1LG2A

Crystal structure of human chitotriosidase in complex with ethylene glycol
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
365
structure length
359
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chitotriosidase
publication title Structure of Human Chitotriosidase. Implications for Specific Inhibitor Design and Function of Mammalian Chitinase-Like Lectins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 123
structure length 359
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1lg2A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1lg2A01
4C7GA 4EE9A 3MMUA 1W3LA 3W53A 2XTKA 1LL4A 1R85A 4PEEA 4AISA 5A94A 3MUIA 3QHNA 1RP8A 1UA3A 2AAAA 4J3WA 1WNOA 3AZRA 1KWKA 1ITCA 1CLVA 2VTFA 2F2HA 2XM2A 5A2CA 4EANA 3KL0A 2DH2A 2CBUA 4DWSD 5CPQA 4BF7A 2ZX9A 3TA9A 1W9PA 3AFBA 2BXYA 3B8SA 4PMDA 1NWSA 4PTXA 1XSKA 3L4TA 3WH9A 2YKKA 2Y4SA 4MB4A 2YOCA 2G8ZA 4UFKA 3CZLA 1JD7A 1WAWA 4TTGA 3RILA 3VGDA 2DT3A 3VD7A 4B3KA 1NH6A 1UR8A 3GNRA 3N17A 1QBBA 3NIYA 2QPSA 2XSBA 5EBAA 1CGXA 4KGLA 1OIFA 1E6QM 2RGMA 3S6TA 4PMQA 3IAPA 1JZ3A 1CBGA 4P7QA 4OBSA 2WKGA 3VIOA 3WDRA 3THDA 1UD3A 1XRVA 3WUGA 1UQYA 5CQ1A 4P8VA 4KH2A 5HDRA 3WQWA 2JFEX 1HT6A 5I3DA 4ATDA 2DSWA 3VVGA 3PTKA 1ISWA 4WKFA 4KWUA 3UEQA 4CN4A 2WZHA 1BVNP 2NW0A 3WH6A 1BLIA 4A4AA 5BWFA 4LX4A 4YN5A 3PHAA 3WNKA 1TG7A 1CWYA 1WDPA 4MB5A 4MNKA 1HVXA 1J0IA 2UY3A 2QPUA 3WL0A 4E8DA 3U5UA 3TTYA 3CUIA 4TVUA 2XYLA 1C8XA 2QMKA 1C90A 1TMQA 1BG9A 4RL3A 1CENA 3UCQA 3LPOA 4CD7A 2ZXDA 3N9KA 3VIFA 3AIQA 3ECQA 1G94A 5LA1A 4W86A 2XFYA 5A6SA 5DT5A 1PX4A 3SCNA 3VX0A 4CKQA 2J7HA 5A8OA 4M24A 5E0FA 1Q6EA 5A95A 3VGBA 1PAMA 1VJSA 3WUEA 3VKKA 2WSPA 2F61A 1JI2A 2ZUUA 3CUFA 1LQ0A 4C7DA 5AC4A 1CZ1A 1XD0A 5BXRA 3AMDA 2W61A 1GPFA 1J0JA 5EFFA 5I77A 3VMNA 4PSRA 4W7UA 3ZT6A 4TTUA 2D0GA 3GH4A 5A1AA 1TA3A 3WF0A 2ZX6A 5DO8A 4AEEA 4AY1A 4B9ZA 4MB1A 3MS8A 4PMZA 2O9PA 3RJXA 3FY1A 4MAVA 2WZIA 1PJ9A 4XUYA 3OGSA 1FOBA 1KB3A 5LYRA 4JL1A 1RD6A 4CCDA 3CLWA 3CHDA 1JZ7A 2E8ZA 3BGAA 2O9RA 1WB0A 1QVBA 3L4XA 2EPNA 1M03A 2J4GA 3BAWA 3DECA 3WD2A 4WIWA 3NDZA 2YL8A 4TVDA 2XFFA 4AD1A 3SCOA 2WM0A 1HJUA 4W8AA 4NF7A 1E72M 5CLWA 1OT2A 1J0ZA 4JFTA 2BY2A 5A6BA 3GH7A 1PZ3A 1B1YA 3W0KA 1C7TA 1OSEA 2OSWA 4FLRA 4WSJA 2PWHA 3WUFA 3OLDA 3VIPA 3CZJA 1JZ5A 2EQDA 1ISZA 4S3KA 3PZNA 2VCCA 1DWIM 3T09A 2ZX8A 4PTWA 4B3LA 1J0HA 3GNOA 3UESA 1ZJAA 5LA2A 1BSIA 1MFVA 2VZVA 2VR4A 2CHNA 1JYWA 4H8UA 2VJXA 1ECEA 2DSZA 1H49A 1ZBVA 3LMYA 4W88A 3AHYA 1E4LA 1CYGA 1FFQA 1NWRA 3D5HA 3B9EA 4AZIA 1EDTA 4YPJA 2OYMA 4D6CA 1AQHA 4LQ1A 3VU2A 2QV4A 5BCAA 2VCBA 4D1IA 4UQAA 3IJ9A 1MVYA 3M46A 1MW0A 3VM5A 4BQ5A 3MO4A 2IXUA 4AIEA 3W38A 3I3BA 1K9FA 1QHOA 1VF8A 3GH5A 1UWSA 2VMFA 2CEQA 1KGWA 2J74A 1UA7A 2IUZA 1UZ1A 4MNLA 3WD4A 2VRKA 3G6MA 1XHGA 1JYVA 3WN6A 3IJ7A 4BS0A 2ZWYA 4H2CA 1LJYA 2D20A 4Z2JA 1JI1A 4LYQA 2BHZA 2BHUA 3PTMA 4CN1A 4U31A 2JE8A 1CXLA 4LGXA 4CUCA 1SFSA 4Z2KA 2CBIA 2EO7A 3HU7A 5I23A 3MANA 2J79A 4UNIA 3WIJA 2VO5A 1AMYA 5M3WA 2WHLA 1UHVA 3CHFA 1TR1A 4QFUA 3BAXA 2VZTA 4AWEA 4HOZA 1H09A 1HX0A 1GJUA 1E1EA 2EPLX 4UOJA 1QNRA 1CXIA 4P8WA 1GCYA 3UG4A 2YDSA 1KWGA 2YA0A 3QHMA 1MW1A 1E5NA 3K8KA 4PYSA 1E4IA 4PMNA 4TUFA 4CD8A 3U5YA 4D6EA 1GQKA 2JIEA 3VD4A 1BGAA 4QCEA 1HL8A 1V6XA 1WDSA 3N15A 4QLLA 4H8HA 3WMSA 4V27A 2CIPA 2BHYA 3AIUA 5I78A 1K9DA 1XH2A 1GOKA 1I1XA 1HVQA 4MNMA 2CBVA 1YHTA 1CTNA 5DFAA 2ZXAA 4F66A 3T2QA 5CZKA 3RJYA 4DWSC 4U3CA 4MAZA 3WF3A 2WC4A 4GQRA 4V2XA 3VDBA 1LWJA 3NCOA 3I3DA 3VIIA 2JF7A 3L4ZA 3WNMA 1W3HA 2ZICA 2YBUA 1HXJA 1GORA 2Y8KA 2PC8A 2PF0A 1GQJA 3A4AA 2CERA 3WNNA 2FDMA 4H04A 5BRPA 2WAGA 2OYKA 1X6LA 1KR0A 1W91A 3TTSA 2G3NA 3GXIA 3ALFA 2BFGA 3VIJA 1XD1A 1OIMA 4KGJA 1R7OA 2DH3A 2WNWA 2XPKA 2DQXA 3WNPA 3PBGA 4ZE4A 3PZMA 3L2LA 1NP0A 1LWHA 1BF2A 3ARZA 3ALGA 1GHRA 1E6PA 4PMRA 3LPGA 1V3HA 1DP0A 4ACZB 3DHUA 3AS0A 2GJXA 2J78A 3WSUA 2WLZA 5FCZA 1B30A 1HJVA 3ZR6A 1V02E 3S2CA 3RO8A 2WANA 3VGHA 1LL7A 5I0DA 2WVTA 1EIBA 2GVYA 4JFVA 3AMCA 1UR2A 2YL5A 1KGXA 2JEPA 3MU7A 4NSBA 4OKDA 3IK2A 3W27A 4BCEA 2D3LA 2WMKA 2WC7A 2X2YA 4ZEPA 3UG5A 4AZ5A 3KL3A 4UTFA 5M17A 4UFHA 3PZQA 1UYQA 3DC0A 1JNEA 4Z2LA 4HOWA 2GFTA 1UR9A 3CMGA 1A3HA 3TTQA 4HA4A 3WQVA 2QLYA 3KEHA 1AVAA 2V3GA 1WE5A 2W62A 1H41A 4ZXLA 2G41A 4UOQA 2YDQA 1O7AA 3VDHA 3WEZA 1O6IA 1C3FA 1UR1A 1JG9A 3EBVA 2VC9A 1Z32X 4F9DA 3AIRA 1GVIA 4J27A 1B3YA 1U2YA 1PIGA 3CH9A 1X6NA 1DEDA 1I1WA 2ZIDA 1XSJA 1XCWA 1R8LA 3W82A 3EMCA 1E73M 5HBFA 1NOWA 3N11A 3OGVA 1C92A 3W6MA 4W5UA 1HF6A 6A3HA 3K8LA 1M01A 1D2KA 1AQ0A 1W2PA 3O9NA 2ESCA 4K68A 3ARSA 4V28A 3VX1A 1J0KA 3KL5A 1UWUA 1IZJA 1DHKA 1UWQA 4D72A 1WZKA 2W66A 3RPMA 4UFMA 4H8VA 1BFNA 1K9TA 2WB5A 4W8BA 5GNXA 2FGZA 5A6MA 1W3JA 2XWDA 4A3HA 1JDAA 2J75A 3ARTA 1UH2A 3MUZ1 3GXFA 1EH9A 2E0PA 2VRJA 4CD4A 2VX7A 4FLSA 3VIMA 1JAEA 5IXEA 5EB8A 3OZPA 1JZ8A 2PWGA 4Q7NA 3APGA 2QF8A 4OZOA 1E70M 1UD4A 3OZOA 3VMPA 3RM9A 2ZUWA 2WK2A 3SCVA 2YDRA 4UCFA 1QW9A 4PCSA 2J62A 1MXGA 4J3VA 4D71A 1E6SM 1JFXA 1HKKA 4AEFA 4X0NA 3MSDA 5JH8A 4NZCA 4PMVA 1CPUA 1V0LA 2WYSA 1QNQA 3IJ8A 4TVCA 3RCNA 1Q6DA 3VNYA 4YHGA 5BROA 1TFVA 4AIUA 4BQ3A 4PMXA 1FFRA 2E9MA 4JZ5A 1R86A 5A8PA 4M1RA 3L4VA 4RE3A 4AZBA 5A8MA 4GI9A 4JKLA 2CYGA 3A4XA 4FF5A 1MYRA 4JKMA 2AOSA 1XGZA 3OA5A 1LF1A 1CXFA 1OBAA 2XIBA 1OGGA 2O92A 2CXGA 4W5ZA 1US2A 2Y2WA 5F7UA 5AYIA 4AZGA 1RH9A 1ZBKA 1NOFA 1J10A 4J7RA 3T2OA 1OD8A 1E15A 2YIHA 4NRRA 3VTRA 3WQ4A 3PN8A 4QLJA 4L4OA 4M82A 1HIZA 3BH4A 3EYPA 1H4PA 2WHKA 5I2UA 4HZ8A 5AC5A 1W1PA 2MANA 4IISA 3MV01 1GZJA 4OJYA 4N0RA 2WMIB 2WZEA 2EPOA 2YA2A 1H11A 1UZ4A 5CJ5A 4EK7A 2WCAA 3G6LA 3B9DA 2V3FA 1JNDA 3WD0A 5GQBA 1IV8A 2HISA 2ZUVA 4D6IA 3ARQA 1MQRA 2V5CA 1NP2A 1EQCA 2BY1A 4AD2A 1UD8A 5CXPA 9CGTA 2QHAA 1XV8A 4W7VA 5C70A 1D7FA 3KZSA 5A2AA 1ZBCA 1J11A 4OIFA 2VT0A 3CPUA 3L2MA 1MW2A 4JHZA 1G0CA 2W63A 2PBOA 3BLKA 2J25A 3VMOA 2UY5A 1OGBA 2WMJA 3AIVA 2GK1A 5TD4A 3VIKA 2CHOA 4AZCB 5D9MA 3CUGA 1GQLA 4UQCA 1KGUA 5CG0A 3SCWA 2VURA 5BXPA 7TAAA 3WNOA 4AZ6A 2WVVB 3A4WA 3WY1A 1HKMA 3HJEA 3AROA 1MFUA 4CCCA 2J47A 5FL1A 4PUDA 4CU7A 3PTQA 3SUSA 3WD1A 2Q8XA 2OWXA 2PWFA 3K1DA 1G9HA 3FW6A 4HZ7A 4GO8A 1EHAA 3EDEA 1LL6A 2EEXA 2WBGA 1F4HA 4HMDA 3MMDA 5JIWA 3W4RA 3CUHA 3F4VA 1M53A 4KMQA 1W3KA 4KRTA 2EXOA 1WDQA 4OOUA 3ZJKA 1DTUA 2X05A 4WKHA 4DWSA 1CDGA 1H5VA 2W67A 1H2JA 5JBDA 3VD5A 6TAAA 1VJZA 3M07A 3N12A 4FMVA 2JIWA 3CZ8A 5CPTA 5KEZA 2W91A 5E70A 1HN1A 1UOKA 2WCSA 5HNNA 1VFUA 3WMCA 3BCFA 1TUXA 3WD3A 1M7XA 1KXHA 3SCRA 1FH7A 3POCA 4PRWA 3EDFA 2CBJA 3N18A 5CSUA 3WF2A 1BG4A 7CGTA 2D0FA 3KE0A 2W4XA 3BMVA 3VD9A 3GXDA 1U30A 3OLIA 1E6NA 1PX3A 3AYRA 3RIKA 4GPNA 1HL9A 4DUXA 4JCLA 1ZJBA 1EO7A 2A3BA 2PI6A 1EA9C 1NARA 1BGGA 5IHSA 1UUQA 2PBGA 4AMCA 2CPUA 1Q6GA 3OB8A 3AXHA 3W24A 2EPMX 2X1IA 1E56A 1XH1A 1ISYA 2A3HA 4U5IA 3WMBA 1UKTA 5A8QA 1W9BM 1TVPA 4ATWA 2ZOXA 3N1AA 3W81A 4S3JA 2J7BA 1CGVA 1V0MA 3OG2A 7A3HA 4AW7A 1PBGA 1B9ZA 4MDOA 3DHPA 3TTOA 4W89A 2WVSA 5JUVA 1V03A 2ZX7A 1QW8A 3AMLA 1E43A 3ARUA 2V3EA 2VVNA 1E40A 4WK9A 3NJ3A 4TXEA 2CKRA 1GVYA 3SUTA 3CHCA 2WHJA 1KCKA 3WFZA 1QI4A 3RM8A 3WNLA 1UD5A 1K6AA 4PMYA 3AICA 4E8CA 1HKIA 5ABFA 3DYOA 3M7SA 4QDMA 2G3IA 5IFTA 2J7EA 3QR3A 3W28A 1XH0A 4KRUA 2DT1A 3WFLA 4MB3A 1SYTA 3CZKA 1XYFA 1JL8A 2PWEA 1SMDA 4CCEA 1UG6A 3K8MA 4RE2A 1H1NA 1W9XA 2DGAA 4HMEA 2DT0A 3MKKA 2A3EA 1R7AA 3W37A 3MUAA 3BAJA 3E1F1 1JXJA 1C93A 1G01A 2DSUA 5BRQA 2J7FA 4Q22A 1Q6CA 1V02A 4HTYA 4GZJA 4P7NA 1XYZA 2WCGA 3QGVA 4CD6A 4D6GA 4EAMA 4ZENA 1TA3B 1EDGA 2OYLA 1VENA 2D24A 1V3LA 1W32A 1ZS2A 4GZIA 5D8WA 4U3AA 2XVGA 1LG2A 2YLLA 2J8FA 4GI6A 1GJWA 1EOKA 1OB0A 3PZ9A 1QBAA 1PEZA 1N82A 4YHEA 5HPCA 2VI0A 3CBWA 4U5KA 4AYSA 3BSHA 1LG1A 4WLCA 4CD5A 1E6XM 4GQQA 2VZUA 3WENA 3EDDA 3EMZA 3K4AA 4N42A 4LXFA 4OOZA 2XIIA 2XG9A 1NM9A 1OM0A 1ITXA 4HU8A 3ZO9A 1B2YA 2DSVA 1B0IA 2XFRA 3AMGA 4TOQA 1E71M 1EGZA 1C7SA 1QI2A 5A6KA 3GDBA 4AC1X 2JALA 4H7VA 1E0WA 4J3SA 4HU0A 4J28A 2CETA 5D8ZA 3AZSA 2XVPA 3BSGA 1I75A 1SMAA 1E1FA 4HP5A 4P7RA 3GTNA 1TZ7A 2JEQA 3VGGA 1V6WA 2WW5A 3AHVA 2YLAA 1V3IA 3OBAA 4HA1A 3WF4A 3VIGA 1BPLB 4UQBA 3BAIA 3K46A 2FH8A 1W9UA 3T2PA 1V08A 1JIBA 1CGUA 1F4AA 3ZMRA 3AISA 1P6WA 3WEOA 1E4MM 4W7WA 1ISXA 1GUVA 1E55A 2VZOA 2C8NA 1A47A 2D2OA 4JFUA 1W9DM 3GNPA 5C71A 2D23A 1J12A 3ZR5A 1VEOA 2E4TA 5AY7A 1JD9A 4P7LA 2FH6A 5JBFA 4D6DA 1CEOA 2UY4A 1B90A 4XZBA 5E6YA 1OD0A 2WMFA 2F8QA 4RE4A 1UKOA 2J7CA 2YJQA 1H3GA 3CGTA 2GSJA 1KQZA 1RPKA 3ZIZA 5D9NA 3FAXA 3NYDA 3IANA 3MV11 4M56A 4AXNA 3ZSTA 4HPHA 1OCQA 1JXKA 4WKAA 3FN9A 1QI5A 5DF0A 3AIEA 4UFIA 3BAYA 2UWFA 2PWDA 4DM1A 1VFOA 3GBDA 4H41A 4R27A 1HJSA 4JHOA 4MADA 1IT0A 2WMHA 2E9LA 2EJ1A 1X1NA 2BVYA 1DWJM 3D3AA 3DYMA 1MQQA 2UY2A 1GOWA 3GXMA 4AIOA 4JCMA 1ISVA 2W5FA 3WDPP 1VFMA 1CXHA 1JAKA 2CCRA 4ML4A 2XJ7A 3HN3A 1B3VA 1BYBA 4QCFA 2ZUSA 1HJQA 2DDXA 3II1A 1XCXA 4QP0A 2WBKA 4PMUA 4JKKA 2E9BA 1HKJA 1Y7VA 5D4YA 5BXSA 5FD0A 3WBAA 3PZOA 2E3ZA 1ODZA 4P8UA 3SCPA 3WH5A 3EDKA 3WL1A 3WF1A 3ZQ9A 5BYWA 3WQ8A 1JZ6A 1UWRA 2CKSA 3WDQA 1ZBWA 2Y24A 4R5EA 1DWHM 3LPFA 3ZJ6A 1Q4NX 2DT2A 3T0DA 4MDPA 2WPGA 1CIUA 5EMYA 4BQ2A 1EQPA 2VNCA 5D9OA 4UQ9A 1VRXA 2XGIA 8CGTA 3VILA 1KR1A 3VD3A 1OINA 2BXZA 1FHLA 3AQUA 3ZT5A 1V6VA 3W6LA 2C7FA 1DWGM 3EMQA 3KWXA 3RMEA 3SUUA 5DMYA 2NSXA 1FP8A 4UZUA 3GZAA 3AI0A 2X0HA 5A6BD 4CGTA 1QPKA 3U7BA 4WF7A 3BMWA 1VEMA 4M81A 2QMJA 3A47A 2DIJA 4IM4A 3ARVA 1TE1A 2HVMA 1ODUA 1CGTA 1H0IA 1UH3A 2Y8VA 4AD3A 1KXTA 3VUPA 1HP5A 2ZXQA 3MUY1 1BYDA 1CGYA 2Z1SA 4B16A 5D9PA 3UG3A 4GO9A 4HZ6A 2ZUTA 1E6ZA 1XC6A 4AD4A 1VIWA 1ZU8A 2BV9A 2J7DA 1ZB5A 2DEPA 4PN2A 2GJPA 1OT1A 3T0BA 4MNJA 4BZYA 4PUEA 1NWTA 2GJXB 2OWCA 1VEPA 2FGLA 2AMGA 3OLGA 2D22A 4MJ4A 4UQEA 3SEPA 3W29A 2WSKA 3PZUA 3NSMA 3N13A 1E0XA 1GNXA 5ECUA 4IPNB 3VIHA 3BAKA 3SCTA 1EXPA 4XZWA 4Y7EA 1LLOA 2GJRA 1DWAM 4ZFMA 2GUYA 3DYPA 1WP6A 1CXKA 1GOQA 4QLKA 3ARWA 1CXEA 3VO0A 1C91A 1VAHA 2VZSA 4BA0A 3FAWA 1GOOA 3AS3A 1JDDA 2WXDM 4C7FA 1JZ4A 2BVTA 2FHBA 3RM4A 3GBEA 5IHRA 2YL9A 1GOMA 1VB9A 1L8NA 1IZKA 1KQYA 2X09A 5E9AA 2Y5EA 5I6SA 3AHZA 2EPKX 1UKQA 3O6AA 2J8GA 1KXQA 3SURA 3VGFA 1WO2A 3F5KA 3ZOAA 1E3XA 3ARPA 4UOZA 3TP4A 2YBTA 4HMCA 1DWFM 4U2YA 2X8RA 4NRSA 2OSYA 1CNVA 3F5JA 1UH4A 1EO5A 3A3HA 4B9YA 4Z2GA 5FOOA 1HP4A 2NT1A 1CGWA 2VX6A 4F8XA 6CGTA 4DUWA 2VCAA 2V5DA 1BVZA 4E4PA 4J3XA 4D6JA 5E0CA 1QOXA 1UWTA 2C0HA 2G4FA 4DUVA 3FHAA 3BXWA 1S46A 3L4UA 3LPPA 5AYBA 3AZTA 2WWCA 5C8BB 2Z1KA 3CZGA 3CTTA 3F5LA 4Z2HA 1UD2A 1EDQA 1J01A 2FHCA 2BY3A 3AHTA 3T08A 1FA2A 3U57A 1UQZA 1K9EA 3AMKA 4X9YA 4AD5A 3OLEA 3AYSA 4PBGA 4Z2IA 5FIPA 2YL6A 1NWUA 2G3JA 1MXDA 2V38A 1UWIA 2CITA 5A3HA 3WH7A 1WZLA 1BTCA 4D1JA 3VGEA 4GIAA 3PZVA 1V6YA 1C8YA 3PZTA 1W9VA 4GKLA 4MPKA 2GDVA 3AJ7A 3VDAA 4CN6A 1KXVA 3CZEA 1VBUA 3SCSA 1KBBA 1R87A 4J3TA 3PZIA 2D3NA 3SIMA 3W26A 1EOMA 1PX8A 4D6HA 5M5DA 1JFHA 1B31A 5FL0A 1JF6A 1GOIA 3WH8A 3U7VA 1UR4A 5E09A 3UR8A 2ZXBA 3SUVA 3OIHA 4ACZA 3AS2A 1FHDA 4JIEA 1L0PA 1JGIA 5M03A 4U33A 1MW3A 1G1YA 3VINA 4A3YA 3ARXA 4CU6A 1H0GA 3UERA 2VX4A 1J0YA 3UR7A 2O9OA 4GZEA 2BY0A 5GNZA 2CNCA 1Q6FA 2WWDA 1OGSA 3ZT7A 3BC9A 5ABGA 2XGBA 3WQ6A 3J7HA 4UQDA 2WVUA 1PIFA 3I3EA 1PZ2A 4TX6A 4D6FA 3W25A 2BS9A 3RDKA 2NT0A 4ZE5A 5ABHA 2VOTA 3CHEA 4M80A 1JDCA 1CLXA 3L4YA 1J18A 2FHFA 1W1VA 2EBNA 3NSXA 1UR0A 1HJXA 2ZUNA 1NQ6A 4CVWA 1E3ZA 3NDYA 2VQTA 1BAGA 5HXMA 1JZ2A 5FKYA 4FLQA 4LPCA 5A6LA 2V3DA 5DT7A 4PSPA 2B31A 2WKLA 1PPIA 4JFWA 2VVSA 4P7OA 3WBEA 3AXXA 3UETA 1JF5A 2WHMA 2J7GA 5LA0A 1UKPA 3ZM8A 5I5RA 2VR5A 3QHOA 3NSNA 4PCTA 4M8UA 4LYRA 4W85A 4B15A 3VOCA 3WELA 2XUCA 4IUGA 3K4DA 1E5JA 2G3MA 1MWOA 3FHQA 4DM2A 2DPEA 1QNSA 5A69A 3T0AA 3TOPA 4W84A 4GI8A 2OWWA 1FH8A 5CSYA 1BYCA 4X0VA 4BQ4A 1QHPA 4GXPA 3FXYA 1V3KA 1RP9A 2XSAA 3OGRA 3BLPX 3VDCA 3B9AA 1NOUA 4L4PA 2GK1B 3AIWA 1QHZA 4W93A 1QNPA 2VQUA 4LYPA 2DIEA 3QOKA 3A6OA 1GHSA 3GM8A 3THCA 2D0HA 2RGLA 4W8LA 1W2VA 4GINA 3MMWA 8A3HA 2O9TA 5HOSA 4XB3A 1MQPA 1TCMA 1FP9A 4ZXOA 3WEMA 3GYCA 3ZJ8A 5IDIA 1J9YA 4W87A 2TAAA 1QI3A 1B3WA 4ATLA 3POHA 2ZX5A 1GQIA 2BNJA 5EFDA 2WMGA 1ESWA 1ZL1A 1W1TA 4F9JA 1CECA 3CUJA 5KZ6A 2XVKA 3WUBA 2IXVA 1VFFA 1FH9A 1EHNA 1BYAA 4DWSB 1AQMA 3VM7A 2PB1A 3L4WA 4MTVA 5CPSA 5A2BA 2BVDA 1UKSA 2XWEA 3CMJA 4AD0A 5I24A 5GNYA 3WQ5A 3QOMA 4WSKA 3AXIA 5HPOA 3N04A 1U33A 4F79A 3VPLA 4AZHA 4FK9A 1G5AA 2WC3A 2VX5A 4HOXA 2ZWZA 3M6DA 3ZSSA 5A6AA 1HJWA 4HA3A 4URIA 4UZSA 2J77A 1WZAA 1M04A 1WDRA 4CU8A 1TVNA 4ACYA 5CGMA 1WKYA 3NUKA 2VL4A 2GDUA 2OSXA 2E40A 4OBRA 1QNOA 3TONA 2A3CA 1V6UA 4UFJA 3O2LA 4NI3A 5ABEA 3WDJA 4E2OA 3JUGA 3EDJA 3IAQA 3SCUA 1GW1A 3PZGA 4JFSA 1JYXA 3FNDA 1E4NA 4HPGA 2WLYA 2W92A 3BCDA 2XVLA 3AIBA 1KCLA 1WZMA 5E6ZA 2XM1A 2WMIA 1E9LA 4EKJA 5DEZA 5JIPA 1V0KA 4JL2A 4P8XA 2ZUMA 1SR0A 2XHYA 4J3UA 3ARRA 2D1ZA 1V0NA 1E0VA 3CO4A 1KFWA 1YQ2A 4PTVA 4AZ7A 4WJXA 1W1YA 2JF6A 3MSGA 4XX6A 2OLHA 1US3A 4MJ2A 5A8NA 4UR9A 5GPRA 2E8YA 3ARYA 1BQCA 3SCQA 4M29A 4U2ZA 3CIVA 2VUYA 3HMCA 1VBRA 1B3ZA 5I79A 4CVUA 5CGTA 5A6JA 1HNYA 2A3AA 2YA1A 4QAWA 4AZCA 5ABFB 1V3MA 3SUWA 5IFPA 4PTMA 2VRQA 1UD6A 2DSKA 1OWQA 1XSIA 2CESA 3ZJ7A 4IPLA 2ZE0A 4OUEA 2WVVA 3VNZA 4UFLA 1QI0A 3WKZA 1B3XA 1D3CA 4TX8A 3AS1A 5JBEA 4JAWA 1KBKA 1GONA 5CLTA 1V3JA 1C8QA 3AHXA 3AOFA 3WDIA 3WDHA 1WCGA 4FLOA 4PMOA 4XV0A 1WPCA 2XVNA 2X0YA 1JYNA 5BXTA 1BHGA 1E6RA
chains in the Genus database with same CATH superfamily
1RQBA 2OFNA 3SY8A 5D38A 4ILSA 4LTSA 4PEEA 1WOBA 3F2DA 3LGEA 3QHNA 2AAAA 4IIHA 4J3WA 1DXEA 2YCIX 4I6KA 2OT0A 3AZRA 2VTFA 4LRSA 4LAOA 1XUUA 1ZP4A 2G5WA 3GC5A 2ZQUA 5H91A 5CPNA 3GUWA 5FEZA 1M6JA 1ELSA 4LALA 4OE7A 3UU0A 4HMNA 1EYEA 1EX5A 4DWSD 4ZSTA 2BXYA 3VKJA 4GQBA 4PTXA 2VENA 1K6WA 1XSKA 4IMCA 4MB4A 5DMMA 5ECVA 2RAGA 1SQ7A 2G96A 3SSJA 3CZLA 5C2GA 4TMBA 4LB4A 1JD7A 2WQPA 3OBKA 2DT3A 1NH6A 1QAPA 3T0TA 3GNRA 5FF7A 3N17A 1IWBA 1QBBA 4Z1AA 4DEFA 3KHDA 4CNSA 3W76A 1XYMA 3KTXA 3TYAA 4PMQA 1GVSA 1R2RA 1XYAA 1SO3A 3VNDA 4P7QA 4S3AA 3S46A 3L68A 3VIOA 1UD3A 1XRVA 3VOGA 1UQYA 5K9XA 1EEPA 3P82A 3NQ7A 3VKAA 4G7EB 1ZP3A 4W9QA 4N9EA 1ISWA 1F8AB 3UXLA 1XFCA 3HV8A 2UV8G 1QW7A 5CC6A 2NW0A 1EP2A 1BLIA 4FNPA 2DY3A 4YN5A 5F2MA 2YGYA 1E1CA 1TG7A 1V7AA 3LI0A 3UZYA 1P1XA 2XYLA 4QDPA 2DZAA 5C9XA 2QMKA 1C90A 3NYZA 1VFHA 2QCNA 1CENA 2X7WA 3QMRA 4CD7A 3VIFA 3AIQA 3ECQA 3KAGA 4LUIA 4W86A 4OGZA 5AHFA 5DT5A 4CKQA 2EKGA 5A8OA 3LTPA 3W7IA 1H7PA 4RXGA 3N2BA 2NZLA 3C2FA 3HPAA 1VFSA 3C0QA 1VBJA 5AC4A 3WLQA 3EXSA 5KZEA 1BXNA 3TAOA 5EFFA 5I77A 1QR7A 3WBXA 4TTUA 3O6YX 2XZ7A 1DIEA 3CV1A 5DO8A 3D0CA 2PCEA 4AEEA 2QT3A 3IPWA 2EKCA 1DJHA 4JL1A 2YB1A 3O5FA 2PAJA 3G0UA 1RD6A 3GIQA 4WVXA 3CLWA 3BGAA 3S9YA 1XRTA 1EBGA 1KC7A 3C86A 3L9CA 4GY7A 2Y78A 4UNKA 3U48A 4A29A 2J4GA 3UJEA 4DO7A 1Q7MA 3WD2A 3NAVA 1EFZA 1P5BA 4HYVA 4G2DA 3WJXA 4NF7A 5CLWA 4QSFA 5H6HA 3PWAA 2BY2A 1H50A 5E93A 5A6BA 1MRAA 7REQA 3L12A 2OSWA 4WSJA 4E6MA 1IE7C 4IZGA 4JQ2A 3TN6A 3UZJA 4YWSA 1JZ5A 3DFQA 2HE5A 5G1TA 1QATA 3JZEA 4UTTC 5H8PA 1TIWA 5KETA 2PEVA 4B3LA 1T8XA 4N9CA 4HHMA 3NDOA 3LHWA 3PVFA 1ZJAA 2NWSA 5LA2A 4NP7A 3R8GA 1TIMA 4O4VA 1MFVA 2FVMA 4PB3A 1YXDA 3GKFA 2CHNA 4BF5A 5E5CA 1T5AA 1SW0A 2VJXA 3PFMA 3EKGA 3NFUA 4J2MA 2REQA 2NWRA 1ZBVA 4W88A 3OVPA 3IARA 4Q8TA 3AHYA 1IXPA 2Z1VA 4FI4A 1GVQA 1RZMA 3PPFA 4C1NB 2PV1A 1NWRA 3LENA 4IQCA 2WM1A 1AQFA 3HF3A 4IJCA 4MZYA 4YPJA 5CPLA 2QV4A 3I6CA 4PTNA 3EX2A 2VOMA 4S3FA 2R6OA 4XBSA 3IJ9A 4D1IA 2V5LA 4I9TA 1EF2A 5TF0A 2IXUA 3F7JA 3TNOA 3I3BA 1E9YB 3CT7A 3RFWA 2QIWA 3QM3A 1KGWA 2V30A 3S2NA 1UA7A 2GQ9A 5MF5A 5DY3A 3BICA 5FI8A 2O0TA 2ZZ2A 3BURA 2GQ3A 5C2CA 1RQHA 2D20A 4UTLA 4LYQA 3PTMA 1SJDA 4U31A 2JE8A 1AZ1A 2RUCA 3MBDA 2CBIA 3R94A 2GSEA 2VEMA 3GDTA 2J79A 1PHQA 1HL2A 3SECA 5M3WA 2WHLA 4BK9A 1TV2A 1K8XA 1LZOA 1H09A 4RPPA 2HK1A 1HX0A 4RUBA 3KRBA 1GJUA 1QNRA 1CXIA 3PNZA 3QRHA 1HQTA 1WXZA 2Y7EA 4DXXA 4Q3MA 4H9MA 3ID7A 3CWHA 2Y1HA 2AGTA 2KO7A 1YMYA 1H1ZA 3H26A 4FOJA 3U5YA 1YNQA 3UQNA 3OZYA 1GQKA 4TW8A 3VD4A 5HMEA 1HL8A 2ONEA 1WDSA 3W1TA 4XKYB 3WMSA 2CIPA 2BHYA 2ZE3A 1GOKA 3HFYA 2P0IA 2QNEA 4NX0A 1W0MA 3E0LA 4F66A 3T2QA 5CZKA 3RJYA 4Q8NA 4U3CA 1LP6A 5BU9A 1DXFA 4V2XA 2PDUA 3CLMA 2JF7A 2IKHA 3WNMA 5HJXA 1OVDA 4GWEA 3PF3A 3EZ4A 5FESA 3A4AA 5FF3A 3WNNA 1MUWA 5BRPA 4RJEA 2OYKA 1XRSA 3O07A 4RZ5A 2ATSA 1KR0A 3GXIA 4WX2A 4LVBA 3QY7A 2BFGA 3LDVA 4KGJA 1TTIA 1P43A 4C6MA 1YPXA 1FWAC 3DZ1A 1NP0A 1YE4A 1FWEC 1BF2A 2NQHA 3QTGA 3B0VC 1GHRA 3H22A 1FKBA 3CTLA 4E2BA 3LPGA 2PWVA 1V3HA 3MP3A 5GPGA 4ACZB 1MUMA 4X61A 3PANA 4LVAA 5FCZA 2I5IA 4G7EA 4S3EA 4H9XA 1HJVA 1FJDA 1GKRA 3ZR6A 3IUIA 3TROA 3RO8A 3S6OA 2WVTA 1PSCA 1EIBA 1NSJA 1DIOA 3EOOA 3SFKA 4JFVA 3AMCA 5J5DA 1UB3A 1A4MA 1KGXA 2DV0A 3MHGA 2Y0FA 1VLIA 3V7PA 4JYEA 3H6OA 2WC7A 1V4YA 4H9UA 5HMSA 2ZC1A 2PDBA 3UG5A 4AZ5A 4O28A 3QXBA 3I4KA 3KABA 4US5A 3DC0A 3CWNA 4Z2LA 2DQWA 2CLKA 4HA4A 2QLYA 3MP5A 3DGBA 4LF2A 3WQFA 2F6UA 1X1ZA 1FAPA 4IPXA 4UOQA 2YDQA 3BLOA 5G2HA 1C3FA 5K2ZA 3EBVA 3AIRA 1U2YA 3MCOA 2BBFA 1PIGA 4PFMA 1DEDA 2DP3A 3LEPA 4JX5A 2BTMA 1PXGA 3EMCA 3LSBA 3GHUA 2QGYA 3IACA 3OGVA 2RSEA 3EIPA 4W5UA 5U4NA 6A3HA 3TQ0A 3EY6A 1VYSX 3K8LA 1D2KA 1AQ0A 1EJRC 4ZO8A 3O9NA 3CEPA 1OG0A 5I3KA 2A21A 1J0KA 1JCJA 2B7OA 3N3TA 5HTGA 5M1TA 1UWQA 4LVGA 3EOSA 4ZZ9A 1OZQA 4H8VA 1TSIA 3V16A 1GZGA 1BWLA 3W2MA 3NGJA 1PKMA 4W8BA 1WX0A 1PZ1A 2D73A 4W4QA 3FOKA 2RDUA 2J75A 1UH2A 3GXFA 4LUTA 2P3ZA 1EH9A 2E0PA 3ZWSA 1ZJHA 4XISA 3UGVA 5CBBA 3FGCA 5L9FA 1YLVA 7XIMA 2CWXA 1RHCA 2WNNA 3WLLA 1E70M 5RUBA 4DF2A 2PDXA 5HINA 3GDKA 1KRBC 1OG6A 3DG6A 4AEFA 1UUMA 1XR2A 3S9ZA 3VCRA 4B90A 2FZBA 3MWAA 5JH8A 4QIBA 4QXIA 4PMVA 3TA6A 2WYSA 1A5SA 1XINA 1OCNA 3TH6A 3W9ZA 4JIHA 3BPWA 4BQ3A 3CO8A 1RUSA 1R86A 1YTKA 4RZ4A 3RPTA 5A8MA 4JFLA 3MB9A 1P6BA 4EPDC 1UPMB 4JKMA 1YX1A 4PL2A 3QW3A 3I6RA 1HUVA 3T81A 1OGGA 3OHMB 1US2A 2Y2WA 5F7UA 3NL2A 3NNTA 1ITUA 4HKPA 1ZBKA 1NOFA 2GUUA 4EPBC 1OD8A 1ALDA 2ZA2A 3WQ4A 3GRIA 4QLJA 2J9ZA 4M82A 3W7GA 3EYPA 4E4FA 1H4PA 4HJWA 4K36A 2WHKA 2RUDA 5AC5A 4DNMA 4K37A 4OJYA 4N0RA 3CWOX 3UG8A 1UZ4A 1AH4A 2WCAA 5GQBA 1TZ9A 4JICA 3BCJA 3KLKA 4A3RA 1MQRA 2FAPA 3I7RA 1NP2A 1YBQB 3GVQA 3BLLA 5CXPA 4MWAD 4AWUA 4A2RA 4CQCA 1T0OA 2BGSA 1J11A 3P0XA 3TC6A 3MJYA 3L2MA 1KM2A 1G0CA 4QEEA 2UY5A 1O5QA 4JTRA 3AIVA 5TD4A 2PDHA 1F6YA 2EG6A 3PA7A 1IXOA 3LMZA 3NG3A 1GQLA 4UQCA 1KGUA 4C6EA 2XN1A 1GEQA 4JN6A 3B8WA 2VURA 7TAAA 3WNOA 3HJEA 5GJMA 4BEQA 4DN1A 3IVSA 1JVNA 4ODRA 5K4XA 2Q8XA 3C2RA 2OWXA 2PWFA 3G18A 2BP1A 3FW6A 4FX7A 4WEVX 4HZ7A 1EHAA 3T8QA 3TMLA 1XDJA 3MMDA 1Q2RA 1EJWC 4LBRA 1K7EA 1Z89A 4KMQA 1FCBA 1W3KA 3C8NA 4HSOA 3TYZA 2EXOA 1FUYA 1GEHA 4C5YA 2HBXA 2FPYA 2P10A 4G5DA 3QPEA 2QDGA 1VJZA 3R6IA 1NDVA 4F2BA 1S1PA 4DRIA 1H1YA 2W91A 4E2DA 3LD5A 1HN1A 4K7YA 3BJTA 3QMSA 2PODA 3ES7A 2XN2A 4NJHA 5AHEA 2ZADA 3PFRA 3K2GA 1SZGA 1M7XA 1KXHA 4LFYA 1L6WA 3WYZA 4PRWA 1XYLA 3EDFA 4JQ1A 2Z1WA 4GIEA 1FCVA 3OLIA 4G1NA 2QS8A 1PX3A 3RIKA 4GPNA 1HL9A 3LCWA 3M5XA 4R9OA 5A8GA 1V5XA 5HW8A 2ZQSA 2A3BA 4LBUA 4ADUA 5IHSA 2CPUA 1R38A 3S1GA 3W24A 3BJSA 4B5XA 4QSHA 2A3HA 2PC4A 3MZNA 3M5YA 4QITA 3FKRA 4L6HA 5A8QA 1EUNA 2DVUA 5EMMA 2NVAA 4LVFA 1PBGA 1B9ZA 4GGBA 4MDOA 3DHPA 2L2SA 5HWMA 1V03A 1MDLA 3JR2A 4HNCA 4JEQA 5CPMA 1XBXA 3O6CA 1DJNA 2CLEA 3NJ3A 4LAWA 4TXEA 1XL9A 1V51A 1IWPA 1EC8A 3JRKA 4DZAA 1LOQA 3WFZA 4LH8A 3CYVA 1QI4A 3RM8A 1ZNNA 3I7QA 3LHUA 3LCHA 4Z0JA 1E9IA 1KM4A 3ERPA 2C91A 4ZO6A 1JCHB 3QR3A 4PE8A 1J93A 4UC5A 2EJAA 1XH0A 4KRUA 4WZHA 2QQ6A 1Q45A 4S38A 3UGRA 4MB3A 4XZHA 5CZTA 1SMDA 1OFQA 1K1DA 3LU2A 4ODLA 1W1IE 4ZPWR 1KRMA 5HQLA 3KVJA 1GVFA 2M2AA 3W37A 1OZMA 1IGWA 2HS6A 2POZA 3W7MA 3WJWA 4AAJA 4QR6A 4EXAA 3FLUA 1SZFA 1RCXB 3HG5A 4D6GA 4EP8C 4ZENA 3EA1A 1PL9A 1TA3B 4YTSA 3U2EA 3GIPA 1V3LA 3NQGA 1VBHA 3W84A 4M6VA 3O5MA 4GI6A 1EOKA 3GVGA 1N82A 4YHEA 1A7XA 3L66A 4PH6A 4U5KA 4CD5A 2VZUA 3W7PA 1WYIA 5REQB 3WJYA 4OOZA 3NEHA 3SGUA 2XG9A 1NM9A 3KDNA 4Q6JA 4HU8A 1B2YA 3AMGA 4TOQA 1C7SA 2QUTA 2JALA 4H7VA 4Y2WA 5LGXA 1H63A 3PB2A 3W1RA 5U7SA 3WLHA 4P7RA 3THQA 3VK5A 3GTNA 1UJQA 3FVDA 1ONEA 4AH7A 3PRDA 1IHIA 4EX4A 2WW5A 4YIWA 2DUAA 2YLAA 1V3IA 1ZZMA 3WF4A 3UPBA 3UVAA 2P8BA 2FH8A 3Q94A 4KR0B 5HNTA 3NWRA 1W9UA 3T2PA 2CZ5A 4S2CA 1P6WA 3CV7A 1ISXA 2VZOA 5C71A 1W9DM 4OUIA 3DFYA 4DRJA 3IKDA 2ZZ6A 2FH6A 4DBSA 3S47A 1H7NA 4X3ZA 4I5RA 3IHZA 3VZYA 3GD6A 1H62A 1XIGA 4IGSA 4Q4SA 4FIRA 2WMFA 4RE4A 2QAPA 1UKOA 4LC8A 2YJQA 1H3GA 3CGTA 4HHLA 1PDYA 3RGTA 3IANA 3MV11 4AXNA 3ZSTA 1OCQA 4M7TA 3AJXA 1QI5A 1SSGA 2I16A 4UFIA 4DM1A 4ZR8A 4AQLA 4A8LA 2FKEA 2OOGA 1IR1A 4R27A 1HJSA 3TQPA 1IT0A 2O7QA 3G3MA 4EWND 2FTYA 3M0ZA 4KFOA 2F9RA 1MQQA 1GOWA 5GJPA 1KKOA 1BRLB 2ZCGA 1XS2A 4JTJA 1ISVA 2W5FA 3E74A 3WDPP 2XP9A 4OT7A 2CCRA 3HN3A 2HPMA 3M0IA 1BYBA 5HMFA 3BE7A 4JY8A 3M0KA 1PKLA 4LNCA 1PKNA 2WBKA 4IG2A 4PMUA 2E9BA 1JPKA 5DRIA 1YW1A 5BXSA 4FP1A 3OW1A 2E3ZA 1ODZA 3WH5A 1R3YA 4BWLA 3WF1A 3ZQ9A 3WQ8A 1UWRA 4NZ5A 2M1IA 3WK3A 5I09A 1RV8A 1ZBWA 2GGIA 4L80A 1PVNA 3ZJ6A 1UZHA 3ABSA 1CIUA 4GISA 3FJ4A 4GYPA 2Z6IA 1EQPA 4BQ2A 3WH0A 1J5SA 1SJCA 2YXGA 1VRXA 3LHZA 1OCJA 1OFDA 2W0UA 4C6OA 1XLDA 3VD3A 3HPXA 3WZ0E 3EOEA 1BSLA 2CLHA 2ZKMX 2Y8UA 1AD4A 1QCWA 2NQLA 5FAJA 5AC6A 3DESA 4KCVA 4QJ3B 4WQ6A 4EOUA 3KWXA 4U86A 2E6YA 1W5QA 5DMYA 1XRFA 2HMCA 1FP8A 4UZUA 1G7VA 3M0XA 4K1WA 3HQNA 3DFPA 1Q6LA 1TV4A 2INEA 1Q1CA 3GFYA 4DBEA 4FHAA 5I3FA 4DB7A 4FXRA 2QMJA 4IM4A 3W87A 2GL5A 2PDNA 3LS9A 3LQGA 1FCQA 2HVMA 1FTXA 1D9EA 3NQBA 2Q5AA 1H0IA 1UH3A 4C60A 5K3VA 4NIRA 2OELA 1W1B1 1BYDA 4B16A 1ADOA 5AHMA 1O95A 2VEIA 2ZUTA 3SAZA 3HQ1A 4HQVA 4H8NA 2DEPA 3ABQA 1I2PA 1OT1A 5KZMA 3T0BA 3BV4A 2GPTA 3DH7A 4GXMA 1NIUA 3MYPA 4AF0B 3MCNA 4DRSA 2GJXB 2F23A 4GA8A 5FJOA 4YNGA 2OWCA 3OQEA 4Y90A 4IFKA 2DW6A 4UQEA 4MIMA 3A3XA 5EMLA 1NAL1 4K7VA 2OZTA 3OPSA 3N2CA 3WG6A 5ECUA 3C5QA 3VIHA 1QTWA 5CZSA 3VCNA 2GJRA 1WP6A 1UUOA 3CYJA 3ARWA 1CXEA 4AYGA 1GOOA 4ODNA 2WXDM 3LRKA 4C7FA 1JZ4A 2IQDA 3TLLA 2IQTA 2OQLA 2QUVA 3GBEA 1GJPA 2YL9A 1U1UA 3QQ0A 2NQ5A 3E0IA 3B7XA 4O19A 3HMJG 1IZKA 4P5UA 5I6SA 1UKQA 4US6A 3BG5A 3W1UA 1S5NA 3EWUA 2J8GA 1KXQA 1WO2A 2G50A 4ADSA 3TP4A 3GG8A 2QYGA 3TAKA 4NRSA 4B9YA 1RJRA 3USBA 5D2VA 5CH9A 1HP4A 5CAHA 1LTDA 1VHNA 2XINA 1Z7AA 3O06A 4R7OA 1KNWA 1PIIA 6CGTA 3SQSA 4QT2A 4O0ZA 2V5DA 5E0CA 2C0HA 3RPDA 1FWCC 6ENLA 5CKSA 3BXWA 4IT6A 3L4UA 4LY8A 4JFKA 2MNRA 4LCQA 4HNTA 2WV8A 2PMQA 4GYKA 1UD2A 1EDQA 1ZSXA 1EWDA 2ABAA 5PTDA 2BY3A 3AHTA 1UQZA 1K9EA 1YW5A 4X9YA 3ITLA 4AD5A 3OLEA 4HCDA 3JYJA 3EPNA 4Z2IA 1TPB1 2FZ9A 4JTUA 3AYVA 1FCUA 1Q8AA 1DQWA 5TNVA 2CITA 4ICNA 5A3HA 3M7WA 1AJ2A 3VGEA 4IPJA 4GIAA 3PZVA 3QFEA 3GKAA 4GKLA 1POKA 4MUPA 2CZFA 1KM3A 4WDUA 2GDVA 3VDAA 1Z48A 1Y5VA 3SCSA 1KBBA 4XK2A 1IQ8A 4HK7A 3N25A 3SIMA 3W26A 2A2IA 2GJNA 2OQYA 3MI3A 4E38A 1EPXA 4IOTA 2HTMA 3VNJA 3R43A 5FL0A 1JF6A 2YX0A 4S1FA 1TKKA 5E09A 2ZXBA 6PTDA 1HKWA 3WLNA 1FHDA 2YYTA 1XLCA 1JGIA 1F8MA 1NU5A 3NQEA 1HW6A 3N29A 5A6TC 3EWDA 3VINA 4IHCA 4LEQA 4FX6M 1J0YA 4QQ3A 3BWWA 3GTFA 3QV8A 2O9OA 4GZEA 4N7QA 1DTNA 3EB3A 4ITZA 1Q6FA 1QO5A 4DNHA 3GDLA 4DO5A 3TR9A 5B7ZA 3MDUA 3NQ6A 2WVUA 3I3EA 4N2YA 4DZIA 1W3IA 4TX6A 4G9PA 3OYZA 3DU0A 4AU0A 1FKJA 1EC7A 1FQ0A 2XH2A 4M80A 4XQ6A 4GMEA 3LX9A 1JDCA 3WK0A 1CLXA 3L4YA 1J18A 1TPVA 1UR0A 2Y63A 4BI5A 4PZVA 4M7SA 1MI3A 2ZUNA 3UQIA 1N7KA 2AL2B 3QPZA 5BU6A 1BAGA 4NZFA 4ODKA 2ZZ4A 3TYEA 2FVLA 2VEGA 3LG3A 4GNKB 3M6YA 5A6LA 3PPCA 4LAMA 1OX4A 4A6GA 1OC7A 4PSPA 2A4AA 2VVSA 4RNFA 3C0SA 1Z69A 1FBAA 3EB2A 3NTYA 3RUBL 2QF7A 3RU6A 1SM9A 3G77A 4AWTA 1XLFA 2PE4A 4LYRA 4QBXA 2NVCA 3GVRA 4GNVA 2DZTA 3K4DA 4LS1A 2G3MA 3FHQA 4DM2A 1J4IA 3B0YA 2E6AA 4GQ0A 5A69A 1RY8A 3TOPA 2ISVA 2OWWA 4JTFA 1FH8A 2RQSA 2BSLA 5CSYA 2QV5A 1BYCA 4X0VA 1W8SA 4DBUA 4BQ4A 3W3OA 3QZ6A 4Q4OA 3BLEA 3B9AA 1NOUA 3S5SA 1QNPA 3DKJA 4LYPA 4HB7A 2DIEA 1AW5A 4IXHA 1GHSA 4QIUA 2RGLA 4FIQA 4W8LA 1VFLA 3QV9A 3DFOA 1C9WA 5HOSA 4XB3A 4ZS6A 2YSWA 1ECQA 2IQ0A 4INFA 3GYEA 4GNJA 3WEMA 3GYCA 3ZJ8A 1EZ2A 4PL1A 4DIAA 1Q3NA 3EWYA 3RRAA 3IUHA 1AG1O 1ZJIA 2ZX5A 2UZ5A 1ME8A 2QJGA 3S83A 1E0UA 1ESWA 3KBWA 2VXNA 1CECA 4MSPA 3S4TA 2XVKA 1VFFA 3I65A 3DFHA 1BYAA 1VIZA 1R30A 3FA4A 3IJ6A 3H2EA 5FF0A 4GRSA 2BVDA 3CMJA 1GVOA 3IGUA 4Q4RA 3ONBA 5HPOA 4F79A 3LBCA 4F0LA 2R9RA 4AZHA 4HOXA 5A6AA 4DJFA 4UZSA 1M04A 2CXEA 4CU8A 1YDVA 4ACYA 4XSLA 4N02A 4O8AA 2PPNA 1ZPTA 3MP4A 2OSXA 2E40A 4PUUA 1QNOA 1EB3A 3WDJA 3JUGA 3EDJA 3IAQA 3SCUA 3PZGA 1JYXA 4LV4A 1S2AA 4ZOEA 4S3DA 4K38A 2V67A 1ZY9A 4U85A 2XVLA 1WZMA 1RJQA 3BJFA 1KCXA 3IGSA 4XAGA 5E6ZA 2ZZ3A 5HATA 2WMIA 1EJUC 1FWSA 3ANYA 4EKJA 1V0KA 4JS3A 2D2HA 1MXSA 1SR0A 2XHYA 3V36A 1DJZA 2D1ZA 4B2DD 3NO5A 4PTVA 1Q63A 4WJXA 4DQWA 3SY1A 3MSGA 1CB7B 3P62A 1US3A 4PCFA 4UR9A 3MWCA 5GPRA 3SCQA 4Y96A 1FKLA 1SZNA 2ISWA 4U2ZA 4FNUA 1VBRA 4W9TA 5I79A 4CVUA 5CGTA 3GW3A 1HNYA 2ZVIA 2YA1A 3PBVA 4KPLA 5ABFB 1V3MA 1S38A 5CJMA 3QGKC 4JFMA 3SUWA 3ICJA 2VRQA 1UD6A 2DSKA 1OWQA 3E9AA 3T0CA 1XLMA 3QSTA 4XZNX 3WLKX 2CHRA 3UPMA 4AY7A 3TKFA 2E25A 3VNZA 1QI0A 1D3CA 2HE8A 1GOXA 3AS1A 1M41A 2PA6A 4JAWA 1GONA 2UZ9A 3AOFA 1E44A 3WDIA 3H4XA 1WCGA 4FLOA 1L6YA 3G2GA 2V9DA 3SSZA 4WY0A 1UR3M 4XV0A 1WPCA 4GH3A 3FS2A 4IH3A 1LROA 1BHGA 3KFTA 1E6RA 4QE4A 3PRAA 4EE9A 3MMUA 3W53A 3PK7A 1NY1A 2PDQA 4AISA 3LM7A 4MGVA 1RP8A 3W7OA 4B5UA 1WNOA 4RW5A 1ITCA 3EEZA 3EGJA 4DVOA 2F2HA 3MHUA 1H7OA 2XM2A 5K9CA 4EANA 3U0HA 1XLEA 1J6PA 1PTAA 2AGKA 2CBUA 3V3WA 1YPFA 4GYJA 3QH2A 1B4EA 3AFBA 1MUCA 1UMYA 4OWGA 3WBYA 1PHWA 3P14A 4E2VA 2Q6ZA 1WQ5A 4RDZA 3CJPA 2PFHA 1XICA 1K4HA 1WAWA 3S5NA 3W7JA 3VGDA 2HXUA 1IT7A 1UR8A 2F84A 4HSHA 2QPSA 4MJMA 5EBAA 1XIMA 1DIDA 2RGMA 4LSBA 3S6TA 2Z29A 1AL7A 3W2NA 3IAPA 4AWSA 1JZ3A 3SO7A 1CBGA 3BSMA 3VOHA 4OBSA 1TWZA 1W17A 2WKGA 3WLRA 3M0MA 5CQ1A 2C18A 2LGOA 4DJDA 5AKQA 3KBJA 5I3DA 2GQAA 4GLEA 2PLJA 3K13A 3GB6A 2YCLB 3PTKA 1XP3A 4WKFA 5AYYA 3UEQA 4LAYA 4CN4A 4E3TA 2V68A 4HZMA 3WH6A 1JCNA 1R46A 3ENLA 4LX4A 2XIJA 3FV9A 3IRSA 2FIQA 3QEZA 1CWYA 4WOZA 3HB9A 4GX8A 1HVXA 1ONWA 4AXKA 1J0IA 2A0NA 2QPUA 3TTYA 4UDMA 3LN3A 1CB2A 3L65A 3C6CA 3SGGA 1Y0EA 1C8XA 1UROA 3NQVA 4TV5A 5DCDA 1TPC1 4GACA 3M5ZA 3UCQA 2ZXDA 3GDMA 3N9KA 1U83A 1G94A 2XFYA 1Q66A 1LRNA 4KIRA 5A6SA 5B8IC 4A8RA 3W22A 2PV2A 3R11A 4S2BA 2Z2BA 4M24A 5E0FA 1Q6EA 1S2CA 5A95A 2QDEA 4DT4A 3T4CA 3LOTA 4O1BA 2F61A 1JI2A 3CUFA 4C90A 4ZTXA 1FDYA 3QZAA 4S23A 1UJPA 4JYSA 4QZVB 3AMDA 2W61A 1GPFA 2Y89A 3XIMA 3M41A 4MYAA 2D0GA 3QR0A 3WQCA 4JQ4A 4NVTA 4D8ZA 2ZX6A 4ZQPA 4PMZA 2O9PA 3RJXA 3KHJA 3UXDA 2WZIA 2XP4A 2GJLA 4HNNA 4Y9NA 4Y9OA 1PJ9A 2DVXA 1S2UA 2XH4A 3TFCA 1TPH1 3BQ6A 3CAKA 2L5HA 3CHDA 3A5VA 3U2ZA 5LHFA 4I8YA 1XIBA 2O9RA 1WB0A 3RLHA 1F07A 4J3ZA 3ABRA 1M03A 1N55A 3PBWA 4WXZA 4JTSA 3DECA 1IXNA 4DZ2A 1DORA 3NDZA 1Q5MA 3I7SA 1KO0A 2XFFA 2WM0A 4W8AA 1RA0A 1E72M 4J4KA 3LTSA 1KM0A 3RLUA 1J0ZA 4WGXA 5CCZA 3WQGA 1C7TA 1OSEA 3TQVA 1D3GA 1XLGA 3SGZA 1O1HA 1MO0A 3CMFA 4EPKA 2POTA 5I98A 5SWUA 4KBXA 9XIMA 3OLDA 3VIPA 1F40A 1W31A 3QLDA 3V4BA 2EQDA 1ISZA 2E5BA 1DL3A 3UF8A 4S3KA 4AVOA 3TXZA 1FKRA 1RVGA 4PUNA 5IOBA 4IGHA 4PTWA 1J4RA 1FRBA 4YTRA 2HV5A 3WLPA 3K5XA 1H60A 4HN8A 2PD9A 2VZVA 2VR4A 4TX0A 1DJWA 1PS9A 2KR7A 2JK2A 4O1EA 5DO2A 4MY1A 3IGXA 3VNKA 4F2TA 5G2IA 1E4LA 3CEUA 3A21A 4XD6A 3IIPA 1CYGA 1TVLA 4IMFA 2ZZ7A 3CPGA 5FJPA 5IRPA 4LQ1A 5DXYA 1O12A 3O5IA 2A3LA 5BCAA 3P2VA 1VD6A 4WHBA 3M46A 3NL5A 3MO4A 2BOEX 2ACQA 3FYOA 4XSMA 1K9FA 4GVIA 1QHOA 1D7IA 2Z2UA 3R4IA 1UWSA 2QULA 4JYDA 4L4LA 2NV2A 2OG9A 2MNTA 1T6MA 5D2TA 4E0CA 4JTTA 4Q8UA 3NQMA 4UTWC 1XHGA 3P84A 4H2CA 2Z24A 1JI1A 3O5EA 3A5FA 3W70A 1SFSA 4Z2KA 4FAMA 5I23A 4GGHA 3SI9A 3R2GA 3CC1A 3BOLA 4UNIA 2GVLA 3UJSA 2ZQ0A 1UHVA 3WJZA 1TR1A 5E9XA 2PRMA 4QJ5B 2W3ZA 4CCZA 1YATA 2VZTA 4AWEA 1PV8A 4QROA 3EWCA 1E1EA 1GG1A 3BLDA 3S5OA 4P8WA 4JHMA 1RQEA 4TW7A 1RK6A 1KWGA 4FNQA 1ZK6A 4PYSA 3OHIA 4MLRA 1E4IA 5HAOA 2QCDA 3W74A 3TW7A 2PDYA 1FWTA 3BG9A 5HUOA 4DO6A 1EJSC 3T07A 1TX0A 1KKRA 4NAFA 2V2DA 4QLLA 3ANVA 2HJPA 2X41A 3AIUA 1J4HA 1A0CA 5I78A 1K9DA 1ZCNA 1KTBA 4ICMA 4MNMA 3IWPA 2W6RA 4V1XA 1YHTA 2GVJA 4PODA 1N1AA 3S0CA 2ZXAA 5DLCA 4PUKA 3W1QA 4POCA 4GQRA 3PY2A 1UIOA 3EX4A 4DRQA 1FDZA 2ZRZA 4LAXA 4CQAA 3NQDA 4JGDA 1GORA 2Y8KA 3HGOA 2HVNA 5XINA 3W83A 2PC8A 4LUYA 1IX5A 2CERA 3KRZA 3IJDA 3UA3A 3E12A 4MG4A 1HO4A 4J1OA 1W91A 3ALFA 3KLLA 4PRRA 4Z1BA 2JGQA 3H7VA 1R7OA 1X8FA 1QWGA 5DY2A 4XZ9A 2XPKA 1W5NA 3WNPA 2OZ8A 4ZE4A 3PZMA 4HN4A 2GVEA 1FHUA 2GGGA 1QT1A 3KBSA 4KFNA 1E6PA 1PE1A 4PMRA 1XWYA 2X1TA 1T41A 2J78A 2WLZA 3G0XA 3PRBA 2IMRA 4HCLA 1TJRA 4I5XA 4HNUA 2YCLA 3DHFA 4JBRA 4LS0A 3IS4A 1D7HA 3F2BA 1QNVA 2GVYA 2HNEA 4O1AA 1UR2A 2RHGA 2JEPA 3LCLA 4HBOA 4NSBA 3C2YA 1TCDA 3FJ6A 4EPEC 3W27A 4AVNA 2R91A 4BCEA 2D3LA 4XTDA 4Q4KA 4ZEPA 1XGEA 3MBFA 3W86A 1FKKA 2NX3A 4UTFA 2OGJA 4KWWA 2GGHA 3MUCA 2WO5A 1JNEA 3CMGA 4IGMA 1A3HA 3TTQA 1Q6RA 3WQVA 2X1RA 3QC3A 1AVAA 1WE5A 2PLKA 1FWHC 1EBHA 3VDHA 3WEZA 4YTQA 4RR4A 4V1YA 2XP5A 3UR5A 1UR1A 3W7HA 2FFCA 2PS2A 3ABZA 5DMNA 1TPWA 2VC9A 4F9DA 2H9AB 2PUZA 3R12A 2DZUA 2FTWA 4ROPA 1I1WA 1R2SA 1L1PA 5MKGB 1R3SA 3W82A 1R8LA 3NM3A 1E73M 1QOQA 4F0KA 5CG7A 1VH7A 4ZQOA 4M6PA 1YNPA 4O1DA 3W6MA 2CLPA 2ISSA 4R0XA 4JEJA 1M01A 4X2RA 4Z17A 2IPGA 2R24A 3BUVA 2QCCA 2ESCA 4Q8QA 1RJPA 3N9RA 4K68A 4RDVA 3VX1A 3FDKA 3IIZA 4M19A 4HU4A 1DHKA 5EL1A 1WZKA 2PBCA 4A21A 4OTKA 3R13A 1BFNA 1K9TA 4AC7C 2FGZA 2ZA3A 3R10A 3TZFA 1W3JA 4LUJA 2XWDA 1JDAA 3ARTA 3MUZ1 2DUXA 5C5YA 5KTLA 1VPQA 3AWNA 4CD4A 1PCWA 2PDGA 4FLSA 4C6FA 2RURA 3IK4A 1A5AA 2OODA 1U5HA 2P76A 5I00A 1OFOA 4YS1A 4OZOA 3DAQA 3KRSA 4ZQNA 3S8HA 4KW2A 1PWMA 4KT2A 2GZXA 1F76A 1ICQA 3VMPA 3SCVA 1W5OA 3E96A 3MJMA 3GFZA 1QW9A 3KBMA 4J3VA 4D71A 1F3EA 1HKKA 1V93A 3GXTA 3WLJA 5J04A 6REQA 4M6QA 3W07A 4NZCA 3CNYA 4GX9A 2PGFA 4DBWA 2FB3A 3V0SA 3PUOA 3HG2A 3CXOA 2EULA 1Q6DA 3VNYA 4YHGA 3GHRA 3THAA 4AIUA 4PMXA 1FFRA 1VGAA 3RO6A 4JZ5A 1TWWA 3C2EA 3R7MA 4M1RA 4AZBA 2QDDA 2YDAA 4JKLA 3BMBA 2P0OA 5F4WA 5LNRA 2WSRA 3KS6A 1AH0A 3BW4A 2AOSA 2R82A 3OA5A 1CXFA 4BR1A 3P93A 2YPIA 3V75A 4H9VA 4GC4A 4MSSA 3WK2A 4AZGA 4B5NA 4J7RA 3TVAA 1M65A 4QQUA 3ITTA 1E15A 3T42A 3KAFA 3Q65A 1OQFA 3PN8A 3U8GA 2Z7GA 4KKXA 5LHEA 2A79A 3MVTA 4O4WA 4Q8VA 2IKIA 5I2UA 2I9UA 4IISA 4ORIA 2YA2A 2EPOA 5C7VA 5CJ5A 2V3FA 1KV5A 1I6NA 2CFFA 2Z28A 1JNDA 5XIMA 2HISA 1Q85A 4LJ3A 3ARQA 3GNXA 1EQCA 1U5JA 4LW7A 3PWGA 4JPGA 2NX1A 3UI5A 2OCZA 3P80A 9CGTA 5C70A 2A7RA 3A13A 1J5TA 1K3UA 3W7RA 4OIFA 2VT0A 1MW2A 1MZRA 1RPXA 4BWLC 2W63A 3RHGA 1A5CA 2J25A 3PS7A 5D02A 4QX4A 3E2QA 4UMCA 1PINA 1OGBA 3GZ3A 2WMJA 2GK1A 2CHOA 3REQB 3LV5A 2BZNA 4AZCB 4GVGA 3VOFA 3CUGA 3BL3A 4CQBA 1XJBA 2N87A 3LHYA 4ZPTR 4GYPC 5HQEA 2WVVB 3COTA 1ENUA 3V0UA 3HO8A 3SUSA 4PR4A 3K1DA 3A23A 3OYXA 3BDKA 4LEFA 2VC6A 1LL6A 2EEXA 1F4HA 2QGHA 5JIWA 5D37A 1KCZA 3PR9A 4HPXA 4IQJA 4L72B 3Q45A 1WDQA 1PO9A 3KBNA 5G1YA 3ZJKA 4LVDA 4UTJA 4WKHA 1LBLA 4DWSA 1H5VA 1Y5WA 3VD5A 2FB2A 3H2FA 4ENLA 2JKAA 4NXKA 5E70A 3JZUA 3DDMA 2WCSA 1VFUA 2OB3A 2RH9A 4U10A 1TUXA 4DAFA 3UJRA 3KAOA 3SCRA 1FH7A 3S1UA 4L5ZA 5CSUA 3WF2A 1YTDA 1BG4A 3KE0A 4H3DA 3GG1A 2ANUA 4DYJA 4ZOBA 5CC5A 1FY6A 2Y7GA 1ZJBA 3R0UA 1NFPA 3H55A 1EA9C 1BGGA 3CL6A 1T8QA 1UUQA 4HHPA 4PUWA 3OB8A 1TPUA 4NZ1A 2EPMX 4YWIA 3MKCA 4L6DA 5KSWA 4U5IA 3EXTA 3M43A 3B8DA 3N1AA 3W81A 4S3JA 1YTEA 4GUJA 3IK8A 3UCCA 2EGZA 3HPFA 3WLMA 3D6NA 4W89A 2WVSA 1P7TB 1QW8A 2VVNA 2MLYA 3EA3A 4AUBA 1VLWA 1FWBC 3F1QA 4WK9A 3LV6A 1E1CB 5KZDA 2CKRA 4JIQA 4O13A 1M7JA 2QR6A 3ELFA 3SUTA 4ICCX 3CGMA 2WHJA 1IEWA 5LGZA 4B91A 2J9YA 3QF0A 2K8IA 1OF8A 2R1PA 1AH3A 4IIBA 2EG7A 2E68A 1HKIA 1BKHA 3DYOA 1JDFA 1WXJA 4JNYA 4QDMA 2G3IA 4ZPVR 1HXVA 5IFTA 5TQLA 5D2WA 3WFLA 1SYTA 3WMLA 4NI8A 4HK6A 1JL8A 2VUNA 4IXXA 4C65A 2C79A 3L21A 4RE2A 1H1NA 4JXCA 2DGAA 4NNAA 3MKKA 1R7AA 1TWIA 3GNNA 1DQXA 3E1F1 4JIPA 1JXJA 1C93A 1RCOB 2DSUA 4GUHA 1F8IA 2J7FA 4Q22A 4QRNA 1V02A 4HTYA 5J6EA 4GZJA 2W9MA 3HIJA 4O14A 4GC3A 1A3XA 3NQCA 3W7LA 3TIMA 3TU9A 2YLLA 1GJWA 3GIYA 2VI0A 5HANA 3CBWA 2FJUB 3MKVA 1JCMP 2ZDRA 3B8TA 4IPIA 3BSHA 3V18A 1E6XM 3WENA 3EDDA 3K4AA 1EC9A 4QISA 4N42A 1OM0A 2YCEA 2PU1A 5HQMA 3ZO9A 4GCXA 1E71M 1QI2A 4AHPA 4N9DA 1E0WA 3G5EA 2YBVA 2Z27A 4HU0A 4J28A 7REQB 2CETA 5D8ZA 2XVPA 4NUWA 3BSGA 3CV2A 4I6VA 1SMAA 4HP5A 5HNUA 1XLHA 3VGGA 3LI1A 1VCFA 3DN5A 2YR1A 3K46A 4KERA 1V08A 1CLKA 1W26A 3AISA 4WXYA 1M3UA 3WEOA 1GUVA 1E55A 3E5BA 1DJIA 2C8NA 4GGQA 3GNPA 1ZAHA 4BY3A 2D23A 3HZ3A 1W54A 2IKGA 3WJSA 2E4TA 1F3TA 2ZRWA 1G4SA 2REQB 2VCDA 4JYFA 4P7LA 2VYOA 4IQDA 4LYKA 3V1PA 3PUEA 3MVIA 5DBTA 1OD0A 1X6UA 1QASA 4S39A 3C8FA 1U79A 1DE6A 1XX1A 3B05A 2GSJA 4E5TA 3FAXA 3NYDA 4M56A 4IT4A 1JXKA 3TCZA 1MZHA 1J4EA 1I0BA 5DF0A 1QK2A 3AIEA 4LANA 2J27A 2IF4A 3S2JA 4JHOA 4H6KA 4AFYA 2WMHA 2EJ1A 4L1XA 1FD9A 1VHCA 1X1NA 1M68A 2E6FA 3DYMA 4P2VA 2UY2A 3LTYA 3UY8A 3OJGA 1G4EA 3DHDA 3STGA 1EPVA 1VFMA 1CXHA 4X22A 1TUFA 2DDXA 4L7ZA 4AG0A 1F73A 2WZTA 3TYUA 2HSAA 2NQJA 3GC4A 1HKJA 4Z08A 3GO2A 1MNZA 5FD0A 3WBAA 3PZOA 2YFOA 3EDKA 3M47A 1U1JA 3WL1A 1JZ6A 4XZLX 3QKEA 1VPXA 3FXGA 4ERGA 3B40A 4YMZA 1Q4NX 3QVQA 3LUTA 1OY0A 5I03A 4WJEA 4EF9A 3T0DA 1WOAA 3B0UX 2WPGA 5HJLA 5D75A 5HNRA 2XGIA 8CGTA 1X38A 1KR1A 3ZLFA 1V8EA 1TV7A 3P3BA 2A7PA 3E2VA 4NJKA 1ML1A 4DUOA 2BXZA 1DOSA 1FHLA 4ZMGA 3ZT5A 3ITGA 2C7FA 3SY5A 4DJEC 3A9IA 4HNOA 1GW9A 1O5KA 3NI6A 3RMEA 4F48A 2RDTA 1IR2A 3TQKA 3AI0A 2X0HA 2Y88A 2ACRA 4XBJA 3U7BA 1EKOA 2DG4A 3BMWA 1VEMA 1LOSA 2OX1A 5EU9A 1BWKA 3A47A 5AHLA 1W5PA 1B6CA 3NZPA 2B7PA 5J5RA 3LXBA 2YCKX 2BGNE 3OVGA 2OFJA 1ODUA 5G4EA 2DZWA 3KOZA 1FHVA 1NJJA 3VUPA 1HP5A 4DJFC 1LLWA 4O54A 5F1UA 4GFSA 2GOKA 5D9PA 3UP8A 3UG3A 1XC6A 3UYIA 3GXNA 3KOYA 5DELA 3SR7A 4AD4A 1X7IA 1ZU8A 2J7DA 4PN2A 2E09A 2WJDA 2GJPA 1DKWA 4MNJA 4BZYA 4TV6A 3RMJA 3W2UA 2PDMA 1NWTA 4HTBA 3TYCA 3RXZA 2QCEA 2QCFA 4U4MA 4CNNA 3W29A 1P7TA 4AVFA 3NSMA 1E0XA 2V81A 4IPNB 3TWAA 5EMUA 2TMDA 2F7FA 3O5RA 2V0TA 1LLOA 1DWAM 1J6OA 3FIGA 1CXKA 5BRBA 1GOQA 4K8HA 3LQLA 3TOYA 3VO0A 1JPMA 3P67A 2YZ5A 1C91A 6XIMA 1XDLA 1VAHA 4BA0A 3FAWA 4F4RA 1VCGA 4IX0A 1JDDA 4O11A 1CCWB 2BVTA 3BANA 4RE0A 4OU1A 2FHBA 3RM4A 1GOMA 4FXFA 2H3DA 1L8NA 2PDJA 4QNWA 2X0SA 3MQTA 1TJ0A 1A5LC 3WLOA 2EPKX 2PZNA 2VWTA 3SURA 4Y6GA 2AQWA 5DIUA 3ZOAA 3GU9A 1KRAC 1TJPA 4FXSA 4UOZA 4GE8A 2P1FA 3RX3A 1DWFM 2OSYA 1CNVA 3DI0A 3NA8A 4GIYA 2PGWA 4Z2GA 2G0WA 5FOOA 5LNUA 3LUOA 3GVVA 5CJNA 1CGWA 1XW8A 1PCKA 2PDWA 4F8XA 4KFPA 3KOFA 3UWUA 3NR0A 4E4PA 1XG4A 4NXSA 2A7NA 1UWTA 1A53A 3RRXA 2R94A 5HMDA 1ZUAX 3AZTA 4O52A 1TB3A 4HYRA 3TUUA 1B3OA 2EF9A 4H9TA 3PULA 3KP1A 3STFA 5FEWA 2FHCA 3MPGA 1RLCL 3ORWA 3CQHA 3VKCA 8XIAA 1TQJA 3AYSA 3NZGA 2FMNA 1NWUA 1J96A 1VYPX 2V38A 1UWIA 3UQBA 3S1XA 3WH7A 3BK0A 3IIVA 1WZLA 4H01A 1BTCA 1RBLA 4D1JA 1W9VA 4LUTB 2GYIA 2H3BA 2RUQA 3RK8A 3Q4DA 4CN6A 2Z7KA 4YLWA 3FGCB 1MDRA 1OC6A 1RVKA 4D6HA 1B31A 4JTIA 4JIIX 4CNPA 1GOIA 3DGRA 2PTDA 1SO4A 3OIHA 4AX7A 1EYWA 3AS2A 3S5ZA 2AKZA 2HRWA 4JIEA 1QPRA 3VUSA 1GVRA 4U33A 1YNYA 3S42A 3UWQA 1Y0OA 4CU6A 1H0GA 4DJDC 3UCDA 3UERA 3N4EA 1WV2A 2PWUA 4PB4A 3UR7A 3UZ5A 2CNCA 1LT7A 2C1HA 3BGGA 2XDFA 2KGJA 3DFTA 1GZ1A 3VXGA 4C5ZA 4D6FA 2BS9A 3TSDA 3RDKA 3W88A 4C91A 5KMYA 4F40A 2VOTA 3CHEA 1XIFA 1SJAA 5BMXA 1LBFA 3LRLA 2FHFA 3T44A 3HBLA 1OYAA 1HJXA 1X39A 4WD0A 3TDFA 4IFOA 2FKPA 1ADDA 1VZWA 3NDYA 3QMTA 1CT5A 4QNEA 1JZ2A 2TYSA 4JNZA 5HR6A 3AYTA 4M6UA 2WKLA 4JFWA 4P7OA 3FFSA 3CB8A 1GYLA 4G56A 2WHMA 1HFBA 5LA0A 2OKTA 3W7DA 3ZM8A 3NSNA 1HG3A 4MWAA 4NAEA 4G7FA 4G50A 3GTXA 2XUCA 3OOQA 1I8JA 4IUGA 5T26A 3AXKA 2WJFA 1X7FA 1MWOA 3U2OA 1LRQA 2J24A 1P0KA 2DPEA 1QNSA 1K77A 3Q2DA 3BMXA 1UWAA 2QJHA 3V0TA 1Z9AA 4JTEA 3KZ7A 4BEUA 1V3KA 2NQ9A 3VDCA 4L4PA 1UBPC 1RBAA 2VQUA 4Z1DA 3QOKA 3A6OA 3N6QA 4JTAA 3L2IA 2VN1A 2D0HA 4NX5A 2FZ8A 3BQ5A 3TV8A 4OV9A 2O9TA 3WQOA 4PB5A 5AC8A 1R6WA 3BVJA 5DIVA 1MQPA 5EPDA 4K8EA 5HW6A 1FP9A 3VNLA 5CZ0A 3R0KA 1A80A 3KADA 5IDIA 3OZMA 3OA3A 4NU7A 4W87A 4L9YA 3CASA 1QI3A 5FAGA 4GOAA 2BLEA 2WMGA 4RV3A 3G1AA 4XO6A 1NVMA 5C55A 1KTNA 5KZ6A 2IXVA 1C29A 1EHNA 1NEYA 2Z00A 3RLGA 1AQMA 4JN8A 2PB1A 4R3UA 4XIMA 3C4UA 1TO3A 3GU1A 3PC0A 2E5DA 5CPSA 4F0RA 1A5KC 3ABOA 4Q4PA 1NQKA 2P3EA 2V6AA 5GNYA 3TX9A 4UTHA 4S3GA 3RNDA 3N04A 1U33A 3VPLA 2C1IA 4L4MA 2PV3A 1G5AA 2C0AA 2ZWZA 3KCEA 2V5KA 1HJWA 4HA3A 3KOXA 3LCIA 1WZAA 2PRHA 4NG3A 5CGMA 2RKXA 2VL4A 3AAMA 5L6UA 2PPOA 3N14A 2Q8ZA 3HPSA 4XUGA 3G22A 2BDQA 5D05A 2A3CA 4NI3A 5ABEA 2E28A 3I4EA 1KM1A 3KCLA 1L6SA 3UW6A 1XYCA 4WGHA 1DVJA 3FNDA 2WLYA 3JVAA 3NVTA 3KCJA 2DIKA 1Z3NA 3AIBA 4AX6A 4DI8A 4EVZA 3CK5A 3FX4A 1DJQA 2XSXA 3S1VA 3E0WA 5DEZA 5JIPA 1AA1B 3S2MA 3P7YA 1SFLA 3QY6A 4I8DA 3GG7A 3RR4A 2ZUMA 5C6MA 1E0VA 5JH1A 1EGMA 3F03K 2JF6A 5JMUA 3SRDA 2OLHA 4HPNA 2ASHA 3D47A 1IEXA 1GQNA 2X42A 4MJ2A 5A8NA 2BVWA 2E8YA 1BQCA 4M29A 3CPRA 3B0PA 3MCMA 2NV9A 2VUYA 2P4VA 2P8CA 4WCJA 5G4HC 5LXXA 1L8PA 4HNLA 4N19A 4MKSA 5F2IA 4Q7BA 3WX7A 4PTMA 1QK0A 5EY5A 3KBVA 4OUEA 4IQEA 1JRBA 4UFLA 1B3XA 2CU0A 5B7YA 5HWJA 4GFIA 4MZ8A 5XIAA 4GXWA 1V3JA 3AHXA 4PMOA 3AALA 1D6OA 1SFJA 4M5PA 2KZHA 3PP7A 1JYNA 1OABA 3BG3A 3W02A 1L9WA 1O66A 2XTKA 4A3UA 1R85A 5A94A 5F4SA 1Q8JA 1B4KA 3G1DA 4O16A 3EWWA 3S6DA 1E9ZB 5A2CA 4I7VA 1FWRA 4DYEA 2PCQA 3IV3A 3E0VA 3KL0A 1LOLA 2DH2A 3AWOA 3EKLA 1XFBA 4BF7A 1W9PA 3GSMA 2I9EA 1FKIA 3B8SA 4PMDA 1YDOA 5BNKA 3TJXA 3L4TA 3WH9A 2Y4SA 2PP0A 2G8ZA 4UFKA 4Q4MA 1R47A 1YEYA 3RILA 5LNWA 5FEXA 3RAOA 4B3KA 3VA8A 4DELA 3E38A 5CZJA 4FAPA 4EACA 3NIYA 2JKPA 3G1XA 3QN3A 4KGLA 4PMJA 1OIFA 1FKWA 3HM7A 5HW7A 3VCCA 3WDRA 1UASA 4P8VA 1Q13A 4KH2A 1NDWA 3W72A 5HDRA 3QSRA 4REQA 1HT6A 4ATDA 1NDZA 2DSWA 1VBGA 2E5CA 3VVGA 4KWUA 1RR2A 2EHHA 3LA4A 4JX4A 1PWLA 2WZHA 5G1MA 5BWFA 3PHAA 3WNKA 3UNTA 1FX6A 1VYRA 2GOUA 4MNKA 3O5JA 4NYYA 1FDJA 3U5UA 3CUIA 4TVUA 3MZ2A 3ITCA 5HR7A 2PDIA 1BG9A 1RBOB 4RL3A 2QKFA 3LPOA 3N2OA 1F6KA 3MT1A 3QV6A 5LA1A 4DIPA 1Z41A 1W3TA 4FSAA 4G2PA 3VX0A 1ZQ5A 3VGBA 2WZMA 1UOZA 2H6RA 3WUEA 3VKKA 2OZ0A 2B0MA 1LQ0A 4C7DA 4XAFA 1CZ1A 3R8HA 3U9IA 3O05A 5BXRA 1REQA 2G4JA 1MNSA 4QS6A 4IIFA 4ZSUA 3H12A 3CB3A 3VMNA 4PSRA 4J5NA 4O0QA 3JYMA 5DITA 4XIAA 3U4AA 2ABBA 3WF0A 4IG2B 3OO2A 1JPDX 4PBFA 1XC4A 3MS8A 4IP4A 4ODMA 3O7UA 3CS2A 3FY1A 2PDKA 3EPOA 1UCWA 4GK8A 1FOBA 5LYRA 3ITXA 2D69A 4BI7A 1KW1A 2KX9A 4XO7A 4CCDA 5LIKX 1QVBA 1OFAA 2VFFA 4CQDA 3TW9A 3IIXA 2ZA1A 2WSYA 2YL8A 4TVDA 4AD1A 1K7FA 3SCOA 1HJUA 4XAKA 4R9XA 1N2VA 5IBXA 4JFTA 4L9XA 2V2CA 4M0XA 3GH7A 1F9CA 2QXWA 1PZ3A 3BW2A 4IGNA 1B1YA 3W0KA 4C6IA 2ZBTA 3RX2A 1TJ1A 4FLRA 1TJ2A 2PWHA 3R25A 4MKVA 3CZJA 2E6DA 4H9YA 3NZQA 2NUWA 5BOFA 1FWIC 1V7YA 3ZVHA 4WR3A 5HULA 3PZNA 1P48A 3T09A 2ZX8A 4UUIA 1J0HA 3GNOA 4EXQA 3SDOA 3UESA 1R9ZA 4AHQA 3G1VA 1K7XA 2TODA 3ZVIA 3UWZA 4JTDA 1IEQA 2QCLA 3MDWA 1JYWA 1IYXA 1ECEA 2DSZA 2SFPA 1HGYA 3W7KA 4FOUA 3BV7A 3N2MA 4AIBA 4FALA 1FFQA 1KFCA 3NRKA 3D5HA 2WNQA 1EDTA 4AZIA 4D6CA 4FEZA 1AQHA 4MUZA 2VCBA 4UIOA 4UQAA 3FEQA 3VM5A 1MW0A 4C1LA 4BQ5A 4MOZA 2XP8A 3W38A 4RLIA 4IFKB 3GH5A 1G67A 2HQAA 1JNSA 1P1MA 1ZTVA 2J6XA 2JBMA 3L5LA 1JCTA 4O1FA 1UZ1A 4MNLA 2R1LA 1JYVA 3WN6A 3IJ7A 2ZWYA 1S2WA 1LJYA 4W9PA 3FA5A 5GJNA 2BHZA 2BHUA 2I7GA 1W37A 1CXLA 3E49A 3L0NA 1VKFA 1ZGDA 2EO7A 2PTYA 3HU7A 2OOFA 4XG1A 3F4WA 4QEHA 1NFGA 3MANA 4ASTA 4GIVA 3WIJA 1QPNA 2DU2A 2CLLA 3E5PA 2BWGA 1VRDA 2DG3A 4MMWA 4QFUA 3BAXA 4L9ZA 3AU6A 4HOZA 1LDCA 2I1OA 4UOJA 5AECA 3SN1A 2ZRVA 3PG8A 4ZODA 1PUDA 3UG4A 4O18A 3VYLA 4O8RA 5EMKA 3E2RA 1P0NA 4PMNA 3C2VA 1WKDA 2PDCA 1DIKA 3TK7A 4D6EA 2JIEA 2HPIA 1BGAA 1DE5A 3UR2A 4IMAA 1P0EA 2QCGA 4H8HA 1XH2A 2OU4A 5HA7A 1BXBA 3WLTA 2CBVA 3EPMA 1CTNA 3EAUA 4LU0A 3E3HA 5DMLA 3GHSA 4DWSC 3VABA 3WF3A 2D9FA 1LWJA 3NCOA 3F2CA 3VIIA 1F3XA 2OX4A 3L4ZA 1KBLA 1SFTA 2RDXA 2VC7A 1HXJA 1OEPA 2MUCA 2PF0A 5AZ1A 4O10A 4H04A 2WAGA 5JVLA 3PM6A 4HHHA 2G3NA 3VIJA 4QAIA 1XD1A 1OIMA 2DH3A 3UXKA 8TIMA 4X63A 2ZRYA 2DQXA 1GT8A 2E1DA 3P8IA 4F0MA 2ACSA 2X30A 1Z42A 2D2GA 3ALGA 3QC0A 4B5WA 3DHUA 3AS0A 5ENLA 3WSUA 1B30A 4C6NA 5LZLA 1CI1A 2DVTA 3BLIA 1V02E 4N4PA 2WANA 1A3WA 3DEQA 3VGHA 5I0DA 3P81A 4BI6A 3W23A 4IL0A 2YL5A 4RW3A 1XI3A 5BOEA 1GK8A 2EG8A 2WMKA 2X2YA 1JQXA 1QFEA 1S3HA 4L6OA 3GU0A 2F38A 4Q8PA 3B8VA 3CIWA 5M17A 3PZQA 3NEVA 2X7VA 4HBKA 3LLFA 1UR9A 2B7QA 4L3NA 3OOBA 2V3GA 2W62A 2RJGA 4ZXLA 3LHVA 2G41A 1O7AA 3ZXWA 1O6IA 1H7XA 1G69A 1OX4B 1Z32X 4XD3A 1B3YA 3DERA 4DF1A 3CAWA 2ACUA 3T4WA 1N8WA 1IZCA 1OADA 1LWIA 1XCWA 4GH1A 4LB3A 3H2CA 3DG3A 3BARA 3ZR4A 4K39A 4JY9A 3N11A 1C92A 5LIUX 1FKTA 1W2PA 3SB0A 1SGJA 3ARSA 4C6LA 3S2LA 1SSDA 5FSDC 1EP3A 3KACA 3CAVA 3W75A 2GVGA 2EPHA 1IZJA 4D72A 4UFMA 5I7GA 2EAWA 3IGHX 3P6LA 3MY9A 1GTHA 1EJTC 2VEFA 3N2XA 4AEOA 3M64A 4KEZA 5TIMA 1EL3A 1D8WA 2PSNA 3VIMA 1JAEA 2W27A 5EB8A 2PWGA 5TAOA 4Q7NA 1ROUA 5KINA 2VFIA 4NZJA 1JUEA 1QUMA 1P0DA 3IJQA 3OZOA 2CZDA 2Z4GA 3TC7A 2WK2A 4RV8A 2YDRA 3KRUA 5T8GA 2GWNA 2QCHA 2OR2A 2PLMA 4PCSA 3G1SA 2J62A 1Y65A 1MXGA 1A0DA 2E67A 1E6SM 4XAZA 3TMQA 4X0NA 3MSDA 1Q2SA 2INZA 2ZYFA 1D8CA 1V0LA 2DZPA 3SN0A 3IJ8A 3H7RA 1LORA 2FQIA 2QJIA 3RCNA 4TR9A 4JR5A 5BROA 2TPSA 1TFVA 4ZQCA 2QJMA 5A8PA 3L4VA 4RE3A 2BX7A 3R58A 4GI9A 3O6DA 3EOUA 2CYGA 4RZBA 4NJIA 4FF5A 1XGZA 2XPAA 4ML9A 1I2QA 3R79A 1GWJA 1VQTA 1EJVC 4IQLA 2XIBA 3EWZA 3UNDA 2CXGA 4W5ZA 5I3GA 2F4EA 2YZRA 2OLSA 3IUDA 4IJBA 5AYIA 1U5VA 4YYFA