1LG2A

Crystal structure of human chitotriosidase in complex with ethylene glycol
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
365
structure length
359
Chain Sequence
b'AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chitotriosidase
publication title Structure of Human Chitotriosidase. Implications for Specific Inhibitor Design and Function of Mammalian Chitinase-Like Lectins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 123
structure length 359
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1lg2A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1lg2A01
1QOXA 5GPRA 2ZUWA 1ESWA 1HNYA 2QMJA 3L4YA 2QPSA 3AHZA 2EPKX 4WJXA 3N04A 2WC7A 3RCNA 3VNZA 2J7BA 2J8FA 3L2LA 2PWDA 2GK1A 1W3HA 3PZTA 1TVNA 1JYNA 5M17A 1KCLA 3QOMA 2DDXA 3TA9A 4JKLA 1HVQA 5LA1A 1E6XM 3ARSA 3DHUA 3RILA 1PBGA 4W7WA 2WMGA 1RP9A 4P8XA 5AYBA 3GXMA 3AIRA 5C71A 3WH8A 2EPOA 3UR7A 3B9EA 2ESCA 3UEQA 1BGGA 1C90A 1US3A 1W9BM 1V6WA 3L4TA 2JEQA 5D4YA 4UZUA 3CLWA 5A1AA 1X1NA 3VD7A 4MNLA 2OSWA 4NF7A 2X05A 1UOKA 1UKQA 5ABHA 1V3LA 4MNMA 1UH2A 3WEZA 3WF3A 5D8WA 2V3GA 1KXQA 3GNOA 2J4GA 7CGTA 3I3BA 3RO8A 1MVYA 4GI6A 1W1TA 2VRJA 2XFFA 4E2OA 3WDPP 1UKSA 2BHYA 4PBGA 1QPKA 4GI9A 2HVMA 4CU8A 1J0KA 3PZGA 3T2QA 3TONA 1K6AA 4LYQA 1DWGM 3W28A 3WD2A 1MW2A 5EFFA 4A3HA 2WVVB 4HU8A 3WQVA 4AIOA 4PMUA 3M07A 3A4XA 1P6WA 4AD3A 2D24A 3EDDA 4PCSA 3LPOA 1JZ5A 3VDCA 1TA3B 3ZQ9A 4GZIA 2NT0A 4AIUA 1E3XA 3F4VA 4JKKA 4MJ2A 5ECUA 5BXTA 2D0HA 2G3NA 1GVYA 4DUVA 4U3CA 4S3KA 3VINA 4EK7A 5IDIA 3MMUA 1ZBCA 1GHRA 5E6YA 3B9AA 1FH9A 1D3CA 3IAPA 3WMBA 1VF8A 1JAEA 3CGTA 2J78A 1E3ZA 2ZOXA 3K1DA 4HA3A 1EIBA 3KWXA 1TZ7A 2XSBA 1KFWA 3CUGA 1EH9A 4OOZA 2X8RA 2VVNA 4L4PA 4QCFA 3UG3A 5CLWA 4JFWA 3W6LA 2DSZA 2O9TA 3VD9A 4E4PA 1E15A 4PMDA 3EDKA 2XHYA 4D71A 4EKJA 1ZJAA 2YBTA 3EDFA 1EOMA 2EJ1A 2W67A 3WH5A 3CUJA 4GO9A 5HPOA 1QI4A 4MB5A 3OLEA 3SUWA 2VC9A 3VGEA 3MUY1 5E70A 1UWTA 1KGWA 1VB9A 3VIHA 1FP8A 1OINA 5JBEA 1VFMA 3DC0A 1GQJA 4DWSB 2W91A 1KGUA 4CU6A 3K4AA 3PN8A 4QP0A 2NW0A 4XUYA 1C8YA 2DEPA 1JZ8A 5TD4A 3PTMA 4HZ6A 2F8QA 4W84A 1XD1A 3HU7A 2DSWA 3AS3A 3VM7A 4KRUA 4GI8A 1Q6DA 2QPUA 3VPLA 1E5NA 3B9DA 3WUEA 1G94A 1CLXA 2X1IA 5CQ1A 3U5UA 3D5HA 2V3DA 5KEZA 4WSKA 1X6NA 1PIGA 3CZEA 4PTXA 3ARVA 2VNCA 3M6DA 2PI6A 2WHLA 1JF6A 4J3XA 1NQ6A 1CXIA 1BVNP 1R85A 3WMCA 1NOWA 3TP4A 1G5AA 3AYSA 3N1AA 3GH7A 1CGVA 1XD0A 5A8PA 3WH6A 4AD5A 3WBEA 3IAQA 1MWOA 3AICA 3VGHA 5ABFB 1WPCA 3MKKA 2CESA 1UR4A 2ZWYA 1B30A 1QHOA 1XGZA 1GZJA 1H3GA 4M80A 2CBIA 3NIYA 6TAAA 2VJXA 4D6IA 1ZBWA 4AZ7A 2WLZA 5I2UA 1NH6A 4C7DA 1E40A 1NWSA 4JHOA 1V6VA 2D2OA 4JCLA 3W6MA 1QNRA 4FLOA 2O9PA 5AY7A 1PZ3A 3O6AA 2WW5A 4JL1A 4GINA 3ARQA 1C3FA 3WDHA 3WF1A 1B3VA 5FIPA 4GKLA 3AIWA 4TUFA 4UFJA 4JAWA 4IPNB 3L4ZA 1E9LA 1UR0A 3PZMA 1UD6A 1UZ4A 5I5RA 4E8DA 1MFVA 1UD3A 2GDVA 2ZX9A 4YHGA 5IFPA 1WKYA 5HXMA 3VX1A 2ZICA 1SFSA 1LJYA 1A3HA 1UA3A 1FA2A 1W9DM 2XVLA 5HPCA 4BZYA 1EQPA 1KXHA 4AY1A 3CUIA 3WNLA 1KQYA 3W24A 4CN6A 4JFVA 1OGBA 3OLDA 1UWRA 1UHVA 1NP0A 3AIEA 3FY1A 3HJEA 2WCAA 1KXTA 4C7GA 4DM2A 1KR1A 5D9PA 1W2PA 3VKKA 4P7OA 1E1EA 5CPSA 1ODUA 2J25A 1DHKA 2FH8A 2IXVA 3SCUA 1EHNA 1XYFA 4EE9A 3EDJA 3QR3A 1BTCA 3OIHA 3MO4A 4NI3A 3PZNA 4UZSA 3GTNA 4W8AA 1OM0A 4AEFA 4D6DA 4CN4A 4Z2HA 1XCXA 3VIPA 1TFVA 4GXPA 4X0VA 1ZBKA 1LF1A 1E6PA 4M1RA 5A6SA 3F5KA 1JZ7A 4PMQA 1NOUA 1CXEA 2F61A 2XIBA 2FHFA 2DSUA 2JALA 3ZJ8A 4JHZA 2CHNA 4CD6A 1JDAA 2PB1A 3EMZA 4ZXLA 2WHMA 3ECQA 1Q6FA 3ARTA 1E6QM 2ZUTA 4PMVA 3SCOA 1C92A 2GSJA 3N15A 2GUYA 4RE3A 1E4MM 1L0PA 3MMDA 3GBDA 1OBAA 2WMIA 7A3HA 1R7OA 4DWSD 1ITCA 1HP4A 2E8ZA 1K9EA 1PX4A 4PRWA 2VX6A 1JGIA 1OGSA 2A3CA 1E6SM 3ARRA 3F5LA 5D9NA 3EMCA 5CXPA 2XYLA 4WLCA 3OGSA 1BYDA 1CIUA 3AMDA 2CBVA 1TCMA 3SCSA 1QI3A 2VZUA 4HP5A 2J7HA 4FLRA 2GJRA 2WLYA 2BVYA 1KBKA 1TUXA 1VJZA 3FNDA 3GXIA 4CD5A 1RH9A 3DHPA 1KGXA 3APGA 1R7AA 4AZCB 4ACZA 2E0PA 1CTNA 1E55A 2VT0A 4MDPA 4W89A 1HKKA 3AXHA 4W86A 5BROA 4J27A 2XPKA 3BLPX 3HMCA 1WDSA 4OJYA 3G6MA 3POHA 3RM4A 3W26A 1W1PA 1EA9C 1B1YA 3NYDA 2QLYA 4KMQA 1Y7VA 2VI0A 2WAGA 5BXPA 2BY3A 1Q6EA 3WNKA 1QW8A 2C0HA 1XYZA 4NZCA 3WDJA 4GQQA 1V3KA 2D0GA 1GUVA 5ABEA 5HNNA 5A6BD 4ZENA 4UFLA 3W25A 1G9HA 1JZ2A 4PUEA 2CNCA 1JI2A 2D1ZA 1UQZA 3ALGA 3DYMA 2VZVA 1BGAA 5DF0A 4UFHA 4F8XA 4BQ5A 1J11A 3ZJ6A 5I23A 2OWCA 5JIPA 2GJXA 4HTYA 1JZ4A 3W81A 2CBUA 3CZLA 2C7FA 1FP9A 3RJXA 3N17A 3WFZA 1U2YA 3VVGA 4R27A 3N12A 1CYGA 4EAMA 3AFBA 2VRQA 2UY4A 4HPHA 2D20A 4NSBA 1QVBA 3AHXA 4F9DA 5FCZA 1OSEA 3K8LA 4IPLA 5A69A 3PZOA 3ZR6A 2ZX8A 3RIKA 5M5DA 1GONA 2V5CA 3VO0A 3WF0A 2DGAA 4RE2A 1PAMA 1EO5A 4CCCA 1R87A 2WMHA 2WVUA 4P7RA 3ZJ7A 1GOOA 3T2PA 2W92A 1OT1A 9CGTA 3FW6A 1BG9A 4H04A 2CCRA 1JNDA 5DFAA 3UESA 4AZHA 2RGLA 4D6JA 4DUWA 1HL9A 4W85A 3RMEA 3DECA 1OCQA 5I78A 2WSKA 1JZ6A 1F4AA 4P8UA 2Z1SA 2WC4A 2A3AA 1CENA 2E9BA 3WL1A 3B8SA 2ZUUA 8CGTA 3AMKA 4H7VA 1VEMA 2VUYA 3BCFA 1QNSA 5CPQA 1C7SA 3GM8A 1GOIA 3PTQA 4YPJA 5A6JA 1BHGA 1BG4A 1Q4NX 1JL8A 1G1YA 2WYSA 4W8BA 3SUSA 3CHCA 2VTFA 3AZTA 2CEQA 2ZUMA 1BYAA 3THDA 2XGBA 1JDCA 1E43A 4V2XA 4P7QA 2XVNA 1JYVA 2J47A 4IM4A 3KZSA 1MXGA 4PTWA 3UERA 3EMQA 4X9YA 2CHOA 1RP8A 1J10A 3WNPA 4Z2IA 5LYRA 3ARYA 3VMNA 4TVUA 3W4RA 1QNPA 1J12A 4XB3A 1M04A 2EXOA 5IXEA 4PMXA 2PWHA 2VCBA 2UY3A 2YDRA 3BAWA 4UQDA 4P7LA 3UG4A 4CD7A 2BVDA 1JIBA 1HKIA 2O9OA 5DEZA 1JDDA 3HN3A 4MPKA 1YHTA 2YA2A 1EDGA 1WDPA 4IUGA 1EDTA 3GNRA 4MJ4A 4P8WA 4Q22A 1GQIA 5D9MA 3WENA 1L8NA 4PSPA 2BY2A 4FMVA 4TOQA 4CCDA 2B31A 1H41A 4U31A 1E6RA 4JKMA 5KZ6A 1BLIA 1VAHA 2BHUA 1BF2A 3U57A 1BAGA 1GQKA 4D6FA 1FH7A 5A6AA 4F9JA 1A47A 5BXRA 2WBGA 2A3BA 4LX4A 2DT3A 2ZUSA 2PWEA 5I79A 3TTYA 1GOQA 5GNZA 2XM2A 4F66A 5I6SA 2D22A 4PTVA 2FGZA 4HOZA 4L4OA 3SCVA 3VU2A 3GYCA 4Z2KA 2TAAA 3AZSA 1QW9A 1EQCA 4AW7A 4W7UA 3VUPA 1UR8A 4N42A 4AZ6A 3FHQA 3BGAA 5A8OA 3OBAA 1V3MA 2GFTA 1UKPA 3AMLA 4QLKA 2DSVA 2G8ZA 5F7UA 1XH2A 2WKLA 1NARA 1CGWA 1UYQA 2E9LA 2J79A 2IUZA 4D6GA 1CXKA 1XSJA 3SUVA 3N13A 1JXJA 2D23A 5FL1A 1QNQA 3VM5A 2WCGA 2VL4A 2DPEA 2DT2A 1V0KA 1HL8A 2G3MA 5FOOA 5EBAA 4ZEPA 5CG0A 1DWHM 1UKTA 1ZS2A 4J3UA 1JD7A 4KRTA 1E4NA 1WDQA 1V3HA 1J18A 1EHAA 3KEHA 1JNEA 4CKQA 1VBRA 3AIBA 3M7SA 1B90A 1LQ0A 2EO7A 2GK1B 4PCTA 3T2OA 1MXDA 2WNWA 3VMPA 1GORA 3FHAA 1BPLB 1TE1A 1W1VA 1VBUA 1S46A 4OBSA 3LPGA 3W27A 3K4DA 1VFOA 4H2CA 2EBNA 5JH8A 5IHRA 1UD4A 2VX7A 2ZX7A 2YKKA 2VZTA 4OIFA 4QFUA 3WH9A 4U3AA 5DO8A 3PZIA 1YQ2A 2WHJA 3WF4A 4D1IA 4UFMA 5A2AA 1CGTA 1MW3A 1GPFA 3MV11 2E4TA 2JF6A 2WANA 4GZJA 2CIPA 1HVXA 1WDRA 4PMOA 2RGMA 2PBOA 3L4VA 4BQ4A 3ZIZA 3AOFA 2O92A 1V08A 3CMGA 1D7FA 3VDAA 3A4AA 4LYRA 2CYGA 4AYSA 5CPTA 3RDKA 2WWCA 4MNKA 1GOMA 2YBUA 3J7HA 4NRSA 2XVKA 2QV4A 3EBVA 3QHNA 1UKOA 3PZVA 3OZPA 1H11A 2FHCA 1J0JA 3WF2A 3ZSSA 2DSKA 3NSMA 1ISYA 1W9PA 4D6HA 3SCPA 2AMGA 3O9NA 1RPKA 1BFNA 2X2YA 2XGIA 3WQWA 4CUCA 3RPMA 1EGZA 1UH4A 1HKMA 1HT6A 1JFHA 4P7NA 1E5JA 3QOKA 3W53A 1KB3A 7TAAA 2W62A 2YL5A 5JBDA 1ZBVA 2DT0A 3GDBA 5GNXA 1MFUA 2WVTA 2BXYA 1UUQA 3WBAA 4A3YA 4CVWA 1W3LA 3VDBA 4JL2A 2A3HA 3BXWA 4YN5A 1Q6GA 2VX5A 3NJ3A 4JFTA 4AZCA 3OG2A 4IISA 1B9ZA 4OBRA 4UQ9A 2FGLA 2YDSA 2VCAA 4W5ZA 1WE5A 1UD2A 5JBFA 5BRQA 3W37A 3RM8A 4UQCA 4QAWA 2WKGA 1W9VA 2WK2A 1K9TA 1C93A 2WMJA 1UR9A 1V6XA 4AZIA 3A4WA 3A3HA 3W38A 1VIWA 1TVPA 2ZXDA 3BH4A 5A6LA 1H09A 1E70M 1R86A 5A8NA 2JFEX 4AXNA 2MANA 1D2KA 3T0AA 2VO5A 1OIMA 1CGXA 3OLGA 3MSDA 3WEOA 2WWDA 1IZJA 3SIMA 2EQDA 1J0IA 1H5VA 2UY5A 3ARPA 2D0FA 4MDOA 4AEEA 1MW1A 4D6EA 3WMSA 2WPGA 5ABGA 1FFRA 2AOSA 1PZ2A 1O7AA 2J62A 2ZWZA 1J0HA 1H0GA 5E09A 1Z32X 3BAJA 3MSGA 1B0IA 2UY2A 4WK9A 1GNXA 2AAAA 3WKZA 3N11A 2PBGA 3L4UA 4PUDA 4U2ZA 5A2BA 4ML4A 3IJ8A 3L2MA 4TVCA 1EXPA 2CPUA 2IXUA 5DMYA 1VFFA 4XZWA 4J28A 5EFDA 3NDYA 1XH1A 3AS2A 3VDHA 3WQ4A 3AXIA 3ZJKA 1VRXA 4LQ1A 3ZT5A 3G6LA 4DM1A 2WM0A 4TXEA 2XTKA 1W3KA 1CBGA 1FOBA 3AS1A 3CMJA 1JG9A 3SCWA 2ZXBA 1W3JA 1EDQA 1V0MA 1AQMA 5I77A 1PX3A 4ACYA 3IJ9A 3U7VA 2V3EA 2BS9A 3IJ7A 1FHDA 1US2A 1HJQA 2WVSA 1HJXA 1J0YA 1XCWA 4LGXA 2CERA 3VILA 3UG5A 1ZU8A 4XX6A 3N18A 4W87A 3OB8A 4PEEA 3SUTA 1CDGA 5E0CA 3WFLA 3T09A 4WSJA 1JYXA 3CTTA 4JCMA 2VX4A 1VENA 2BHZA 4PMZA 4C7FA 5A6KA 3VIMA 3CZ8A 3MUIA 1PIFA 4M29A 3II1A 1B3YA 3PZ9A 5A6MA 1CGYA 4MB3A 1ITXA 2G4FA 3NSXA 1QI2A 5EMYA 2ZUNA 3WD4A 4TTUA 3AMGA 1FHLA 1UWIA 5JUVA 1RD6A 2Y2WA 4BF7A 5JIWA 1CXFA 4UTFA 3ZO9A 1XRVA 3T0DA 1E73M 1GHSA 4QLJA 2W61A 5AC5A 1VEOA 2WVVA 3PTKA 1C91A 3SCNA 4HOWA 4UOZA 2D3LA 2QHAA 1BYBA 3AHYA 3WDQA 1V03A 4Z2GA 4B15A 2WXDM 3AROA 1TA3A 3VIOA 2YA0A 5FD0A 1FH8A 2WSPA 4EANA 5BYWA 2EPNA 4WIWA 3GBEA 4Z2LA 3VGGA 4AD4A 2VZOA 2Q8XA 4CD8A 2VZSA 2YIHA 1ISXA 2J7CA 5LA2A 2XG9A 1V02A 1W1YA 1H2JA 1EO7A 2O9RA 2CITA 1LL4A 1C8QA 1GQLA 1TMQA 4HA4A 4FLQA 1OD8A 1WNOA 5EB8A 2DT1A 1JI1A 4AD2A 1LWJA 1UG6A 3BAXA 1M03A 1OIFA 3DYPA 3GNPA 4F79A 1KQZA 1E56A 4JFUA 2VR5A 1OWQA 1J01A 3M46A 3JUGA 3VTRA 3I3DA 5AYIA 3SEPA 3TOPA 2YOCA 4OUEA 1UH3A 3S6TA 3VIFA 3UETA 3UR8A 1BYCA 2ZE0A 4AZBA 5DT7A 1XH0A 3K46A 1BVZA 1B3ZA 3AIUA 2WMIB 4H8UA 5A2CA 4DWSA 2VCCA 4M81A 3WN6A 2EEXA 4UNIA 4TX8A 4W7VA 2W63A 3BAYA 3ZT6A 5CGTA 1R8LA 4MAVA 3RM9A 3ZMRA 4URIA 4D1JA 4GIAA 1QBAA 4HOXA 3CZJA 3BLKA 5BXSA 2Y4SA 1PJ9A 2DIEA 1AVAA 5A8MA 3CHEA 4GPNA 4B3LA 4TVDA 3A47A 3WIJA 1MQQA 1KXVA 1F4HA 2WMKA 1MW0A 4ACZB 1I75A 4BQ2A 4KGJA 5I0DA 1ISZA 4PMNA 1PEZA 3CO4A 5CSYA 1KWGA 4M8UA 4A4AA 3ZM8A 1CWYA 3CUHA 4PMYA 1GW1A 1CECA 2WZEA 4UFIA 1BQCA 1ZB5A 1I1XA 3NUKA 1M01A 5HDRA 3DYOA 3BC9A 5BWFA 1H4PA 4LPCA 5E9AA 1SMAA 2VMFA 1KWKA 3EDEA 1EOKA 1HJWA 1LG2A 2CETA 3PZQA 3F5JA 4H8VA 5ABFA 3AHVA 4J3VA 3GXFA 3L4WA 4ATWA 3VIGA 4KH2A 2OWWA 4MB4A 1ECEA 2NT1A 1U33A 1WAWA 3AIVA 1DWIM 1W9XA 4M82A 5A6BA 5CZKA 1TR1A 4ZE4A 1CGUA 1WZLA 1SMDA 2ZXAA 3BSGA 1GOWA 1M53A 2VOTA 2EPLX 1MYRA 3MUZ1 3TTOA 4XV0A 2UWFA 3VGBA 4J3WA 2BY1A 1WZKA 3VD3A 1NWTA 1GCYA 2HISA 2E8YA 4X0NA 1V0NA 1CNVA 3ARUA 2Y8VA 4AWEA 1B3XA 2GJXB 1DWJM 3S2CA 4M56A 5I3DA 2JF7A 1UWUA 4TTGA 1QI0A 1PX8A 3CZKA 1NWUA 5IHSA 1SYTA 1IZKA 4U33A 4FK9A 5D9OA 3AZRA 1V6YA 1WCGA 3CBWA 4CU7A 2YDQA 3WNNA 3T0BA 3MMWA 4FF5A 4MAZA 2FHBA 4QCEA 5E6ZA 2ZX6A 1W2VA 3ARWA 2WZIA 2E9MA 2A3EA 2OSYA 4V27A 2D3NA 2V38A 2GDUA 2VQUA 3FAXA 2DIJA 1V3IA 3CZGA 3ZSTA 1C8XA 1CZ1A 2VRKA 2V5DA 1C7TA 2VQTA 3LPPA 1DWFM 2XM1A 1WO2A 3PHAA 1K9DA 4BA0A 2QMKA 4AZGA 3SURA 1OGGA 2OYKA 2WZHA 3OA5A 2BV9A 1UZ1A 1XV8A 2FH6A 4W8LA 1UQYA 5E0FA 1MQRA 3THCA 1LL6A 1B31A 1HF6A 1W32A 2OWXA 3BAIA 4AMCA 2J74A 3POCA 2PF0A 2BFGA 4CCEA 1GVIA 3CHDA 4HMDA 5CGMA 1E0VA 4GZEA 3A6OA 3BMVA 1E4IA 4HMEA 2OYLA 3ZT7A 4ATLA 4P8VA 4M24A 5DT5A 4ZFMA 3WD0A 1W91A 4TX6A 3U5YA 5FL0A 1J9YA 1JAKA 5FKYA 1CEOA 4AC1X 4PTMA 3VGDA 3MS8A 4BS0A 2E40A 2YL8A 2C8NA 1WB0A 2JIWA 4OKDA 6A3HA 1AMYA 1J0ZA 1VFUA 4WKHA 3IK2A 5I24A 2W66A 3AHTA 3WELA 1HJVA 3WNOA 1E1FA 3ALFA 2PWGA 4LXFA 3LPFA 2YLAA 1HJUA 1LL7A 2OLHA 3WH7A 3AS0A 3BMWA 1CXLA 4QDMA 1N82A 4AD1A 3WY1A 2VURA 1K9FA 1VJSA 1HN1A 2WCSA 6CGTA 2DH2A 1E4LA 3CIVA 1KR0A 1GJUA 4CD4A 2XFRA 3AQUA 1UR1A 1V0LA 3QHOA 1O6IA 1SR0A 4DWSC 4XZBA 1DTUA 1HJSA 4J3TA 1JZ3A 3OGVA 4B9ZA 1V02E 3KL5A 4UOJA 3VGFA 5M3WA 5GQBA 1UWSA 1W9UA 5M03A 3FXYA 3WEMA 1JD9A 2BNJA 2XSAA 4QLLA 4HMCA 4WKAA 5CJ5A 3TTSA 4MTVA 1HX0A 2G41A 1QBBA 1QI5A 2WBKA 1FFQA 4N0RA 1G01A 1XC6A 3VOCA 4W5UA 1DEDA 2XWDA 3SCRA 3RJYA 1OB0A 3SUUA 1XSIA 5IFTA 4R5EA 4NRRA 4H8HA 3CHFA 3VIKA 2ZX5A 2X0HA 1GOKA 2XFYA 3AXXA 3OLIA 1AQHA 4YHEA 3MANA 1DP0A 3FAWA 3WQ5A 3GH5A 4BQ3A 1NOFA 3UCQA 4Y7EA 4V28A 3MV01 3ZR5A 4MADA 2VVSA 2J7EA 4K68A 1ISVA 3CH9A 3U7BA 3BAKA 3O2LA 1ZL1A 4PSRA 5LA0A 1HIZA 3PZUA 3WUFA 4Q7NA 1KCKA 4HPGA 3NSNA 2WMFA 4WF7A 2YJQA 1H0IA 3QHMA 2JIEA 4JFSA 3KE0A 2XJ7A 2Y24A 3IANA 2ZIDA 3L4XA 5CLTA 5HBFA 3KL3A 3ZOAA 4UOQA 4MB1A 5A8QA 3AMCA 4D72A 2Y5EA 3AYRA 3NDZA 1XSKA 4AISA 4GO8A 1JFXA 4U5KA 2G3JA 1BSIA 3W0KA 4OOUA 2XWEA 4UCFA 2JEPA 1UA7A 2GJPA 3N9KA 1E0XA 5D8ZA 3WDIA 4UQBA 2ZXQA 2QF8A 1LLOA 4AZ5A 4S3JA 1CPUA 2Y8KA 3WUGA 3GZAA 2CKSA 4DUXA 2J7DA 3BSHA 1ODZA 2YLLA 3W82A 2J8GA 1NWRA 4Z2JA 1UD5A 1E72M 1E6NA 1B3WA 3SCQA 3BCDA 3CUFA 2VR4A 3MUAA 4B16A 4WKFA 4PN2A 2G3IA 1JYWA 4B3KA 2PWFA 1UR2A 1H1NA 3SCTA 1I1WA 3WQ6A 2GVYA 4AIEA 1HXJA 2Z1KA 3KL0A 3W29A 3ARXA 4E8CA 2XIIA 4PYSA 3MU7A 3FN9A 3VIJA 2OSXA 3VIIA 2W4XA 2J75A 2FDMA 1JF5A 1X6LA 3K8KA 1UWQA 4B9YA 4MNJA 1UD8A 1CLVA 2CXGA 2JE8A 4FLSA 2CKRA 3LMYA 5C8BB 2J7FA 1V3JA 2BVTA 4UR9A 2XVPA 2BY0A 4CVUA 3E1F1 1QHZA 4ZE5A 1NP2A 2XUCA 3WD1A 1HP5A 2EPMX 1MQPA 1LWHA 2J77A 3QGVA 3WUBA 4CGTA 1HKJA 1TG7A 2J7GA 1JXKA 1ZJBA 2XVGA 3VD5A 3AISA 1OD0A 1M7XA 2E3ZA 4LYPA 3AJ7A 3T08A 1ISWA 3AI0A 4UQEA 1LG1A 1VEPA 2YL6A 4KGLA 3WQ8A 3EYPA 2WB5A 1NM9A 2YL9A 1G0CA 1WZMA 5CSUA 1E71M 5C70A 4RL3A 5AC4A 4RE4A 4HA1A 4GQRA 4J3SA 4W93A 5GNYA 4JZ5A 2DQXA 1KBBA 3WL0A 1V6UA 1B2YA 5HOSA 1E0WA 3D3AA 4UQAA 1WZAA 4U2YA 1IT0A 1AQ0A 4H41A 3VMOA 1E6ZA 2WC3A 4HU0A 4D6CA 4UFKA 4W88A 3CPUA 1Q6CA 8A3HA 5A94A 2V3FA 4JIEA 4J7RA 3WD3A 4AD0A 5A3HA 2W5FA 1H49A 3AIQA 4HZ8A 1WP6A 1U30A 2F2HA 3WNMA 3GXDA 2WHKA 3VD4A 2CBJA 3NCOA 4ZXOA 3K8MA 2OYMA 1PPIA 3OZOA 4PMRA 5A95A 1QHPA 3ARZA 4KWUA 4OZOA 3OGRA 1XHGA 2PC8A 4BCEA 2NSXA 3I3EA 1QNOA 2X09A 1CXHA 2X0YA 4U5IA 2BXZA 5BRPA 3GH4A 2YA1A 4ATDA 3WDRA 4HZ7A 3VNYA 3TTQA 1DWAM 1OT2A 4CN1A 5BCAA 3PBGA 2DH3A 2ZUVA 1IV8A 3WSUA 3VX0A 1GJWA
chains in the Genus database with same CATH superfamily
2REQA 5GPRA 1YDYA 4IQJA 3PBUA 3RU6A 4A3UA 3H4WA 2EPKX 5DQPA 3TKFA 2I7GA 2J8FA 3L2LA 1M7JA 5HWJA 4RLIA 1EJTC 1FWNA 2RUDA 1MUMA 3PZTA 2BZNA 4OV4A 4RDWA 3TA9A 1HVQA 3LLXA 1WV2A 1E6XM 3K1GA 1QCWA 3Q45A 4J2PA 3VK5A 3AIRA 5C71A 1I9CB 4GFIA 2EPOA 4HGXA 3QZ6A 5LGXA 2PV3A 3C56A 4PE8A 1C90A 3UXAA 1W9BM 1V6WA 3O7UA 3CTLA 4H8NA 3WLMA 1F3EA 4GABA 4FO4A 1X1NA 1TREA 4K2SA 4NF7A 3S6OA 1UOKA 5ABHA 1VPQA 3TSBA 4RPQA 4DI9A 2V5JA 2V3GA 3GNOA 5CZSA 2OT0A 3EX4A 3RO8A 4GI6A 5G2IA 4RDYA 4H00A 2VRJA 2XFFA 2P50A 2AGTA 4JTKA 4YL2A 3A22A 3W84A 5H8MA 1S2TA 1XW8A 2HVMA 4HNCA 3TONA 4LYQA 4UCGA 3CQJA 3GNNA 4DF1A 4JTLA 3W28A 4H9TA 3WD2A 4YIWA 5B80A 1MW2A 3SY5A 2WJZA 4PMUA 4LH8A 3EDDA 1QXLA 4TU1A 2Z27A 4RDVA 5CPLA 3O5JA 3ZQ9A 4YVPA 3TV8A 1GZ1A 4AIUA 1M1BA 1C29A 5BXTA 1F8MA 1KT1A 2YCJA 1GVYA 4IPPA 2LKNA 3TYUA 4NHVA 4ROQA 3URBA 3IAPA 3WMBA 3CGTA 3W76A 1M41A 6ENLA 4MWAD 4HA3A 1QK2A 3P5YA 5BZAA 2X8RA 2VVNA 4QCFA 3UG3A 4QAIA 4Z1YA 2Y63A 2PS2A 2P0IA 3DENA 5AZ1A 1LM1A 1E15A 2PPOA 2W6RA 4EKJA 1ZJAA 3EDFA 4UMBA 3WH5A 4J4KA 4C90A 4GCXA 1DIOA 5D02A 4TQTA 3SI9A 4CLMA 2I9EA 4ZQCA 3W86A 5T9BG 3M0IA 3MUY1 5E70A 1TJRA 1UWTA 1KGWA 3VIHA 1VFMA 2IKHA 2BASA 4DWSB 2HS6A 2W91A 3SAZA 1KGUA 3W72A 3R79A 2VUNA 1LBLA 2QUNA 3STPA 1C8YA 3PTMA 2F38A 3W6YA 1T8QA 2POZA 2MUCA 3WCZA 3H4GA 1O5RA 2P3EA 3E6EA 3VM7A 2YZRA 3VPLA 3B97A 1X98A 2E1WA 4LANA 1UIOA 1N8FA 3QLDA 3USZA 3KAOA 1G94A 1CLXA 4LVDA 3DFOA 4MVAA 4XO6A 2V3DA 4AVNA 4DO5A 4WSKA 1KKOA 1X6NA 1JPKA 3ARVA 2VNCA 1PUDA 4FOUA 2PDHA 2AL2B 2C14A 5EMMA 3KAGA 1CB7B 5JVLA 1QPRA 4A22A 3H9RB 1Z9AA 4G2DA 3C3NA 1DJYA 3AAMA 1K8ZA 4QDPA 4L1WA 1FCQA 2FKEA 3GUGA 3AICA 1R9HA 1YE6A 4BY3A 1OCNA 3WX7A 5CGQA 1UR4A 2ZWYA 1B30A 4B5XA 3BOLA 3O0KA 2P4VA 1XGZA 1H3GA 2WZTA 1J4IA 4GX9A 2VJXA 4D6IA 3FYYA 2O4QA 3B40A 1WA3A 2UV8G 1DJGA 3LZ5A 3T40A 1OYCA 4C6OA 1V6VA 2D2OA 4TIMA 1LRTA 1QNRA 2O9PA 1KM0A 3GHSA 1PZ3A 2A0NA 4JL1A 1C3FA 3WDHA 1GTEA 2E5DA 3WF1A 3AIWA 1UPMB 4UFJA 1MUWA 2ACRA 1UD6A 5EL1A 5I5RA 4FALA 1BTMA 2PLJA 4IUOA 2HBVA 3QMRA 4NJGA 5IFPA 1S5NA 1WKYA 2XP7A 5HXMA 3ES8A 1YW1A 2Z1XA 1W9DM 3UXKA 2FQIA 3P81A 1KXHA 2E6DA 3CUIA 4JFVA 3OLDA 1LRQA 1XYMA 1FWSA 2PDBA 1F61A 3PBYA 1IR2A 2V69A 4A05A 3URQA 1EIXA 1OFPA 1ZP3A 2LJ4A 3PWIA 3TNOA 4DM2A 2YX0A 3L67A 1XLLA 3PP7A 1WUEA 3EZ4A 3TWAA 4IJBA 4AAJA 3R13A 3SCUA 3LU2A 4EE9A 2OR2A 5FI8A 3QR3A 2WNNA 3OIHA 2QJNA 4DI8A 4AX7A 4UZSA 5J8LA 3H24A 3NXLA 1FKBA 1LOSA 1CCWB 1J8VA 4D6DA 3M0MA 4KRZA 1EGMA 3O5RA 1YKWA 3LY0A 4O1FA 3UJRA 4ZS6A 1LYXA 1ZCOA 3QPEA 4GXPA 4HPNA 3CUXA 2NV9A 5A6SA 3ODKA 1TV2A 3B4UA 1NOUA 1CXEA 3S8HA 2F61A 3OQ8A 2FHFA 4L3NA 2JALA 2ZQTA 3BGJA 3FKRA 4JXCA 3SQMA 4CD6A 5HR7A 2GWNA 3HMJG 3EMZA 2WHMA 3CYVA 1E44A 3I4EA 2OX1A 3CYJA 3M0JA 2QCCA 3TCSA 1EWEA 2GSJA 2A6LA 1E4MM 2TODA 2J24A 3MMDA 4BJHA 3W2JA 1D7HA 4IPJA 1ZJIA 1OBAA 4M0XA 3VC6A 2EF9A 5G5IA 1SZEA 1JULA 1QPLA 2F4EA 1Z41A 4HNUA 1NFPA 2V9DA 1VRDA 5CCZA 1OFEA 1Q6LA 1OGSA 1BD0A 3W2KA 3ARRA 4WLCA 4PEKA 5CPOA 3DIPA 3AMDA 2A1YA 2CBVA 4MY1A 5LIUX 3NZQA 1QI3A 1B6CA 2J7HA 4FLRA 1A5CA 3UGVA 3CXOA 1QR7A 3FNDA 5E5CA 2ODOA 1RH9A 3DHPA 1R7AA 2MNRA 5HWNA 4DHGA 4I9TA 1CTNA 1E55A 4MDPA 1KLZA 5BROA 4J27A 2XPKA 4YTRA 3HMCA 1WDSA 3G6MA 3POHA 3RM4A 1S3TC 4RZ6A 1U1HA 5AKQA 4LRTA 3FSUA 3T55A 1BKSA 4QT3A 2BY3A 3Q65A 2C0HA 2HE5A 1R3YA 2EG6A 4BF9A 1R46A 1XYZA 3TAOA 4NZCA 1MI3A 4L7ZA 5ABEA 5A6BD 3W25A 1JZ2A 1NELA 1XGEA 1JCLA 1NTHA 4BR1A 3ALGA 1Q6UA 4N6FA 4ZOEA 4Z0SA 4RDZA 1S2UA 3TCEA 2VFGA 2I5IA 3UI5A 4CCZA 3GPKA 4R9XA 5I23A 3EEGA 4CQDA 5AYZA 2RSEA 3TTEA 3W81A 3CZLA 1JCHB 3RJXA 3WFZA 1XYLA 3N12A 1CYGA 3IKGA 1XF0A 2UY4A 4NSBA 1PWMA 1OSEA 3K8LA 3PZOA 1FJDA 5M5DA 1GONA 2WQDA 4C6CA 1EBHA 2RDXA 4GLEA 4Y8FA 5I3KA 1ONEA 3V1PA 2DGAA 3QSTA 4H83A 2PF8A 1EO5A 4LS0A 1R87A 4Z08A 3NPVA 2PPPA 1YPIA 3HV8A 4YVVA 2OODA 4LAMA 4DF0A 3NQ7A 1A7XA 2PODA 3QF0A 1DORA 1DIKA 1TJ0A 4D6JA 4ZODA 2E1DA 2WSKA 3VKCA 1CENA 3B8SA 4IFKA 1IF2A 1Z69A 2VUYA 1XBYA 1K70A 4RJEA 1M5WA 2PD5A 3SFWA 3E0LA 3W3OA 1GOIA 2BTMA 4B5VA 3JU2A 4YPJA 2CLKA 5K9XA 1Q63A 3BJFA 3Q94A 3W7NA 2PZ0A 4ADSA 1JPDX 4W8BA 4KFOA 1AD4A 1VD6A 3H2OA 4IGMA 2ZUMA 3THDA 4ZCWA 1PO9A 1RA5A 1JDCA 1E43A 3O5OA 2J47A 3ITXA 1MXGA 1JPMA 3EMQA 1XXXA 2CHOA 3NL5A 1RP8A 1J10A 5TF0A 2HBXA 3KHJA 3WNPA 5LYRA 3VMNA 3CQHA 3W4RA 3FS2A 1QNPA 2F7FA 2PRLA 3BLFA 1QUMA 3WFAA 2OMAA 1WXZA 4XKYB 3W1QA 2GWGA 3QY8A 3KVMA 3HG4A 2PWHA 4IT6A 3DI1A 2OZTA 4KIRA 1RSCA 3UG4A 4ZO7A 3RLHA 4KESA 1JIBA 1HKIA 4RX0A 3L9CA 1SVDA 2O9OA 4KS0A 1JUEA 4JNYA 2F23A 4P5UA 4PUNA 4IUGA 3P61A 4XAYA 3UCDA 4MKVA 4MJ4A 4LUYA 1G6CA 2C18A 3CAVA 2QNEA 1L8NA 1A4LA 4TOQA 4NU7A 2GVEA 4GIYA 1WDWA 2B31A 1H41A 1E6RA 2CLPA 4Y9MA 2NWRA 3MVTA 2C19A 2FFCA 3HTWA 3EX1A 3SW6A 4D6FA 5A6AA 1P4CA 1A47A 2X7VA 3EKZA 2A3BA 4LX4A 2DT3A 3C0SA 2PWEA 5I79A 3TTYA 9XIAA 3LDVA 3W9ZA 3VU2A 3CV6A 3TQ0A 3DBNA 1EQCA 4GYPA 4W7UA 3VUPA 1UR8A 2ISVA 1FKWA 3FHQA 4QG9A 3BGAA 4RPPA 4A35A 1B57A 1A0CA 2PGRA 3W2UA 1FWFC 3AMLA 1Z8AA 4NNBA 5EYWA 3IVTA 2FZ8A 1PS9A 4JQ3A 1NARA 1ZPTA 5F1UA 3B4YA 2E9LA 5AHIA 1XSJA 3SUVA 4YTUA 4GOAA 2D23A 1SW3A 3WZ0E 2VL4A 2DPEA 1OEPA 1V0KA 4LT9A 4JIIX 3NM1A 5DX7A 1UCWA 5EBAA 4HKPA 1ZS2A 2IPGA 4TX0A 1IT7A 1JD7A 2QAPA 3IGHX 2J88A 1V4YA 1J18A 3WLOA 4DRQA 4A3QA 3M7SA 3W1RA 1KA9F 4D8ZA 3KFTA 4O8AA 2EO7A 2BB0A 2YCEA 1TJPA 3T2OA 5CBJA 1WKFA 1TWIA 3FHAA 2ZR6A 3W7LA 2ZR4A 1TE1A 4YTQA 4BF8A 1GYNA 3LPGA 3TMLA 3W27A 5J04A 2PMQA 3W00A 3D46A 3UXIA 1VLIA 4GY7A 1XG4A 5HULA 2R94A 3PUDA 3H12A 3HPZA 2VZTA 4OIFA 3N6JA 5DO8A 2DW7A 2BP1A 3WF4A 1MW3A 3O15A 3MV11 4AQLA 3SY8A 2WANA 3MTWA 4NZ1A 5E1QA 4K8EA 4PMOA 3L4VA 2GLKA 3V35A 4BQ4A 4JYFA 1V08A 1L6WA 3A4AA 1POJA 1Q45A 4LYRA 3ONBA 2GGIA 4RXFA 3MUCA 2P5NA 2PGWA 2ZTKA 1VHCA 3NQ2A 4WEVX 1TRDA 4TV5A 4KIEA 4EPEC 2ZZ4A 5DRCA 3L23A 1OC7A 3S5SA 3ITTA 1XS2A 4QS6A 1P48A 4NJHA 3LOTA 3WF2A 4PGLA 3D3FA 4H01A 3O5KA 1BFNA 4ZSUA 1I60A 1FQ0A 4LB3A 1UZHA 1EGZA 1HKMA 2PU1A 3NEHA 3ES7A 3W53A 3ME3A 1OYAA 1F05A 4A8NA 4YYCA 2FVLA 4KWOA 1DTNA 4XTDA 1MFUA 5GNXA 1UUQA 4O50A 4R88A 4HJFA 4YN5A 2CZFA 4H2HA 5CAHA 4JFTA 1QDSA 4AZCA 3OG2A 4NAEA 4MWAA 3PWAA 1YTEA 1WE5A 4KEUA 3D6NA 4J4NA 3SRFA 5JBFA 5BRQA 3VUSA 3W37A 4UQCA 3BE7A 3AJXA 2PPNA 2HZGA 3JVAA 1ICSA 4PUMA 3TWBA 3A4WA 2WZMA 2XH2A 4JQ1A 5A6LA 1Q2RA 1KM2A 5A8NA 1TPUA 2NQLA 3T0AA 3OLGA 4I9JA 3C3UA 3GLCA 3A9BA 4QTGA 2QKFA 3H7RA 3VOJA 1P7TB 2VCDA 3VYLA 4JN7A 3WMSA 1M5YA 5CAKA 1RR2A 2AOSA 4L72B 2RDTA 4CNOA 5LHFA 4KCTA 4AF0B 2J62A 5D05A 4N9BA 3GDTA 3LLDA 4C6QA 3W22A 4C1KA 3WK0A 3P14A 1B0IA 3QKEA 2UY2A 5LHEA 3FSTA 4PC8A 4DH0A 3RHGA 2PBGA 3L4UA 4PUDA 3GTYX 5ABTA 1EEXA 4AHQA 2DZSA 3IJ8A 3L2MA 1EXPA 1DJWA 1FKGA 3NR0A 1VYPX 3KW3A 4LTSA 2IXUA 2VXNA 4XSLA 3LG3A 3R94A 4QXIA 2PDJA 3WQOA 1LBMA 2R1KA 3VDHA 2Y6ZA 3GVQA 4O1AA 4G5DA 4DM1A 1DIEA 1PYMA 2EG7A 3N6HA 1A5BA 4JTRA 3G1YA 3AS1A 3CMJA 3M1ZA 1AODA 1TSIA 1FDZA 3LXBA 3T0CA 3W7MA 3C0QA 3GG1A 1JCNA 2V3EA 5F2GA 1GKQA 2BS9A 1VFLA 3QV8A 3FYOA 2KGJA 1IX5A 5H91A 3UWQA 3VILA 3N2OA 2GGEA 5DIUA 4XX6A 1XIIA 3OB8A 2NVAA 2KAUC 2RJHA 3WFLA 1UJQA 1LOQA 1JYXA 3NM3A 5MKGA 1VENA 4I3GA 5D2VA 5EMUA 1EPXA 4QEEA 3NQDA 1TMHA 4M29A 3II1A 3PZ9A 1VH7A 1NEYA 3WLRA 3OTRA 1AZ2A 2G4FA 3DFNA 1FWWA 3UJSA 3ZVHB 4REQA 4S3EA 3WD4A 3CK5A 4GZ7A 3CT2A 4TTUA 3PSVA 3AMGA 4LUTB 3KS6A 2VYOA 1UWIA 1W1IE 2FGBA 3P0XA 5CPMA 3IIZA 3PTKA 3TC5A 1W54A 4NXKA 2XP6A 4HOWA 2VC5A 1FKHA 1F07A 1WX0A 1BYBA 4U84A 3RG6A 1SJCA 3JRKA 2FYMA 3H53A 3AROA 1TA3A 3LCGA 2YA0A 5FD0A 4V15A 4EANA 3GBEA 3SJ3A 4NZJA 4O57A 2Q8XA 4CD8A 1FKJA 2J7CA 4KEMA 1TX2A 2CITA 2B5UB 1LL4A 2WJDA 4UTWA 1KRCC 3VABA 3LXAA 1HGWA 4MJMA 1OD8A 1WNOA 2DU2A 2DT1A 3KLKA 4AD2A 1LWJA 4DN1A 3GNPA 4F79A 1DJNA 2CLMA 4ZPVR 2QV5A 3R10A 3PAJA 3GS6A 3W7DA 2Z2UA 3UI4A 5M1TA 4YLWA 3EOUA 2QUMA 3SEPA 1QWGA 2ZTJA 4LB4A 1ITQA 1WKEA 3LRKA 3H55A 3K46A 3I68A 1Z7AA 2WMIB 3BQ5A 4H8UA 5A2CA 3KOYA 4W7VA 3W73A 3QPYA 1Z3NA 3RM9A 3RYSA 2XIQA 4MUPA 1FD9A 4DZ5A 3BLKA 4XD6A 2Y4SA 5LXEA 4XBSA 4GPNA 2OEKA 3KOXA 3U8GA 4TVDA 3O5EA 3PM6A 5LXXA 3A47A 1KBIA 2XP3A 1R2RA 2LGOA 2XISA 4PMNA 2GQAA 5CSYA 1KWGA 4ICNA 3XIMA 3ZM8A 3LHYA 5AYXA 3RFAA 2C16A 2JGYA 1J6YA 1EBGA 4NZ4A 1NFBA 3DYOA 3GC2A 3TXZA 3BC9A 1H4PA 4LPCA 1KWKA 1HJWA 3PZQA 3I6CA 2VWSA 5HUOA 1YTKA 5ABFA 2F6UA 4G1NA 4POCA 4ATWA 4KH2A 2L2SA 4MB4A 3BLLA 4H9YA 1WAWA 3R2GA 3AIVA 5A6BA 1UR3M 4NJJA 1AUSL 1WZLA 1F3TA 3BANA 1KCZA 2NXGA 2Y1HA 4L4LA 2EPLX 1MYRA 3MUZ1 1AA1B 1AG1O 4DBSA 5BOFA 4WVXA 1QWKA 3PS7A 4RW3A 1BWKA 1WDDA 2Z6IA 4M6VA 2E8YA 2HK0A 4ODRA 3EA2A 1KFKA 3IJIA 2Y8VA 3PG8A 1B3XA 1S5WA 2JF7A 3IACA 3E2QA 3USBA 1PX8A 3CZKA 1NWUA 2WPBA 5IHSA 1WUFA 2PTZA 3AU2A 1FKFA 2CZDA 3CBWA 1UUMA 3TYCA 3T0BA 5CH9A 3MMWA 4IH3A 4EIVA 4ODLA 2E28A 3ITYA 1W2VA 4ERGA 4GUGA 4JFLA 3DAQA 5XIMA 1HG3A 4L61A 3CPGA 2VRKA 1A0EA 4WY0F 3LPPA 1WO2A 5EMJA 3EWZA 3O0FA 1DYSA 1OGGA 2OYKA 4XTIA 3KBSA 4I8YA 2N87A 3N34A 2BV9A 1UZ1A 2FH6A 1UQYA 2ALRA 1MQRA 3SDOA 1TTIA 4UMCA 4DZAA 3MCOA 1B31A 3F4NA 5FJTA 5I07A 4AMCA 3GIQA 1BRLB 2ON3A 4CCEA 2VEKA 4I7UA 4HMDA 2YCLA 1KW1A 3P80A 1KKRA 3BMVA 4KQZA 1GG0A 3O1NA 2AKZA 4BWLC 3N19B 5DXXA 3MDUA 4M24A 2VDGA 3NO5A 2Y0FA 2PD9A 3HZ3A 3PJTA 2HDJA 4HQVA 2E40A 2YL8A 5HQMA 1GG1A 3H70A 3AALA 4TR9A 4OKDA 2KO7A 3JS3A 1AMYA 6A3HA 4UIOA 1KCXA 2XFWA 1RK6A 4HSOA 2QZRA 1ME9A 3S9YA 1V93A 1HJVA 3C0LA 1M9HA 3ALFA 5KINA 4LXFA 3LPFA 3EWXA 4HB7A 4LBUA 1R3TA 3TXVA 5F4WA 4ALDA 1EJVC 2X0SA 2YSWA 1RLCL 1TUFA 4AD1A 4O16A 1XBVA 2VURA 1K9FA 1VJSA 3SSJA 3S1VA 6CGTA 2K8IA 4RXGA 2M2AA 5KSWA 1UR1A 3ATZA 1V0LA 2Q09A 3QTGA 4PRRA 1QASA 2QJGA 2QQ6A 4O0KA 4GQGA 3CB8A 2VDHA 4JFKA 3L5AA 3FXYA 1JD9A 1LP6A 2BNJA 4M19A 4HT3A 4QLLA 4MTVA 2OO0A 2ISDA 3S5YA 4KEVA 1FKKA 4W5UA 4Z1DA 4QEHA 3MW7A 3RJYA 5IFTA 3WJWA 2QIIA 1FBAA 4AYGA 1TWSA 4I9MA 4F4RA 2FVKA 5GPGA 2Z1VA 4AWTA 3ERPA 1HXVA 1OJXA 1AQHA 4YXGA 3NQVA 1J4RA 3VXGA 2I16A 2BGSA 5SWUA 2GSHA 3H8AA 4TW7A 4GVGA 3NQFA 1Z44A 3ZR5A 3STFA 3S1XA 2X7WA 4G8TA 2P0OA 4CNUA 2X42A 4G9PA 3OVRA 1ZL1A 5J6EA 4HPGA 3NSNA 3K5XA 1YNYA 3TJXA 4WF7A 3PC0A 5HWBA 4DXKA 3P62A 2ANUA 2QDGA 3IANA 2Y7FA 4UTIA 4IIGA 3ANYA 5DCBA 4C1LA 5A8QA 1NFGA 4D72A 1X38A 4BI7A 1XSKA 3U0HA 3B0YA 4KFNA 4IZGA 3GR4A 1UBPC 1BSIA 2G3JA 2YFNA 4UMAA 4GIEA 3EX6A 1KTNA 2JEPA 3KTCA 3RXZA 3O63A 1ME7A 2ZXQA 2QF8A 2YCIX 5XINA 3O06A 3UWWA 5HW8A 3WUGA 2CKSA 1S5VA 4PUKA 4IF2A 1IYXA 4FXJA 3V7PA 4ES4A 1ODZA 3W82A 1NWRA 1B3WA 3SCQA 3U2OA 1XFBA 3FKKA 4ODOA 1RVGA 4B3KA 1ZALA 1ME8A 1XKYA 2GVYA 1E0UA 4K6AA 1GVRA 2XZ9A 2XIIA 3LN3A 1HKWA 3MU7A 2QCDB 1ADSA 5BOOA 3VIJA 2W4XA 1JF5A 2HMCA 4MNJA 2I57A 2C13A 1CLVA 3FJLA 1L2UA 2JE8A 2FB2A 3WK3A 1H7RA 2BVTA 4MF4A 4MSSA 2BY0A 3UU0A 3CV7A 4ZE5A 2DUAA 1NP2A 4NYYA 3CWNA 3V4BA 1HFBA 3PBWA 3LXCA 5D32A 2HSAA 1LWHA 1SZFA 2DUXA 3IARA 4CGTA 5T26A 1EX5A 1JXKA 1XRSA 3V5OA 1OD0A 1M7XA 1BWVA 1XQLA 2E3ZA 3T08A 3AI0A 4UQEA 4PB5A 2YL6A 2HWGA 3WQ8A 4JQ2A 4XIMA 2WB5A 3URNA 1A53A 1NM9A 1UP0A 3WLKX 5AC4A 3FJ4A 4K36A 2F6XA 4HA1A 4GQRA 4HSHA 4IG2B 4W93A 4IQLA 2Q8LA 1BQGA 3TFCA 1V6UA 1E0WA 3D3AA 4Q4PA 4UQAA 3H21A 1WZAA 4JNZA 1XLEA 3P5ZA 4EOUA 2Y8UA 1GT8A 3DBPA 4HPXA 5EBUA 5BMWA 1E6ZA 5HR6A 1MSSA 4HU0A 4RZ4A 4UFKA 3TK7A 1Q6CA 8A3HA 3FOKA 4EXQA 1U1JA 3M16A 2I14A 4JIEA 4J7RA 5A3HA 2W5FA 3D0CA 4HZ8A 4FX6M 1KM3A 4H6KA 1S38A 2DZUA 5HUPA 3ABQA 2WHKA 5DY3A 1RJPA 2CBJA 3NCOA 4Y9PA 2J6XA 4UDMA 1PPIA 4PUWA 1JR1A 3OZOA 1QO2A 5FJIA 4FXFA 3P8JA 4OWGA 4AVFA 3RGCA 3BQ6A 4LNYA 4M6PA 3BARA 3DHDA 3B8VA 1J6PA 3HFYA 3I3EA 1TPH1 4U5IA 5BRPA 5KTLA 4ZO8A 3ANVA 4ATDA 2PDXA 3WDRA 3TTQA 1DWAM 4LU0A 4CN1A 5BCAA 3DOPA 3L4YA 2QPSA 1JGMA 4GG9A 4M51A 3LHUA 3VNZA 1I0BA 4HN4A 2PWDA 1YADA 2GK1A 4ZOBA 5T9CE 4IGHA 5G1YA 1F73A 3C61A 2DDXA 4ZOAA 4JKLA 5C9RA 3WH0A 1N55A 3LCLA 4O0QA 3VA8A 4RKAA 2J6VA 1PSCA 4X60A 3EWUA 4W7WA 2WMGA 1RP9A 4HIBA 3GXMA 2VFHA 4JR5A 2OO6A 1W3TA 2GVGA 3KDNA 3WH8A 3UR7A 4LC6A 1A50A 4PA8A 2ESCA 1K3UA 4DELA 9XIMA 3UEQA 1HKVA 1MNSA 3PPFA 4Q4KA 3L4TA 4UZUA 3SY1A 3CLWA 1PYFA 2OSWA 1W37A 2X05A 1V3LA 1H62A 4MNMA 2PP1A 2Y78A 4FIRA 5AHLA 8RUCA 1KXQA 3FEMA 2J4GA 2YB4A 1MVYA 1XM3A 1FX6A 3OHMB 2VWTA 4PCFA 4HYWA 2BHYA 4PBGA 5CBIA 1NSJA 1GPWA 3T2QA 3L68A 3LD5A 1K6AA 1P1MA 1DQUA 1GEHA 1DWGM 3BMXA 1RBLA 1TWZA 3W85A 2NV1A 4A3HA 4GWEA 2WVVB 4HU8A 4AIOA 3LX9A 2DV0A 3A4XA 4AD3A 2D24A 3GO2A 3T9PA 1CB2A 1TV8A 5F2IA 2X1TA 4KWWA 4GZIA 2NT0A 3F2BA 6XIAA 5CJMA 3GB6A 4JKKA 3DG7A 4U3CA 1ZJHA 4EK7A 3MMUA 2Y70A 1ZBCA 2A79A 3SZ8A 1JAEA 1EGVA 2DJXA 2J78A 1ZUAX 3K1DA 5HW7A 1EIBA 4FEZA 1ICPA 1K6WA 3KWXA 5AECA 4QSHA 4ZVJA 3CUGA 4OOZA 3KRSA 4L4PA 3QZEA 4QISA 4A3RA 1IXPA 4HCLA 1RQBA 3C52A 1ZFJA 2ITKA 4AG0A 3L5LA 3WBWA 5KZMA 2EJ1A 3SO7A 3Q2DA 3HQPA 4GO9A 3KCLA 2F21A 4ODNA 1QI4A 3IKDA 4IQDA 5T91A 1GVSA 4GQBA 4MY8A 3DGRA 3MVIA 1VB9A 3PJXA 1OINA 5JBEA 5T8GA 5FSDC 1R9ZA 4IIEA 3TN6A 2VOMA 1ECQA 3VNKA 2ZRYA 4XUYA 3EX2A 4JYDA 1W5NA 2DEPA 3HURA 5TD4A 3E0IA 5F2LA 4YCPA 3UZ5A 1KFLA 2PCQA 3FA3A 2X2GA 4GI8A 1Q6DA 1D8WA 1XIEA 4FR6A 4JIPA 3EPNA 1E5NA 2XH0A 3B9DA 1XPGA 3WUEA 4NNAA 3V1HA 4P61A 1RBOB 1GVOA 2HTMA 3OZMA 2OOFA 3WLTA 1EUNA 3U5UA 3D5HA 3S0CA 1FWRA 5AC7A 3CZEA 3W23A 4B5WA 3M6DA 3W7KA 2PI6A 2WHLA 4J3XA 2BDQA 2NUWA 1R85A 5G4WA 1TIMA 3M41A 1L1PA 3EKLA 1B5TA 3OP2A 1G5AA 3AYSA 3GH7A 4LBRA 4ZQPA 1XD0A 3LTYA 3IAQA 1TZ9A 3G2GA 1WPCA 4HHLA 2ZFAA 3R8HA 3MKKA 3NFUA 3ITCA 3T7VA 3GTFA 3G1RA 1GZJA 6TAAA 4DIAA 1ZBWA 3RCMA 4AZ7A 3EB3A 4GI4A 2ONEA 1DOSA 4C7DA 1X97A 5C2CA 4F48A 2V82A 2HCVA 5HNRA 3LUOA 2PLCA 3G77A 1YTDA 4GINA 2OKOA 4H3DA 4B90A 4DJDD 1T96A 4I5XA 5FIPA 1HQTA 2Z1BA 4TUFA 1PCKA 2HPIA 4BKNA 1V7YA 3GW0A 3HQNA 1E9LA 1UR0A 3L4ZA 4OFCA 1KFJA 3NQ8A 5HJXA 1UD3A 4F3HA 1Y65A 4K7VA 1AL8A 1LZOA 4OU1A 4B3ZA 4F2UA 3C86A 3OPSA 2NQJA 1KT0A 2A4AA 3GD6A 1RJQA 3CH0A 1SJDA 1KQYA 3Q37A 3W24A 4CN6A 1OGBA 4I9AA 1UWRA 1MMFA 4E38A 3SADA 3FY1A 3HJEA 1Q7MA 5D9PA 3VKKA 2ZC1A 1VCGA 1ODUA 5CPSA 5D2YA 1HW6A 1YBQA 1LOLA 1O60A 1JJKA 3NQGA 3MP4A 1BTCA 2VFEA 3MO4A 4NI3A 5C6MA 3G22A 4AMAA 3H2CA 3EOLA 1OM0A 4QITA 2ZQUA 1BKFA 2FIQA 3AU6A 3BO9A 1TFVA 1UPPA 4X0VA 4JY8A 4C1NA 4M1RA 4M6QA 4PMQA 5LNSA 3AUOA 2O7QA 2OLAA 4FNSA 4JHZA 1F3XA 3PBMA 5HMDA 3ZZ1A 2ZZ3A 3N2TA 3ECQA 1TPEA 3NL3A 2V68A 2IKGA 3KVJA 2O7SA 4I90A 2ZUTA 5MHBA 1LLZA 1CLKA 3IIXA 1C92A 1Q2SA 2Q8ZA 4ERAA 4RE3A 1FWAC 3EPMA 4JOMA 3G24A 1LQAA 4DWSD 4R85A 1ITCA 2H6RA 3WJYA 4LUSA 2P88A 3G1FA 2E8ZA 2ZRZA 2ALDA 2VEFA 3S2NA 4PRWA 2XP4A 2YYUA 3DFYA 4FF7A 1JGIA 1E6SM 3F5LA 3GAKA 2YCKX 2XYLA 5LIYX 3OGSA 1ZHAA 1CIUA 3U4AA 3UI6A 1RQEA 1TCMA 2PGFA 1UJPA 4O1DA 4MLRA 4QE5A 4OHQA 3C2FA 4RE0A 1A5OC 4H4IA 2GJRA 2WLYA 4Z1AA 1KBKA 3DFSA 3T8LA 3W87A 2XPAA 2A7RA 4AZCB 5AC8A 1RLDA 1TO3A 4DVOA 1HKKA 4DWDA 4IIHA 3NZ1A 2KI3A 1M7PA 1W1PA 3LCIA 1EA9C 4ZSTA 1KFBA 4JTJA 4NX5A 3THUA 4JBRA 1B1YA 3NYDA 1GVEA 3TQPA 4K8HA 1OZMA 4DEFA 5BXPA 3C2VA 4PULA 1QW8A 1O5XA 2J8TA 1RCOB 3UD6A 4GQQA 1R9YA 2O56A 3QV7A 1GUVA 1X7IA 1G9HA 1JVWA 1HO4A 2NXHA 1BL4A 3O6YX 4PUEA 3S46A 4J35A 2QJIA 1UQZA 2VEMA 2VZVA 4AFYA 1BGAA 4D8AA 3TN5A 1JUKA 3CEPA 2OWCA 5JIPA 2ZR5A 2CBUA 3TQVA 3N17A 1U2YA 5E93A 4R27A 1Q85A 4AWUA 4EAMA 3C4UA 2ZA3A 4HPHA 3C2EA 3CB3A 3IGXA 4IPLA 5A69A 4IMAA 5BXJA 2ZX8A 3JZEA 1FKLA 3VO0A 3ABZA 4CNNA 4RE2A 4CCCA 4P7RA 2J9XA 3NGFA 5K2ZA 5BU9A 3ZJ7A 5C0QA 3MKVA 3C0JA 3BG9A 3W7JA 1GOOA 1Q4WA 2VC6A 3E2SA 4H04A 3UESA 4IOTA 4AZHA 2RGLA 4DUWA 1OCQA 5I78A 1G4SA 4MSPA 4CEUC 4NX0A 2A3AA 3AXMA 4RZ5A 1TPDA 3BICA 1XLGA 4PTNA 1EZ2A 5CPQA 1U5HA 4R7OA 1O66A 3UNTA 4GIVA 4K7YA 1Z42A 4QE1A 2WYSA 1L9WA 3N6QA 4Q33A 4WX2A 3SUSA 2VTFA 3AZTA 3NA8A 4YCOA 2GQ8A 4Z0JA 4FNTA 1GWJA 4EPBC 1TV7A 3WJSA 4TMCA 3KZSA 3QW3A 2AQWA 3MP5A 2ADAA 4MWAE 4TVUA 1J12A 5IDZA 3VE9A 1M04A 2HE8A 3TJIA 5IXEA 1MEWA 1RD5A 1YDNA 1R2TA 3QM3A 4UQDA 5DO2A 1JDDA 3HN3A 3UYIA 2YA2A 1SJAA 1WDPA 1EDTA 3GNRA 4P8WA 3ELFA 4Q22A 1GQIA 3E0WA 3WENA 2OEJA 2BY2A 1SFJA 4FMVA 1NDVA 4EX4A 2G0WA 2OLSA 3W1LA 4Q8WA 2XP8A 3KP1A 3U57A 1BAGA 4AY8A 2E25A 3W1XA 3M0VA 3L0KA 4HNLA 5BXRA 5K9CA 3QC0A 3WBXA 2XZ7A 1QK0A 2ZUSA 3B06A 2HROA 2P8BA 5GNZA 5K4ZA 4F66A 5I6SA 2G4JA 3EXRA 3MKCA 4O19A 3OOQA 4J2MA 1SQ7A 3SCVA 2ZA2A 3RFWA 5I3FA 2V5LA 3ITGA 1LUCB 1DJZA 4L9YA 5D30A 2TAAA 3AZSA 5FJOA 5BMXA 1QW9A 4AW7A 4N42A 4GFSA 3OBAA 1Q66A 1V3MA 4L9XA 3CAQA 4HK5A 4QLKA 3MCMA 2DSVA 2PV1A 1OX4B 1YDOA 3R43A 1UYQA 2J79A 2ZVIA 4PBEA 1KFEA 3N13A 2EKGA 1Q8AA 5FL1A 1QNQA 2Y85A 3MDYB 3GXPA 3SN0A 3LEPA 1W1B1 4LAZA 5FOOA 2GUUA 2GQ3A 1Y5XA 1R3WA 4KRTA 3BUVA 1Q6OA 1WDQA 3NRKA 3TU9A 4JTIA 3KEHA 3LLFA 1SFLA 3QFEA 2FB3A 1R3SA 2NLYA 3ZXWA 3UJEA 1YYAA 4DXXA 4D8LA 1GORA 3P60A 2DQWA 5B7YA 1BPLB 1TTJA 4LUIA 1SFTA 1W1VA 3TOYA 4OBSA 1H50A 1K03A 1R6WA 3PRAA 1VFOA 4BF5A 4DLFA 1K77A 4UNLA 4MYAA 1EJSC 4JN8A 2VX7A 2YKKA 4OGZA 3STEA 4QFUA 3BL3A 2R1LA 3PSWA 3W1AA 3QY7A 3THAA 4LWWA 1CGTA 4F40A 4H9MA 2E4TA 2JK2A 2FLIA 5KITA 2FZBA 3M7WA 1H61A 2RGMA 2PBOA 1XBZA 3IGSA 3TE9A 3ZIZA 2PN0A 3GNXA 5EY5A 2O92A 1D7FA 2CYGA 3P74A 4AYSA 5CPTA 5FSEC 4AU0A 2V2DA 3K30A 4X2PA 1UKOA 4AVOA 1DXFA 3FA4A 3CT7A 2FHCA 3CV2A 2M08A 3ZSSA 4PUJA 4DPPA 4LVBA 1OZQA 4XKMA 1AZ1A 1U5VA 3S6DA 2AMGA 4KERA 1RPKA 1Y0OA 3G18A 3WQWA 1MDLA 4GMEA 4CUCA 2GPTA 1HT6A 1E5JA 3QOKA 2Z24A 1A80A 1SJBA 3RPTA 3EXSA 1GZGA 2YL5A 5JBDA 4GUJA 2BXYA 3H2MA 4CVWA 1W3LA 1PDYA 2ISSA 3BXWA 3MUXA 1K4GA 3IGUA 4OBRA 4UQ9A 2POTA 4Q8QA 3CL6A 3TMQA 1UD2A 3OOBA 3URAA 3L65A 3HG2A 4IQCA 2ZCGA 3W74A 2OGYA 3GXTA 4XBKA 3PJUA 3V0UA 3APYA 4JFIA 2ISWA 3RF9A 1WOBA 1EXBA 1H7WA 2H3DA 4IQ2A 4U28A 5BWAA 1PTDA 5HWCA 7PTDA 2XH4A 5K7JA 1TVPA 2ZXDA 2E6FA 3L7RA 1E70M 1D2KA 1OIMA 4G7EB 3WEOA 1XLDA 2WWDA 1KRBC 1IZJA 1EF3A 4ZFCA 2UY5A 2D0FA 4AEEA 4N2YA 1R3QA 2FJKA 2WPGA 3I6TA 1E9IA 1FKDA 2EPHA 3OHIA 5CEWA 3M5VA 2ZWZA 1XCFA 5GJPA 2H9AB 5E09A 4JQ4A 2AAMA 3BOXA 3MSGA 3M6YA 1REQB 4MGVA 1R5YA 3FV9A 4L1GA 2I1OA 2NV2A 3QH2A 4KR0B 4U10A 2HS8A 4ML4A 4F0SA 4LAYA 3IJDA 3B3DA 4GYPC 1PVNA 3GC4A 4XZWA 4J28A 1S3HA 1TCOC 4OE7A 4KEZA 4NQ1A 1UW9A 3ZJKA 2NLIA 3FK4A 4LQ1A 1VKFA 1NMWA 3EA1A 1JEZA 2G5WA 4QJ4B 4TXEA 2XTKA 4C6JA 1PB0A 3HFTA 2ZXBA 1W3JA 3GU9A 2GDQA 4O2TA 1AQMA 3T8QA 4TO8A 1EL3A 2V5BA 3GVWA 3IJ9A 1HJQA 2QVHA 1J0YA 2CERA 3S2MA 1C9WA 4DO7A 1W26A 3N18A 5AHEA 1I2QA 2KFWA 4W87A 1CI1A 4W9TA 4WDWA 3SUTA 4G7FA 5E0CA 3QRHA 5CZTA 1ELSA 4JCMA 1EPVA 1PDZA 4DJDA 1VYRA 5D03A 2VX4A 4N6EA 4C7FA 3OIXA 5HK4A 1E1CB 3TN3A 4HJWA 1GKPA 1B3YA 1ZAJA 1CGYA 3GY1A 1TPC1 1IQ8A 2DFAA 5EMYA 4BEQA 3B8TA 3KRBA 1VFSA 3UR5A 1SM9A 5JIWA 4FP1A 5D38A 2YB1A 2R8WA 1RCQA 2YFOA 1H7PA 4ZZ9A 1E73M 5AC5A 3TC6A 2VFIA 3SCNA 4DB7A 4K1WA 2QHAA 3WMLA 3AHYA 1V03A 4Q8TA 3VZXA 4LAXA 3OA3A 4E4FA 1XUZA 2OKTA 3LBCA 4PB3A 1WBHA 4B15A 2WXDM 1H7XA 4B4HA 1O5KA 5H8PA 1FH8A 5C54A 4UR7A 2WSPA 1UROA 1YPXA 1PKLA 5CC6A 3EWCA 4WIWA 4Z2LA 2QDDA 3LHTA 4W9OA 4RV3A 5DANA 5HINA 3BURA 4GJJA 1ISXA 2XG9A 1UASA 3SR7A 1W1YA 1H2JA 3GG7A 4HD5A 1XLAA 1C8QA 3BMBA 4Z1BA 1XRTA 1C8VA 4K39A 4YVXA 3TDFA 3A5FA 1JI1A 2WJFA 3TW6A 4QT2A 1UOZA 2OG9A 1S2WA 2VR5A 1VFHA 2PV2A 3M46A 4HU4A 1JQVA 3VTRA 4HNVA 4QG8A 1POKA 4MWAC 1ZY9A 2A6NA 3L5MA 2YOCA 4JYEA 4OUEA 3S6TA 1W17A 3VIFA 2R1MA 4A2RA 4GYKA 1PHWA 1T99A 1XH0A 3U6WA 3R6IA 4W9PA 1DQWA 4O18A 3FDGA 4DWSA 3FIGA 2VCCA 1TIWA 1VPYA 3MY9A 4UNIA 4TX8A 1U5JA 3NWRA 1R8LA 4MAVA 3V0TA 1XLMA 1I2PA 3H54A 2D69A 3TSDA 3ZYZA 3BV4A 4HOXA 3CZJA 2QDEA 2GSEA 2JBMA 4LOCA 1AVAA 5A8MA 5LGZA 3SRDA 4H19A 4L6DA 4JTQA 3CUZA 3KVKA 1MQQA 1B4EA 3TC3A 1KXVA 4DRMA 1F4HA 2OTDA 2WMKA 1MW0A 4ACZB 5K3VA 5FEWA 5I0DA 1ISZA 4XZNX 4MM1A 5LNWA 4YTTA 2QIWA 4PL2A 1TVLA 1CWYA 2AL2A 4LJ3A 1BQCA 5A6TC 1H1ZA 1I1XA 3NUKA 4DJFD 1M01A 5BWFA 1X39A 1SMAA 2HXTA 3MI6A 4DIPA 1EUAA 2CETA 4ZQMA 3LNPA 4JPGA 3F5JA 1QFEA 2PFHA 4JICA 2ZQ0A 2VHLA 3GXFA 2WOQA 4V1XA 2OWWA 4TV6A 1ECEA 3E0FA 3RU8X 3KAFA 1G67A 6PTDA 5AVNA 4M82A 1DWIM 1W9XA 3T07A 5LSMA 2ACUA 3NGJA 1CGUA 3B8WA 5EMLA 2ZXAA 1GOWA 3PG9A 4XV0A 4RZBA 4J3WA 4A6GA 3VD3A 1XINA 1IEVA 1GCYA 1X96A 3HO8A 4DX3A 3ARUA 3IIPA 4AWEA 2GJXB 3IJQA 6TIMA 5I3DA 3AWOA 5CSSA 2EAWA 4UXDA 3I65A 4O52A 4U33A 4FK9A 2PSNA 3G8RA 4CU7A 2RDWA 3WNNA 3HQOA 1F9CA 2ZZ6A 4NY2A 1PKMA 4MAZA 3M0KA 1FVPA 3HF3A 4QCEA 3VDGA 4LCQA 2OSYA 4O1EA 2GDUA 3TROA 3ZSTA 1C8XA 4KCUA 1PKNA 2V5DA 4GY0A 1C7TA 2VQTA 1DWFM 2QW5A 5FJPA 3PHAA 1LORA 4Q8OA 1O5QA 2WZHA 3CL7A 2YYTA 5I98A 5HNTA 2VN1A 1LL6A 2Z2AA 1I2RA 4PBFA 1NMVA 1HF6A 4O54A 5REQB 3HPSA 2H8XA 3TDBA 3NQ6A 4ADTA 2PF0A 3GXNA 1QRQA 5IBXA 1PKYA 3UWEA 1W31A 5DRIA 1IXOA 4GZEA 3A6OA 2Y61A 3S9IA 4CNPA 4E4UA 1M68A 2C1IA 1ML1A 4JY9A 3LV5A 5DT5A 4TX6A 5G1MA 1ZLPA 3K13A 1J9YA 1XDMA 3UZXA 2VKZG 4NILA 4PCNA 4UTWC 1T41A 2Y89A 3IK2A 5I24A 2W66A 3AHTA 3WELA 3WYZA 2HRWA 4GD0A 2XP5A 1XIFA 4HCDA 2PWGA 5EPDA 1VQTA 1HJUA 3F4DA 4R53A 2O55A 4Y9OA 4DY1A 3KXQA 4RCXA 1N82A 3TH6A 3P82A 2CLHA 3PPHA 2OQYA 3TX9A 5AC6A 3BLOA 3OG3A 1LWIA 2WCSA 1B4KA 3CIVA 3PR9A 3B0PA 3SGGA 1GJUA 4CD4A 3LCXA 1KTBA 2PDWA 3VOIA 3QHOA 1IGSA 1XLFA 3GC5A 3G1XA 3HB9A 4Y6GA 4B9ZA 1V02E 3VGFA 5M3WA 3GW3A 1W9UA 2L5HA 1YW5A 5FF7A 3WEMA 3TUUA 2G41A 3U2EA 4DJED 1I2OA 4JTAA 1QI5A 2WBKA 3DFPA 4N0RA 4IHCA 1G01A 1XC6A 2MLYA 4I6VA 1DEDA 3SCRA 4PMJA 4BI6A 3UQAA 1RV8A 1G69A 3VIKA 2MF9A 2MPHA 4NKCA 1H5YA 4XO7A 3GQYA 3GUWA 3L0NA 5C9WA 3OLIA 1V5XA 4YHEA 3FAWA 4BQ3A 2VD8A 1NOFA 1MNZA 1XC4A 4QQ3A 4Y7EA 4V28A 2A85A 4MHBA 4MADA 3BW3A 2ZRUA 3CH9A 3R0UA 3UCCA 3BV7A 3O2LA 4UTKA 1HIZA 3APTA 3LGGA 3WUFA 3ANUA 1K02A 2YJQA 3NOEA 1N7KA 3PVFA 4JFSA 3I7SA 3SM0A 4FXSA 2DZAA 3IV3A 2Y24A 3T4CA 3B0XA 4ZA0A 3ZOAA 4DAIA 4ZTXA 2WJEA 4DXVA 1O95A 3GTXA 4C5YA 4DZ3A 3W0KA 3TYBA 2DG4A 4UCFA 2E68A 1EC9A 3WDIA 4UQBA 2PDCA 4S3JA 3PANA 1CPUA 2UZ9A 1EJUC 3GZAA 4RNJA 4IL0A 4LCRA 3RAOA 2YLLA 2J8GA 1E72M 4RW5A 2HVOA 4B16A 4WKFA 3T0TA 1Y0EA 3GIYA 4PN2A 2G3IA 5C5YA 2PP3A 1JYWA 4MOZA 1VCFA 3QLLA 2OPJA 4FZIA 3LI1A 4HARA 2RDUA 4GJ1A 1SO5A 4M5PA 2DG9A 5DMMA 3KL0A 1VPXA 2RJGA 1IWBA 3VKDA 4K3ZA 3NNTA 3VIIA 2J75A 2EHHA 3K8KA 2ASHA 2NQZA 2PC4A 1UD8A 3H23A 4BFAA 2CXGA 4FLSA 3SN1A 3GVVA 3WO8A 5C8BB 2J7FA 1KC7A 4R7WA 3E1F1 1QHZA 1EP1A 4WXYA 4PH6A 1U83A 2EPMX 2J77A 1MQPA 4ERIA 2VC7A 1JUBA 1A4MA 4KWVA 4XKYA 3WUBA 4KKXA 1BSLA 1HKJA 1TG7A 2J7GA 4HHHA 4X9SA 4NJIA 4LYPA 3AJ7A 1PTGA 1ISWA 3KBJA 3XISA 4YU1A 1VEPA 2C91A 4IFOA 1OHLA 3FYPA 4NL1A 3CQ0A 1G0CA 4CQ8A 1E71M 3S2LA 4RL3A 2PDKA 4QM1A 3W7GA 1Y5VA 5E0KA 1TR9A 3UZZA 2H8ZA 1IHIA 1MUCA 4WGHA 3W7EA 1YBQB 2PA6A 1FWDC 1IT0A 4Y2WA 3P7YA 4H41A 1K7EA 2WC3A 4W88A 3RCYA 3CPUA 3HPXA 2CLIA 1W56A 3KVLA 4UTTA 4F0KA 2F2HA 3WNMA 4H9XA 1UC4A 2H3BA 5EMKA 2Q71A 3K8MA 1F40A 2OYMA 3LBMA 3W2MA 1G4TA 3CQIA 4PMRA 4QS5A 4HBOA 2YZ5A 3AC0A 1QHPA 3ITLA 1RY0A 2PDNA 2IMRA 3ONCA 4ZPWR 1I45A 5FJRA 7TIMA 2BXZA 3RRAA 4XVEA 2V2HA 4LC8A 1XG3A 1FKSA 1IEWA 4HZ7A 1OT2A 1XIHA 1YEYA 1IV8A 3SQLA 3WSUA 4QSFA 1X8CA 2ZUWA 3GSMA 1HNYA 3GAYA 1DE5A 1R38A 2WC7A 5XIAA 3RCNA 3KBNA 3G0UA 2PWVA 2X30A 1A5NC 3M64A 1OX5A 1UMLA 2G3FA 3B03A 3A12A 1EWDA 4A8LA 3NXFA 4X22A 4GXWA 1TVNA 5M17A 1KCLA 3P84A 3QOMA 1O12A 4DNHA 3OO2A 4WHBA 3ARSA 1ZRQA 3LHWA 3DHUA 2VP8A 3RILA 1PBGA 3R0KA 4JTGA 5AYBA 2JKPA 1OK6A 3NQMA 3PBVA 4JHMA 1EF2A 5D2XA 3ZWTA 3C6CA 2ABBA 3B9EA 1MEHA 3NYZA 4S3BA 3VE7A 1US3A 4LFYA 5PTDA 3KBWA 1JCMP 2JEQA 2W79A 5A1AA 2VEPA 5FF3A 4GRSA 3VD7A 2F2DA 4IMEA 3O05A 1UKQA 1AH3A 2FZ9A 1AQFA 1H7OA 5D8WA 3LA4A 3T42A 2OZ3A 3INPA 5M2FX 4IMCA 5AB3A 7CGTA 3I3BA 5CC7A 1W1TA 3KM8A 4DROA 4E2OA 2OZ8A 4UBPC 4US5D 4GI9A 3DI0A 4IX2A 3PY2A 3JR2A 4DYKA 1W3NA 2C1HA 4RUBA 5MF5A 5FESA 4MFEA 1QOPA 2XPBA 5EFFA 4OBTA 1OX6A 4Q4SA 3MHUA 3WQVA 1A0DA 4DO4A 3A3WA 2PPGA 3M07A 3KS5A 4GBUA 1P43A 4QRNA 4PCSA 1JZ5A 3VDCA 3ZLFA 3FA5A 2YXOA 4O10A 5B8IC 1XIDA 1E3XA 1FCUA 4ZMGA 5ECUA 2D0HA 4DUVA 5I00A 4S3KA 1DVJA 2D9FA 5IDIA 2ZYFA 4YJ5A 2WSQA 1D3CA 1SSGA 3LM7A 1OADA 2PLKA 5C55A 1NSGA 2XSBA 1KFWA 3CIXA 4LAKA 4HBKA 4JFWA 2VGFA 3W6LA 2O9TA 4I5RA 3VD9A 2ZRWA 4PMDA 1XIMA 2WKJA 1LT7A 2YBTA 2HQAA 1DJHA 2INEA 3CUJA 3F2DA 3OLEA 3CEUA 4FOKA 3VFLA 3SUWA 3VGEA 1H63A 5AFDA 1FP8A 3MZNA 3TYEA 3GE7A 2BODX 4NG3A 3K4AA 1P7TA 1SW7A 2R82A 1R9XA 4MYXA 4QP0A 5TIMA 4MZ8A 4N02A 2NW0A 1D6OA 2PUZA 3RX3A 2BG5A 2QEZA 4QX4A 3LCWA 3C2OA 4AF0A 6REQA 4GGQA 3UPMA 3BOFA 1UBSA 2F8QA 1XD1A 2E77A 1EJRC 1OVDA 3B04A 3S1UA 2DSWA 4KRUA 4AH7A 4A21A 3SGUA 2OFNA 1IEIA 1FCVA 7REQB 3LQGA 2B7QA 5CQ1A 1DXIA 3IS4A 2Z28A 2DZVA 2V8ZA 1VFTA 5KEZA 3GHUA 4L6OA 4PTXA 5IRPA 1XLBA 5FAGA 4B5SA 1NQ6A 1CXIA 4DJFA 3V75A 5BW6A 3WMCA 1NOWA 1AJZA 3TP4A 1FWGC 3P6LA 4HYVA 4DZHA 3WQGA 1ADOA 3N1AA 2BWGA 3BCJA 1L6GA 4JD4A 2OQLA 5A8PA 3WH6A 4AD5A 5TBOA 1DJIA 1MWOA 3VGHA 1AW2A 4DF2A 1GQNA 1TELA 2CESA 4R34A 3F7JA 1X6UA 3NPWA 4M80A 1LROA 3KBVA 4KF1A 2WLZA 1NH6A 3DUGA 1NWSA 4JHOA 4JCLA 4FLOA 4ORMA 3O6AA 3ARQA 2I5QA 1LTDA 5AZ0A 3NI6A 2QUTA 1B3VA 4MUZA 1A5SA 2YXGA 4O4WA 4IPNB 3LBOA 2IQDA 8XIMA 4E8DA 3LI0A 4YHGA 3WK2A 2ZBTA 2ZZ7A 3VX1A 2ZICA 1RA0A 3B7XA 1FWTA 1OYBA 1FA2A 4UTJA 4MFDA 2C79A 1DBTA 4HSNA 3QQ1A 1P5QA 4LUTA 1EQPA 1OF6A 1WQ5A 1DJQA 1IEQA 4FNPA 3UR2A 1UHVA 2OCZA 4N9DA 3AIEA 2R1PA 2WCAA 1LBFA 3MJYA 3FVDA 1KR1A 4EXAA 1E1EA 4DYJA 1FRBA 2J25A 1DHKA 2FH8A 2IXVA 2PAJA 4XVDA 1XYFA 1YATA 1P6CA 3NVDA 1TPB1 2FPYA 8TIMA 2NQ9A 1NJJA 4Y96A 3OYXA 1EA0A 3PZNA 1HZYA 4JX6A 4S2BA 3GTNA 3HPAA 4IICA 4AEFA 3OVPA 3M5ZA 1VJIA 2FKPA 3LQLA 2DZXA 3HV9A 4Z2HA 4NAFB 1EX1A 1XCXA 3VIPA 1CT5A 4E2VA 1ZZMA 4CEXC 3F5KA 1JZ7A 3LM3A 3HGOA 2WV8A 2DSUA 3ZJ8A 4QGCA 1N2VA 1Z89A 2CHNA 1RAKA 3ICJA 3UZYA 1JDAA 2Z1WA 4PFMA 4ZXLA 4Z1CA 4UTHA 1XLHA 3NG3A 1G7VA 3B0VC 1CW2A 4C5ZA 2RURA 3VAVA 2R91A 3GZ3A 3GKFA 4RK8A 4S3DA 2WMIA 4RNFA 1R7OA 3JYMA 4LVFA 3BSMA 3N2MA 2UBPC 1YLVA 1HP4A 3S47A 5DIVA 1K9EA 3QGAC 3UVAA 2BOEX 4UTLA 2VX6A 2A3CA 1DHPA 1RHCA 1Z6KA 5U4NA 1BYDA 3E12A 3E0VA 4HNNA 3SCSA 3R8GA 2VZUA 3UY7A 1PXGA 1QATA 4ICMA 3FLUA 2AQOA 1TPWA 5C2XA 1VJZA 1XIJA 3GXIA 1KGXA 3HM7A 2J9ZA 4HBEA 4FX8A 2VT0A 4FOJA 4W89A 5I3IA 3O3RA 3AXHA 4DJEA 3U9IA 3NVTA 3TJLA 3HGRA 3LRMA 2GJNA 4AXKA 3WLQA 1R3RA 3AYTA 2V63A 4KMQA 1Y7VA 2VI0A 4Y8EA 2Z25A 2LLEA 3DFQA 3ZLHA 3F4WA 1XISA 4L5ZA 2OGJA 5FEXA 3WDJA 1NY1A 2D0GA 3UNDA 5HNNA 2R24A 4JIHA 3VCNA 1CX9A 4CQAA 1JI2A 2D1ZA 6ALDA 3DYMA 1T11A 1SZGA 5DF0A 3TFXA 4WD0A 4IXXA 4F8XA 3K2GA 1J11A 1PHQA 3DEQA 4O8RA 4O4VA 4E3TA 4J9JA 1GOXA 1JZ4A 3OODA 3VNDA 3N29A 3ABSA 3MO7A 4DNMA 1FP9A 2NXIA 3VVGA 3MA8A 3P67A 1KD0A 1QT1A 2JGQA 3ID7A 4NUWA 3S42A 2D20A 2XSXA 3AHXA 3E96A 2G37A 3M0YA 3BK0A 3ZR6A 4GH1A 3RIKA 4WRHA 4WY0B 4F2TA 3SECA 1PAMA 4A8IA 3ENLA 3SIZA 3A23A 4QJ1A 3L21A 3T2PA 2FPTA 4HA0A 2BGNE 2V2CA 2CCRA 3GDRA 5DFAA 4LNCA 1HL9A 4O53A 2XINA 4HNOA 3DECA 1F4AA 4GK8A 2E9BA 3WL1A 2ZUUA 3UW6A 1Y8BA 2Q02A 3TR9A 3LYEA 3BCFA 1BRLA 1QNSA 2E5CA 1Q5MA 2E67A 3KZPA 1C7SA 4G2PA 3GM8A 3PTQA 3MHFA 5A6JA 4ENLA 1BHGA 3M47A 1BG4A 1Q4NX 3NQAA 1JL8A 4XAKA 3OQEA 1G1YA 3SN4A 1EYEA 3NTYA 5L6UA 3C8FA 1BYAA 4WUIA 1P0KA 2XGBA 3MDWA 4V2XA 5A5WA 1JYVA 3G1VA 2ZE3A 4ODMA 2X1UA 3UERA 2V0TA 1FWBC 4X9YA 3PNZA 4UTUA 2XIOA 3ARYA 3KADA 1D7KA 3R0DA 1A3WA 1FY6A 2P1FA 1T40A 1RK5A 3QBUA 4YWSA 2UY3A 1AJ0A 2BOFX 4P7LA 4CD7A 2BVDA 1FKRA 3MP3A 3V16A 3KOWA 3S3GA 2ZC8A 4ZBCA 4MPKA 1F6PA 3A4JA 3W1UA 3TR2A 2Q3RA 4C6FA 4PSPA 1ZCNA 1RPXA 4U31A 1EKOA 1JQXA 1VAHA 2BHUA 4QG6A 1GQKA 4N9CA 1XFCA 3LRLA 3OEXA 5BOEA 4JIQA 3CMFA 1H60A 3M43A 3MHGA 3H2NA 1GOQA 3UY8A 5TAOA 2D22A 4PTVA 2FGZA 3JW7A 4HOZA 3W7PA 4TX9A 4Z2KA 1Q6RA 4ROPA 4XWUA 2DVTA 1AFSA 1T6MA 2QT3A 5HKGA 4JX5A 7ENLA 2QGHA 2G8ZA 3G0XA 5F7UA 1O4UA 2OU4A 3BTNA 2WKLA 1CGWA 4D6GA 4GKTA 2VENA 3GFZA 2E5BA 3IK4A 1FXQA 3BJSA 1JXJA 4KFPA 2DJLA 4BI5A 2P8CA 3QJAA 2DT2A 1HL8A 3A5VA 3OU8A 5CG0A 1UKTA 5AOUA 3O8AA 3WQDA 2REQB 3SGZA 3STCA 1E4NA 2ZQSA 3GTIA 3EB4A 1JNEA 4CKQA 1X7FA 1FDYA 2VDIA 3ZLGA 1WYIA 5D75A 4R9OA 2WNWA 2Z26A 2VR2A 2XGZA 1W5MA 4XZHA 1V79A 1XBXA 3K4DA 4ODKA 1G7UA 3LS9A 1UIPA 1E0TA 2ZX7A 1NDYA 5D2WA 2D2GA 4U3AA 3R7MA 2WHJA 2CLFA