1LG2A

Crystal structure of human chitotriosidase in complex with ethylene glycol
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
365
structure length
359
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords chitotriosidase
publication title Structure of Human Chitotriosidase. Implications for Specific Inhibitor Design and Function of Mammalian Chitinase-Like Lectins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 123
structure length 359
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1lg2A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1lg2A01
1B3XA 3EDJA 5A6MA 2WXDM 4LGXA 2G3JA 3AI0A 4GINA 5BWFA 2YIHA 1PX4A 2XIBA 4AW7A 2XVGA 2WMHA 3WF3A 4M81A 1FH7A 3WUFA 5LYRA 1W3LA 1WDQA 3WNPA 3FAXA 5KEZA 2E40A 3AIBA 3AHTA 5I6SA 2YDSA 2GUYA 3CLWA 1LWHA 4MJ4A 2D0FA 4UOJA 2FGLA 1X6NA 2DQXA 2AAAA 5FL1A 2BXYA 1L0PA 4V28A 5DMYA 5HNNA 2GSJA 1W9PA 4AIOA 4NRRA 3OLDA 2EO7A 2FH8A 1E3ZA 3G6MA 1WB0A 3VM5A 5CXPA 3AXIA 1W3HA 1BVZA 1KQYA 3UCQA 2JF7A 2OSWA 1FP8A 1D3CA 2XVLA 3A3HA 1KWGA 3WDRA 2WPGA 3W37A 4TXEA 3MANA 4UTFA 1NWSA 2BFGA 1JZ6A 1RPKA 1E72M 1O7AA 3L4TA 1UD5A 3L4VA 3BCFA 1X6LA 2VZVA 4P7OA 2DH2A 3AMKA 5IHSA 1CGUA 3S6TA 1Q6EA 1FP9A 3SURA 2JIWA 3ARPA 3SCRA 1BGGA 3NSNA 3RDKA 3VMPA 4NI3A 4URIA 4F66A 1E0VA 4X9YA 4WK9A 1W1YA 3OZPA 1JYXA 3TP4A 3S2CA 1UZ4A 4IPNB 4ACYA 5D8WA 1EDTA 4AD1A 1F4HA 1H41A 4PMNA 5A95A 2DSWA 5E9AA 2WZEA 1E4NA 5JIWA 4U33A 1IT0A 1L8NA 1TG7A 3ALFA 1UKOA 3CZKA 4ZXOA 3ARRA 4M82A 4QCEA 4KRUA 4PRWA 2DT0A 4DUWA 3T2PA 4D6IA 3TONA 3VIHA 3WDQA 1XH1A 2J47A 1JI1A 4WKFA 3WF1A 4W8AA 4JL2A 4L4PA 1HJSA 2W63A 3RM4A 1HKKA 4DWSC 7CGTA 3EDKA 1JNDA 1GOWA 2VO5A 2RGLA 2UY4A 2WVTA 2CNCA 1R85A 2E4TA 5FKYA 4GI9A 4M1RA 4P8WA 3PZ9A 3SCSA 1DWGM 4UNIA 2YKKA 1MQQA 1AMYA 5KZ6A 1V02A 1GZJA 1GJWA 1J0ZA 1OT1A 2YBTA 3MSGA 2DSKA 5EMYA 1EDQA 5GNYA 2EPMX 1ZU8A 2B31A 1CXEA 4Q22A 1MFUA 2X0YA 2XFRA 3WD2A 3NYDA 3T2OA 4HTYA 2ZUNA 2OYMA 4JCMA 3APGA 2E9BA 2XM2A 5ABEA 4AY1A 1JXJA 3OBAA 1LWJA 3BSHA 3NCOA 2VZOA 1Q6DA 1J0HA 3A47A 4B16A 8A3HA 3VDAA 4RE2A 4HMCA 4K68A 2Z1SA 1JZ4A 4ZE4A 3ARYA 2ZOXA 3I3DA 3N13A 3WQWA 1DWHM 1CTNA 3MMUA 1H4PA 1H11A 1H3GA 4QP0A 1K9FA 2GK1B 1QHZA 3NSXA 1H1NA 1CGYA 1S46A 3OGSA 2E0PA 2W5FA 2V3DA 1JFHA 1D7FA 1BPLB 4UFIA 2FHCA 1XC6A 1UR2A 5C71A 3HJEA 1OBAA 4W93A 4W84A 2VZUA 4BQ2A 1JZ3A 4OBSA 4D6HA 2ZUUA 4ZFMA 3AIUA 2PBOA 1I75A 2EPOA 4UFHA 4QFUA 3SUWA 3ZJ8A 3BAKA 3AMDA 3VO0A 5A8OA 3UETA 2JEPA 3VTRA 4LXFA 2CETA 3VOCA 1JD9A 1XGZA 3VIPA 2VJXA 4NF7A 4JZ5A 5CGTA 1HP4A 3OGRA 2ZUSA 2CPUA 1CXHA 1KGXA 3N04A 2DT3A 2OWXA 4J27A 3VMOA 4D6DA 1UWQA 4WKAA 3N15A 2WKGA 3WELA 5FCZA 4UQ9A 3W26A 5FOOA 1YHTA 1UYQA 1V0LA 4ZXLA 2D3LA 4TVDA 2PWGA 1HL9A 4UZUA 3B8SA 1K9TA 3AROA 3CHCA 2CBJA 4OBRA 1CGWA 2WZHA 5E0CA 1DP0A 2X8RA 5A6AA 2AMGA 1GQIA 3BSGA 5C70A 3SCOA 3ARXA 3AJ7A 5D9MA 1A47A 1J0YA 2WLYA 9CGTA 3ZT6A 2VX5A 1DWFM 1H2JA 2BY3A 2E9MA 4HU0A 3SUTA 2X0HA 2XGIA 3HMCA 4W89A 2WBKA 1QHOA 1WDRA 3DHUA 5D9OA 3IJ9A 3ZSTA 4JIEA 4EK7A 3SEPA 2J7GA 4FK9A 2NW0A 3SCVA 3VGDA 2BHZA 2J7FA 1NWRA 1WE5A 4F9DA 3WD3A 2WMIA 1KQZA 5BRPA 3VX0A 1BYBA 5CLWA 3WDIA 1E5NA 1PIGA 3HU7A 4PCSA 3MU7A 2YDQA 3QHMA 2VQUA 4PMDA 3SCUA 1N82A 4OOZA 1LG2A 1K9DA 2C7FA 2NSXA 1UR9A 4UOQA 3J7HA 3WQ8A 3VDCA 3ARUA 1C91A 3WQ6A 1VEMA 4LYQA 1W3KA 3B9AA 4P7LA 5AC5A 5CSYA 2WANA 1VF8A 1H0IA 4HA1A 3LPFA 4M29A 1GCYA 4GZIA 5GNXA 4C7GA 2WWDA 3CO4A 5EB8A 4B9ZA 3RO8A 1HJUA 1EXPA 2VRQA 4H04A 2CBVA 1ECEA 2WC3A 5CPSA 5A6SA 1HF6A 2YLAA 3GNRA 4TX8A 1QOXA 1BF2A 3F4VA 1CYGA 4PMOA 3WMSA 2DPEA 4B15A 1OGBA 3AIWA 3EMZA 2EPLX 3WL1A 3EYPA 4W8BA 5M5DA 4H8HA 4NRSA 4AMCA 4P8VA 2JALA 4PMVA 2CXGA 5A2BA 3VD9A 2ZUMA 3KZSA 2XVPA 1C8XA 3LMYA 3PZUA 1EO5A 3VD5A 3ZT7A 1CECA 3GXFA 3ZR5A 4D6CA 4GZEA 2AOSA 1QNQA 4JHOA 2WVUA 3MS8A 3AQUA 3WF2A 2PWEA 1CIUA 1GOQA 3WH6A 2W67A 1GORA 1MWOA 3BXWA 3K1DA 3QOKA 1TUXA 2J74A 3B9DA 4RE4A 2DIJA 2XYLA 5A8PA 3DYMA 1JDAA 3FW6A 1CENA 2CBUA 1B90A 1OCQA 3M46A 2WB5A 1G5AA 4MNMA 4WSKA 3E1F1 3WUBA 4Z2JA 1E1FA 1AQ0A 2WMGA 2OWWA 2GJXB 4DUXA 2BVYA 1WZAA 4PUEA 2XM1A 1P6WA 3U57A 4AZIA 4JFSA 1ISVA 1W32A 2W4XA 3MUY1 4CVWA 3NSMA 2V3GA 4AZGA 3D3AA 3FXYA 1JIBA 1UA7A 1KR0A 2D3NA 3WNLA 1V3JA 1E56A 2J7DA 3BMWA 1VB9A 4QLKA 1DTUA 3WH7A 2ZXQA 2CIPA 4BZYA 1E4IA 2XWEA 4J3WA 4UQDA 5JUVA 4MB1A 1KFWA 1ISXA 1FH8A 3BGAA 3KL0A 3O2LA 4AC1X 5DFAA 2BXZA 3W53A 3VGFA 4C7FA 1EO7A 4S3JA 3TA9A 4S3KA 4M8UA 1SFSA 1UWUA 4JFUA 2D24A 5BXRA 4P7RA 3T09A 4LX4A 3QGVA 5IXEA 3WFZA 1HVQA 3MMWA 2DSVA 2ZX8A 1W2VA 3AIRA 4A4AA 3ECQA 1UR4A 1EOMA 1OM0A 1OINA 1QI5A 3RPMA 4P8UA 2ZXBA 5LA2A 3HN3A 3VIJA 1R7OA 1BVNP 4J7RA 4HZ7A 4H8UA 3SCNA 4XUYA 2VCBA 4D6JA 3ZJ6A 4HMDA 1PPIA 1BGAA 5A69A 4U3CA 4DM1A 3IAQA 3BCDA 3MO4A 5E6YA 4TX6A 3SUVA 1OSEA 1NARA 3OLEA 3SUSA 3WSUA 3ZMRA 5A2CA 3AMGA 1JD7A 3EDDA 1HKIA 1B31A 1B3WA 3ARSA 3TTSA 3WKZA 3BAWA 2G8ZA 3EMQA 4CD6A 4EE9A 5HDRA 3VD3A 3EDFA 2BHUA 3RM8A 4AD3A 2UY2A 5GPRA 1WZMA 4W87A 2VVNA 2Y8KA 3WY1A 1QHPA 1J9YA 2WLZA 1PBGA 3N9KA 3IK2A 2Y5EA 1E4MM 3IJ8A 1R8LA 2HISA 3BAJA 1NWTA 2RGMA 6TAAA 1GOMA 5I2UA 3PTKA 5M03A 3NIYA 4TVUA 3VD4A 2V5CA 2G3MA 1B3ZA 1KBBA 1UQYA 2XVNA 3T0BA 1E6XM 3WMCA 1CXIA 1E6SM 1JZ2A 3SCPA 4PTVA 2YL8A 1V6UA 4FLSA 2VZTA 2XFYA 4AIEA 1QBAA 1BQCA 3K46A 4JL1A 2WVVA 3QHNA 3WQ4A 4W8LA 1E0WA 3L4WA 3VILA 2OSYA 4OIFA 4AD2A 3GBEA 3VIOA 1MYRA 4AWEA 1XH0A 4YHGA 1UA3A 3PBGA 3UR8A 1GVIA 4YHEA 4OZOA 4Z2KA 5A94A 3TTYA 5AC4A 5A8MA 4JKKA 1JF5A 1HJVA 3I3EA 5LA1A 5E09A 1CDGA 2VMFA 4IM4A 4XX6A 3BAXA 3AXHA 1US3A 3WENA 3SCQA 3K4AA 4AZCB 3CZEA 2G3IA 1CEOA 2GDVA 4EAMA 1V0MA 4QLLA 1GQJA 3THCA 4W7WA 1UZ1A 1WNOA 2D1ZA 2BHYA 2Y2WA 3UEQA 1UKQA 3GZAA 2YA1A 1FH9A 1EH9A 2A3BA 5M3WA 3AHZA 1QBBA 1TVNA 3II1A 1NOUA 5AYBA 2VCCA 1SR0A 3VD7A 4JFVA 3U7BA 2W62A 1WZLA 1UKTA 1CGVA 1E4LA 2YA0A 4KWUA 1W9BM 3RJXA 2WSKA 2E9LA 4J3VA 2QHAA 2CCRA 1VEOA 1GQLA 1VRXA 2G41A 3RMEA 2GK1A 3BAYA 4AEFA 1UQZA 4Z2GA 3W4RA 5D9NA 3BLKA 4OKDA 5FIPA 5CGMA 1WKYA 4DWSD 5I23A 4PMQA 1JFXA 1C7TA 5M17A 3DYOA 3CHEA 1GPFA 2JE8A 1UD2A 5TD4A 2J77A 3RIKA 1AQHA 4JKMA 3WIJA 4XB3A 1M03A 5CPTA 2O9OA 2XSAA 2A3CA 4CGTA 3MUIA 1UUQA 1VBRA 1NP2A 5DEZA 1ISZA 2QPUA 3WN6A 3WDPP 3ARWA 1CNVA 4MJ2A 1BLIA 2WHKA 1G9HA 1TMQA 4HPHA 2PB1A 4R27A 1XYZA 1CXLA 1RP8A 1IV8A 2ZX6A 4CD4A 3MSDA 3VUPA 2XVKA 1SYTA 1U33A 5A8NA 2MANA 3GM8A 1GHSA 2WCAA 1FFQA 3PTQA 2QMKA 4DWSA 4M56A 4H41A 3OB8A 3ARTA 4HOWA 1W2PA 1XSKA 1LL6A 1JAEA 1J01A 4H2CA 3WBEA 1OGGA 3KL5A 2ZX5A 3AISA 4RL3A 1ESWA 4MB3A 4KMQA 3WEMA 5HBFA 4UFKA 1M01A 4W7UA 1JYWA 3OLGA 3WFLA 2VZSA 1QW9A 1MW2A 2WHLA 3NJ3A 4AISA 4ML4A 1D2KA 1U30A 2FH6A 5ABFB 1V3IA 3UESA 1VBUA 1J10A 5A6BA 1OIMA 3N1AA 2XHYA 2WWCA 1RH9A 3AZSA 1UG6A 4U3AA 1WPCA 3AS2A 1UR8A 4U2ZA 3WMBA 1JDCA 1JZ8A 1Q6FA 2CERA 1E43A 3U7VA 4F79A 1J18A 2DGAA 3MMDA 3AFBA 4ACZB 5IDIA 2ZWZA 2VRKA 4YN5A 2J75A 3W6MA 4HOXA 4AZ7A 3ZO9A 1W1TA 1HNYA 3ARVA 1C93A 2OYLA 1ZS2A 2VCAA 4PTWA 1CGTA 3PN8A 2XTKA 3W6LA 2A3EA 3FNDA 1KXHA 1PX3A 4P7NA 2W92A 4CN6A 4PTMA 1QNOA 5BYWA 1VFUA 2UY3A 3SIMA 1BG4A 1GOIA 4D72A 4ZEPA 1Q6CA 2VI0A 2VT0A 1G1YA 4MB4A 2J62A 5F7UA 3THDA 3N12A 3PZIA 1W1PA 4J3SA 1J0JA 3CHDA 1KXQA 2FHFA 3OGVA 1I1WA 4A3YA 4A3HA 1CLXA 3AS1A 3O9NA 4UZSA 1E6PA 1WAWA 1XV8A 3GBDA 2XWDA 2V38A 2YL5A 3W0KA 1HX0A 4U5IA 3PTMA 1DWAM 4AYSA 5E70A 3OG2A 1JI2A 2O9TA 2CYGA 4W7VA 2GDUA 1RP9A 3ZT5A 1PZ3A 2PWFA 1E5JA 3GNPA 4AIUA 4GO8A 1ISYA 2NT1A 3OIHA 2CEQA 3CIVA 3WD1A 1UH3A 1VFOA 1UWTA 2J78A 2X09A 5DT5A 1K6AA 2VRJA 1V0KA 5IFPA 4X0VA 3M6DA 4TTUA 2OSXA 2ZUWA 2WHMA 2YL6A 2EEXA 1JYVA 4AZBA 2CHNA 5E6ZA 1HT6A 4OOUA 2GJXA 3VNYA 4MADA 2OWCA 1CWYA 1W91A 1VEPA 5A6KA 4GI6A 1W9XA 2D20A 1UR0A 4AD5A 1CPUA 4YPJA 4HA4A 4W86A 4U5KA 2ZICA 1X1NA 3PZNA 2FDMA 4QLJA 3MUZ1 5I24A 1NWUA 2WC4A 4AXNA 4P8XA 4FLRA 3PZQA 5A6LA 3ARQA 4WJXA 3WF4A 2ZE0A 2ZUVA 3UERA 1V3LA 2EJ1A 1W3JA 1BYAA 1V6XA 2DEPA 3WH8A 4W5ZA 1B1YA 3ZSSA 4N42A 1E6QM 1FA2A 1B3YA 3M07A 3CUJA 4AD4A 4JAWA 3RM9A 1GOKA 3SUUA 4AZ5A 1HN1A 3L2MA 2WW5A 1EOKA 4B3KA 3QHOA 3QR3A 1GJUA 1OB0A 3PZOA 2WMKA 1ZBCA 5JIPA 5FD0A 4XV0A 1MXGA 2CKSA 2BVTA 2EPKX 1G94A 3GXIA 4UR9A 1GHRA 5D4YA 1OIFA 4R5EA 1XD0A 2JIEA 3D5HA 3EBVA 5JBEA 3MKKA 1JL8A 3RILA 1W9UA 1JAKA 2D0GA 1M53A 2O9PA 1H0GA 1C90A 1BYCA 3W25A 1GONA 3M7SA 4L4OA 3VNZA 1KBKA 3TTQA 2EPNA 1WP6A 4TVCA 3CUHA 1V08A 3K4DA 2WVSA 3KL3A 5BXTA 1I1XA 5DO8A 5HXMA 4CCEA 7TAAA 2W61A 1EA9C 3EDEA 3A4XA 1CBGA 2E8ZA 1QVBA 2DDXA 3IANA 4GZJA 4XZWA 3VU2A 1H09A 1H49A 4CCDA 5ABHA 3AYRA 2WZIA 1NP0A 3U5UA 2XUCA 4F9JA 4PMRA 7A3HA 3AMCA 1MXDA 3CMGA 4GKLA 3VGEA 1Z32X 5I5RA 1BYDA 3WNKA 3UG3A 1E71M 2VTFA 2WYSA 1TVPA 2QPSA 3VPLA 5C8BB 1E1EA 3L2LA 1NM9A 3MUAA 2G4FA 1GW1A 1OGSA 4PBGA 2FHBA 3FHAA 3OZOA 4TUFA 3A4AA 3GXMA 3T2QA 1ZL1A 1TA3B 2HVMA 1TE1A 2DH3A 4PUDA 5I0DA 4Q7NA 2Y24A 4KGJA 2XPKA 4CD8A 4PYSA 4XZBA 3VGBA 1TZ7A 3A4WA 5ABGA 3PZTA 4W88A 2V5DA 4BCEA 5DF0A 1OWQA 4GO9A 5A8QA 4EKJA 3CGTA 3K8MA 3CTTA 1KCKA 2D23A 3GYCA 3CZLA 1B9ZA 1KXTA 3F5KA 1HKJA 2PC8A 5DT7A 2EBNA 5BXPA 4NSBA 1EDGA 4Z2HA 3GH7A 5AY7A 4BS0A 3CZ8A 5JBFA 3WQ5A 4AZCA 2X2YA 3IJ7A 2EXOA 2ZX9A 3B9EA 2JF6A 1MW0A 4JCLA 2X1IA 1VFMA 3GXDA 1XCXA 4E8DA 3AMLA 4Y7EA 4CCCA 5E0FA 1JXKA 3ZIZA 3VKKA 5HPOA 2J79A 1JZ5A 4EANA 1HKMA 3ZJKA 2G3NA 4MNKA 3VDBA 3TTOA 3T0DA 1M7XA 3PZGA 1E6ZA 1E15A 4CU6A 3O6AA 3SCWA 3W38A 1OD0A 3AS0A 3K8LA 1TFVA 1ISWA 5IFTA 4UOZA 1FHLA 3WF0A 3BC9A 4PMYA 1LJYA 2YDRA 4HP5A 3CMJA 1UD3A 2WM0A 5I3DA 3CBWA 2CKRA 4IISA 4PSRA 3WBAA 1MW1A 4ZE5A 4C7DA 1LQ0A 2WCGA 2ESCA 2JEQA 2DIEA 4UFMA 3W29A 2IUZA 8CGTA 1YQ2A 1UR1A 2WCSA 4CKQA 1HJWA 5BCAA 1G0CA 3F5JA 1J12A 2XSBA 2QMJA 4BQ3A 5HOSA 4WLCA 2F2HA 2W91A 4J3XA 4DUVA 2ZXDA 2WBGA 2WC7A 5JBDA 4J3TA 3A6OA 1EGZA 1ZBVA 1MQPA 3WD0A 2WNWA 4FLQA 3UR7A 4P7QA 1KGWA 2VX4A 2Y4SA 1XHGA 4V2XA 3WEZA 4HOZA 3CUFA 1KB3A 1UD4A 3PZVA 1FFRA 1QI2A 3U5YA 5CPQA 3AOFA 1E70M 3L4UA 4FF5A 2GJPA 4WIWA 1NH6A 1JNEA 2VL4A 4PEEA 3L4XA 3TOPA 1WO2A 1EHAA 3VIKA 2YOCA 3CPUA 4D6GA 3UG4A 4M24A 2VOTA 1WDSA 3W28A 1VJSA 4UFLA 1CGXA 1PAMA 2ZWYA 1DWIM 1ZJBA 1ZJAA 3GTNA 1V0NA 5ABFA 1PZ2A 3ZR6A 1HJQA 1GOOA 3JUGA 5I79A 1E6RA 4MAZA 4HPGA 2VURA 1WCGA 1EHNA 2WSPA 4BF7A 4AD0A 3POCA 2WVVB 3DECA 5CQ1A 4F8XA 3CH9A 3AIEA 1DWJM 2DSZA 1TCMA 2J4GA 3BAIA 5D8ZA 4ACZA 3CUIA 1JDDA 3VM7A 1V6WA 1XRVA 3N18A 1VENA 1XSJA 1CXFA 5A6BD 4TOQA 1E40A 2BY0A 1JGIA 4QAWA 4HU8A 5BXSA 3WUGA 4MTVA 4E4PA 2J8GA 3T08A 2BY1A 5A2AA 4AEEA 3MV11 3BH4A 2V3EA 1UWRA 4WF7A 1VAHA 3ARZA 1LLOA 4MNJA 1FOBA 4GXPA 2CESA 2J7HA 1C8QA 1IZKA 4ATDA 1W9DM 4BA0A 1KXVA 3UG5A 2O9RA 2D0HA 1LL7A 3VINA 2XIIA 3NDZA 4W85A 1NQ6A 1Q6GA 3G6LA 1HP5A 1MFVA 3NDYA 5EFFA 1BSIA 1OT2A 1HXJA 2VVSA 1E55A 1ODUA 3FHQA 2VX7A 4D71A 1OD8A 2YL9A 1SMAA 3W82A 1UKPA 3CZGA 2F8QA 3K8KA 4PTXA 2C0HA 4HA3A 1W9VA 3ZQ9A 2BS9A 2E8YA 4CU7A 2CHOA 5CG0A 4KH2A 1V3KA 1NOWA 3LPOA 3RJYA 4OUEA 1B30A 3N17A 3VIGA 5LA0A 4J28A 5HPCA 4ATLA 1WZKA 5ECUA 3T0AA 1XCWA 2PBGA 4JHZA 3WD4A 4E8CA 4TTGA 4PMZA 1UWSA 3VX1A 1LG1A 2DT1A 5A6JA 1E6NA 1R86A 3GH5A 3AZTA 2WHJA 1B0IA 5EBAA 3WNMA 1XD1A 2O92A 4U2YA 1QI4A 2CITA 4E2OA 3AICA 1C92A 3KEHA 4UQCA 5CLTA 2JFEX 4PMUA 5A3HA 3DC0A 3KWXA 3CUGA 4WKHA 1C7SA 3PZMA 4MAVA 2A3HA 4BQ4A 3L4ZA 1BFNA 2ZX7A 4JFWA 2OLHA 3ZM8A 2QLYA 1ITXA 2QV4A 4JFTA 4DWSB 4KRTA 1UWIA 6CGTA 3LPPA 1E9LA 4BQ5A 5JH8A 2YJQA 1HJXA 4GI8A 4PMXA 1MVYA 3I3BA 1UH4A 1XYFA 2WMJA 5CZKA 4CU8A 4JKLA 1HVXA 3VMNA 2BVDA 5CJ5A 2OYKA 2NT0A 1GNXA 1CZ1A 1C3FA 4FMVA 3WNOA 3WEOA 4PSPA 4UQEA 1U2YA 4M80A 4MNLA 4UCFA 5I77A 1BHGA 2CBIA 3MV01 1UKSA 3BMVA 5BRQA 1QNRA 4HZ8A 3CZJA 1PIFA 1BTCA 4UQBA 1WDPA 3RCNA 1O6IA 3DHPA 5D9PA 2J25A 2V3FA 2Y8VA 2A3AA 1EQPA 1KR1A 2VC9A 2DT2A 4D6FA 1QW8A 4V27A 1FHDA 1Y7VA 3WH5A 2XJ7A 4UFJA 1V03A 1J0IA 4CD5A 2GJRA 1PX8A 4MPKA 1BAGA 3KE0A 1KGUA 3VDHA 5AYIA 3ZJ7A 2C8NA 3W24A 2XG9A 3FAWA 1ZBKA 1ZBWA 2PWHA 1HL8A 2ZUTA 1B2YA 3AZRA 4HMEA 2WMFA 4GPNA 2FGZA 3VVGA 1UH2A 1QNSA 5CSUA 4LYPA 2WAGA 2IXUA 3AIQA 4J3UA 3L4YA 1KCLA 2BY2A 1JYNA 3OLIA 4IUGA 1ZB5A 3NUKA 2Z1KA 2VQTA 1BG9A 2YA2A 3WUEA 1ITCA 1HIZA 3WDHA 4B3LA 2QF8A 3GH4A 2VUYA 3W81A 1MQRA 2Q8XA 1TR1A 1M04A 5FL0A 2X05A 4QCFA 4D6EA 2UWFA 4AZ6A 1QI3A 1VJZA 2WKLA 2WK2A 1NOFA 3ZOAA 3AHXA 2WMIB 1SMDA 1CXKA 4H8VA 3CHFA 1EIBA 1W1VA 4H7VA 2VX6A 3AXXA 4FLOA 4CUCA 2ZXAA 4U31A 4MB5A 4CVUA 3AS3A 2VNCA 5A1AA 1PEZA 1TA3A 2J7BA 5BROA 1JF6A 1UOKA 2PWDA 4CN1A 1VFFA 4LYRA 3VGGA 1C8YA 4AZHA 3IAPA 3N11A 1V02E 2GVYA 1J11A 2TAAA 3AIVA 1R87A 1IZJA 1GQKA 3VIFA 1PJ9A 2PF0A 1A3HA 4X0NA 4MDOA 2YLLA 4CD7A 4PCTA 1AVAA 2D22A 1DHKA 1GUVA 3QOMA 1E73M 1ODZA 3LPGA 2BV9A 5EFDA 1K9EA 1V6VA 1QI0A 1AQMA 1G01A 1RD6A 4B9YA 4WSJA 1E3XA 3SCTA 4CN4A 5GQBA 3POHA 3WH9A 1US2A 1UD6A 1Q4NX 3FN9A 2J7CA 3GNOA 1E0XA 2D2OA 3BLPX 1MW3A 1XSIA 2J7EA 4OJYA 4D1JA 4GQQA 1GVYA 2XGBA 1JZ7A 3VIMA 1V3HA 4GQRA 2VR4A 4DM2A 3AHVA 4Z2IA 3W27A 2YBUA 2IXVA 1EQCA 1V6YA 3EMCA 1F4AA 1UHVA 1LF1A 3WQVA 4HZ6A 2W66A 5GNZA 1UD8A 4GIAA 3AHYA 2ZIDA 3WNNA 1VIWA 3WDJA 4W5UA 3DYPA 3GDBA 1DEDA 2F61A 5I78A 3ALGA 2DSUA 2E3ZA 1CLVA 1H5VA 2VR5A 4LQ1A 2PI6A 4ATWA 4NZCA 4IPLA 4N0RA 3F5LA 2EQDA 4PN2A 1LL4A 1R7AA 4QDMA 1QNPA 1QPKA 3VGHA 1KWKA 6A3HA 1B3VA 3PHAA 4RE3A 2XFFA 2UY5A 4LPCA 4MDPA 1XH2A 3FY1A 4Z2LA 4KGLA 4ZENA 5IHRA 3AYSA 1V3MA 2GFTA 3OA5A 2J8FA 3VIIA 2BNJA 1JG9A 4UQAA 3WL0A 1J0KA 4D1IA
chains in the Genus database with same CATH superfamily
3BLLA 4O1FA 2EG6A 4O1EA 3DG3A 2WSQA 4LGXA 2G3JA 2FZNA 5BWFA 3UPBA 2XIBA 4KCVA 4LUSA 3BANA 3UNDA 2AL2B 1KM2A 4M81A 1PIIA 3WUFA 1SW3A 3MHFA 3JW7A 3FAXA 2E40A 3C4UA 3LZ5A 3F2DA 1TWDA 1LWHA 3QN3A 4GBUA 1QASA 3W7IA 4IQEA 4QNWA 1BSLA 5D09A 3DIPA 1F9CA 3M6YA 3NI6A 3IJDA 2RDUA 2GSJA 4NX5A 1W9PA 4NRRA 3KCOA 2SFPA 1DIDA 4UTKA 3I65A 1KQYA 3LD5A 1Z8AA 4BFAA 1DXEA 1D3CA 5CSSA 4DWDA 4O10A 1X8CA 1RPKA 1E72M 1O7AA 1JJKA 5DMLA 1FKRA 1ZHAA 4YYCA 1M65A 1UD5A 3T07A 3L4VA 4P7OA 1IEQA 3XINA 5IHSA 4ODOA 1CGUA 3S6TA 1FP9A 3SURA 5K7JA 3ARPA 3SCRA 3AAMA 3PWGA 3UGVA 3PA7A 3NSNA 3RDKA 3VMPA 2MNTA 3TFXA 1E0VA 3LV5A 4WK9A 3OZPA 3HG5A 8XIMA 2YBVA 3W88A 3TP4A 2BLEA 4NU7A 4HPJA 4IPNB 1JCLA 4GJJA 2JKPA 1EDTA 3ODKA 5G2IA 4K1GA 4O0KA 1DBTA 1H41A 4XWUA 3PJXA 4QEEA 4MUZA 3NXLA 1E4NA 3UF8A 4U33A 1IT0A 1ADOA 1TG7A 4PUWA 3CZKA 3E2VA 3ARRA 1JDEA 3O0KA 3PPGA 2XP5A 4DUWA 1E0UA 3UCDA 3ICJA 2HCVA 4LVAA 4PB5A 3VIHA 1VIZA 4LVBA 3WDQA 4QGCA 3SY5A 4W8AA 3IIVA 4KT2A 3QQ0A 4JL2A 3T78A 4IPPA 3HGOA 1AL7A 3RM4A 7CGTA 3EDKA 1PTDA 2OOFA 1EA0A 2UY4A 2CNCA 1R85A 4PGLA 4RW3A 4TX9A 1SJBA 4Q4MA 3PZ9A 4XTDA 4GZ7A 1MQQA 4GY7A 1R3WA 3W1UA 2PV1A 3BW3A 3SGUA 4ADUA 2F9RA 1OT1A 2FFCA 1ZCCA 2VDIA 3GVWA 1ZU8A 5H8MA 1MFUA 2X0YA 3AXMA 3BLOA 4HTYA 5CG7A 2OYMA 3A13A 1PCKA 1UZHA 4DZIA 1LWJA 3CV6A 3BSHA 4ILSA 2VFEA 2VZOA 3UWUA 1Q6DA 4B16A 8A3HA 3KXQA 3HMJG 4K68A 3GDTA 5IM51 1JZ4A 3ARYA 4JY9A 3GVGA 3VE9A 3CIWA 3WQWA 1DWHM 5HKGA 1CTNA 1ROTA 3OA3A 3DH7A 1GEQA 3LCHA 2J9ZA 2OXNA 5I3KA 1FXQA 2ODOA 1F6YA 4B3ZA 1L6SA 4FF7A 4UFIA 3S1XA 2FHCA 2R1MA 1AZ2A 5AB3A 4FALA 2H3BA 2XIOA 4ODNA 4BQ2A 2PLJA 3O07A 4OBSA 3P0WA 4D6HA 2QAPA 2ASHA 2NXHA 5LZLA 2PDQA 3SUWA 1KKOA 3BAKA 3VO0A 3UETA 3UI4A 3V0TA 2GDQA 1XL9A 2EG7A 3QBUA 1KRBC 4ICMA 3VOCA 1XGZA 2ZRWA 4NT0A 1W54A 1KTNA 1CXHA 1F73A 1KGXA 3URAA 4NJIA 1F05A 1XBVA 4JNYA 3VMOA 1V77A 1Q6QA 1O5XA 3W26A 1RLDA 1YHTA 4G7EB 4WJEA 4ZXLA 4QJ4B 3HPAA 4TVDA 2PWGA 1E44A 5KMYA 3TJLA 3GXPA 3CHCA 1GGOA 2PDKA 3EPMA 3H21A 4OQVA 3ZLFA 1PUDA 2MLZA 3RU8X 1ZCOA 1OABA 4WY0A 1GG1A 3VNKA 2QUTA 4OV4A 4LAMA 2VGFA 5D9MA 4B90A 3XIMA 3NA8A 2Y61A 2TPSA 3RGCA 3OQEA 2HXUA 4W89A 1QHOA 1WDRA 3DHUA 2V67A 2J7GA 4JTCA 1HKVA 4FK9A 4IFKB 5HWJA 3A3XA 4NY2A 2J7FA 3BV4A 5FF3A 2Q5AA 1WE5A 5JH1A 2NV1A 3MUXA 3M7WA 4YLWA 4IMEA 2X40A 1LBLA 3VAVA 5FEWA 3WDIA 3HU7A 3NZQA 2ZQVA 2M08A 3QHMA 2PDPA 1N82A 1LG2A 1K9DA 4L9YA 2QGYA 4FX7A 2NSXA 5HUPA 2JK2A 3L67A 2ZADA 1E9YB 3WQ6A 4LYQA 2QQ6A 2VEFA 3B9AA 4Y9PA 1Q45A 1W1IE 1Q66A 2GGEA 2Y78A 1GCYA 1OZQA 4C7GA 2C0AA 3KP0A 3HG3A 3BSMA 2VRQA 3JYJA 3LNPA 3PBUA 4K7VA 1ECEA 3A9BA 5CPSA 5A6SA 2YLAA 3GNRA 1BF2A 3O8AA 1S5VA 5D2XA 1DJQA 1W0MA 3KDNA 4XK2A 4PMOA 3WMSA 4F0SA 2ATMA 3G8EA 3EMZA 3EYPA 3OU8A 1LOQA 2JALA 1QK0A 2W0UA 3KZSA 2PPPA 3M0MA 4C6CA 4HK6A 3CV1A 4PR4A 1YDNA 1CECA 3GXFA 1FVPA 1TWIA 4GNVA 1QO5A 4JHOA 5DMNA 4C1NA 3V3WA 4DYEA 3UXKA 2QDDA 3GTFA 1MWOA 3QOKA 3GTIA 1VZWA 1W3IA 4C6MA 1XUUA 2DIJA 2DFAA 2XYLA 4NQ1A 2BSLA 3DYMA 1SZFA 3E5BA 2CBUA 4HSOA 4JN8A 3OBEA 2WB5A 3WUBA 4Z2JA 1GPWA 1AQ0A 2GJXB 1MRAA 2BVYA 1WZAA 3O5MA 1OY0A 4LUTA 4HD5A 4ADSA 2KI3A 2V3GA 4ASTA 4O8RA 2GPTA 4MFDA 2G4JA 4E2VA 2PURA 4UR7A 2A85A 5AKQA 3VAWA 4QITA 1UA7A 5CPOA 4KERA 4N6FA 5MHBA 3G2GA 3IGSA 4DH0A 3U8GA 4MHBA 4QLKA 3UWYA 3H7VA 4BZYA 1E4IA 2QR6A 4UQDA 2OZ0A 4GA8A 4MB1A 2R14A 4F0HA 1XFCA 3H24A 3S2MA 2WNZA 2M1IA 3BGAA 4J4NA 2ZYFA 5U7SA 4HK7A 4S3JA 3GLCA 3O6YX 1SFSA 1UWUA 2D24A 4IMFA 4GMEA 5T91A 3T09A 4LX4A 3KLKA 1GG0A 2IW0A 3EX1A 3TXZA 1XC4A 4R7JA 4A4AA 1UR4A 2Y7EA 3NR0A 2C15A 3B0VC 3RLGA 3RPMA 1SM9A 3NG3A 2DG4A 4C6PA 4LCSA 3NQFA 1GW9A 1WX0A 5DITA 2GVGA 4HZ7A 3SCNA 1DJHA 5G4EA 1ZY9A 1S2TA 2NQ5A 3MYPA 3CIXA 3L5MA 1K7XA 4U3CA 2INFA 2R1NA 3TROA 4ERAA 5KZMA 4TX6A 1Q8AA 4IOTA 3OLEA 1NARA 3SUSA 3FGCA 4IIHA 5LNVA 3TTSA 4XZIA 3H26A 3IV8A 1RV8A 4QQ3A 1GKPA 2G8ZA 4AQLA 5CC6A 5C55A 2I9EA 2C79A 4O17A 5HW6A 2BHUA 3EWDA 4QDWA 4Q6XA 4AC7C 1T0OA 2VVNA 3BICA 3VNIA 1QHPA 4REQA 4GXMA 4D2JA 4Q7IA 2GJNA 1B54A 1DJGA 1R8LA 1RA0A 3W1NA 3C2YA 3R0KA 1NWTA 1UC4A 2C71A 4ITZA 3DGRA 3STCA 4KEMA 4PUMA 5I2UA 5LIYX 3IUHA 3PTKA 3SJNA 3SSZA 3NIYA 4A8LA 3VD4A 4NZ1A 2V5CA 1B3ZA 3UVAA 4LCQA 4PUUA 3TCSA 2YYUA 7PTDA 4H7CA 2KR7A 2FMOA 3LRMA 2C13A 4PTVA 4UTWA 1IT8A 1V6UA 1VS1A 1XP3A 2QUMA 4R9XA 2PDIA 2X7VA 2XFYA 4AIEA 1QBAA 4RZ6A 3MA8A 3QHNA 4W8LA 3L4WA 3B7XA 3VILA 2ZR5A 3K4WA 2ATSA 4S39A 1MYRA 4YJ5A 4JNZA 1XH0A 4YHGA 4AF0A 4YVVA 3TN4A 1XWYA 1PO9A 4OZOA 3KUMA 3NQGA 5A8MA 3RUBL 4FIQA 1JF5A 3MI3A 2R82A 2YR1A 3AXHA 4AZCB 4GUIA 4LEQA 1DJZA 1CEOA 4RR4A 3VXGA 1V0MA 3NZPA 2VN1A 1TE6A 1TJ0A 3A23A 3KAHA 1WNOA 1NEYA 2D1ZA 4GABA 5IRPA 2Y2WA 3LTSA 3GZAA 1FH9A 2FPYA 4H8NA 3T44A 1L9WA 4UUIA 5M3WA 3P3BA 5AYBA 4Q8VA 4GI4A 1F6KA 3TXVA 1XBZA 1AD1A 2J27A 4OVXA 2W62A 2R1LA 4PBEA 2HE5A 1E4LA 3EXSA 2YA0A 3Q37A 1P6BA 4NI8A 4BF5A 2C91A 1OFQA 4IIBA 3AALA 3QZEA 7XIMA 4Z2GA 3N4FA 5D9NA 4E8GA 4N4QA 4C6IA 1QXLA 1WKYA 5I23A 1JFXA 3NPXA 3DYOA 4C1LA 2BTMA 4JNMA 3WQFA 5TD4A 3RNDA 3ITLA 2IPGA 3W7QA 1T7LA 1AQHA 3G1VA 2O9OA 1X38A 3DFTA 1VBRA 2E6AA 2A7PA 1XFBA 4FIRA 3PPCA 4H9UA 4YTQA 3ARWA 1O66A 1CNVA 1IIHA 4BF8A 4IJCA 1W5PA 5C7VA 4EOUA 4R27A 3Q58A 4J40A 3N2MA 4GH3A 2C19A 4XVDA 1P6CA 1NF7A 3IJLA 3ZS4A 2XU2A 2DG9A 3GM8A 4O8AA 4M56A 5I3JA 2ZZ5A 4O14A 4GD0A 2BX7A 1XSKA 1LL6A 4QSFA 1OGGA 3KL5A 3AISA 4ORMA 1QZ2A 3H2NA 3WBXA 5FJJA 4LRSA 3FA4A 3FYOA 4K8HA 4DRKA 1A5MC 4GGHA 4J3ZA 2ZA3A 3UWVA 5G4WA 3QKZA 3WJXA 1JYWA 1P1XA 2VZSA 4MPQA 3NJ3A 4N4PA 3HPXA 3LCGA 4Q4OA 5A6BA 4JTAA 2XHYA 2WWCA 3BG5A 1RH9A 1DIEA 2ALDA 4IP7A 1JRBA 4JTGA 3QTGA 1WPCA 3P7YA 3AS2A 4U2ZA 1JZ8A 1Q6FA 2CERA 3QGAC 1E43A 4C6EA 1IXQA 5JVLA 4F79A 4EX4A 1J18A 1PHQA 4M3PA 3SN0A 1J4EA 3E2QA 3BGGA 1XIDA 5CCZA 1XDLA 1G7UA 3S83A 1HNYA 2OGJA 3ARVA 1C93A 2WZTA 1CGTA 4ZB0A 3FNDA 1KXHA 4EXQA 4JTDA 3O5DA 1WXJA 1KRCC 4IUOA 5CPMA 1QNOA 5BYWA 1VFUA 3VZZA 1ZP4A 4L61A 3I7QA 4D72A 2VI0A 3S2NA 2VOMA 4OUIA 4AU0A 4L6OA 2FIQA 4S1FA 3D3FA 4DZ2A 3CWHA 3OG3A 4K36A 4J3SA 1J0JA 5AZ0A 2FHFA 3M5VA 3P14A 1OZMA 3ITGA 3ZVIA 1E6PA 1TPUA 1WOAA 1W37A 3ITYA 3BWWA 1PDZA 2WOQA 3L0NA 3SW6A 4IX0A 5E70A 3OG2A 1L1PA 3E96A 1KLYA 4HN8A 4O4VA 4W7VA 5I02A 5D75A 3AU2A 3NQMA 4JTFA 3F4DA 3MP5A 4UTIA 5C6MA 4E3TA 4I7UA 4ZGYA 1UWTA 4LANA 1G4TA 2ZR6A 2OEJA 1K6AA 3MZ2A 3W23A 4RNHA 1EXBA 3AYVA 3KLLA 1PV8A 4LUYA 1SJDA 4AZBA 3CV2A 5GPGA 3TW9A 1HT6A 4QRNA 3RLHA 2D2HA 4KCTA 2Y7DA 4QT3A 2Z7KA 5D32A 2D20A 4WSHA 3THQA 4DT4A 4U5KA 1X1NA 3KBNA 4S3FA 4DBDA 2EHHA 3W1QA 3T0CA 2WC4A 1VYPX 4GNJA 4XAYA 1FDJA 2WJEA 3KOXA 5AHMA 3QV7A 5A6LA 3UERA 4RXFA 2FVLA 3W6YA 3BLFA 3WLMA 4L6DA 4CQ8A 3B4YA 2DEPA 5K9XA 3WH8A 4W5ZA 1B1YA 1SSDA 5K9CA 2Z1VA 3NZGA 2QCNA 1FA2A 4Y9NA 2NUWA 4DBEA 3S5NA 2ABAA 1S3TC 5EL1A 3KAGA 4B3KA 3BG3A 4ZSUA 3OIXA 1GJUA 3TN6A 2G50A 1OB0A 4MOZA 3NTYA 5CBBA 3THUA 5JIPA 5FD0A 1JCYA 3RRXA 4QDPA 3B03A 2BB0A 3GXIA 3QZ6A 1XLEA 3LS9A 1RQEA 2BOFX 1DJXA 2HV5A 3QLLA 2YCIX 4K8EA 7TIMA 3FLUA 3SY1A 1JAKA 4XZ9A 1M53A 3W7PA 4PODA 2O9PA 1H0GA 1DQXA 2E77A 1GQNA 4L4OA 4G56A 2DVTA 2PPNA 1HQTA 3LYEA 1J4RA 4GXWA 2O4QA 4TVCA 1V08A 1TJPA 2PP0A 3LHYA 2WVSA 1I1XA 2IS7A 3N3TA 1EA9C 1QVBA 3FYPA 2DDXA 1IWAA 1FWDC 3ZVHA 1XYBA 4GVIA 1H09A 5ABHA 2W9MA 2WZIA 3QVQA 2XUCA 1Y5XA 3AMCA 1MXDA 4H6KA 3SIZA 3GU9A 3VGEA 3MJYA 1QOPA 3OEXA 1W5QA 3UG3A 5C8BB 1E1EA 1NM9A 3HTWA 2G4FA 4WDUA 4IPJA 2GVEA 1XBYA 4IFOA 5LNUA 1DQUA 3W70A 1ZL1A 5DCEA 3H54A 5HATA 1XISA 2XPKA 1OFAA 4PYSA 3VGBA 1TZ7A 2VC5A 4H1ZA 4J5NA 4BCEA 5DF0A 1LUCB 3GIQA 3N3MA 2LGOA 2PTYA 1JCNA 2VFHA 4Y96A 3DUGA 1JDFA 5AC7A 4MY9A 1JVWA 4BS0A 3CZ8A 5DO2A 3WQ5A 2FB2A 4JCLA 2X1IA 1XCXA 4JFJA 3AMLA 3VFLA 4LC8A 3ZIZA 2BOEX 4JFKA 1FHVA 4JTLA 3PNZA 1NJJA 3MKCA 1E15A 3W1RA 4IQLA 3CASA 1KFEA 3RLUA 4TO8A 5IFTA 1FHLA 3ERPA 3BC9A 3KAOA 4JIIX 2Y62A 3DXIA 1KNWA 3V36A 1LORA 1KD0A 4IISA 1XF0A 2UZ9A 3WBAA 3B8IA 4C7DA 3QPZA 5FJOA 2NVCA 2XINA 4NZ4A 3NPVA 3QMRA 1R9YA 2Q02A 1UASA 1SZNA 3W7JA 1EC9A 4CKQA 2ZA2A 1HJWA 2OLSA 1G0CA 1J12A 2XSBA 5HOSA 1EJWC 1JNTA 1IXNA 1POKA 2CLPA 2ZXDA 3T8QA 3VUSA 2MLYA 1OCNA 2RJHA 3SN4A 1ZBVA 5HAOA 1M7PA 1KGWA 3FVDA 1R3RA 5B8IC 2FTWA 4ZMGA 1RLCL 1PKYA 1QI2A 4LUSB 3CMFA 3L4UA 1FKIA 1NH6A 2ACSA 3B8UA 4Z08A 1L6FA 3QSRA 3W73A 3GDLA 1EHAA 3O5QA 3CPUA 4M24A 4UMBA 3S1VA 1AODA 4H9TA 1VJSA 1NMVA 5HJLA 3IUDA 4XAGA 1ZJAA 3GTNA 1V0NA 2TRSA 1FKKA 1VPQA 4MAZA 1IWBA 4HPGA 4JD4A 2VURA 4LNYA 3OHMB 1D6OA 1D3HA 3S1UA 4HJWA 3ANVA 3W76A 3SADA 3DECA 4JR5A 5L9FA 3HQPA 3GAKA 4MWAC 1T8XA 3BAIA 5D8ZA 3TNBA 1TTJA 4HARA 4MGGA 3Q94A 5C9ZA 1XSJA 4DNMA 5A6BD 4GJ1A 4TOQA 1S2UA 3H6OA 1FWRA 1JGIA 1YNPA 5BXSA 3WUGA 4E4PA 5AOUA 3T08A 3A3WA 5I06A 4ZTXA 2BY1A 4GCAA 4ZOCA 4LBRA 1VAHA 1DKWA 3TC3A 4FA3A 3ARZA 4IPXA 3MUCA 2PDCA 2QGHA 2J7HA 4V15A 1H50A 1IZKA 2HS8A 4LTSA 4BA0A 3UG5A 2ZZ1A 5FESA 3S2JA 3NWRA 3OQ8A 2YX0A 3W3OA 3G6LA 2J9YA 1IR2A 3NDYA 4K39A 5HULA 3PR9A 1OT2A 2R94A 3DFHA 3CU2A 1HXJA 1E55A 1FKHA 2BG5A 5TBOA 1MNSA 3FCPA 3QY6A 2YL9A 3W82A 3CZGA 1R3TA 2F8QA 1F5ZA 1W9VA 5H1WA 1TMHA 5CG0A 4KH2A 3UYCA 2QKFA 1V3KA 5K4ZA 3E3HA 1SGJA 3P62A 4HCDA 1ITUA 1B30A 3VIGA 2INZA 4MKSA 3UU0A 5HWNA 3UR5A 4ATLA 1WZKA 2HBXA 5ECUA 1KM3A 3ANUA 1UOZA 4W9QA 4PMZA 1GVEA 2VKZG 3VX1A 4L4MA 2FJUB 1YYAA 3ABSA 5EBAA 4C6NA 3WNMA 1ENUA 4LU0A 4U2YA 1QI4A 3ZFHA 1J6PA 2VFFA 1J8VA 3N2CA 3LSCA 3O0FA 5DQPA 3KEHA 4UQCA 4PMUA 4ZSTA 4LY4A 2GLKA 3CUGA 5JU6A 1C7SA 2Z1XA 3IHZA 2HBVA 1BFNA 3ONBA 5IDZA 2GUBA 2OLHA 4M5PA 1IX5A 1ITXA 2QV4A 1Q7ZA 3S9ZA 5JH8A 4UNLA 1XRTA 1MVYA 3T7VA 2X1RA 4CU8A 2E5DA 2NUYA 2OYKA 1CZ1A 4RZ5A 4ZB5A 1C3FA 3WNOA 4DYJA 4UQEA 1U2YA 5HW7A 4I8DA 3PY2A 5I77A 1BHGA 1US0A 2FB3A 4JIHA 3CZJA 3OVQA 1PIFA 3JR2A 1QFEA 1WDPA 3RCNA 3B0YA 2J25A 4JTIA 3TW7A 2VM8A 5AC8A 3U48A 1QW8A 5C9UA 4XSLA 4YXGA 4PUNA 2DZBA 3C0SA 2A3LA 4M1BA 4QISA 4MM1A 4UFJA 3TZNA 3BJFA 1TPWA 1PX8A 3LA4A 3MDYB 1XLMA 4X61A 1BVWA 3ZJ7A 4HPXA 3QFWA 3W24A 4E5TA 1ZBWA 2PWHA 1EQ3A 1HL8A 2ZUTA 3W2JA 1TQJA 2IQ0A 3SM0A 3VNLA 1DXFA 5H6HA 4ODPA 4GPNA 4TW6A 1QNSA 4BR1A 1OYBA 3USZA 1UP2A 4CNUA 3AIQA 1FDYA 3M5ZA 4EXBA 1KCLA 4KF1A 3QGKC 2Z0IA 3OLIA 1ZB5A 5C9WA 3HPZA 4A8IA 4DRHA 2R1KA 1BG9A 3V5OA 2Z7GA 1H62A 3UJ2A 3WUEA 2ZQUA 1HIZA 5BU6A 4B3LA 1FTXA 5G1MA 1N55A 4H6EA 3KDOA 3BOFA 2UWFA 3QMTA 1V93A 3GHRA 1NSGA 3O5EA 1FCQA 4G8TA 1NOFA 3PPHA 3PBYA 3LXBA 5HUAA 1QWKA 4NX0A 3CHFA 1XQKA 1NFBA 2VX6A 1EWEA 3B3DA 4H7ZA 2OX1A 1WDDA 2NV9A 4YL2A 4B5TA 3B0UX 3C2FA 4KKXA 2P4VA 4DRIA 1EJ7L 1K03A 1JF6A 3N25A 1J11A 2TAAA 3AIVA 5CC5A 3R25A 2PDLA 3V0SA 3M0ZA 1PJ9A 4TX0A 4WDXA 1N8IA 3TSMA 1RR2A 2Z1BA 1XQLA 3O6CA 3ITXA 4X0NA 4JICA 4MDOA 4PCTA 1AVAA 3IGUA 2F23A 3ITVA 3EWUA 4DHGA 2BV9A 1K9EA 1V6VA 2OZ8A 5HQEA 1QI0A 1AQMA 4B9YA 1K4HA 1I0BA 2Q8LA 3MMTA 1AH4A 4WSJA 3SCTA 3GG1A 1JCXA 4IT1A 3WH9A 1UD6A 1OADA 3QC3A 2J7CA 1UZDA 3GNOA 1TPH1 3BLPX 1PHWA 4FOKA 1BXCA 4N6EA 4ODMA 2J7EA 3VKJA 4UWMA 3GK0A 5HW8A 1A5AA 5J5RA 2V5JA 3A9IA 4LH8A 1ICSA 1MNZA 3QR1A 4C1NB 4Z2IA 3UZZA 3W27A 3KHJA 2IXVA 1S5MA 1V6YA 1F4AA 3CNYA 1LF1A 4ZZ9A 2RQSA 3ES7A 5C2GA 1UD8A 4O11A 3AHYA 1N1AA 1VR6A 2ZZ2A 3WDJA 2E1DA 1DEDA 2PN0A 4Y6GA 3CQHA 1VBGA 2VGGA 3O5RA 2DSUA 1LQ2A 2ACUA 4LQ1A 4ATWA 4L65A 4IPLA 4J9JA 1AK5A 4GISA 2F4EA 1A5CA 1R7AA 1XIGA 4DPQA 4LUTB 4ML9A 1G4EA 4RE3A 1R2TA 4XUGA 4LPCA 4MDPA 3FY1A 3EKGA 4KFOA 4KGLA 5IHRA 1Q7MA 3A12A 3AYSA 2Y5SA 5BOFA 3B4UA 2GFTA 3OA5A 3O5JA 3MDWA 3WL0A 4GC3A 4A8RA 4LBUA 2ZRVA 3EDJA 2WXDM 3P2VA 2B7NA 4GINA 1YXCA 2ZZ4A 4AW7A 2Y6ZA 1NIUA 2XVGA 4DRSA 3C3NA 5FF4A 1O5KA 3UI6A 5LYRA 3UY7A 3O5IA 4Q7BA 3WNPA 5KEZA 3AIBA 1W1A1 2YDSA 4EXAA 3E5PA 4TYOA 5FL1A 1L0PA 3PSWA 2GQ3A 1F8IA 1QPRA 5HNNA 4JTTA 3RGTA 4AIOA 2FH8A 1E3ZA 3G6MA 3VM5A 1XIBA 1IHIA 1ONEA 1W3HA 2AWGA 2JF7A 1FP8A 4Y90A 5FI8A 4TXEA 4S3AA 4YYFA 1NWSA 3D47A 2RUSA 4FO4A 1K8CA 5LGXA 3RITA 2VZVA 4O4WA 3GXNA 4WRHA 2IKIA 2C3ZA 2DH2A 2RDTA 5XIAA 3BMBA 2FTPA 3P5ZA 3TUUA 4H83A 4LS0A 1U79A 2JIWA 4LB4A 3PUDA 4EWJA 3N9SA 3UBPC 3FGCB 2CWXA 4QG9A 1PSCA 2QCLA 1JYXA 1D8CA 1J4IA 3GNNA 2RURA 3MWAA 3L12A 4PMNA 1R5YA 2DSWA 4XZLX 2XH2A 4E4UA 1TPDA 1XINA 5JIWA 2HVNA 4REQB 2OOGA 3ALFA 3N4AA 2WNNA 4DX3A 1EKOA 4ZXOA 5C9XA 5I00A 4M82A 2DU2A 4QCEA 4KRUA 4K38A 4PRWA 4XZHA 1AA1B 4JGDA 2DT0A 3TONA 1ONXA 4IICA 2J47A 4KCWA 4XD4A 4PCFA 1DPMA 3ABZA 3IRSA 1R3YA 3DFOA 3QQWA 1QPOA 4ZQMA 3O05A 2MNRA 1TZ9A 4P8WA 5D02A 1ZTVA 2BZNA 3SCSA 4DRMA 2VEIA 3LU2A 1DOSA 1TCOC 3PTDA 5KZ6A 4G1KA 4MWAD 1GZJA 3ES8A 2OFNA 2YBTA 3CGMA 2XN1A 3KX6A 2ZTJA 1OFRA 5EMYA 5CAKA 1EDQA 5GNYA 3UA3A 5D30A 1MI3A 2XFRA 5ECVA 2R1PA 5I3IA 1Q5MA 3KTCA 1I9CB 5JMUA 2FPTA 2MPHA 1I6NA 2XM2A 1FWBC 2VUNA 3S9YA 1S5NA 4RV8A 1QPFA 3OBAA 3IRDA 3NCOA 1JUEA 3EGJA 4CEXC 4I7VA 2D2GA 1JPKA 5CJMA 2ZOXA 3WQCA 3I3DA 2HEJA 3P5YA 3EKZA 3L0KA 4F2TA 1H3GA 1OF8A 4BEUA 4DI8A 1K9FA 1WBJA 1YPXA 1H1NA 4C6JA 3MWCA 3OGSA 2E0PA 2W5FA 2PTZA 2PD9A 1JFHA 4QM1A 1XC6A 3GC4A 1EBGA 3HJEA 1OBAA 4CNNA 5FACA 1PZ1A 1XIEA 5K2ZA 3AIUA 1NDZA 2BODX 4MG4A 2PBOA 1IZCA 1I75A 4UFHA 4DO6A 1KM5A 4IH3A 4HSHA 1XUZA 3ZJ8A 5AECA 3AMDA 5A8OA 1VCGA 1YPIA 3FOKA 4XBKA 2I5GA 1F8MA 1JD9A 3VIPA 3NM1A 3E0VA 5FJIA 2WPBA 4HYWA 3H2CA 4NF7A 4ZFCA 3T8LA 3M41A 4FXRA 1EJUC 2CPUA 2DT3A 4J1OA 5CJNA 3TSDA 2P76A 1WQ5A 1GRJA 3UFYA 4Y9MA 4WKAA 3WELA 5FCZA 4UQ9A 5FOOA 1TMLA 1UYQA 2QUNA 3UQBA 2OU4A 3F4CA 4JEJA 2GOKA 1K9TA 3AROA 4UMAA 1YDOA 3SRHA 3GRIA 3BPWA 1TR9A 2X8RA 3E0LA 1GQIA 4YTSA 2OJPA 4XKMA 1EJRC 2G37A 1S2CA 3IK8A 3ZT6A 1LDCA 1H2JA 1M3UA 2BY3A 2E9MA 2NX3A 4HU0A 4GYFA 1U5VA 1DJYA 2X0HA 2WBKA 5D9OA 4JIEA 2NW0A 2G3FA 1JCHB 4QIBA 5DMMA 2HK0A 1P5QA 3VNDA 2NQZA 4AB4A 1TWSA 4B5WA 4LUIA 5DELA 5BRPA 1BYBA 1Q2RA 2C16A 4EP8C 4CNOA 1E51A 3PB2A 5LHEA 1TTIA 3V75A 3SCUA 4JYFA 4C6QA 4D8LA 3WLRA 3OZYA 1TPVA 2ADAA 1OFDA 2IPWA 3RAOA 3M0YA 3UXAA 4Q8NA 4UOQA 5D38A 3ARUA 4MUPA 1W3KA 3HQ1A 4MFEA 3TYAA 1NELA 2WANA 1RJPA 3ZLHA 3LPFA 4ZQOA 5HINA 3IEBA 4M29A 1T41A 4GZIA 5GNXA 2OQHA 2WWDA 3CO4A 4B9ZA 2OODA 3LENA 4IX2A 3W02A 1K77A 2HMCA 3VCCA 2I1OA 4TX8A 3H7UA 3F4VA 3W86A 1P0BA 2P53A 2QJIA 3N34A 3M0KA 1Q6HA 4B15A 3WL1A 1UBPC 4W8BA 5M5DA 3DENA 3R94A 3EX2A 2CW6A 3H53A 4P8VA 4AMCA 1PVNA 4PMVA 3UXIA 3VD9A 3UJEA 5CZJA 3LMYA 3PZUA 1EO5A 4XKYA 3STPA 3ZT7A 1TUFA 1BD0A 4YTUA 2AOSA 1QNQA 3GFXA 2WVUA 3PUOA 5FEXA 3BO9A 1EFZA 3IJ6A 3MT1A 3PRDA 1O12A 5G5IA 2QUUA 1XIMA 4OTKA 4GUJA 1DV7A 1H1ZA 2PDYA 2A4AA 2HPIA 2EKCA 3I10A 4OWGA 1RHCA 2ZC1A 3BARA 1XGDA 4QE1A 2Z2AA 2J9XA 2PDHA 3NOEA 2YCEA 3EWBX 3UGRA 4I9TA 1OCQA 2NVAA 3CLMA 4HCLA 4NNAA 4MNMA 1PDYA 4US5A 3E1F1 3NGFA 5EMMA 2OWWA 5CKSA 5DRIA 4PUEA 1YRRA 3U57A 4AZIA 1UPMB 4JFSA 1W32A 3MUY1 3BUVA 4CVWA 4AZGA 3BLDA 3M0XA 1SJAA 3D3AA 4RV3A 3RLVA 1W26A 5ABTA 5TF0A 4GFIA 4GOAA 2Z25A 4DZ3A 1V3JA 1E56A 3KAFA 2J7DA 4F0MA 4LFYA 2QJNA 2XP6A 3DOPA 2ZXQA 1M9HA 4IFRA 1OF6A 5HUOA 4QJ3B 5JUVA 2NXGA 2VENA 2KAUC 1YTEA 1WXZA 4IXHA 1ISXA 1YNYA 3D6NA 3O2LA 3R8HA 3WQEA 1R9ZA 5FJTA 3PJWA 3LHVA 4C7FA 2Z4GA 3UI5A 4S3KA 4A2RA 4JFUA 4IMAA 2OFJA 1IWPA 2ABBA 4FX6M 4KEVA 4A3UA 3AIRA 4X9SA 1OM0A 2YPIA 2HZGA 4P8UA 5LA2A 3PUGA 3VOIA 3CJPA 2D73A 3VIJA 2E25A 1PXGA 4H8UA 1Y5VA 1PKNA 2QDEA 2I7GA 2B5UB 3EEZA 2LLEA 2VCBA 4ZPVR 3RK8A 4O1AA 4GCXA 4LALA 4TV5A 3IAQA 4O16A 3SUVA 3ZMRA 2QCFA 3AMGA 1AFSA 3KHDA 5AYZA 1FRBA 1B31A 1B3WA 1J79A 4PCNA 3R7MA 3BCJA 4RCXA 3MBFA 2G97A 1KRMA 4DXKA 3TA6A 3THAA 2C14A 3RM8A 4AD3A 4ZPTR 3I68A 3QH2A 4W87A 4O50A 5G4HC 4AY7A 1HO1A 3ZVHB 3MC5A 2WLZA 3NURA 3LXAA 3N9KA 3UP8A 4S3CA 2RGMA 1ZJIA 4HNNA 1RPXA 4G2PA 3U3HA 1GVFA 3F2BA 1KBBA 4FOUA 4RJEA 2A7RA 1UQYA 1BQGA 1YDYA 1E6SM 5CSRA 2E1WA 1JZ2A 3FA5A 4ZR8A 4FLSA 4BI5A 1XI3A 1F74A 1BQCA 3K46A 2WVVA 2M2AA 1XGEA 1E0WA 1TZZA 4QE5A 4ZB2A 2OSYA 4FS9A 4GQ0A 3GBEA 3VIOA 4YIWA 4AWEA 3HQOA 2PDWA 1Q85A 4YHEA 4E38A 2QF7A 1P0KA 3GDRA 3TTYA 4O2TA 1HJVA 5LA1A 1H51A 3V1HA 3OP2A 4IIGA 1DJNA 2QCCA 5JQ9A 1US3A 1RY8A 4GVFA 3K4AA 1XICA 2G3IA 5DXXA 4I5UA 2DV0A 1UZ1A 1UKQA 2YA1A 3WLLA 3JRKA 3ORWA 3S1WA 1EH9A 2A3BA 3WQDA 4PL1A 4ZS6A 3AHZA 4X2RA 3FDGA 1FKFA 2F38A 1ZFJA 3ABOA 1ZUAX 1SR0A 3H9RB 2OKOA 4U4MA 1VGAA 3VOFA 1NQKA 2NWSA 2X0SA 1AJ0A 1CGVA 2FZDA 2XZ9A 3RJXA 3P74A 2CCRA 3WJZA 3KWSA 1GQLA 3RMEA 3BAYA 1UQZA 4N9CA 4INFA 1NAL1 4HGXA 1FKTA 2P3EA 1S1PA 4Q33A 4YMZA 5CGMA 5M17A 1UR3M 3CHEA 1B6CA 2AGTA 3SAZA 3G5EA 1OFEA 2YXGA 1LWIA 1GYMA 2J77A 2PD5A 3FSUA 2C1GA 1HZYA 3PAJA 4JKMA 2ISFA 3WIJA 1S2AA 4XB3A 9RUBA 5CPTA 2O4MA 4CGTA 2A3CA 5LIWX 1UUQA 3W00A 1NP2A 3VZYA 4K6AA 3WN6A 4H9ZA 1GEHA 4JYEA 1BLIA 1KFKA 2L2SA 1G9HA 1TMQA 2QULA 5HK4A 1OFPA 4PH6A 4C02B 2ZX6A 3GAYA 3MSDA 2XVKA 4IT4A 3G0SA 5BNKA 5A8NA 4DWSA 3OB8A 2BBFA 4IJBA 3ARTA 2O7QA 1G4SA 3AO0A 1YW5A 3ISIX 4YNGA 3CUZA 5C2XA 5HBFA 4LAUA 4PEKA 1LRTA 1M01A 1U1JA 2CZDA 4FP1A 4US6A 3PWIA 3OLGA 3WFLA 1F3EA 4AISA 1D2KA 2FH6A 3UESA 3B9NA 4I6VA 2ISWA 1HGYA 3S47A 1I0DA 3AZSA 1UG6A 4U3AA 3LHZA 3KTXA 1QO2A 4TU1A 4ERIA 1FDZA 3UZWA 3PS7A 7ENLA 1WV2A 3CEUA 1W6TA 1T99A 1TWWA 1O4UA 3PM6A 4YN5A 3W6MA 1BKFA 4BY3A 3LTPA 4Z17A 1CLKA 2PFHA 2XTKA 2A3EA 1PX3A 2BVWA 4D8AA 2W92A 3PVFA 3SQMA 4CN6A 4LAWA 3WK0A 2IPFA 3LEPA 4EPKA 3RYSA 1P1MA 2E5CA 2UY3A 9XIMA 4WCJA 1BL4A 3CAVA 2B7OA 3B9OA 1G1YA 2A79A 4K3ZA 2W6RA 4MB4A 5F7UA 5LNSA 3NZRA 4XZNX 3R2GA 1SVDA 2HTMA 3IACA 1TPFA 3T4CA 1RVGA 1X97A 4K37A 4A3YA 3OTRA 1YPFA 4A3HA 2RUQA 1KA9F 3QTPA 4O12A 4H2HA 1WXYA 3KCJA 2XWDA 2Z6IA 2V38A 2YL5A 5T26A 1HX0A 3R6IA 4U5IA 3W0KA 4MWAB 1DORA 4PTNA 2A6NA 2CYGA 1RK5A 2FKEA 3C6CA 5AYYA 1FCBA 1RCOB 1RP9A 4L6HA 3DHFA 3ZT5A 2VC6A 4V33A 1E5JA 2EJAA 3O5OA 4AIUA 1ISYA 4GC4A 3TMLA 4FPSA 3OIHA 3G24A 3WD1A 3WLJA 3MKVA 3WCZA 2X09A 5DT5A 3W71A 1VPYA 3W1MA 1H1YA 2P88A 2J6XA 3MTWA 1VFHA 2OSXA 3M9YA 2V5LA 2Y1HA 2ZUWA 4I6KA 4Q3MA 2CHNA 4L1GA 4LF1A 2E6YA 1H60A 4OOUA 3VNYA 1HL2A 3FFSA 1ME8A 4Q8PA 1VEPA 3QR0A 3TYEA 3NL5A 4IXXA 4G50A 1UR0A 4NZFA 4AD5A 1CPUA 4YWSA 1GTHA 3CQ0A 4W86A 2LPVA 2ZICA 3UQIA 4HNLA 4US5D 3DGBA 3GS6A 3MUZ1 5I24A 1NWUA 2XISA 4MSPA 2UZ5A 1XCFA 1QUMA 4S2BA 4AXNA 4OBTA 3U4FA 3UXDA 4P8XA 3LK6A 4X63A 4DRNA 1KTBA 3PZQA 4WJXA 1R9XA 1W3JA 1BYAA 3OODA 1V6XA 3UY8A 4DF2A 4Q8TA 2V6AA 4HVXA 4NIRA 1XLJA 2NX1A 4HNCA 4AYGA 1E6QM 4B91A 4JAWA 1GOKA 4AZ5A 4RXGA 4ADTA 4GUGA 3QHOA 3QR3A 1YKWA 4GIVA 1OG0A 3NVTA 3T81A 2I5QA 2VDHA 1LYXA 1GKRA 1ZBCA 5LGZA 1OC7A 2CKSA 1G94A 3ZYZA 3WLNA 1EX1A 4DLMA 4R5EA 1W3TA 3RCMA 1XD0A 2JIEA 5LHFA 3MKKA 1A3WA 1JL8A 2PDUA 3IKGA 3U4AA 4Q4KA 3WJYA 1RQHA 4L9XA 3VC5A 3L5LA 1C90A 3S5OA 1BWVA 1SJCA 1SQ7A 5C7HA 1BKSA 3G0UA 4AUBA 3CYVA 4R7WA 1KM1A 3R0DA 4LAOA 5D05A 4DO4A 2AL2A 5HXMA 1YXDA 4OE7A 3A4XA 1CBGA 4DB7A 3URQA 1S38A 1LP6A 3PPFA 4KIEA 4XZWA 1H49A 4ZODA 1ELSA 2LJ4A 2PZ0A 7A3HA 2KO7A 3FJLA 4MWAE 5I5RA 5LNRA 3EIPA 1D3GA 2WYSA 1E71M 3T9PA 2QPSA 1KBJA 3BTNA 3VPLA 4IPIA 3L2LA 5A8GA 3JYMA 3G1HA 1YMYA 4QTGA 1YBQA 2FHBA 2E67A 3M5YA 5F2GA 3BK0A 1EP3A 3NQVA 4NNRA 1A5OC 1TE1A 3CH0A 4UCGA 4WGXA 4CD8A 3LCLA 1C8VA 4WEVX 3W1TA 3PZTA 4O0QA 2PCEA 3P93A 4LT9A 1OWQA 4GO9A 3HO8A 1PINA 4NVTA 1KCKA 4Q4QA 3CZLA 1JQXA 1D7JA 3HGJA 1HKJA 3Q45A 2PC8A 4E0CA 2X7WA 4Z2HA 2FZBA 5AY7A 3H4XA 2X2YA 3IJ7A 2XH4A 3E2SA 4DIAA 2ZX9A 4N9DA 2G95A 2PGFA 3TIMA 4GACA 1MW0A 3GU0A 1VFMA 3GXDA 2C1HA 4E8DA 2Z6JA 4RE0A 4RDWA 4CCCA 5E0FA 1JXKA 3C3UA 3VKKA 2CLLA 4BF9A 2J79A 1HKMA 3T0DA 2G3NA 3VDBA 1M7XA 1IF2A 1BF6A 2OGYA 2EPHA 2YB4A 4G9PA 2GQAA 4CU6A 4FAPA 3MVIA 1OD0A 3AS0A 3K8LA 3H2AA 1VLIA 3LNMA 4YVXA 3WF0A 4PTDA 1JPHA 1K4GA 4HP5A 3CMJA 2PBCA 3K1GA 3S46A 2WM0A 5I3DA 3GX9A 3M64A 1VYSX 4JQ4A 3C5QA 3IVTA 4ZE5A 1LQ0A 2WCGA 2JEQA 4DBWA 1NVMA 4KW2A 1YQ2A 4U28A 3KCEA 2WCSA 5BCAA 3UF9A 2W91A 4J3XA 4DUVA 1ZSXA 3T40A 2WBGA 3EWWA 2HJPA 4HTBA 1XYAA 2OG9A 4B2DA 1FWSA 2WNWA 3PFMA 3W9ZA 3PANA 2OMAA 5AHNA 3EX3A 3NL2A 4E4FA 3TMQA 1MUMA 3O5PA 2YCKX 3CUFA 3NQ6A 4LVGA 4HOZA 4HIBA 1YE6A 1H7WA 2ZQSA 1Z6KA 3CB3A 3PZVA 1GJPA 3F1QA 1M7OA 2AAMA 3RX2A 4FF5A 4PE8A 1JNEA 2Y89A 1S2VA 2VL4A 4AFYA 3L4XA 1EUNA 3O06A 2AL1A 4MJMA 1GVRA 5F4XA 3SQSA 3U0HA 2VOTA 3S8HA 1ADSA 2PA6A 3COTA 4HHLA 5D03A 2J66A 2O56A 1K3UA 3N73A 4TNSA 1ZJBA 2PV2A 4JHMA 5ABFA 4HT3A 3ZR6A 2XFWA 5I79A 1OVDA 1KFCA 2DVUA 1WCGA 1CB7B 1IT7A 3VKBA 4GQBA 2PU1A 4KEZA 1Z3NA 3DI1A 4BF7A 4AD0A 3E49A 3POCA 4O1BA 5CQ1A 4LS1A 4F8XA 1KBLA 1MZHA 2J4GA 4PL2A 3FAPA 3O5KA 3GKFA 1QPNA 3VM7A 1K70A 2V8ZA 1FAPA 1XRVA 3KW3A 3N18A 4A05A 1VENA 4TQTA 2Q6ZA 3AXKA 4DROA 4HU8A 1MXSA 2GQ9A 3H70A 3ME3A 3GTHA 3GU2A 4QT2A 3MV11 3O1NA 1R38A 2V3EA 3LN3A 1UWRA 5DRCA 1IYXA 1F40A 3HBLA 3FSTA 1FWNA 3UT0A 2ACQA 1LLOA 4MNJA 4PC8A 1OX5A 2JQXA 5LXEA 2O9RA 1LL7A 5BWAA 5LIUX 4QAIA 1NQ6A 1XM3A 4Z0SA 5EFFA 2X42A 1QCWA 1ODUA 4NHVA 4XAPA 4DJFC 3Q65A 4D71A 3C56A 3W75A 3FK4A 4PTXA 4HA3A 2G5WA 2E8YA 3RPTA 2CHOA 4AEOA 1NOWA 3LPOA 1XKYA 2KX9A 3QQ1A 2I57A 4GX8A 3RF9A 4UNKA 3R8RA 3GW3A 2IQTA 2E5BA 1XCWA 2PBGA 2XH7A 1M5WA 3NL6A 3WD4A 4TTGA 5MKGA 1LG1A 1FWIC 4A3QA 3GH5A 2J8TA 3AZTA 1B0IA 1QNVA 1L2UA 2O92A 5F1VA 3GHSA 4C6KA 4L4LA 1OFBA 4Q4SA 4AVNA 3E74A 1QAPA 3HIJA 5CLTA 2JFEX 2ZZ7A 3LDVA 3DC0A 3G1RA 1OC6A 2Q71A 4MAVA 4BQ4A 4C91A 4JFWA 4DJFA 3INPA 2QLYA 2ZQ0A 4E2BA 3CAKA 4KRTA 6CGTA 3LPPA 3T4WA 2DQWA 3GNXA 3VKAA 2YJQA 4PMXA 2DZVA 1UH4A 1XYFA 3EOEA 5CZKA 3A5VA 2Y70A 2V5KA 2DW7A 4JKLA 3TQVA 2PDMA 3UNTA 2NT0A 2WO5A 4FMVA 1X8FA 3MCMA 5T8GA 4M80A 2DIKA 4HQVA 4MNLA 3RPDA 2NUXA 1QNRA 2XSXA 4AVFA 3N2OA 4GIYA 5DCDA 1QPLA 1BTCA 4UQBA 1O6IA 2Y88A 4IQDA 2OTDA 1R9HA 3DFYA 3DHPA 4NNBA 2Y8VA 2IKJA 3OHIA 3GZ3A 2DT2A 1NF0A 4D6FA 1J2WA 2CLFA 1G7VA 1UROA 3NAVA 1YADA 2XJ7A 3I7SA 3WH5A 4R34A 2POTA 1PBKA 2GJRA 2Z00A 3T42A 1BAGA 2Q3RA 3KE0A 1ZNNA 1KGUA 5I03A 3VDHA 2IF4A 5AYIA 1EYWA 2C8NA 1P48A 3FAWA 4I5RA 4YCOA 1FWGC 1OHLA 2PAJA 4CQBA 3AZRA 2PGEA 4Y8EA 2FGZA 1LOLA 1UH2A 3QFEA 3MP3A 3M4HA 5IBXC 4J3UA 2W3ZA 4DBSA 2E6DA 3ID7A 4B5UA 4ZA0A 3NUKA 4C5YA 2VQTA 2MF9A 1T5AA 5KZEA 4MYXA 1W17A 3B0PA 2OZTA 1E1CB 4ZOEA 3WDHA 3H23A 3OYXA 2VUYA 3ENLA 2Q8XA 4HSNA 2X05A 4D6EA 4AZ6A 2WKLA 2WK2A 2D69A 2X1SA 3G3DA 3WG6A 4H8VA 4S3DA 5XINA 1W1VA 4LEFA 3WMLA 1ZJHA 5BOOA 3H2FA 1KW1A 3AXXA 3MSRA 4JTKA 1S3HA 4KIRA 2ZXAA 4S38A 1QT1A 2ETNA 4I9MA 4HB7A 4IG2A 3VKCA 4Q8MA 4JN6A 3KOFA 4KQNA 1TA3A 5IBXA 1SR9A 5BROA 3UWQA 3TZFA 4LYRA 1YXYA 1C8YA 4PB3A 1R87A 4HU4A 3LGDA 1GQKA 4KBXA 3VIFA 2GZXA 2G0WA 3DC8A 1A3HA 1LRQA 2YLLA 4CD7A 5DY2A 2D22A 2WJFA 1DHKA 2GSEA 1ODZA 3EWZA 1HXVA 1G01A 1RD6A 1Q7QA 3TCEA 5GQBA 3T1GA 3S6DA 4HN4A 4Q8WA 1XPYA 1E0XA 2D2OA 4BI6A 5REQA 4IIFA 1R2SA 1MW3A 1XSIA 3PC0A 4OJYA 4LS2A 4XKYB 3LHWA 1OX4A 3CV7A 3GIPA 1A5NC 3QW4B 4M51A 2DJLA 4W9PA 3KP1A 4MF4A 4AY8A 3NRKA 1Q3NA 3AHVA 3EMCA 3W83A 4H9MA 3WQVA 3PWAA 1XG3A 3N29A 4YCPA 5GNZA 4FXSA 4GIAA 3MW7A 1QU4A 2ZIDA 4DJEC 5AHLA 3L21A 3H8AA 3WNNA 1NFGA 5CEWA 4W5UA 4KWOA 3DYPA 3GB6A 3GDBA 1ZK6A 5I78A 1TRIA 3EEGA 3ALGA 3MBDA 3RMJA 3PFRA 3CAWA 3QF0A 4N0RA 2EQDA 1ZRQA 1FWTA 4HYRA 5K3VA 2OR2A 3PHAA 2XFFA 2UY5A 5AHEA 4ZENA 4MZ8A 1IEXA 4UTWC 1V3MA 2Q3OA 2J8FA 3MO7A 1JG9A 4KFPA 3JS3A 2VFGA 1TRDA 1B3XA 1Z48A 2GGIA 3AI0A 4ZBCA 2YIHA 4AHQA 2BGNE 4DI9A 3GIYA 2WMHA 3MP4A 3DESA 1TIWA 2AGKA 2OVLA 4DJEA 1R0MA 2KFWA 2B7QA 2DZXA 5EMJA 3AHTA 5I6SA 4CNSA 2F21A 3TN3A 2GWGA 3H22A 4MJ4A 1ZAIA 4UOJA 4NNCA 4GVHA 2GUUA 3GSMA 4LY8A 4V28A 4GY1A 1FKBA 4NP7A 3HM7A 1EWDA 1LLZA 5CXPA 1OFOA 1BVZA 1XLKA 3UCQA 2OSWA 2FLIA 2XVLA 3A3HA 3WDRA 3W7MA 3MANA 4LF2A 1SO5A 3KADA 1X6LA 2H8XA 3U2CA 4FEZA 3ABQA 3H7RA 4KWWA 4AWUA 1XIIA 3CEPA 2I9UA 1G4PA 4I3GA 7REQA 3AWNA 4B5SA 1JPMA 3WZ0E 1BGGA 4NI3A 4F66A 4HKPA 4X9YA 3LERA 4HZMA 1W1YA 1KLZA 1TJRA 3S2CA 1UZ4A 2FFIA 4XTIA 3SRFA 4AD1A 5F2IA 4LAKA 4DY1A 5E9AA 3GG7A 4JIQA 1ZLPA 1QRQA 2MLXA 3TLLA 1L8NA 3W7LA 1UKOA 1ZAHA 7ODCA 1ML1A 4DF1A 3GPKA 3T2PA 5B7ZA 1T8QA 1VYRA 1X7IA 2ZCGA 1XH1A 3R58A 1H7XA 4WKFA 3WF1A 3TC5A 2QJGA 4DZ5A 4L4PA 4WDTA 3N2BA 3KRSA 2QS8A 3BQ6A 3VI2A 1TELA 1HJSA 4K7YA 4QJ1A 1XLDA 5FA5A 1GOWA 2VO5A 2FDSA 4LC6A 4YVPA 4CEUC 1VP5A 2E4TA 4XD3A 1D8WA 2YDAA 4KEUA 1J4HA 4GI9A 4M1RA 1IXOA 3O5FA 4QROA 4UNIA 2YKKA 5DIVA 4FB7A 1DJWA 3GWQA 1V02A 2I5IA 2X1TA 3MSGA 3TTEA 3FDKA 2DSKA 3GC2A 1GVQA 2B31A 1CXEA 4Q22A 2XH0A 1H61A 3NYDA 1I45A 3I6RA 1EGVA 3PAOA 3APGA 5ABEA 2TODA 4AY1A 1DYSA 2OO6A 2QYGA 4DJDC 4BK9A 3A47A 2OEKA 3K5XA 4HMCA 2MUCA 1SW0A 4JQ1A 3DKJA 4ZE4A 3PP7A 3WLPA 3N13A 1H11A 4QP0A 3EOOA 4S3EA 1QHZA 3DHDA 3NSXA 1EL3A 4XQ6A 1CGYA 1S46A 3IJQA 4ODQA 5DLCA 4LSBA 4DJFD 1BPLB 4ICNA 1A7XA 2EG8A 3R8GA 3EZ4A 1TV2A 2Y7FA 3CB8A 5AZ1A 3BL3A 4W93A 4QHRA 3ITTA 1TJ1A 2ZUUA 4QFUA 3BOXA 4GY0A 3QYSA 3VTRA 3TK7A 4GFSA 1JULA 1EUAA 2XP9A 4UDMA 5HT1A 5CGTA 1HP4A 3OGRA 1DIKA 4DJDA 1KM6A 3O15A 2EF9A 2OWXA 4BEQA 2FAPA 5HMSA 4J27A 1KT1A 3LHUA 2I16A 1CCWB 2ZBTA 4IIEA 4D6DA 3R43A 1UWQA 3N15A 3NEHA 1HG3A 2DG3A 1LCOA 4F48A 2GQ8A 1HL9A 4UZUA 2QCHA 3EX4A 3SI9A 1FKXA 5MF5A 2CBJA 4OBRA 1Z7AA 1CGWA 2QPXA 1DP0A 4GQGA 2AMGA 3N19B 5C70A 2OQYA 3SCOA 3TAKA 3ARXA 4DUOA 3AJ7A 2WLYA 3TE9A 2VX5A 1DWFM 4PRRA 3E9AA 4W9OA 4JTSA 3U2OA 3HMCA 4G5DA 4OFCA 5C0QA 2VGIA 2YXXA 3VGDA 2BHZA 1VCVA 3Q4DA 3LLFA 3NPUA 1K8XA 3LGEA 2RFGA 4NL1A 5HNTA 1TPC1 4AX7A 5EPDA 2JZVA 1KFLA 2V82A 1WYIA 3B04A 3TYDA 4PCSA 2QEZA 2YDQA 4GG9A 3LBOA 4PMDA 3QM3A 4LWWA 3D0CA 2Y7GA 2C7FA 3CC1A 5I07A 1UR9A 2DUZA 3MHGA 3J7HA 3WQ8A 3S6OA 5I98A 2V81A 1C91A 1VEMA 3KZPA 1POJA 5CSYA 5AC5A 1VF8A 1H0IA 5C54A 4EVZA 3M16A 1HKWA 1REQA 1HTIA 5EYWA 3I6CA 3OZMA 3C0LA 2QVHA 3G77A 4H04A 2CBVA 2WC3A 4JTEA 1LLWA 1HF6A 1GOXA 1QOXA 5DANA 1CYGA 2OCZA 1XRFA 5HJYA 1OGBA 3AIWA 4FNPA 3H4WA 4PBFA 2PTWA 1AD4A 1P0NA 3V5CA 3ATYA 3ITCA 2CXGA 5A2BA 1F3TA 1ZAJA 1NFPA 2XVPA 4IP5A 4GYJA 4V1XA 1BWLA 2XPBA 3IKDA 1LOSA 5BU9A 1MMFA 1WDWA 3AUJA 3TQPA 3LBMA 2PWEA 1GOQA 4YTRA 1GORA 3BXWA 3C0JA 1MEIA 4LNCA 4GUHA 2Q01A 1TUXA 4M7TA 2J74A 3B9DA 1KTCA 3GUGA 4RE4A 1Q6IA 2QIIA 2E7FA 4EACA 1GTEA 2ZR4A 3DFPA 5A8PA 2OB3A 1CENA 3GNDA 2BDQA 2PDFA 1QTWA 3REQA 4WSKA 2PU0A 1E1FA 3UVIA 3DFQA 2PF8A 2WMGA 4DUXA 1TCDA 1P6WA 4OV9A 4NILA 4QSHA 1PWMA 3NSMA 3QC0A 2YCLA 2PS2A 1QOQA 4O57A 1UUMA 3SGZA 3FXYA 1JIBA 3KRBA 1KR0A 5D2WA 3BMWA 3W7GA 1LT8A 1VB9A 4HNVA 3WH7A 3AJXA 1JPIA 3I6EA 4N02A 1U5JA 4K1WA 2FYMA 4J3WA 4IMCA 1VBHA 3E0IA 1VLWA 1L6YA 4MLRA 1EF2A 3W2MA 2ZDRA 5DFAA 2BXZA 3W53A 1A5UA 2XIMA 1U22A 1EO7A 3B40A 3TA9A 3C2RA 4AAJA 5BXRA 4MIMA 4P7RA 3PBWA 1EC8A 3WQGA 1M5YA 4AWTA 3S4TA 3WFZA 1HVQA 1WKFA 3DEQA 1R2RA 4QIUA 3MMWA 3U2ZA 2DSVA 1W2VA 3SECA 4XIMA 4XO7A 4DJED 3FYYA 3NYZA 2ZXBA 1YX1A 3HN3A 2XP3A 2J6VA 2J88A 1R7OA 1ZQ5A 1BVNP 4PUJA 4ENLA 3DI0A 4WX2A 3QLDA 3EWYA 4XUYA 3URNA 4HMDA 1C29A 1PPIA 1NU5A 3KFTA 1JUKA 5A69A 3UZ5A 4DM1A 4FNQA 3MO4A 2HWGA 1RZMA 2WSYA 2E28A 3WSUA 1OSEA 1K7FA 2QIWA 4KS0A 3SBFA 1Y5WA 3LB0A 3E38A 1FD9A 5XIMA 3GUWA 4O15A 3SN1A 2DZSA 1QR7A 4EE9A 3L68A 4O19A 5HMEA 1BXBA 3LM7A 4RNFA 3HG4A 1SW7A 2UY2A 3VOHA 5GPRA 1BXNA 3EAUA 2Y8KA 3TC7A 3WY1A 5HWBA 4PUKA 3IK2A 2Y5EA 4JIPA 2JKAA 1E4MM 3IJ8A 2HISA 4A3RA 3TYBA 3KM8A 3GVRA 2OLAA 3WLQA 4KCUA 3STFA 3RN6A 6TAAA 1GOMA 1DHPA 4TVUA 1C9DA 4CNTA 5LKYA 3GC5A 1KT0A 1TWZA 2XVNA 1FKSA 2CU0A 4CQAA 1HUVA 4MY1A 1YBQB 4RLIA 1V4YA 2VZTA 1FWJC 2PV3A 4B5VA 5C2CA 1HGWA 1R6WA 3G1XA 4Q8UA 1UA3A 2PPGA 2NXIA 3UR8A 1GVIA 4HBOA 3C8NA 6PTDA 4HBKA 1ZPTA 4Z2KA 1QW7A 3NEVA 1IQ8A 4RDYA 2WNQA 5DY3A 1N2VA 3CPRA 3TWAA 4I9JA 4F0RA 1H5YA 5E09A 5J8LA 3TC6A 4Q8OA 4Q6JA 2VMFA 3KOYA 1IIGA 4IM4A 2PC4A 1K6WA 4XX6A 3EOLA 1RALA 3BAXA 3PR2A 3WENA 4EF9A 3CZEA 1ZCNA 1U1HA 1VJIA 2VGBA 1OCBA 2GDVA 4EAMA 3FV9A 1XLIA 4QLLA 3W84A 5AYXA 4OGZA 3THCA 1GYLA 3G0XA 3UEQA 2B81A 3KS6A 1LT7A 2WQPA 4IQCA 4Y9AA 3B8DA 2CLMA 1PKMA 1JCJA 4L1XA 1GVOA 4KWVA 2VCCA 3VD7A 4HMNA 3EKLA 3P84A 2XN0A 3TX9A 1PTGA 2NQLA 1WZLA 1UKTA 3TEVA 2X2GA 4KWUA 1W9BM 1R46A 2WSKA 2E9LA 2QHAA 5EU9A 1VRXA 2GK1A 8RUCA 3GY1A 2FQIA 3STGA 4WXYA 3QXBA 3BLKA 4OKDA 2NVDA 5FIPA 2CC0A 4LV9A 2NLYA 1RAKA 3KVLA 1GPFA 5J6EA 1B57A 3FJ6A 5AHFA 4JDYA 3RIKA 4O18A 4HK5A