1LG1A

Crystal structure of human chitotriosidase in complex with chitobiose
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
365
structure length
365
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chitotriosidase
publication title Structure of Human Chitotriosidase. Implications for Specific Inhibitor Design and Function of Mammalian Chitinase-Like Lectins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 114
structure length 365
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1lg1A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1lg1A01
1Q6FA 2XWEA 1UZ4A 4B9YA 1XYZA 1UHVA 1JXKA 1DWFM 4U5KA 3A4XA 1YHTA 4NRRA 3PZ9A 4F9DA 4DUXA 1OSEA 1E5JA 5FOOA 1FH9A 1JI1A 3UG4A 5GPRA 1BLIA 4PYSA 2QLYA 1EOKA 2YBUA 3WUFA 3M7SA 2XGIA 5HXMA 4PMRA 4LXFA 5E70A 2G3IA 5IXEA 1DEDA 2GSJA 1G94A 3WKZA 2XHYA 3K8MA 4WSJA 4Q7NA 5BRPA 2QHAA 2QV4A 5E0FA 4DWSB 4XX6A 1OIFA 3QHMA 1V6VA 3AFBA 2NW0A 4UQ9A 4BQ5A 3DC0A 1W32A 1LWHA 2PWFA 4Z2HA 2G3MA 2VCBA 3BAYA 2EQDA 7A3HA 1WDRA 4CVUA 1E1EA 1VFOA 1UR2A 1UWUA 1H4PA 4H8HA 3UETA 3W26A 5EBAA 4OBRA 1VFFA 4ATLA 4GI9A 4ACYA 1UKTA 1WDQA 1V02E 4AC1X 4Z2JA 2VZUA 1US2A 2VX4A 4BA0A 1QVBA 3WH7A 3BGAA 1GW1A 3GXIA 4DUWA 5IHSA 4IISA 2GJRA 2B31A 3KWXA 2WC4A 1I1XA 4HZ8A 5ABEA 2DIEA 2JIEA 1W9XA 1VB9A 1VFMA 5A6KA 1KCKA 1WE5A 3AI0A 1E6PA 3AZRA 1W9DM 4GZIA 3AIVA 3UG3A 4UNIA 3DHPA 1E56A 1EDTA 2J7DA 3GBDA 1B3ZA 2NSXA 4V28A 1JZ7A 4ZE4A 1XCXA 4BQ4A 3RCNA 2QF8A 3L2MA 3T2QA 2BVDA 1H5VA 4W8AA 1QNSA 4JCMA 2D3NA 1GHRA 2ZXBA 2O9OA 5ECUA 4X0VA 3AXXA 5AYIA 3LPOA 3GH4A 1UQZA 2WVSA 5GNYA 3FHAA 2EPNA 3OLGA 2DT2A 1CIUA 3WF3A 1KGXA 2ZUTA 4U33A 4UOJA 4GI8A 5ABHA 2DSKA 3A4WA 1HJUA 4JL1A 2J8GA 4P8XA 1NOWA 2J62A 4H41A 2WMHA 5I3DA 3GNPA 1BYDA 3SUTA 1HJVA 5AY7A 4TTGA 3GDBA 4AD0A 2JIWA 3WDRA 2FHCA 3GXFA 4CD6A 2YLLA 3VPLA 4UOZA 3T2OA 1E0XA 4ACZA 1V3KA 4QCFA 1XRVA 3NDZA 4GXPA 2XWDA 1XD1A 1B0IA 3AIEA 4F9JA 4JFVA 4C7GA 3T2PA 2XM2A 2E8YA 3L4YA 2AAAA 4CU8A 3ARTA 4RE2A 3AS3A 2CNCA 1H0GA 2VR4A 2EPMX 4MNMA 3L4XA 1QI5A 3PZVA 2J75A 3JUGA 1F4HA 1IV8A 1BSIA 1UUQA 3DYMA 3OGSA 1BPLB 1J0ZA 5I5RA 3ZO9A 2JFEX 3SIMA 3PZQA 1L0PA 3VGFA 1JZ4A 3K4DA 3K1DA 1BG9A 5D8ZA 3VNZA 3AHZA 2WZIA 2WHKA 3ZR6A 1PBGA 3WNOA 4MB3A 4XB3A 4D1IA 3ZQ9A 4U31A 2YKKA 2AOSA 2WVVA 2VUYA 4KH2A 5M3WA 1VEOA 2O9TA 4M56A 2VZOA 1QOXA 3WD0A 1EGZA 4GINA 1UR0A 4CVWA 3FAXA 1CYGA 2GFTA 4U2ZA 3BMVA 4NRSA 4AEFA 2C0HA 4LPCA 1BG4A 3KE0A 1U30A 4R5EA 7TAAA 4E4PA 1C7TA 4LYRA 3DECA 2O9RA 3RIKA 1NARA 5CQ1A 1VBRA 2WBGA 4W87A 1NOUA 4CD5A 3WUEA 3TOPA 1RD6A 1D2KA 1VF8A 4OOZA 2WANA 1FOBA 2EJ1A 5I24A 1GJUA 5I23A 3N17A 3VVGA 1FHDA 3CLWA 1JZ5A 1JZ3A 1MW0A 2CKSA 2GVYA 2O92A 4JZ5A 5EMYA 3VIGA 3QR3A 2OSWA 2BY0A 4JIEA 1KQYA 1V6XA 4Q22A 1Q6EA 4NI3A 1BAGA 1UH3A 4MNJA 2WCGA 4LYPA 3WMSA 2OYKA 1KGWA 1MVYA 1MQPA 1E6ZA 5EB8A 4YPJA 1GNXA 3QOKA 3LPFA 2IXUA 4E2OA 1JYNA 3CIVA 4U5IA 4Z2LA 2CCRA 1DHKA 5BXTA 4TX6A 1DWAM 4PEEA 1JYWA 1J0KA 4P7OA 4TUFA 2PWEA 4WLCA 2BVYA 4QLLA 1ZBVA 4ZFMA 3WENA 3WH9A 3WF4A 1IT0A 1EOMA 3UESA 3W27A 1E4NA 5A6SA 2D23A 2EPKX 1VEPA 3RJXA 1H49A 1KR0A 3EMQA 1CLXA 1E6NA 3SCOA 1GQKA 5BROA 5M5DA 1KWKA 3HMCA 1W9PA 2UWFA 1EDQA 2YIHA 1GONA 4HOZA 3F5JA 2W67A 3MUY1 3EYPA 3MSGA 3VD7A 1KCLA 2Z1SA 1XHGA 1W9BM 2GDUA 3AIBA 1TVNA 3ARUA 3ECQA 2A3BA 1UD2A 3VINA 5A69A 1GOIA 5F7UA 2C8NA 4CU7A 3SUVA 1B31A 3W4RA 3W24A 5TD4A 2XM1A 4LQ1A 4KWUA 1R7AA 1JNEA 3SCTA 2W62A 1KR1A 1XH2A 3K46A 1EQCA 1E4MM 5BYWA 1WZKA 3SUSA 3VD9A 2VR5A 1Q6DA 1JDCA 1QNOA 1WDPA 4JKLA 5A2AA 2WMJA 4OZOA 1EO5A 2J74A 3WUBA 1GOOA 1OGSA 2WMFA 1D3CA 4FMVA 1PEZA 2ZX5A 1UR8A 3W6LA 3BCFA 4PTMA 1TVPA 1JI2A 1KXTA 4UTFA 1UA7A 3UG5A 1KBKA 3VGGA 2O9PA 4AISA 3KZSA 1LQ0A 3VILA 5HPCA 3EDDA 3F5LA 1C91A 1DWIM 1V3LA 1QPKA 4U3AA 3GM8A 2DT1A 4QFUA 4GQQA 1E6XM 1LG2A 3WD1A 1XGZA 1J11A 1B3VA 1PX8A 2RGMA 3VIPA 1B3YA 3MUZ1 3VM5A 3B8SA 1NOFA 1LL6A 4CU6A 2VQTA 1WNOA 1J0YA 1W2PA 5CPTA 2CBIA 1BYCA 3FNDA 4AEEA 5ABGA 4C7FA 5KZ6A 4JL2A 5A2CA 4XUYA 4TOQA 2VVNA 3AIQA 3ARVA 3AZSA 3KL5A 3VGBA 2VX7A 3EBVA 4KRUA 3VD3A 3KL0A 4FLSA 3VM7A 3NUKA 3PHAA 2BY1A 2C7FA 2BY2A 3VIMA 1W9UA 1DWJM 2J79A 3AMCA 2EBNA 3M6DA 1ISYA 1CPUA 3T0AA 3WH5A 1JAKA 2VURA 3K8LA 1RH9A 1ESWA 3L2LA 2VL4A 3PTQA 3WN6A 3FN9A 4UQAA 4MB1A 4EANA 2Y5EA 1FH7A 2Y2WA 1J10A 4J3VA 1RP8A 3I3BA 2YLAA 2GK1B 1V0MA 2WPGA 3MV01 1HP5A 3RPMA 3MMWA 2J7EA 4FF5A 4HZ7A 1UWSA 4EK7A 3NDYA 4MB5A 4HU0A 4W5ZA 2XFFA 3G6MA 2WSKA 3L4WA 1XD0A 1HF6A 2PWGA 3AXHA 5A6LA 1HKKA 2CBUA 1P6WA 1M01A 4Z2IA 4AYSA 3A6OA 1WDSA 4HPGA 1CXFA 1O6IA 2YJQA 4M29A 2YA0A 2JALA 1SFSA 3CUHA 1E71M 3AIUA 1J18A 2DSZA 2X0YA 5D9PA 1UWTA 1CECA 2QPSA 3VOCA 5DT7A 2CYGA 1J0HA 2VMFA 4W8LA 5CLWA 3AZTA 3AMKA 1UR1A 2UY5A 4H2CA 4PMDA 2GJXA 4F79A 2ZWZA 4P8VA 2WMKA 3PZGA 4WJXA 5FIPA 3MS8A 4XV0A 1GOKA 1UKPA 1HKJA 4D1JA 2DEPA 1JFXA 2D1ZA 1G5AA 4AXNA 3CPUA 4X0NA 2ZOXA 1B30A 3WL1A 4ATWA 3VDAA 1GORA 5CPQA 1LWJA 5JUVA 3W25A 5C8BB 2CHNA 2W4XA 4NF7A 4TVUA 3VUPA 1TA3A 1I75A 5A6JA 4WK9A 1CENA 1EXPA 1TUXA 3TTQA 4UQBA 5ABFB 1KXHA 2FH8A 1E6RA 1ISVA 1EHAA 4MDPA 4N42A 1QI3A 4HP5A 3B9EA 1MQQA 2XIBA 1W3HA 4U2YA 5HBFA 3NCOA 1MXGA 2QPUA 1FP8A 2JE8A 1ITCA 2G3NA 2WAGA 1C3FA 3PN8A 1AVAA 2WWCA 2ZUNA 1QBBA 4CGTA 4V2XA 1JF5A 1VEMA 2DH2A 4M81A 1PZ3A 3CGTA 3CUFA 3W29A 2CBJA 3WNKA 3SURA 3WQ8A 1PIGA 1NP2A 3PZIA 1EH9A 4GQRA 4EAMA 2OYMA 2F2HA 1B3XA 4AD1A 2VCCA 3ZSTA 2ZWYA 3L4ZA 4DM2A 1UD6A 2FH6A 2FGZA 4UZUA 2AMGA 4TVCA 3SCUA 4HA3A 1UD4A 3OB8A 2J7FA 2XFYA 2CIPA 1W1TA 3IJ8A 2WMGA 5CSUA 3MUIA 2ZE0A 2BY3A 2WW5A 3VIKA 1HVXA 2V5DA 5A6BA 4UR9A 2A3CA 2J7HA 8A3HA 1UZ1A 1FH8A 1H3GA 1YQ2A 2OWCA 1QI4A 4TVDA 1PZ2A 1WPCA 1ZL1A 4L4OA 1R7OA 1FFRA 2V3GA 2W91A 2A3HA 3BAWA 2BNJA 1ISZA 1R8LA 1L8NA 5JBFA 1M7XA 1JAEA 3CZLA 1WZAA 3BLKA 3OLDA 1E3ZA 4AIOA 2PI6A 4NSBA 1E4IA 2FGLA 5EFFA 4ZE5A 1XSJA 2VT0A 4AWEA 3N04A 3VX0A 4QLJA 1AQMA 5I0DA 4TX8A 4FLOA 3WNNA 3VDBA 1VFUA 1OD8A 1FA2A 2WCAA 2XTKA 1GOQA 3NIYA 2WK2A 3WD4A 1U33A 5JH8A 3D3AA 5BRQA 2OWWA 1X6NA 1OINA 1MYRA 2Y4SA 3EDEA 2CESA 1GJWA 1IZKA 3AROA 1E1FA 2E8ZA 1V3HA 2JEQA 2JEPA 4AD4A 2QMJA 2UY4A 1VRXA 3U5UA 4M82A 3CZEA 3T0BA 5A3HA 5C70A 2G41A 4W7WA 3WY1A 2E9BA 4YHEA 3PZTA 2WHJA 4WKFA 1JYXA 4W93A 3ALFA 5GQBA 4QCEA 1E4LA 2PWHA 4Z2GA 3AMLA 4W88A 4BQ2A 4PSPA 4WSKA 1EHNA 2E9MA 3GNRA 1ZJBA 4D6IA 5JBEA 1QHPA 2DIJA 1C93A 4KGJA 4HU8A 4E8CA 3T0DA 3BAKA 1J0IA 3SCRA 1JZ6A 3CHCA 1GOMA 4J3SA 3WQWA 2RGLA 2DGAA 3WQ6A 1JL8A 1KBBA 1I1WA 2WMIA 2VZTA 1ZBWA 1C92A 2DT0A 4NZCA 4M8UA 1MQRA 4M1RA 2CEQA 4UZSA 4BCEA 1UA3A 1ODUA 4GIAA 3EMZA 3N12A 1KXQA 4PCSA 1GHSA 5IDIA 1UH2A 5CGMA 4B15A 2OSXA 2ZXQA 2CITA 3U57A 4AZCB 4LGXA 1J12A 1Q6GA 3VDHA 1BGGA 3RO8A 1V08A 7CGTA 3ZJ8A 4U3CA 1RPKA 3CZKA 3IAQA 1HL9A 1UQYA 3CUIA 3HJEA 4OKDA 2E4TA 3POCA 4PMUA 4HA4A 1LJYA 5A1AA 4J28A 3LMYA 3AS1A 3SUWA 1TMQA 2XGBA 1C8QA 2W66A 1CGTA 1UG6A 3KL3A 2ZX9A 3PZMA 4GO9A 4E8DA 1QNRA 2E40A 1XH0A 2WZEA 1QBAA 1UR9A 1JNDA 1E3XA 2VQUA 2D20A 1SYTA 4AIUA 1V6UA 2OLHA 3AHYA 2D2OA 3AMDA 3OLEA 1QNQA 2BVTA 3NSXA 4M80A 1HX0A 1K9EA 2YL8A 2ZUVA 1Y7VA 3WDHA 1XH1A 2MANA 3VMOA 3W82A 1SR0A 3WH6A 3M07A 2WKLA 4AZIA 3W81A 1OWQA 4B3KA 4J3WA 4MNKA 4DWSA 4PMNA 2HVMA 4Z2KA 4RE3A 2ESCA 4CN1A 4Y7EA 3AHVA 3AYSA 1NQ6A 1XC6A 3UEQA 3ARQA 4AZBA 2E0PA 3SCVA 5HOSA 4PMQA 2J4GA 3WNLA 1XYFA 2VRQA 2VRJA 2X0HA 1VAHA 4P8UA 2BHZA 1FP9A 1E55A 1DWGM 5D8WA 3DYPA 1HXJA 2OYLA 3ARRA 3ARWA 1OD0A 4AZ5A 2WHLA 1BYAA 3KEHA 4PMYA 5DF0A 3WD2A 3NJ3A 4UCFA 2D0GA 5DFAA 2EXOA 4IM4A 1GVIA 4MADA 2WM0A 3EDFA 1MW3A 4PTWA 1B2YA 4PCTA 3NSMA 2CETA 3QHNA 1W1PA 1JXJA 3IANA 2XPKA 3RM9A 1JDDA 3GH7A 1Q4NX 2F61A 4KGLA 2WBKA 4W8BA 2YA1A 3WMBA 3POHA 2X8RA 1WZMA 3HU7A 4QAWA 3SCWA 1CTNA 4UFLA 5A94A 3ZSSA 1NWSA 1H0IA 3CH9A 1S46A 1VJZA 5CLTA 4KMQA 1OM0A 3S6TA 1WZLA 3A47A 4ZXLA 1H2JA 4WF7A 1A47A 2ZUWA 4J3UA 5FCZA 3ZJ6A 3ARZA 4OJYA 4MTVA 3RILA 1E70M 5DT5A 1M04A 4W89A 5CSYA 1CXLA 1BTCA 5A6AA 1WB0A 3B9AA 1VIWA 3RM4A 5HNNA 1EA9C 3MUAA 2YL6A 3CO4A 2W61A 2XIIA 3WMCA 2PBGA 1TG7A 4CUCA 1GQJA 5JIPA 1X6LA 2DSWA 3WDQA 3WF2A 3D5HA 1CGWA 1OT2A 1V0NA 1CDGA 4CD8A 1BFNA 4UFMA 4BS0A 3S2CA 3K8KA 2YBTA 3BC9A 1V3JA 3BH4A 4PMXA 3ZR5A 1UR4A 3I3DA 2DT3A 3N11A 3FHQA 1C8YA 1HKIA 3GXDA 2WLYA 3MKKA 4UQCA 4D6DA 1NH6A 3B9DA 2WYSA 1JIBA 2VVSA 2DSVA 1M53A 3TA9A 4DUVA 4ZEPA 1OGBA 1UKOA 4ACZB 4MJ4A 1X1NA 1QI0A 3IJ9A 2TAAA 4HOWA 5I6SA 1HT6A 1JG9A 3BAJA 3A3HA 1J01A 1KWGA 1JD7A 2VCAA 3CBWA 1AQ0A 2IUZA 1W1YA 4JFUA 3ALGA 3VNYA 1TR1A 1JGIA 2CHOA 2IXVA 5LYRA 1OGGA 1M03A 4DM1A 4JCLA 1UWQA 4HZ6A 3OZOA 4BZYA 1PX4A 5FL1A 3AHXA 1GVYA 4M24A 4F8XA 4H7VA 4XZWA 2WZHA 1HJQA 1XSKA 3WEZA 1R87A 3DHUA 1SMDA 2FHFA 1UD8A 3WBEA 3MMDA 1K6AA 1US3A 2WVVB 1R85A 1WO2A 4AIEA 2YDRA 2ZXAA 1V6WA 4X9YA 1TFVA 1U2YA 5C71A 3BAXA 3ZJKA 3CZJA 1K9DA 4ZXOA 1LL7A 3CUJA 1PJ9A 5AC4A 2EO7A 1LF1A 3BSGA 2Y8KA 1GPFA 1ISXA 4UFKA 1TCMA 3N18A 1WP6A 2E9LA 3VGEA 1HP4A 4A4AA 4OOUA 1CXEA 4GPNA 3SUUA 1CGXA 3VD5A 1KGUA 4P7LA 2YA2A 2G4FA 4W85A 5D9OA 2WC3A 3AQUA 4PMOA 2J47A 2BFGA 2ZX8A 1GUVA 2BS9A 3FAWA 1UOKA 3MV11 3PTKA 4P7QA 1ZBCA 2XVKA 3WBAA 1CLVA 3F4VA 2VX5A 3VIJA 5HDRA 1PX3A 4N0RA 4PMZA 1N82A 2VOTA 1UYQA 4JFWA 2D3LA 1G0CA 3VGHA 2DPEA 3AXIA 3CTTA 4IPNB 2XUCA 4EKJA 4KRTA 4UFHA 2OSYA 2W63A 1UWIA 3OIHA 2J7CA 1QNPA 1NM9A 1V0KA 1JZ8A 3O6AA 4W84A 5EFDA 1BQCA 3ARSA 1HVQA 3L4TA 2XSAA 3M46A 3VIOA 2EEXA 3VIIA 2ZUMA 4D6HA 4PN2A 2Y24A 3GNOA 3N15A 1W9VA 2NT0A 1J0JA 2UY2A 4F66A 3ARXA 2VNCA 2G3JA 3ZT5A 2WNWA 3TTSA 3OG2A 1DWHM 1GQLA 4J3XA 1VBUA 2WCSA 3WF1A 2VTFA 1D7FA 4FLRA 1NWRA 1E15A 4H8VA 1QI2A 5DEZA 2GDVA 1ISWA 3MO4A 1DTUA 4ATDA 4HMDA 1GQIA 2X2YA 2Q8XA 3ZJ7A 4A3HA 1DP0A 1ZJAA 4CN6A 2YDQA 1UD5A 2GUYA 5A95A 5I78A 1PIFA 3RM8A 3W0KA 3WIJA 1ITXA 4JKMA 4B16A 4LYQA 3LPPA 3THCA 2CXGA 4ZENA 4B3LA 3VX1A 2XVLA 4AMCA 1MFUA 2VX6A 2DSUA 3CMGA 5BCAA 1G1YA 3W28A 3ZT7A 3AIWA 6TAAA 2Z1KA 1B90A 3BLPX 3AHTA 5A2BA 5JIWA 4UQEA 5CZKA 4P7RA 2X1IA 4WKAA 4W5UA 2V3EA 5A8PA 3WQ4A 3W38A 4CCCA 4GI6A 5A8NA 2ZIDA 3IAPA 4V27A 5A6BD 5FD0A 1ZU8A 3T09A 2ZXDA 1QW8A 3BXWA 2PB1A 1GZJA 3CZGA 3VTRA 1LL4A 1OCQA 2HISA 2PF0A 3VD4A 5BXPA 3AS2A 2F8QA 1KXVA 3K4AA 3BAIA 5A8OA 1W1VA 1E43A 3CUGA 5A8QA 3SCSA 4JFTA 4W7VA 1Z32X 1MFVA 3VMPA 4AZ6A 1CEOA 2Y8VA 4CCDA 4PSRA 3EDJA 2PC8A 4J7RA 2XJ7A 2JF7A 1MW1A 1CNVA 1R86A 6A3HA 4BF7A 4D6JA 5KEZA 2DH3A 3GZAA 5JBDA 3OZPA 4A3YA 9CGTA 3GXMA 1F4AA 1QW9A 4CCEA 2DQXA 2J7GA 2XG9A 2VZVA 2UY3A 5GNXA 1E6QM 3LPGA 5E0CA 3MMUA 4MAVA 1H41A 2VO5A 1TZ7A 2VI0A 1E73M 4AD5A 3UCQA 1CBGA 3WEMA 3UR7A 4D71A 3BMWA 3EDKA 2ZICA 5BWFA 3BSHA 4HPHA 5CGTA 3ZM8A 2GK1A 5IFTA 5D4YA 1C8XA 5M17A 1V0LA 3TTYA 5M03A 1XSIA 4UFIA 4WIWA 1MXDA 1W3JA 3N9KA 1BVZA 4HMEA 2BV9A 1OBAA 5CG0A 3TONA 3O9NA 5E9AA 2WSPA 1JDAA 1XV8A 5DO8A 1CGUA 1K9TA 1H09A 3GTNA 3NYDA 1VJSA 2D24A 3W53A 1BVNP 3WUGA 5HPOA 1G01A 4TXEA 4W7UA 2V38A 3WD3A 1E0VA 4PMVA 2NT1A 1EO7A 5I79A 3WELA 5CJ5A 4UQDA 3PBGA 5I2UA 3U7BA 1Q6CA 3OBAA 4PTXA 4PTVA 3QGVA 5D9MA 1CGYA 3N13A 2JF6A 3IK2A 2X05A 4LX4A 3AS0A 3U7VA 4D72A 4JKKA 3QOMA 4MJ2A 1UD3A 3HN3A 3CHDA 1OB0A 2G8ZA 1VENA 3EMCA 1BGAA 4GZEA 2GJXB 3RMEA 3VO0A 1C7SA 1OIMA 1UH4A 1CXIA 3I3EA 1MW2A 2J25A 4OBSA 2EPOA 1HJXA 2XYLA 1KQZA 4FLQA 1AQHA 4MNLA 4IUGA 4AZ7A 4JAWA 2WVTA 3SCNA 2WHMA 1E0WA 1V3IA 4QLKA 4HTYA 1EQPA 3SCQA 5ABFA 3G6LA 3F5KA 3ARYA 3ZT6A 4GKLA 4MPKA 4AY1A 2OWXA 1ZB5A 4HA1A 1TA3B 3UR8A 5AYBA 2ZX6A 3FY1A 1V03A 2E3ZA 2D0HA 2XVGA 4OIFA 1JFHA 3VGDA 3SEPA 1BHGA 1AMYA 1ODZA 1WKYA 8CGTA 1JD9A 4OUEA 3NSNA 4CD7A 1WAWA 4MDOA 1O7AA 3J7HA 1E72M 1WCGA 4AD3A 1HN1A 2A3EA 2PWDA 1LG1A 3WNPA 3DYOA 1HJSA 4HMCA 4DWSC 2YL5A 1LLOA 3A4AA 4IPLA 4EE9A 3O2LA 4DWSD 5D9NA 2XSBA 2WLZA 1V3MA 4WKHA 2J8FA 4RL3A 4K68A 4L4PA 3T08A 3GH5A 3TTOA 1PPIA 3CHFA 2FHBA 3TP4A 4H04A 3BCDA 1HIZA 1CXHA 4PUEA 1CZ1A 1UWRA 5E09A 4J27A 3ARPA 5BXRA 1B3WA 4UFJA 3L4VA 4QDMA 2V5CA 3ZIZA 2BXZA 1GCYA 3L4UA 3ZOAA 1QHZA 2VZSA 3THDA 1H11A 3FXYA 3OGVA 3AICA 3MSDA 3SCPA 3VIHA 2WVUA 2BHYA 1NWUA 4D6FA 5A6MA 3VKKA 4H8UA 5CXPA 4D6GA 2QMKA 1JYVA 3CHEA 3WF0A 5IFPA 3WDPP 4RE4A 1IZJA 1QHOA 3GBEA 3OGRA 1W91A 1V02A 3CZ8A 4ML4A 1GOWA 5BXSA 4MAZA 2D22A 5AC5A 4XZBA 3WH8A 2YDSA 3VDCA 5I77A 1J9YA 5A8MA 3PZNA 5DMYA 3MANA 5CPSA 3QHOA 3WEOA 1V6YA 2CKRA 2FDMA 3AYRA 1KFWA 1JF6A 1XCWA 2VC9A 1TE1A 3FW6A 2ZUSA 2D0FA 3II1A 2BHUA 3WNMA 4URIA 1CWYA 2A3AA 2X09A 2W5FA 4HOXA 1EDGA 2V3FA 1E6SM 2YL9A 3VIFA 4GO8A 2DDXA 1ECEA 2PBOA 2J78A 4S3KA 5E6YA 3WFZA 4JFSA 4CKQA 4D6CA 1SMAA 2YOCA 1EIBA 2VRKA 3W6MA 2VJXA 2WWDA 4P7NA 2EPLX 1W2VA 4QP0A 3AJ7A 1UKSA 3CMJA 1W3KA 4AZHA 1BF2A 1HKMA 3WDIA 3OA5A 4AW7A 3VMNA 1FHLA 3AMGA 3AIRA 1A3HA 2XVPA 2WKGA 1E40A 3PZOA 4CD4A 3WFLA 4YHGA 4AD2A 5IHRA 5FL0A 3W37A 4PBGA 5LA2A 3WL0A 1NP0A 4MB4A 4UOQA 4YN5A 1H1NA 5FKYA 2XFRA 3U5YA 2ZX7A 3WQVA 1K9FA 3WDJA 3PZUA 4AZGA 4JHOA 3RDKA 1B1YA 5LA1A 3WSUA 2V3DA 1HL8A 1OT1A 1ZS2A 2WXDM 4JHZA 3OLIA 5E6ZA 5LA0A 3RJYA 4FK9A 1HNYA 1MWOA 1ZBKA 2CERA 2GJPA 2WMIB 3E1F1 3GYCA 1G9HA 4PUDA 2ZUUA 1FFQA 4S3JA 3AISA 1W3LA 1BYBA 2J77A 1E5NA 2CPUA 4AZCA 2WC7A 2J7BA 4TTUA 1UKQA 3MU7A 4CN4A 1RP9A 4J3TA 3WQ5A 1HJWA 4GZJA 4P8WA 1PAMA 2XVNA 1CGVA 1NWTA 1KB3A 2W92A 3IJ7A 6CGTA 1JZ2A 3VU2A 1CXKA 3APGA 3PTMA 4PRWA 2CBVA 3UERA 1C90A 1B9ZA 4C7DA 5GNZA 2WB5A 3N1AA 4W86A 3ZMRA 1E9LA 4BQ3A 2BXYA 4R27A 3AOFA 4B9ZA 4D6EA
chains in the Genus database with same CATH superfamily
4AB4A 1UZ4A 4LVDA 1G4TA 3RX4A 1JXKA 1US0A 4DVOA 1ZQ5A 3B05A 3LCIA 2NSOA 4U5KA 3A4XA 4O10A 2C19A 4RDWA 4KCTA 1EJRC 1FWRA 2IKHA 3NZRA 3PZ9A 3Q37A 1E5JA 4XKYA 4MUZA 1ROUA 1BLIA 4H4IA 4WVXA 3ES8A 2YBUA 5HXMA 3M7SA 4KCVA 1VPXA 4CQDA 1OF8A 5EU9A 1MRAA 1AH4A 5IXEA 1DEDA 4L4LA 3WKZA 5BRPA 2QV4A 4DWSB 4XX6A 3AO0A 4UQ9A 3EKZA 4BQ5A 4GI4A 4BI7A 1LWHA 4UBPC 4F4RA 4HU4A 3EKGA 7A3HA 3G0XA 4V1YA 3NQ6A 4JGDA 4K7YA 4QJ4B 3W26A 2NXIA 3LI1A 3B4UA 4GH1A 4ATLA 3EOSA 2H6RA 5I03A 2X16A 4AC1X 4CQBA 1TELA 4DJFD 3TR9A 3GXIA 4IISA 3W7JA 4HT3A 2WC4A 3KDNA 5J5DA 2AQOA 1UUOA 3AAMA 1K3UA 2PLCA 1O5KA 3BGGA 3AZRA 1Q6HA 3S5SA 4J4KA 1O68A 3UG3A 3LGEA 4GWEA 3W86A 3DHPA 1EDTA 2J7DA 1B3ZA 1ME9A 3HB9A 4V28A 4ZE4A 2AKZA 1XCXA 3QPZA 4HK5A 3XIMA 2PDPA 4Q4RA 3H21A 3L2MA 2ZRYA 2C13A 1ALDA 1H5VA 3TC3A 1FXQA 1BKFA 1QNSA 3PUDA 4JCMA 1QPRA 2O9OA 3AXXA 1LDCA 2PCEA 1FKKA 3LPOA 2CFFA 1JPIA 2HQAA 4HARA 1X96A 1YTDA 3WF3A 2ZUTA 4FIRA 4IF2A 4DZ3A 4QITA 3W22A 3A4WA 3IKGA 2J8GA 2J62A 1RSCA 3UJRA 5I3DA 3BJFA 1BYDA 3IIXA 2B7PA 3DBPA 4M6UA 1FKXA 2JIWA 4LBSA 5HMSA 4Y96A 3QXBA 4HYWA 3LV6A 3HGRA 2PDXA 2Y5JA 1V3KA 8XIAA 4QCFA 5KZEA 2ZADA 3NDZA 4GXPA 3MHUA 1Y0OA 3AIEA 3T2PA 2E8YA 5I3JA 3L4YA 2AAAA 4B2DA 4CU8A 1K03A 4HZMA 4RE2A 3AS3A 4AF0B 3LXAA 2X7WA 2PWVA 3SRKA 3L4XA 4RZ6A 3CS2A 2GSEA 4HHMA 3IPWA 2IQTA 1F4HA 3DYMA 1BSIA 4MWAA 4IPIA 1A4MA 1OADA 1C29A 4FAMA 4GZ7A 1G69A 1JZ4A 4J4NA 3K1DA 1BG9A 1KFCA 4H00A 2RDXA 3BG5A 3QQ1A 4K8GA 5CC3A 3O6DA 1TMHA 2I9UA 4YCOA 4HNTA 3BUVA 2YKKA 4RLIA 1A3XA 5AHMA 2VUYA 4KH2A 5M3WA 4RNIA 1EBHA 3FVDA 4PR4A 2QIIA 3H24A 3SRHA 5I98A 3FAXA 3I7QA 4N6FA 1SZRA 4HNVA 5ABTA 3KS6A 2C0HA 4LPCA 3KE0A 4R5EA 1VZWA 3F4WA 4E4PA 1C7TA 4JTAA 3FYYA 4LS0A 3DECA 1NSJA 4WXYA 3BDKA 4IPXA 1F73A 1TQXA 1NARA 4Q32A 4ALDA 1QDSA 4Z1DA 2AGKA 5D37A 3TOPA 1RD6A 3JS3A 4XD4A 1VF8A 1OC5A 4OOZA 3C2EA 4XZHA 4K37A 1GJUA 2VEKA 2EF9A 1YXDA 3N17A 1JZ5A 1NDVA 4O4WA 4G2DA 1S2CA 2GVYA 3HPSA 4I6VA 4LSBA 2OSWA 4HSOA 1KQYA 4S3GA 3YPIA 2FB2A 3GHTA 1FKSA 4MNJA 1QJWA 1LT8A 2A7PA 4LYPA 1ZAHA 3THQA 1KGWA 5LHFA 3NQFA 2BP1A 1E6ZA 3GAYA 2ZVRA 4RW5A 3CHVA 5H8MA 5B80A 2VP8A 4HCLA 4FAPA 1ONRA 1WYIA 4FSAA 4HPNA 1Q3NA 4A8IA 2CCRA 3D3FA 1DWAM 2IKJA 1K4HA 4P7OA 2RAGA 4WLCA 3EX2A 1ONXA 1YX1A 3WF4A 3SB0A 1EOMA 5L6UA 3UESA 1KTNA 1GOXA 1KBJA 3C0LA 1XQKA 1E4NA 4RNJA 2EPKX 1KR0A 3EMQA 5HUPA 1E6NA 3R0KA 2FGBA 3H4XA 5KZMA 2CLLA 1UOZA 1GONA 1DV7A 3EWCA 2W67A 3MUY1 4KR0B 2DG9A 1XHGA 3VNJA 1D7HA 1B4KA 2JZVA 1W9BM 2C1IA 3UXKA 3ECQA 3ARUA 3KVLA 4AY7A 2W3ZA 3RITA 1GOIA 1EBGA 1W37A 3MBFA 3S5OA 1B31A 3W4RA 5E5CA 3GVGA 5TD4A 4MKVA 1R7AA 3GG8A 4S3AA 2W62A 1FWFC 2ACUA 3IVTA 3UGRA 1KC7A 1NMWA 5RUBA 2VELA 2VR5A 3OVGA 3REQA 1WDPA 3VCCA 5LXEA 3LRKA 4DYKA 1EO5A 2J74A 4DRJA 4JQ3A 4PBEA 1D3CA 3EWXA 1XCFA 3W6LA 3MQTA 3NL5A 3TQKA 1KBKA 1FDYA 1VFTA 1EA0A 1VCGA 3ITTA 1EP3A 2O7SA 3F5LA 1JPHA 1PKYA 5LGXA 3GG0A 2Z27A 4U3AA 1R3WA 1BEUA 1JRBA 2DT1A 1A80A 1C9HA 4C1NA 3WD1A 2DUAA 4S3CA 1XGZA 5C9WA 3QTGA 4QGCA 2QCMA 4DO6A 3W71A 1NOFA 1XLEA 4IP5A 2ZCGA 3N14A 1F05A 3P7YA 1IXQA 4MWAE 3GPKA 4QRNA 3KAFA 1Y0EA 2ISWA 1BYCA 4C7FA 4JL2A 3W7KA 2KZHA 4JNYA 4J35A 1FKDA 3G22A 4AIBA 4WHBA 1QW7A 3R6IA 3KL0A 3MB9A 3PHAA 4MKNA 1MUWA 3CPGA 3L0KA 4HKPA 1SZFA 1ISYA 1CPUA 5JVLA 2EG7A 2VUNA 2E6FA 3U8GA 1B4EA 3W1RA 4O0ZA 3P80A 5E0KA 3V5OA 4YYFA 1R3VA 1IR2A 2P3EA 1QWKA 4JXCA 3M7WA 2Y5EA 3W1QA 4S3FA 1GVSA 1OX4B 4JDBA 2ZZ3A 4JQAA 1V0MA 2PDCA 5HJLA 2BVWA 1MUCA 1FJDA 3TZFA 4YJ5A 2VFDA 3HO8A 4HU0A 2E25A 4QEHA 3ZWSA 2XFFA 3G6MA 2WSKA 3L4WA 4MY9A 5LZLA 1HF6A 1ZLPA 1YATA 1V51A 3AXHA 1Q8AA 5A6LA 2PGEA 1HKKA 1M01A 1UP2A 5H91A 4Z2IA 2V81A 4AYSA 4L80A 5FACA 3SDOA 3I4EA 2A85A 2GUBA 4HNUA 4M29A 1H1ZA 3EWZA 1OFRA 2VD8A 3CUHA 3HG4A 5D75A 3AIUA 2DSZA 4EX4A 5H8UA 1AD1A 3RR1A 1CECA 1OEPA 4C6IA 4O16A 1J0HA 2H3DA 2OKOA 4PMDA 1KRAC 2FPVA 2IQ0A 1M5WA 4LY8A 2WMKA 3NPWA 3MS8A 3DFHA 4XV0A 1UKPA 4X22A 1I2RA 1Y8BA 1ADSA 3ITCA 5FAJA 3GS6A 5T9CE 2ZOXA 1B30A 3ZLGA 4BWLC 2PE4A 3VDAA 3OP2A 5CPQA 2GUUA 4LC8A 2CHNA 3SR7A 4TVUA 3VUPA 1I75A 4WK9A 1IEIA 1CENA 2XGZA 3C86A 3EA2A 2Y61A 3E0LA 3AU6A 4AVFA 1K77A 2Z28A 4UQBA 1W31A 1KXHA 2FH8A 3RF9A 4OQVA 5I09A 1I2OA 3KP1A 1QI3A 3PUEA 1FWIC 4WX2A 2XIBA 3BL3A 3GU1A 3PJXA 2QPUA 1FP8A 3LRLA 5CZ0A 1RA0A 3T8QA 1QBBA 3V1HA 4V2XA 1JF5A 1PZ3A 3CUFA 3EPMA 3W29A 2CBJA 3WNKA 1XYAA 3WQ8A 9RUBA 4BI6A 2VCCA 4JN8A 3UNTA 3MP3A 1XKJA 3E0IA 1J4HA 2FZDA 4V33A 1EUNA 4EP8C 1Q1CA 2AMGA 3WJYA 4F0SA 4TVCA 3TQVA 2F38A 3SAZA 3AALA 3UPWA 4HA3A 2IF4A 4B5WA 4ODQA 2V9DA 1V93A 1W1TA 2GJNA 3IJ8A 1PE1A 2V8ZA 4Z1CA 1KM6A 2V5DA 5EMUA 4UR9A 4DRQA 3WYZA 4E3VA 2D2JA 2MUCA 1DXFA 4S39A 3IJQA 2OWCA 3LI0A 3APYA 1WPCA 4L4OA 4ZOBA 4ICNA 3I7RA 2V3GA 5IDZA 2YCKX 4FNUA 1R8LA 1BD0A 1UIPA 1KT0A 1M7XA 1G67A 1Q6IA 1YE4A 4PTNA 4ZE5A 3LBCA 4LV4A 1Z3NA 4AWEA 3VX0A 4I9TA 2VYOA 3UY7A 1ZY9A 5DX7A 2H3BA 2F84A 1GOQA 2XP6A 1U33A 4JIRA 5BRQA 1X6NA 5FAGA 2R8WA 1DBTA 3UG8A 3EDEA 4HMNA 2J9YA 4R0XA 2V69A 4IT6A 2E8ZA 1V3HA 5MHBA 4XIMA 4RCXA 3ZS4A 3TMQA 3U0HA 2PDHA 3OYZA 4JFIA 1VRXA 1D8WA 3QF0A 4LU0A 3UWUA 1WV2A 2NQ9A 1IYXA 3T0BA 3ITOA 1QFEA 2INFA 1GK8A 2NV9A 5KZDA 3PZTA 4FXSA 4PFMA 4KEMA 4C6KA 4AXKA 2J9ZA 1FWNA 2VGBA 3SQSA 1AJ0A 4QCEA 2PWHA 4Z2GA 3KLKA 3WQOA 4ORIA 2D2GA 1EHNA 4IJCA 2E9MA 4D6IA 2INZA 1EC7A 4UR8A 4FI4A 1E9IA 4L65A 3P8IA 1HG3A 4GUFA 2CHRA 3DFQA 3LHYA 4E8CA 2RJHA 3T0DA 2E68A 3BAKA 1J0IA 2TPSA 2P88A 2HEJA 1J4RA 2W6RA 4NNBA 2P0OA 3ATYA 7ENLA 3T55A 1ZBWA 2WMIA 2DT0A 4NZCA 4HSHA 2CZDA 2PDKA 1Z42A 3NTPA 3EMZA 4JICA 4JFMA 2REQB 1GHSA 5IDIA 3EWYA 4NIRA 5KETA 2OLSA 4YWSA 1Q6GA 2DVUA 3VDHA 1R3SA 1F76A 4U4MA 7CGTA 3CO8A 4U3CA 3ZJ8A 3IAQA 2DG3A 3CUIA 3HJEA 2O56A 4OKDA 2DZVA 3CXOA 3LMYA 2HXUA 3SUWA 1C8QA 3RRXA 1UG6A 2ZX9A 3PZMA 2QCCA 4GO9A 3KRUA 4DROA 2E40A 5G4WA 1QBAA 1UR9A 1JNDA 3BLOA 1E3XA 2XIMA 3BANA 2VQUA 4RV3A 1DJQA 4O8AA 1V6UA 1JCMP 3AHYA 4YTRA 3KLLA 5HW8A 3AMDA 3HG5A 5K4XA 2ZZ1A 4D9PA 1S2AA 2V2HA 3WH6A 3MHFA 3HPZA 3W81A 1XBXA 4B3KA 3CT7A 4HB7A 2WKJA 1K8XA 4DWSA 3NZ1A 1HO4A 4PMNA 2HVMA 4Z2KA 3GG1A 5XIAA 3AHVA 3AYSA 3GTIA 4H2HA 3UEQA 3ARQA 4AZBA 4C02B 5HOSA 5JH2A 3KAOA 3UF8A 1G4EA 1FUYA 4X61A 1EJXC 2VRQA 2V2CA 4P8UA 1UBPC 5TQLA 1EGMA 2YR1A 1E55A 1DWGM 3DYPA 3LOTA 3ARRA 2WSQA 3H6OA 3GTXA 3NJ3A 4UCFA 2PDQA 2D0GA 5CCZA 1WBJA 2EXOA 3ID7A 4KCUA 5FSEC 4DNHA 4PTWA 2GSHA 3NSMA 1TUFA 1BQGA 4GD0A 1Q2RA 4IP7A 1TPEA 1Q4NX 5ENLA 3ITVA 3POHA 1WZMA 3HU7A 3TCSA 3GXNA 3SCWA 5I3IA 3ZSSA 2E5DA 1NWSA 3GE7A 2YDAA 4PH6A 5CLTA 5BRBA 1OM0A 1OHLA 1R3YA 1M7OA 1NF0A 2VN1A 1KFLA 3KFTA 4HNOA 2QPXA 3RILA 3CPRA 3L0GA 3M0ZA 2NX1A 3VFLA 1IWBA 3QH2A 1EJ7L 5HNNA 4YVPA 3WMCA 3SGGA 2PBGA 4CUCA 1JCLA 3SJNA 1X6LA 3QBUA 4QISA 4FN2A 3OJGA 1GW9A 4QNEA 4AX7A 3GQYA 1AFSA 5DY3A 1Z7AA 1OT2A 2D69A 1BFNA 2N87A 5I07A 1J2WA 2BBFA 4GCAA 4LWWA 4KQZA 4REQB 3H9RB 1V3JA 1RLCL 3TWBA 1UR4A 3E6EA 3UA3A 4G1NA 4V15A 3FHQA 3VAWA 2MF9A 1W1ZA 4Q33A 2HNEA 3O7UA 4UQCA 5TBOA 4D6DA 1ZALA 2VVSA 1M53A 4ZEPA 3B8TA 3PR9A 3CB8A 1F6PA 4HOWA 3TXVA 3QPYA 4RZBA 5CEWA 3A3HA 1OQFA 3AJXA 1KWGA 5HQLA 3CBWA 1AQ0A 3UJEA 3IJIA 4JFUA 3PWIA 1TR1A 2IXVA 3OHMB 5LYRA 1M03A 5AVHA 3S47A 4JCLA 3C3NA 2RUSA 3ODKA 2QDEA 4QDPA 1TZZA 2G3FA 3LHVA 2E09A 1EXBA 1GVRA 4F8XA 1XG4A 4XZWA 2INEA 2WZHA 3UWYA 3ONCA 1GT8A 3DHUA 3HZ3A 4H3DA 4J40A 1FWJC 4ZOEA 1K6AA 3LCHA 4PE8A 3U2EA 3PC0A 4QSFA 4ZGYA 2XN1A 1UP3A 4IT1A 4X9YA 3WQCA 3ZJKA 2BOGX 4GVGA 1KBLA 3URQA 1LL7A 1PJ9A 5F1VA 2WQPA 2EO7A 2EGZA 3TW6A 1LF1A 3O06A 4M6VA 1GPFA 4UFKA 2PA6A 1XFCA 4DJDC 1WP6A 4NAFB 3ANYA 2E9LA 4DJDD 1HP4A 2XP5A 4OOUA 2HE5A 1MEIA 4GPNA 3W1NA 1VD6A 5K3VA 3VD5A 3W6YA 1FWEC 4P7LA 4XO6A 4W85A 2WC3A 3H7RA 3CAQA 3OQEA 5FJUA 4RV8A 2ZX8A 1XF0A 1TTQA 3FAWA 3TYAA 4ZPVR 4O50A 1ZBCA 3THUA 1DIDA 4PODA 2G95A 4N0RA 4B5NA 2VOTA 1UYQA 1DIOA 1XUZA 2F2DA 2BLEA 2FZ9A 4BF8A 4O11A 3CIWA 2P4VA 4IXHA 3V36A 4O1AA 4QE4A 1QNPA 5T9BG 2PDJA 1V0KA 3ABZA 1ADOA 5EFDA 1Q7MA 1A5OC 1O1HA 3VIOA 5HKGA 2EEXA 3IVUA 4D6HA 5H2ZA 5HULA 1J2BA 3R89A 2Y24A 1J6OA 2NT0A 4F66A 4JR5A 1TYGA 3WQPA 2G3JA 3TX9A 2WNWA 3OBEA 3ZVHB 1GQLA 4J3XA 4CQAA 2WCSA 1D7IA 3UXDA 2VTFA 1D7FA 1JCNA 4NYUA 3W00A 5DEZA 4NXSA 3KBVA 3FIGA 1EX1A 3LK6A 3LY0A 3EXRA 1UASA 2Q8XA 2YFNA 2PP3A 1SSDA 1UD5A 2RDTA 1XLAA 2KE0A 2GUYA 4O53A 4IMCA 5I78A 3WIJA 3DENA 3UI5A 2JGYA 3VABA 2OGYA 3DZ1A 1HGWA 3E49A 1MFUA 3HTWA 2CWXA 3I68A 2ISDA 2PRMA 4IQLA 1AL7A 2WNQA 4LAZA 1B90A 4LEQA 4GNJA 1FWBC 5JIWA 1R30A 4UQEA 3MDWA 2X1IA 2V3EA 5A8NA 1ICPA 4L1GA 2QJHA 3S5ZA 1OX6A 5FD0A 3T09A 1T8XA 1U5HA 1ZSXA 4JS3A 4J9JA 2PB1A 2B4GA 3CZGA 2FKEA 2WM1A 2HISA 4ZTYA 4RNFA 2IMRA 4MZYA 3M0HA 4HD5A 4YCPA 3JXVA 3SCSA 3DG6A 4W7VA 2DFAA 4MF4A 1E9YB 4AZ6A 3W70A 3A4JA 5DELA 1DJNA 4DZHA 4CCDA 4IT4A 1A0CA 1XLGA 3C61A 1E0TA 2XJ7A 1POKA 2JF7A 1LP6A 1QCWA 3W1LA 4W9OA 3S0CA 3W1AA 2PBCA 2P10A 3MSYA 4DXVA 9CGTA 1VPYA 3GXMA 3ITLA 1SM9A 1QW9A 1E44A 3UCDA 4TW6A 5GNXA 5HWCA 3LPGA 5E0CA 3MMUA 4MAVA 3C0SA 3TV8A 2D9FA 3BOXA 2ODOA 2VI0A 4EPDC 2P53A 3UCQA 1OX4A 4PB5A 4BEUA 4HPHA 3O5MA 5CGTA 1R9HA 3QQ0A 5IFTA 1JJKA 3TYCA 3PBYA 4UFIA 3EX4A 3SSZA 3N9KA 2NV1A 2Z25A 3RLHA 5FF0A 4KFNA 2WSPA 1IIGA 1XV8A 3UT0A 5KSWA 1CGUA 3WJZA 1H09A 3GTNA 3V0UA 3I6EA 1G01A 4TXEA 3DG3A 1GVOA 3TFXA 4ORMA 1Y5WA 1E0VA 1XDLA 3RFAA 1EWDA 3PBGA 1TPH1 3U7BA 1Q6CA 3QGVA 2GOUA 4LAKA 3TIMA 2X05A 1S2TA 2ADAA 1J6PA 3AS0A 2NUWA 3U7VA 1SVDA 3IEBA 4L61A 3NGJA 3I4KA 3GDLA 5J6EA 1A5KC 2G8ZA 1BGAA 3VKJA 3Q4DA 4GZEA 3M5XA 4FNRA 1CXIA 3DOPA 3L5LA 3I3EA 1HO1A 3DI1A 2YXGA 4OBSA 3R43A 3F1QA 4MNLA 4TX9A 3H23A 4J2PA 3TR2A 2ZA3A 1GVFA 1KM5A 2WVTA 3CU2A 2WHMA 1KKRA 2XSXA 5CZSA 4KEVA 3NOYA 1EQPA 5CC6A 3UFYA 2E1WA 1G7UA 2YX0A 4TMBA 1ZB5A 1Z41A 4HA1A 1TA3B 4LVFA 5AYBA 4UTWC 3LLDA 3MSRA 3FY1A 4IL2A 2E3ZA 4DQWA 4DY1A 1OYBA 4S38A 3SEPA 1W56A 1PHQA 2GYIA 3TDBA 2ACSA 2NZLA 4QBXA 1LBFA 3NSNA 2XH0A 1WAWA 3J7HA 4E4FA 3O5JA 1WCGA 1LG1A 1SJCA 3FVMA 3EGJA 1HJSA 3A4AA 2V5BA 4HBEA 3O2LA 4Q4OA 4YS1A 1NIUA 1RK5A 1V3MA 3LMZA 4FA3A 1RV8A 4L4PA 1I2PA 3H2FA 3TTOA 3HURA 4O1FA 1HIZA 4PUEA 4CCZA 4H6RA 4J27A 5BXRA 4UFJA 3L4VA 2NUXA 2Z1WA 1GCYA 3W2NA 3THDA 3FXYA 2UZ9A 3N3MA 3SCPA 3N6HA 4KQNA 4PUNA 3CB3A 1QK2A 4MKSA 1H1YA 3VKKA 3W7OA 3CL8A 2QDDA 4ZQCA 5I3FA 1RA5A 2IKIA 3WDPP 1IZJA 3GBEA 1W8GA 4UTTC 1V02A 4ML4A 1RLDA 1X38A 3M64A 2D22A 4I7WA 2E5BA 4XZBA 3QC3A 1V4YA 2PV2A 1J5SA 3W1UA 3U3HA 3MANA 4ZA0A 5CPSA 3UQAA 3QHOA 2BX7A 1RHCA 3I6TA 1BKHA 1L9WA 1V6TA 2FDMA 1UB3A 3AYRA 1KFWA 1JF6A 1XCWA 2VC9A 1HTIA 2D0FA 1JCJA 4GYPA 3RO6A 3N2CA 4URIA 1CWYA 1Y5VA 2AL2B 4KWVA 4GY7A 2V3FA 1DJHA 1ECEA 2PBOA 2J78A 7REQB 5G2HA 3WFZA 1RQHA 4JFSA 1O95A 4CKQA 1POJA 4D6CA 2MPHA 4JX5A 2WWDA 2ZVIA 4QT2A 1T5AA 3AJ7A 2OR2A 4JHMA 2QDGA 4UIOA 3CUZA 3VMNA 1ZFJA 2P8CA 4DO7A 1FHLA 3AIRA 1SR9A 2Y7FA 3IK8A 3UYIA 2BSLA 2XVPA 4UMCA 3RPDA 3U9IA 4YHGA 3P5YA 3LYEA 5FL0A 1LBMA 4MZ8A 3OU8A 3W37A 4PBGA 6XIMA 4YN5A 3H2MA 1H1NA 1A4LA 2CC0A 1PB0A 4AZGA 2PPGA 4JHOA 2G96A 1HL8A 4A3QA 1VYPX 1OT1A 3BWWA 3BLIA 1UCWA 4JHZA 3RJYA 4GUIA 2LLEA 1W8SA 5D30A 1AA1B 2REQA 1XG3A 3ME3A 3MVTA 4Q8QA 4WSHA 1J79A 4PUDA 3HV9A 3CYVA 3QPEA 3HPXA 4MGVA 1W3LA 4GNKB 4IQ2A 1RCXB 3B7XA 2C6QA 3MU7A 1K8CA 4CN4A 4CEXC 3NQVA 2DZBA 1PSCA 2XVNA 3WLNA 4JTIA 3VU2A 2FTPA 4LC6A 5F2LA 2Y7DA 2CBVA 3UERA 1C90A 1XYMA 5GNZA 7XIMA 1PCWA 3RCYA 2WB5A 4TV6A 3N1AA 2D73A 5CKSA 5H1WA 3ERPA 3QR1A 4WJEA 5CPLA 2BXYA 3TN6A 3LQLA 3NL2A 4PBFA 5G1YA 3S9ZA 2FZBA 1Q6FA 2XWEA 3W2MA 3TYUA 1DQUA 3T07A 4G6CA 4GISA 4B9YA 3U6WA 3MWCA 4AX6A 4DUXA 2Y62A 4DZ5A 1W1B1 2Y89A 1FH9A 3UG4A 4NAEB 2W9MA 1EOKA 4XZIA 2ZBTA 3N9SA 4E8GA 1AH3A 4PMRA 3W2UA 3KOFA 2PD5A 5E70A 4E0CA 3HF3A 1ME7A 3LHTA 2ATMA 3K8MA 4IMDA 2HPIA 2QHAA 1JVNA 3NPXA 1IX5A 4K8HA 4IG2B 2GWGA 2ZRZA 4UMAA 1OIFA 3WBYA 1P5QA 1V6VA 1IF2A 3DC0A 3QV7A 4BY3A 1WDRA 4CVUA 3H7VA 3JVAA 1UR2A 3MC5A 1H4PA 3O5PA 1MSSA 3F2CA 2OZ8A 3T1GA 2DUXA 1VFFA 4HHPA 2DW6A 4CNSA 2VDIA 3N6JA 1UKTA 1WDQA 2QIWA 1V02E 4O19A 4Z2JA 2B5UB 3BGAA 4FF7A 3LS9A 4O28A 4DUWA 3L67A 1VKFA 1P0DA 1JCHB 5EY5A 3T40A 3M0LA 2JIEA 3UD6A 4QHRA 1VB9A 1VFMA 1WE5A 2BMBA 4LUSB 4GZIA 2QUTA 4PRTA 4UNIA 3VZYA 4IGHA 3GBDA 1UIOA 4NQ1A 2PDFA 4L5ZA 1I0BA 4H9UA 2QF8A 4Q4QA 3T2QA 2WNNA 4W8AA 5DY2A 1GHRA 3HFTA 1PXGA 4H83A 3NNTA 3FAPA 2ALRA 4IMEA 3T44A 3W75A 3GH4A 1UQZA 4OVXA 2YGYA 5GNYA 2PDIA 1H5YA 2QVNA 4EWND 4ODPA 4U33A 4UOJA 2PP0A 4L64A 2NQ5A 4QEEA 1IE7C 5ABHA 1RUSA 1TWIA 4REQA 5GPGA 2UZ5A 3MPGA 1A49A 2AWGA 5I3KA 2WMHA 3KVJA 1HJVA 1SU5A 2P1FA 1VGAA 1QRQA 4TTGA 4IQCA 1I2QA 4F0HA 2FHCA 4MGGA 4CD6A 1TJ2A 3ICJA 2YLLA 2RUQA 1BXNA 1RAKA 1AH0A 1XYCA 4GA8A 4M5PA 1LUCB 5AYXA 2XWDA 1R2TA 1XD1A 3Q65A 1B0IA 1A5AA 1XINA 1U79A 2QGHA 3LA4A 1H0GA 3AC0A 2VR4A 4C6CA 2EPMX 5CC7A 1JQXA 4LUTB 1WX0A 3BQ5A 4XTDA 1A5SA 1WA3A 4NJJA 1BPLB 1DXEA 5I5RA 2E28A 1EEXA 1NU5A 4KF1A 1EC9A 2DV0A 2JFEX 1BF6A 3SIMA 1OYAA 3LZ3A 4BJHA 3VNZA 3NOEA 2WZIA 3TYEA 3UU0A 4MB3A 2TRSA 4H9XA 4U31A 4MJZA 2X40A 2OO0A 3MKCA 4JY9A 2AOSA 4F2TA 2MLZA 1SZNA 3DX5A 2O9TA 2VZOA 1QOXA 1YIXA 1EGZA 1QMLA 1F5ZA 4GINA 4CVWA 4GFSA 2ZDSA 1CYGA 1J4EA 4PC8A 4NRSA 4AEFA 3W1TA 3GTYX 2EKCA 3H2CA 7TAAA 1JULA 4NAFA 2O9RA 1KTBA 1ZAJA 2I9EA 2VWTA 3SQLA 3RIKA 1GWJA 2CW6A 3N4EA 1H7RA 1U83A 2VXNA 1S5VA 1VBRA 1VRDA 3TW9A 3VOHA 3WUEA 1ZJIA 1TB3A 4GBUA 1D2KA 1Z6KA 3QN3A 3IGHX 5FEPA 3CLWA 2XIQA 2G0WA 3NRKA 3S1UA 2R1LA 2O92A 4XAGA 3VIGA 1FKTA 3QR3A 1GTEA 2PGFA 2NLYA 4JIEA 2BWGA 1L6WA 1V6XA 1OFDA 4TQTA 5F2IA 1W6TA 2FZ8A 1UC5A 3WMSA 3E3HA 4C1LA 4GHRA 1MVYA 3QZEA 3W7HA 3QFEA 2YPIA 3NDOA 4F2BA 3LPFA 4E2OA 1QPNA 1QAPA 2F2KA 4U5IA 4UNLA 4Z2LA 2I16A 2ZR5A 1ZHAA 1X8CA 3U48A 4DRIA 4TUFA 4QLLA 1ZBVA 4Z0SA 4QIBA 4ZFMA 1IT0A 3FKKA 4BR1A 1XUUA 4C6LA 3ZVHA 3PF3A 3U4AA 3DFSA 1CLXA 4R3UA 3SCOA 1XRTA 1SGJA 4LB3A 5M5DA 3HMCA 4PZVA 3KABA 1B5TA 2Z6JA 2PDNA 4XO7A 2V0TA 3AIBA 3MUXA 2ALDA 1ZNNA 3S8HA 1VLWA 4CU7A 1W5PA 5GVJA 3W24A 3P8JA 2XM1A 1KM3A 3IV8A 1TMLA 2HVNA 1JNEA 1KR1A 3BMBA 3K46A 1EQCA 3W9ZA 2JQXA 1WZKA 3SUSA 3L5AA 1TWZA 5A2AA 1OFBA 1OJXA 3URAA 3F2DA 1SW0A 3VYLA 4IIHA 5HWJA 1H63A 3C0JA 3G2GA 4Y9AA 3WQEA 3STFA 1OGSA 4AH7A 2O7QA 4FMVA 3M0VA 3SI9A 2ZX5A 3LCLA 4N19A 4DPQA 4PTMA 1TVPA 1EJVC 1D6OA 3UG5A 4UTFA 3VGGA 2O9PA 4AISA 4XIAA 4JTLA 1LQ0A 2AGTA 1V3LA 3GM8A 3KCEA 4DRNA 3MY9A 3LCXA 4S3EA 5CH9A 4QFUA 1EPVA 4WEVX 3WQFA 2QKFA 3QMTA 1MDLA 2IW0A 5EPDA 3WLLA 4IX0A 3S9YA 1B3YA 3MUZ1 1LZOA 3VK5A 2CLIA 1E0UA 2DZUA 4O52A 3SZ8A 3EOUA 1LL6A 4CU6A 2VQTA 1J0YA 4H6EA 3UZXA 5DRIA 4QXIA 3JW7A 5D38A 3FNDA 4AEEA 5ABGA 1HKVA 5A2CA 1ZGDA 4TOQA 3UR2A 3AIQA 4HBKA 1JPDX 3AZSA 3KL5A 2VX7A 4KRUA 2QS8A 4FLSA 3NUKA 4I8YA 1DJIA 2C7FA 3VIMA 1HZYA 4ONVA 5CBBA 3QMSA 1FQ0A 3T0AA 4DX3A 3NGFA 1RJRA 4LT9A 5LIXX 1B6CA 1RH9A 3HQ1A 3L2LA 2VL4A 3GK0A 4FXJA 1FWHC 4MB1A 1IGWA 3S2NA 2RHGA 4EANA 1QXLA 1EKOA 1WQ5A 2RUDA 4MVAA 3ITXA 4PULA 2Y2WA 3SM0A 1J10A 5AECA 2Y85A 1FHUA 2P50A 2QCFA 4N9BA 3DKJA 4Q4MA 2PEVA 1HP5A 2R1MA 3MV01 3QR0A 3STGA 4OV4A 1M9HA 4Z1YA 1ZCNA 3R8GA 4DYEA 3O8AA 2RFGA 2PWGA 4NX5A 5K9DA 2FPTA 3WK2A 2A6LA 1A7XA 1P6WA 2OU4A 1P1XA 1PYMA 3IACA 3A6OA 1O6IA 2DZSA 3V0TA 2YJQA 3URNA 3V7PA 4ES4A 2YCJA 1PTAA 1E71M 2QW5A 1R0MA 3KHDA 3VOCA 3OHIA 2DZWA 2VMFA 3G1HA 4O4VA 5K2ZA 5HUOA 1NDZA 4BWLA 2POTA 3E96A 5DO2A 4Y2WA 2XN0A 1XBZA 3UJSA 2KI3A 2CLOA 1DE5A 1TJPA 2QJNA 1HKJA 2XPAA 2DEPA 9XIAA 1CX9A 1TPC1 4DF1A 2QT3A 2IKGA 2PU1A 2D1ZA 5C9ZA 2VEFA 3SFWA 1LYXA 3NG3A 4AXNA 3PY2A 5AN7A 1L2UA 3CPUA 3RHGA 2PURA 2ONEA 3WL1A 1TJ0A 4HBOA 4PCPA 1TA3A 1EXPA 5F4WA 1JCXA 1P6CA 4ZB2A 3UQBA 2ISVA 5ABFB 4Q3MA 1MQQA 3HPFA 3TU9A 2HMCA 1WOBA 5HBFA 1MI3A 3MJYA 2VHLA 1IXPA 2G3NA 2WAGA 1C3FA 3PN8A 2DVTA 2WWCA 2ZUNA 4ROQA 3M16A 5C0QA 4AU0A 3CGTA 3PJWA 2CLFA 9XIMA 2V82A 3G3MA 1XLHA 2KX9A 1SFJA 1EH9A 4GQRA 2XP9A 3QLDA 4AD1A 1BXBA 2NV2A 1A5UA 4HPJA 1UD6A 5AZ1A 2FH6A 3V5FA 5HNTA 3KOZA 2VC7A 2GVGA 2FPYA 4K6AA 3G1YA 2UV8G 3VOFA 3URBA 3QZAA 4FXRA 2J7FA 4HQVA 2CIPA 4TW8A 7ODCA 4EPKA 4O15A 2ZE0A 3O6YX 3N2XA 4FR1A 3WZ0E 5A6BA 2QCGA 2YCEA 2A3CA 4JYFA 2J7HA 4XSMA 4K1GA 3COTA 1FH8A 3WK1A 3GIYA 5LNUA 3C2FA 1Q6QA 1XIGA 3PB2A 1PZ2A 3SN0A 4DPPA 1R7OA 3B4YA 1EEPA 2BNJA 2GVEA 2MLXA 5JBFA 3BLKA 3JZUA 1DL3A 2G5WA 4AAJA 4F3HA 3OLDA 4XG1A 3FEMA 4B90A 3LG3A 4A35A 4R85A 1V7AA 4QLJA 4TX8A 1IHIA 4FLOA 2ZQVA 3WNNA 1R2RA 4N7QA 2C71A 3VDBA 1RVKA 4OTKA 1A53A 2BODX 2WCAA 3NIYA 2AL2A 3SY1A 3WD4A 3GDTA 2QXWA 3T4WA 1BRLB 2OWWA 3PWAA 1OINA 1MYRA 2QGYA 7REQA 3KOYA 2GGIA 4GLEA 1E1FA 3NQ8A 1SO6A 4QT3A 2PDYA 3DEQA 1XQLA 1UZDA 1YW5A 1XIIA 4S3DA 1ONWA 1P0EA 2QCDB 1N7KA 3HGOA 3WCZA 3GVRA 1TR9A 1SQ7A 1RY0A 4MFEA 1LOLA 3MZ2A 4WKFA 3KBJA 4MUPA 4DF2A 3BO9A 3O5FA 1E4LA 4Q8PA 4W88A 1RBAA 3OO2A 2Z1XA 4Q4KA 2AQVA 3DFPA 4PSPA 3ZFHA 4MSSA 4WUIA 4B2DD 4AWSA 2PTWA 2ACRA 4V1XA 3A23A 4CQCA 4MWAC 1Y65A 4MWAD 4WJ8A 3CHCA 5IRPA 4J3SA 3WQWA 2Y78A 1J96A 4ZOAA 4K2SA 4LAWA 4B3ZA 1IQ8A 4H7CA 1KBBA 1I1WA 2VZTA 1WXZA 4E2DA 3R0UA 4UZSA 1EF3A 3FS2A 1RZMA 3FOKA 1QPLA 4LCSA 3GZ3A 5G5IA 4G1KA 3KADA 1TO3A 2ZXQA 1WKEA 1PKNA 3VKCA 3GR7A 2J6VA 4LGXA 5HANA 2OODA 1BGGA 2XZ9A 3B0UX 2CZ5A 3STCA 3H70A 1UQYA 3TLLA 3POCA 1T96A 1U1HA 3O5GA 3AS1A 3CMFA 1TMQA 3S5YA 1CGTA 3H53A 1UPMB 3ITYA 3KL3A 3EKLA 1XH0A 5DCEA 4ODNA 1BWVA 3QLLA 4F0MA 2D20A 3TROA 1SYTA 2PLMA 2OLHA 1MO0A 4JFJA 3IUDA 3CQ0A 1H50A 5C2GA 2BVTA 1KRMA 1S1RA 4HCDA 1HX0A 5DANA 3QGAC 1K70A 4NAEA 1Y7VA 2NQHA 1JVWA 1UC4A 2HCVA 3W82A 2F6KA 2MNTA 2WKLA 1O5QA 4JBRA 1OWQA 2FMOA 2PUZA 3ZR4A 4C60A 4J3WA 5SWUA 1I8JA 2ABBA 1GKRA 4IG2A 1JR1A 2FB3A 4LS2A 4GOAA 2ESCA 3MBDA 1WAUA 5D2WA 4F2UA 2TODA 2E0PA 3NO3A 2J4GA 3M1ZA 3DHFA 1XYFA 2ZZ7A 3ORWA 2X0HA 2C91A 2FFCA 2HVOA 4WDTA 1LRTA 1F8MA 5D8WA 4XVEA 2OYLA 2WZMA 4X2RA 1Z44A 3ARWA 1OD0A 2WHLA 1BYAA 5HAOA 5DF0A 1NF7A 2GGJA 1OY0A 1LT7A 2X41A 2FIQA 3MW7A 2GQ9A 1AQFA 1B2YA 1UMLA 5F1UA 5HMFA 2CETA 1FCQA 1JRCA 1W1PA 1ICQA 1JXJA 3IANA 2AKMA 1X8FA 2OX1A 1JDDA 4LUSA 2F61A 3TE9A 4KGLA 2WBKA 4W8BA 2YA1A 3WMBA 2X8RA 2EPHA 4UFLA 5A94A 4PGLA 3CH9A 1S46A 3FKRA 3GD6A 1WZLA 4ZXLA 4JX6A 4WF7A 3MP4A 4IL0A 1P5BA 2HNHA 4PL1A 4J3UA 3GUGA 3ZJ6A 3ARZA 4LNYA 4OJYA 1O4UA 5EYWA 2YSWA 2OX4A 1E70M 2Y7EA 4W89A 5CSYA 3NTYA 1W3IA 1FKLA 3WJSA 3LM3A 1QO5A 5A6AA 3BE7A 3N29A 1VIWA 4YLWA 4GJIA 5F2GA 3C5QA 1S5MA 2XIIA 1Q6OA 1XC4A 1TG7A 2E6AA 1VH7A 1EIXA 1VLIA 2OFJA 4Q6XA 4LY4A 1K7FA 5GJNA 1TQJA 3IUIA 4RW3A 4ODOA 1V0NA 1CDGA 4AHQA 4CD8A 4UFMA 4BS0A 3K8KA 1S3HA 4PCFA 1OCBA 2B0MA 2YBTA 3BC9A 1V5XA 1HGYA 4EACA 3RAOA 1FKWA 5C9XA 3N11A 3ZLFA 4FHAA 4MY8A 1HKIA 3BK0A 1DJXA 4XBJA 3EOLA 4ML9A 1MZRA 2WYSA 2DSVA 1E51A 1VQTA 1UKOA 3EWBX 2PTDA 2DZPA 4MJ4A 1X1NA 3EB3A 4NASA 1PHWA 2TAAA 2WJDA 3L66A 4LUTA 2DUZA 1GTHA 3QFWA 3W7CA 4MMWA 2ZYFA 4B5SA 3CAWA 3DFTA 5CC5A 2IUZA 3FJNA 1W1YA 1Q63A 3DESA 1TPFA 1DE6A 2E7FA 3GNNA 1DOSA 1JGIA 2CHOA 3GVVA 4DM1A 1UWQA 3GIPA 3OZOA 4BZYA 4XWUA 1PX4A 4RJEA 4G8TA 4RE0A 3AHXA 3H8AA 3KRBA 1B57A 3K4WA 1DJYA 3MA8A 1R87A 1SMDA 3GU0A 2FHFA 1X1ZA 5BZAA 1UD8A 3WBEA 4IFRA 3S3GA 4DJDA 1ZP3A 2WVVB 3NQDA 1KCZA 4DRSA 2YDRA 4MYAA 2W27A 1YTKA 1TFVA 5C71A 5AC7A 2ZC8A 1QATA 3O5RA 1MZHA 4FO4A 4LAVA 1FD9A 3L5MA 1W54A 3WJXA 2PPNA 4XZ9A 3TC6A 3N18A 1UWAA 1ZUAX 3MCNA 1LRQA 5IBXC 4GXWA 4FXFA 3VGEA 4U10A 3N19B 2R1NA 1XLMA 3KW3A 1CXEA 3SUUA 1XI3A 2QUVA 4AMAA 2NVCA 2G4FA 3N34A 3AQUA 3WJWA 2J47A 2BFGA 3WFAA 2BS9A 1UOKA 3PTKA 4K8EA 4HHHA 3GFZA 5TNVA 3C2YA 3F4VA 2VX5A 3VIJA 5HDRA 1PX3A 4JIIX 1Z69A 4JFWA 2R1PA 3NAVA 3AXIA 4IPNB 4UFHA 5DCDA 1UWIA 2J7CA 2C18A 4LAOA 3KHJA 4W84A 1BQCA 3FYOA 3GW0A 4KPLA 3ARSA 1HVQA 3L4TA 4JYSA 2XSAA 4H1ZA 2ZUMA 3VIIA 1Z48A 2HWGA 1EPXA 1AG1O 3A5VA 4EWJA 4C6OA 5DIUA 2OOFA 2UY2A 3CT2A 3ARXA 3E5PA 3ZT5A 1DWHM 4M1BA 1QU4A 4G50A 3RX2A 5FESA 3GHUA 4FLRA 2FZNA 1E15A 4IMFA 1QI2A 5HJYA 3BLEA 2GDVA 1ISWA 1QASA 4X3ZA 4S3BA 4ATDA 1GQIA 3OODA 2X2YA 2ACQA 3UQIA 4CN6A 1R2SA 2YDQA 1ITUA 4OGZA 3U2ZA 4UTUA 1IEQA 3W0KA 4A2RA 4DJFC 3M5VA 4KKXA 3TQPA 4AMCA 1KCXA 3ONBA 4QTGA 2TMDA 3AIWA 6TAAA 4TW7A 2Z1KA 5A2BA 1PYFA 5CZKA 4F0KA 3TJLA 1VIZA 3IHZA 1DTNA 1GJPA 3WBWA 3UR5A 4GI6A 3KAGA 4EPBC 1LROA 3OZYA 2WOQA 4DEFA 1QW8A 1JNSA 3IUHA 4L9ZA 1XIEA 2PF0A 3VD4A 4S1FA 4LAXA 2F8QA 3VCNA 3QV8A 4IX2A 4ZQRA 5A8OA 4JD4A 1E43A 4M6QA 4Q8NA 3UYCA 3W2LA 1UJQA 3NO5A 1OX5A 1VCFA 4A3UA 1F8AB 1M68A 2PDGA 4GIRA 2ZRVA 4DI8A 4DI9A 3H4GA 3WLSA 3UXIA 1CEOA 2Y8VA 3EDJA 3T42A 1TTJA 4GACA 2PC8A 1XP3A 4O2TA 1OABA 2G4JA 5I3HA 4DLFA 3R5EA 1CNVA 1FX6A 1K6WA 4X9SA 5HATA 4IP4A 4D6JA 5KEZA 3LEPA 2DH3A 2B81A 4C6FA 3DU0A 1L6SA 2YFOA 4O54A 4BKNA 4ZSTA 4CCEA 2CU0A 4BHYA 2RSEA 2J7GA 4YMZA 2QDHA 3U2OA 5G1MA 1TZ7A 2KGJA 2R82A 3W72A 4DXKA 3IRSA 1CBGA 1Q66A 3UR7A 4D71A 3RPTA 5H6HA 3O1NA 2PV3A 2Z2BA 1EYMA 4HJWA 2WNZA 5D4YA 1V0LA 1XSIA 4HSNA 2FTWA 2XP7A 4W9QA 4IGMA 1BVZA 4MG4A 2BV9A 1OBAA 1ZENA 5E9AA 1S39A 1K9TA 4DIPA 3NYDA 2DG4A 1VJSA 3H12A 5HR6A 5G1TA 4FZIA 2DY3A 3V75A 1TWSA 3E0FA 4W7UA 2WV8A 1T7LA 1RK6A 4BF5A 2V38A 1JCYA 4EF8A 1BWLA 3WELA 1TV4A 5CJ5A 3OA3A 4UQDA 8XIMA 3KRZA 3Q45A 4PTXA 4PTVA 1XX1A 5D9MA 2Z6IA 3LRMA 3HQOA 3LSCA 1RQEA 3O5IA 4D8LA 3HN3A 1OB0A 4O1BA 1UPPA 3NQ7A 3T4CA 3KZPA 1F3XA 3SN4A 3EMCA 3TC5A 3W3OA 2GJXB 4JYDA 1YEYA 3Q58A 5HUAA 1C7SA 1OIMA 4OECA 2NLIA 1FY6A 1MW2A 3BMXA 2EPOA 1KQZA 2VKZG 1D7JA 4FLQA 2P8BA 4IUGA 1KFKA 4TV5A 2XU2A 4JAWA 3TN4A 1KV5A 4HNCA 1AUSL 1S1PA 4HTYA 2YYTA 1M7PA 3PUGA 5ABFA 3G6LA 3ARYA 4IICA 4KW2A 4JTQA 3C2OA 4LNCA 3ZT6A 1XM3A 2RDUA 4OT7A 2ZX6A 4WXZA 4XD5A 4OIFA 4LOCA 2CZEA 3VGDA 1BHGA 1OFQA 1LOSA 1ODZA 4QSHA 4WY0B 1JNTA 2ZA2A 2ON3A 5GJPA 4GC4A 1JD9A 4OUEA 1J6YA 4OHQA 2FZMA 5DQPA 2PDWA 1HN1A 5LNWA 2PWDA 1CB7B 2I17A 4DWSC 2YL5A 1LLOA 4DWSD 5BOFA 2IQDA 3GTHA 3ANUA 2WLZA 2J8FA 3WLRA 4K68A 1TPWA 3GH5A 3UWZA 2Z00A 2W0UA 3CHFA 4H04A 1CXHA 3IKDA 5C2CA 3W2JA 3ARPA 2FMNA 4ZS6A 2EAWA 2BGQA 2FJUB 2A21A 2V5CA 1H7XA 3ZIZA 4QQUA 1EYEA 3ZOAA 1QHZA 2VZSA 3OGVA 3AICA 1EJWC 5BOOA 2WSRA 3T6CA 1PWMA 5C54A 2BHYA 2R94A 2GDQA 3TYDA 2QCLA 4H8UA 1Z9AA 2LJ4A 1JYVA 5LXXA 1IZCA 4RE4A 1OC7A 1QHOA 4M7TA 1W91A 3PAOA 3UZZA 4JY8A 2AL1A 3TMLA 1YKWA 5MKGB 3O07A 3WH8A 2YDSA 3VDCA 3AYTA 3R13A 1GYMA 5A8MA 2EHHA 3GW3A 3W84A 5AHIA 3PPCA 3PZNA 5CSSA 5BWAA 1XPGA 3GU9A 4ZO6A 3ES7A 5DN1A 4DBWA 1BRLA 3DFNA 1TE1A 1Q13A 1P0KA 4DRPA 2C14A 3II1A 2OELA 2BHUA 1TREA 3NPUA 4OV9A 2A3AA 2KFWA 2X09A 4YTQA 2W5FA 2YZRA 4GABA 5C6MA 2FVLA 1E6SM 2ANUA 4NL1A 3PPGA 1TTPA 4S3KA 2Z29A 5LIUX 4IIEA 4K3ZA 2YOCA 3NL3A 3W6MA 2VJXA 4P7NA 4Z08A 6ENLA 2QCDA 1S38A 4Y9OA 3CMJA 4AZHA 4LF1A 4XZLX 3MHGA 4W9TA 4LV9A 3OIXA 2WZTA 3W7PA 4B5UA 2WKGA 4CD4A 4ZQPA 1QZ2A 4EOUA 5IHRA 3FFSA 1BKSA 4YNGA 4A8RA 4NX0A 3TVAA 1HUVA 1Z8AA 3OOBA 1UROA 5FKYA 4DLMA 2ZX7A 4QM1A 3MDYB 3M6YA 1J5TA 4B5VA 1B1YA 4FP1A 1W5MA 3WSUA 5LA1A 2OZTA 1GGOA 2QUMA 2WXDM 4C6JA 3OLIA 4L72B 5E6ZA 2OFNA 4N2YA 2PGWA 3B97A 1TPB1 3QEZA 2CERA 3GYCA 3IS4A 2ZUUA 2CWNA 1SW3A 1BYBA 2J77A 5D02A 1E5NA 1UKQA 1RP9A 4J3TA 3WQ5A 1HJWA 2VFEA 4P8WA 5KITA 1CGVA 1OYCA 3DGRA 3FGCB 2W92A 3IJ7A 3KVKA 4JPGA 1QPQA 2BGSA 5FEWA 3PP7A 3QV6A 3UPBA 4PRWA 1EP2A 4ODKA 1V8EA 1OK6A 4Y8EA 3VC6A 2VGFA 4W86A 2L2SA 1E9LA 4BQ3A 4WOQA 1E1CB 4L4MA 5JMUA 3AXKA 1LQ2A 1K8ZA 4KESA 1XYZA 1UHVA 2AQWA 2W79A 3VKDA 2M08A 3DG7A 1IT7A 1P48A 1XKYA 2PODA 3RX3A 1XLJA 1YHTA 1YXYA 3IVSA 4NRRA 5C9RA 3KVMA 4F9DA 1OSEA 1QTWA 1JI1A 2GGHA 4QE1A 2E1DA 2WPBA 2QLYA 1C9DA 3HGSA 4C6EA 4LXFA 4JN6A 2PLKA 1G94A 4WSJA 2XHYA 4Q7NA 3TCZA 3RYSA 3A3WA 5E0FA 3S1GA 3M44A 3PBWA 3MYOA 3QHMA 2ZRWA 4KRZA 4AWTA 1QUMA 1Q5MA 3AFBA 2NW0A 4C91A 5FF7A 1W32A 4DXXA 1TV2A 2G3MA 2VCBA 1E1EA 1RD5A 1VFOA 4XBSA 3EY6A 1UWUA 2FVKA 4H8HA 3VXGA 2VFFA 3DDMA 3UETA 4ZMGA 3OPSA 5HJXA 5T26A 2G97A 3N2TA 3IJ6A 2MLYA 2ZR4A 3B40A 2VZUA 3G18A 4BA0A 3GXPA 5HNRA 4K38A 1NVMA 2KAUC 2GJRA 3KWXA 3MJMA 1I1XA 2HK0A 2IPJA 4HZ8A 3VDGA 5ABEA 3E12A 1W9XA 3KACA 1JUEA 5A6KA 4GCXA 3TSDA 3AIVA 1JGMA 3R94A 4L6DA 1H7OA 4IGSA 1CW2A 1H62A 4X2PA 2TSYA 2NSXA 1SW7A 4BQ4A 4A22A 4Y90A 2QAFA 2D3NA 3R58A 3QMRA 5DITA 1H60A 1R9YA 3FHAA 4WQ6A 3OLGA 1BVWA 2DT2A 1DKWA 1CIUA 4JTSA 4GI8A 4XZNX 3G0SA 1LM1A 3Q2DA 1WXYA 1HJUA 3LENA 1VFSA 4JL1A 3RUBL 4LRTA 4H41A 1EZ2A 4QG6A 4JQ4A 3GNPA 5HTGA 2A1YA 4IOTA 3OVQA 3ATZA 1UZHA 2HE8A 3GDBA 4C5YA 3LTYA 1RBLA 4M6PA 2IPFA 3GXFA 5G2IA 3VPLA 3HPAA 4B5XA 3SY8A 4UOZA 3WLHA 3L2IA 3MMTA 1E0XA 1XRVA 4MIMA 2B7NA 3BZJA 2ZR6A 4JFVA 4C7GA 2XM2A 3OOQA 3ARTA 3NQMA 3RMJA 2C1HA 4MNMA 5CPOA 1QI5A 3CAKA 3PZVA 2J75A 1EUAA 3GTFA 1VP5A 1UUQA 3OGSA 3EEGA 1J0ZA 4Z42C 3DCPA 3WQDA 1S5TA 1TV3A 1L0PA 3VGFA 2Z7KA 4JEJA 3RGCA 4TNSA 5D8ZA 3AHZA 3BURA 4YTSA 2WHKA 2EKGA 3ZR6A 1W5NA 1PBGA 1EFZA 3O16A 1WDDA 3PTDA 4XB3A 5J8LA 2IPWA 4D1IA 1FCVA 4GVFA 1WKFA 3FXGA 2VFIA 2WVVA 1FVPA 2FKPA 3PG8A 5G4EA 3TSMA 3WD0A 1U1UA 2DW7A 1UR0A 4JDYA 1VBJA 2GFTA 3WK3A 1VHCA 3BMVA 3UWWA 1F6YA 3OTRA 5D09A 1BG4A 1PKLA 2HRWA 3K13A 3PJUA 4XD6A 4YXGA 1VS1A 5E9XA 1SO4A 3FJ4A 4YVVA 4C1KA 3GO2A 8TIMA 5PTDA 3HM7A 3RR4A 2WANA 1FOBA 2EJ1A 5I24A 2DORA 5I23A 4CNPA 3VVGA 1JZ3A 4ERAA 2CKSA 4FNSA 4LUJA 4MHBA 4JZ5A 4W9PA 4KCWA 1TPDA 2ASHA 2BY0A 2FLIA 4Q22A 1Q6EA 2J13A 1UH3A 2B7OA 2WCGA 4NU7A 2Z7GA 1YTEA 2OYKA 5FEXA 4CNUA 1KTCA 3MCOA 1ZZMA 2DZAA 4ZOCA 2IXUA 1PINA 2YW3A 1S5WA 1EZWA 1XRSA 3CIVA 2P76A 3W7EA 3CL6A 1BXCA 5FJIA 3UGVA 2PWEA 3WENA 3XISA 2X2GA 2BTMA 3W27A 1Q6RA 1KM2A 1TTIA 5A6SA 2FJKA 2D23A 1VEPA 3KS5A 3RJXA 3BICA 1GQKA 4IH3A 3GR4A 3MDUA 3PG9A 1F3TA 1NEYA 2CLMA 1EDQA 5BNKA 3EYPA 1UMYA 3MSGA 2V2DA 3P2VA 1TVNA 1YPFA 1UD2A 4UCGA 5A69A 1NFBA 3SQMA 1DHPA 5F7UA 1T11A 1KD0A 2C8NA 4N4QA 4PRRA 3W1MA 4N9CA 4ASTA 3JYMA 1UUMA 4LQ1A 3FA3A 1EWEA 2QUUA 3KBMA 3NZQA 4DYJA 1NY1A 1SFTA 1XH2A 4PUKA 1Q65A 3R2GA 4FNTA 1K1DA 1E4MM 5BYWA 1OFOA 3VD9A 5K9CA 4BF9A 1JDCA 1LOQA 1Q6LA 2Q71A 4LTSA 3R1ZA 4DO5A 2V6AA 4GY0A 3TAKA 1GOOA 3PRBA 2WMFA 1PEZA 1UR8A 3BCFA 1LBLA 1KXTA 4US5A 4NYYA 4B5TA 1Q7QA 4IMGA 1FKRA 4H8NA 1XRFA 3VILA 5HPCA 3EDDA 1C91A 1QPKA 4NKCA 4R7OA 3SRFA 1OCNA 5HMEA 3H54A 1W5OA 4GQQA 3PBUA 1CLKA 3O5OA 1LG2A 3M0JA 3B0VC 4LAUA 3KUMA 5J04A 3SJ3A 3SECA 1PX8A 3NQCA 3VM5A 2WJZA 3TAOA 4EVZA 2OT0A 4IPJA 5HW7A 5I02A 5CJNA 3TSBA 3FJLA 4DO4A 5CPTA 1XLKA 4HCHA 3EIPA 5KZ6A 3BZGA 2VVNA 3ARVA 1X6UA 3VGBA 3VM7A 5H8PA 1PL9A 2BY1A 3OVPA 3LV5A 2Z1BA 2EG8A 1W9UA 1DWJM 2J79A 3AMCA 3M6DA 4J4OA 4JQ1A 3IIPA 3P0WA 2VURA 3K8LA 2J24A 4DB7A 4A8LA 1ESWA 1MMFA 3CC1A 3PTQA 2ITKA 3GIQA 3HBLA 3WN6A 3PANA 4AF0A 3FN9A 2HJPA 3U2CA 4PA8A 4PB4A 5JQ9A 1FH7A 1KRBC 5D2TA 4ECLA 3GAKA 1AZ2A 3C2RA 2C16A 4JNMA 3PRAA 2YLAA 1WUFA 2WPGA 1KRCC 4WGHA 1IXNA 3MMWA 1YYAA 4FF5A 4HZ7A 4H9VA 4S2BA 3LNPA 4EK7A 3RNDA 3W7NA 4HN4A 1SPQA 4W5ZA 4ODMA 4KIEA 4XVDA 5HA7A 3EXTA 4A29A 1ZPTA 3CV7A 4F40A 2I56A 2Y70A 3NWRA 1WDSA 2VGGA 2Y8UA 4JOMA 1CXFA 4W4QA 3VZZA 2YA0A 2JKPA 2JALA 1SFSA 4F0LA 3BLLA 2H90A 2QPSA 3MI3A 4UMBA 2CYGA 1R47A 1UR1A 2UY5A 1AD4A 4H2CA 4O57A 2GJXA 4LJ3A 5IM51 4IWWA 3GDMA 3AUJA 3B3DA 3CV2A 3PZGA 4AG0A 4EXAA 4WJXA 3D47A 3A13A 3N6QA 1YBQB 4PUJA 1WBHA 4PCNA 2PV1A 3NA8A 3HV8A 4MM1A 3W76A 2PDUA 4ZZ9A 4BEQA 4GY1A 4X0NA 2YYUA 5AOUA 1A0DA 3WLJA 3HFYA 4ATWA 1G4PA 1GORA 2ZFAA 1SFLA 2YCIX 1ITQA 3KX6A 2W4XA 4U86A 4NF7A 1QO2A 1GKPA 5A6JA 3ZZ1A 4IHCA 4K36A 1W3TA 4QAIA 3TTQA 4JN7A 1D9EA 4WY0A 3KCLA 1E6RA 1EHAA 4HP5A 5K4ZA 3B9EA 1HL2A 1W3HA 4U2YA 4Q6JA 4PMJA 3CWHA 1ITCA 1RJPA 3NXFA 1L1PA 1AVAA 3WLMA 4CGTA 1VEMA 2DH2A 2VR2A 1I2NA 1RJQA 1XISA 1XWYA 3SURA 1PIGA 1F07A 1NP2A 4TR9A 2OYMA 2F2HA 4AY8A 3ABXA 3ZSTA 3L4ZA 2FGZA 4UZUA 1A50A 2H8XA 1HXVA 5CAHA 5EL1A 4D8ZA 4O13A 4ZO8A 3SCUA 4ROPA 1LQAA 3P62A 1UD4A 3EWUA 1G6CA 5DCBA 4NNCA 3V16A 3N2BA 2XFYA 3TN3A 3O5KA 3MYPA 2CLHA 3B9NA 3B0PA 3MUIA 2J6XA 3W7IA 2WW5A 3CJPA 4LEFA 3VIKA 1OFPA 4Q8TA 1A3WA 1LLWA 5CG7A 2R1KA 4GFIA 2C15A 2F6UA 3WLQA 1DYSA 1YQ2A 1OZQA 1QI4A 4TVDA 3LZ5A 3MI6A 2GPTA 4MY1A 1XBYA 3FA5A 3H22A 4XBKA 2HBXA 5MKGA 2A3HA 2W91A 3M0MA 1L8NA 5AHLA 3O0KA 2Z1VA