IRDA 4E5TA 4FA3A 4WQ6A 4BF8A 2PRLA 3KRBA 3WMBA 3WDPP 2PDCA 4HNLA 1VKFA 4OGZA 1HVQA 2ONEA 1DHPA 1CLVA 1XW8A 4ADTA 4M24A 2E8YA 3L2MA 4F0KA 1E1CB 3UQIA 2R6OA 4F2TA 1FQ0A 4TV6A 4ZENA 2G0WA 2QLYA 4W7VA 3FYOA 1M03A 4KGLA 2WJDA 3OIXA 2JIWA 5LIUX 1WZKA 4MY9A 3C2YA 2OLHA 3AXMA 4RCXA 1VHCA 1U30A 2LJ4A 3F4VA 1PYFA 1N7KA 2CFFA 2AMXA 1AJ2A 4C6QA 4MIMA 3GNPA 2WSYA 4GK8A 3H2EA 1V0KA 3M46A 4NAFA 3W24A 4LYPA 3ARPA 3QF0A 3WUBA 4JHOA 4X3ZA 4FX7A 3WL0A 3SO7A 1M01A 1CEOA 4ML4A 4ACZB 3PNZA 3VIJA 1DIEA 3W27A 2VCAA 4ZQPA 3CH0A 3W00A 3W53A 3AXIA 1Q6RA 2O55A 2ZUVA 4JS3A 3NQAA 2YBVA 2OEKA 4I9AA 1KFLA 2O9RA 3HZ3A 5XIMA 3N12A 1A4MA 2HPIA 2V68A 2X1TA 3MJMA 3IJQA 5E0FA 1GVQA 5HNNA 5IRPA 2FVMA 5TIMA 1RQHA 3SBFA 4YWSA 1E70M 1E51A 2O9OA 1R87A 4A2RA 2BSLA 4NZFA 3L4XA 4D8AA 3UXDA 4HZ6A 4UQCA 1K4HA 2R8WA 3VD9A 3PTDA 5JIPA 1RA5A 3UPMA 5KTLA 1TB3A 1Q7QA 5A6BD 3AISA 3NXFA 1B4EA 3S0CA 2M08A 1E71M 2A7PA 5TF0A 3I4KA 4ZQCA 4MGGA 4OECA 4ERIA 4UOZA 4AEOA 4GY0A 2PODA 3WLOA 2XUCA 4CN6A 1SFJA 3TU9A 1OB0A 3OVPA 4JDBA 1NH6A 1Q66A 3ZJ8A 2PF8A 4ZOEA 2P3ZA 3WL1A 1WP6A 3M5VA 3PR2A 4GC4A 3FGCA 3NSMA 3WQFA 1L2UA 4RDYA 5I5RA 4W7WA 3N6HA 1DXIA 4KH2A 4DBDA 4FNUA 1G01A 5DELA 1KTCA 4IX0A 3XINA 3KDNA 4JTCA 2WNZA 1T96A 1EDQA 3LHUA 4GJIA 5FAJA 4L4OA 5JXQA 2WQDA 1POKA 2OU4A 3P2VA 1LBFA 3WLJA 4K8HA 1XIEA 2CC0A 1F8AB 1IEIA 4Z0JA 3JW7A 4IICA 4BI5A 2GSJA 1FA2A 2WNNA 4LAWA 3Q67A 5FEPA 3O5RA 3NYZA 4RL3A 3WD2A 2XWEA 4MTVA 2MNTA 4KIRA 1LQ0A 2OZTA 3U3HA 2N87A 4GQRA 2WXDM 3WBEA 4ZOCA 1AZ1A 3GWQA 4AZ5A 3H4WA 4BQ5A 5AOUA 2JZVA 4XIAA 2NSOA 5HJYA 4JTQA 1HN1A 2CHRA 2BHUA 3N9SA 1C91A 4LTSA 1UR8A 4BQ4A 2Y8UA 4WHBA 4A3HA 3CT2A 3IUDA 4RJEA 2A5HA 4BK9A 3OBKA 3WO8A 3G0SA 1VGAA 2QJJA 3P93A 1TREA 4ONVA 2GOUA 1AL7A 4ZR8A 3T9PA 2ZDSA 1PZ0A 4Z1DA 1FTXA 2A7RA 4KF1A 5D04C 4G6CA 2J79A 3TA6A 4RZ4A 4O11A 3REQA 4WIWA 1BVNP 3MP4A 4MFDA 4B4FA 4H8UA 5A69A 5AYYA 3TAKA 2W91A 1V03A 2DUAA 1VENA 3NL2A 1PCKA 3ALGA 5DY3A 2C1GA 1Z7AA 1W9XA 4LAKA 3CUIA 3BG9A 1RHCA 4M8UA 1REQA 5HMFA 1NQ6A 1W5MA 5KITA 3M47A 3ANUA 4EPKA 1R38A 2GQ3A 1CXKA 2ADAA 3T0TA 3BO9A 3LTPA 3GBDA 3W7MA 1LLZA 3MBFA 1NWSA 1DWAM 2O7QA 3USBA 3LLFA 2WWCA 1JJKA 3WNNA 1Q2SA 2WAGA 3CIVA 3IGXA 3BAJA 1CWYA 3UYIA 2IQTA 5ABHA 3UJFA 1EDTA 3AIEA 1FFQA 4O13A 3WJWA 4P8VA 4HN8A 4N0RA 4J28A 1PTGA 3AUJA 1XPYA 4O14A 5D8ZA