1LG2A

Crystal structure of human chitotriosidase in complex with ethylene glycol
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
365
structure length
359
Chain Sequence
AKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRAASLNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Human Chitotriosidase. Implications for Specific Inhibitor Design and Function of Mammalian Chitinase-Like Lectins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords chitotriosidase
total genus 123
structure length 359
sequence length 365
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2002-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 1lg2A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1lg2A01
3M7SA 4MB3A 1OIFA 2O9TA 3IJ9A 1BTCA 4EANA 3VIKA 1MXGA 1VFFA 4PUDA 5CLWA 1UKTA 1LWJA 5JIWA 3AMDA 1B3WA 1C93A 2WLYA 3WD1A 4GZJA 2DQXA 4CD7A 4P8VA 2FHFA 2EJ1A 2OYKA 3JUGA 4UOJA 1JDAA 1WCGA 3M46A 3UESA 3GH5A 4GI8A 2D20A 4WKFA 4PMUA 1JGIA 2UY4A 3CTTA 3CHCA 3VD9A 3L4UA 1O7AA 2YKKA 4U31A 4MDOA 1VBUA 2XSAA 3NDZA 4N42A 1B90A 3AZTA 1JYNA 3UR8A 2PWGA 4K68A 4P8XA 1OCQA 1VJSA 4U2YA 2ZIDA 4PN2A 3EDEA 3VOCA 2WVSA 1XSIA 4M24A 4R27A 1JDDA 3VMPA 1TCMA 4KGJA 2CITA 1KWKA 1HN1A 1DWJM 2A3BA 1MWOA 1N82A 3CHDA 3MMUA 1ZBKA 3WFZA 3AMKA 1GQLA 3MKKA 4GKLA 3MUAA 2WSPA 4NZCA 4U3AA 2WKGA 3WENA 3GH4A 1OINA 4WSKA 1JXJA 2J7BA 5IFPA 4J3UA 2NSXA 3WY1A 2YA2A 3AIQA 1BYCA 1C92A 3CZEA 1UWUA 2YJQA 1AQHA 2WC7A 3BAKA 4H8UA 1EHNA 1J12A 3VIOA 4OZOA 2VRJA 4FLOA 3K4AA 4TTUA 1JIBA 2DSUA 2G3NA 2IXVA 4ML4A 1HKJA 2BY0A 1ZJAA 1KR1A 2CPUA 4OUEA 3O2LA 1FFRA 3CMJA 4HPGA 1W32A 3AIUA 4P7NA 2EBNA 3PZVA 1MQPA 2VX6A 4IUGA 3UG4A 3AI0A 4ATWA 3ARZA 4FMVA 4HU8A 3N18A 1NM9A 1AVAA 1CGXA 1TUXA 1DP0A 5A3HA 4PMRA 3A6OA 4AD1A 5DEZA 3BXWA 3TONA 4JL1A 2XVPA 5HBFA 2BY3A 1GOKA 1VFUA 3ARXA 3AXIA 3DYMA 1AMYA 2YA0A 3ZR6A 1C91A 1TMQA 2ZUSA 3I3BA 5D9PA 4UQDA 3AHVA 1DHKA 3PTQA 1ODUA 3ZR5A 4YPJA 3CZJA 2W66A 1UD8A 1M53A 2ZE0A 1E1EA 4JKKA 3WBAA 1Q4NX 3EYPA 4W89A 1HT6A 2EPMX 2JIEA 3CZGA 4W84A 1JZ3A 2V5DA 1HVQA 1H11A 3WUBA 3AZSA 4MNLA 1Z32X 1QNOA 3L2MA 3KWXA 2BXYA 1OM0A 4C7DA 5BXPA 4CD6A 2E9MA 4JCMA 2VX7A 3TTQA 1XYZA 5ABGA 1CLXA 2J75A 4P7LA 1E1FA 2QF8A 2BHZA 2NT0A 5A6AA 2GFTA 2PBOA 2WHMA 3UCQA 2GJPA 2CNCA 3OLDA 3VD7A 3AHTA 4ATDA 2VZUA 3FAXA 4MNKA 1EDTA 4Z2KA 2DSWA 1HJUA 3VPLA 4J27A 2WHKA 3THCA 2VMFA 2J7DA 3GNRA 2ESCA 1PZ3A 1LL4A 1QNSA 1C8YA 2GK1A 3WEMA 5GPRA 4UZUA 2UY2A 3MS8A 3SUUA 5AY7A 2PWFA 3CHEA 3ARQA 1XD1A 1UQZA 1FH8A 3BAXA 3W37A 1BHGA 1NOUA 4AMCA 8CGTA 1CZ1A 2WC3A 1E6SM 3OBAA 4M29A 3SCSA 3VGGA 1V3MA 1LL7A 3VGEA 1JI2A 1G1YA 1D7FA 5CLTA 3W25A 5A6MA 4MTVA 3ZJ6A 2PF0A 3A47A 3W29A 4TUFA 4PBGA 3SUWA 5GNZA 4WKHA 3W53A 3ZQ9A 3VINA 1H1NA 5D9OA 2ZWYA 3ZMRA 1E5NA 2ZXBA 1OT2A 2XSBA 1ISVA 2J7HA 5D9NA 4H04A 2WXDM 5D4YA 3TP4A 3W38A 1V0LA 2W5FA 1UA7A 2VT0A 4HOXA 5CJ5A 1UKPA 4CCCA 2CHNA 4LQ1A 3DHUA 1XD0A 1V0MA 2X2YA 4QLKA 2FHBA 1WP6A 2D3NA 2JIWA 2VX5A 3PTKA 2XIBA 1GZJA 3L4ZA 2G3MA 3GH7A 4AWEA 1UH3A 4OKDA 2WZIA 3PZGA 4BQ3A 3W27A 1HNYA 3OB8A 4S3JA 1E15A 1W9UA 1QHOA 4YN5A 1P6WA 1I1WA 3BLPX 3UEQA 2BFGA 4MJ2A 2JF6A 5ABEA 1LQ0A 2CEQA 1IZJA 1VENA 1EHAA 1FHLA 1WE5A 2C8NA 5GQBA 2CKRA 4J7RA 2FHCA 1E56A 5CSUA 3AIVA 1UWIA 2X0HA 1KR0A 1W9DM 1JAEA 3SUTA 3VX0A 3W26A 5LA2A 5I77A 4A3YA 2D2OA 2WCAA 4TX8A 1TFVA 3VGFA 5A6SA 2WHLA 3VD5A 2VQTA 4D1JA 2OSXA 3WMSA 3BC9A 4LYPA 4AZBA 3BSHA 4W93A 3ZOAA 4AD4A 4CD5A 1EDGA 1B3XA 4HA3A 3ZJ8A 4AD3A 2PWEA 1H4PA 4UOZA 3I3EA 1GJUA 1UA3A 3SCNA 2E40A 2ZWZA 4ZENA 2YLAA 1C90A 4A4AA 3EMCA 1Q6EA 1ZU8A 3B8SA 1BYDA 1JFHA 4W7VA 3WFLA 1VIWA 4HMCA 2ZXDA 3L4VA 2Z1SA 1FH9A 1VEOA 1GOQA 1EO7A 4AD5A 5ECUA 3WBEA 4MJ4A 1WAWA 3K8MA 1G5AA 3G6LA 2GJXB 5HDRA 1HJXA 4U3CA 4PYSA 4WF7A 3UETA 3NIYA 2CCRA 2CKSA 4XX6A 4TVDA 2ZX8A 1VFMA 1QBBA 4W88A 3RCNA 2ZX6A 3WF2A 3BGAA 4AIUA 4JFSA 1H0IA 4R5EA 1OBAA 4AW7A 1FH7A 2F8QA 3PTMA 3WL1A 2XM1A 3I3DA 5I5RA 2CYGA 2BHUA 1FOBA 3ZSSA 4IPLA 3VDHA 2E4TA 4M1RA 4Z2GA 1HP4A 1UWRA 1UR2A 4M82A 3WF0A 3ARUA 1WZMA 3KEHA 4A3HA 4AD0A 1XRVA 1W9XA 4URIA 4C7GA 1CPUA 3VIIA 1R7AA 3VIFA 4OOUA 3MSGA 1W9VA 1CXEA 3POHA 3VNZA 4D6IA 5KEZA 2J78A 2J62A 4DUXA 1KBKA 2VURA 1QI0A 7TAAA 4OOZA 2D22A 3UG5A 1BYAA 1XGZA 1BPLB 2XWDA 3AZRA 5DT7A 1WDRA 4PMDA 2DSKA 1VB9A 1E0WA 4GQRA 3TTOA 1C7SA 5A1AA 2D24A 4HOWA 1BG9A 3VGDA 3OLGA 4L4PA 4LX4A 1JD9A 1BSIA 2WMIB 2HVMA 3PZ9A 4ZE5A 1DWAM 1QOXA 2BV9A 1B3VA 1PZ2A 3OA5A 3TA9A 4ACZB 3MSDA 2J79A 1V03A 4JKLA 2WPGA 1CGTA 1NOFA 1CGYA 1ZBVA 2DT3A 5C70A 2D1ZA 4Q7NA 3WH9A 4PTWA 4D71A 1OSEA 2OSWA 2WSKA 2ZOXA 3DHPA 1U33A 2GVYA 3VTRA 4QCEA 4W85A 4E8DA 2VZSA 2VR5A 5F7UA 2J7EA 1VEPA 1MW1A 3HU7A 3PZIA 4KGLA 3AS2A 5BROA 1A3HA 2GJRA 1K9TA 3J7HA 3WD4A 4UCFA 2G4FA 3WL0A 1W2VA 1FP9A 1V02E 5GNYA 1C7TA 1R7OA 1EIBA 1UG6A 2VC9A 4CD4A 2J7CA 1MFUA 2X09A 4CVUA 4BQ2A 1UWTA 1V6UA 3PHAA 4AEFA 1HKMA 1K9DA 2WC4A 3BAIA 2Y4SA 4KH2A 3QGVA 3UR7A 2WBGA 5I6SA 1K6AA 1Q6FA 4ZXLA 1PIGA 1V6YA 5A95A 4B16A 3PZOA 5A69A 4UR9A 1UKQA 1HVXA 3MUIA 1ZS2A 2QHAA 3GXIA 1TA3A 2VO5A 1LG1A 3EDFA 2FDMA 1WDPA 4KRTA 3ARWA 5M3WA 3CZLA 1L8NA 4TVUA 3N12A 5FL0A 1V0NA 1E72M 1HP5A 2O9PA 3ARTA 1JZ2A 3AYSA 3RJYA 4CCDA 1UR9A 3WMBA 4PTVA 8A3HA 1B3ZA 1CWYA 1MQQA 2Y2WA 4FLRA 5DF0A 4U5IA 2G41A 5HXMA 5I79A 4CVWA 4GIAA 1LL6A 1GQJA 1JZ5A 4TTGA 4E2OA 3AISA 1UZ4A 4ACZA 4C7FA 4QLJA 4AZ7A 2NW0A 5JH8A 5AYIA 1G01A 5E9AA 1WZKA 2J4GA 3ALFA 1IZKA 5A2AA 1GONA 1CXFA 3VILA 3MO4A 2X8RA 3IAPA 3WNNA 3WN6A 2VCAA 3WF3A 3SCUA 3WNKA 3POCA 2D0FA 3KL5A 4DM1A 6A3HA 1V6XA 3IK2A 1QVBA 3U7VA 3OGRA 4ACYA 2E9BA 1ITCA 3MMDA 3WSUA 4D6EA 2V38A 3LPPA 3ARVA 3AIRA 4H2CA 1E4LA 3OZOA 1HJVA 3WH7A 1J0KA 2WVVB 3WNOA 2WMJA 4DM2A 1GQIA 4MAVA 3B9EA 3MUY1 1WKYA 3W24A 3VVGA 4UFMA 1BLIA 2VR4A 2WMHA 1X6NA 1E5JA 1K9EA 3VGHA 1LLOA 3WEZA 4W7WA 2X05A 3ZT7A 3IJ7A 3PZMA 5A6KA 5EB8A 2XIIA 3W6LA 1WZAA 4AISA 1HJQA 1YQ2A 2UY5A 3FXYA 3T2OA 1QI3A 1PX8A 1B31A 3ZO9A 4HZ8A 2PC8A 4JFWA 2GJXA 4JFTA 4AD2A 3NSXA 2AAAA 5BCAA 2D3LA 3A3HA 2BVDA 5D8WA 1LG2A 1ZBCA 5LA0A 3K1DA 3VIPA 5JUVA 4KWUA 5CPSA 1J0JA 2BXZA 3DC0A 4NF7A 4HA1A 5CSYA 4DWSA 1HF6A 4H8HA 4JKMA 5CQ1A 3WEOA 2WWCA 5GNXA 2W62A 3AXHA 3WUGA 4UNIA 2V5CA 4IISA 1PIFA 4GZIA 3KL0A 3AMLA 5TD4A 3WQWA 5CGMA 3BMWA 2ZX5A 4AZCA 1I1XA 4HZ6A 3PZNA 2W92A 1FFQA 2OWWA 4DUVA 5A94A 2VOTA 4RE4A 2EXOA 1G9HA 5A8OA 1LF1A 4XUYA 3PZUA 1GQKA 4NRRA 2BY1A 4XZWA 4XB3A 4JHZA 1JAKA 4OBSA 3ZJ7A 4Q22A 4XZBA 2ZUMA 2RGMA 1KGXA 1W3HA 2X0YA 4M81A 1G0CA 5A8MA 1G94A 1V08A 4W87A 3THDA 1MVYA 3B9AA 1HIZA 3SEPA 3GXMA 1K9FA 3OIHA 4QFUA 4GPNA 2C0HA 3WD2A 1CEOA 5DFAA 2GDVA 3NUKA 1CYGA 1J11A 3VM7A 1NP0A 1UD4A 4PSRA 1MXDA 4HTYA 4ZFMA 1ISZA 1XH2A 4BCEA 2OWXA 5CXPA 2OLHA 1NQ6A 4FF5A 4AIOA 1ODZA 3T2PA 1OGSA 4DWSD 1TR1A 2XHYA 3KZSA 1UZ1A 3VMNA 1J0IA 2G3JA 1GHSA 1KCLA 2WM0A 4U33A 1EQCA 3AMGA 4XV0A 3SCTA 3U57A 1BQCA 1CTNA 2Q8XA 1UOKA 1GOMA 1SYTA 4D6CA 2UY3A 2JFEX 1UH2A 3RJXA 1QNPA 4J3WA 5E0CA 3APGA 1OGGA 2QPSA 3GBDA 3CLWA 1OD8A 1LJYA 1JFXA 4Y7EA 4V2XA 4J28A 1DEDA 3WH6A 2E3ZA 1M03A 5BXRA 1NOWA 4J3SA 2WVVA 5A2BA 2AOSA 1JZ7A 4UFJA 2WK2A 4BF7A 1GHRA 3ARSA 4P8WA 2VCBA 2WYSA 1O6IA 3AQUA 1X1NA 1E6RA 3WIJA 1W91A 1B3YA 1EO5A 4W86A 3NSNA 2BHYA 2DSVA 3AXXA 2WZEA 1UUQA 4UQ9A 1PEZA 4FK9A 4AC1X 5E09A 2WHJA 4GI9A 1GOOA 4H7VA 2PB1A 5I23A 1UHVA 3ZJKA 3U5YA 4AZ6A 2WZHA 2GK1B 2G8ZA 4MAZA 3EDDA 3ARYA 1CXLA 3RILA 3CUHA 1NWTA 1BFNA 2WVUA 2XFRA 2JEPA 4AY1A 3IAQA 1XYFA 1XCWA 2C7FA 4OIFA 3HN3A 3T08A 4HOZA 2EPKX 4UZSA 3WDRA 2WWDA 3VD4A 2ZUTA 4D1IA 1E6ZA 1QI4A 1W3JA 4CU6A 1S46A 3AROA 3QOMA 2XVNA 2DDXA 1E6XM 4MNMA 3KL3A 2ZUWA 1BGGA 1CENA 1V3HA 1VRXA 4F8XA 1E6PA 1XH0A 1D2KA 4LPCA 1W9BM 5ABFB 1HJSA 3G6MA 1FA2A 3WD3A 4OJYA 1JF6A 2O9OA 3MANA 4CCEA 3WDPP 4QDMA 5JBEA 3SCRA 1PX3A 1MW3A 1BYBA 1EOMA 1C8QA 2EQDA 1M04A 1KGUA 4PSPA 2PBGA 4TVCA 4QLLA 1B2YA 5C8BB 1TG7A 6TAAA 1R87A 1CXKA 2CBUA 3WNLA 1JZ8A 1QI2A 3S6TA 1CGWA 1KBBA 4UTFA 3OLIA 1CIUA 5FL1A 2DEPA 3PN8A 3D5HA 1US3A 6CGTA 2DT2A 2BS9A 2QLYA 1C8XA 1XHGA 3AFBA 2Y5EA 3SCWA 1GW1A 2DH2A 2FH6A 4BQ4A 2QPUA 2VZOA 5JBFA 2YDSA 1DWFM 4MB1A 2ZX7A 1HJWA 1UQYA 2BVTA 4JCLA 1GUVA 4HMEA 1KB3A 4F9JA 2WBKA 4N0RA 1SMAA 3K8KA 1MYRA 3WELA 4B3KA 2IXUA 1EDQA 2E0PA 4EK7A 5IDIA 5A8QA 5CG0A 1IT0A 2EPOA 5IXEA 4RL3A 3W0KA 3QHMA 5EFDA 4JAWA 4UFLA 1H3GA 1UYQA 1DWHM 5A6BA 1E4NA 3IJ8A 3T0AA 1KFWA 3A4WA 1E4MM 2XTKA 1X6LA 4JFUA 5BRQA 2XG9A 1OT1A 3N17A 2J25A 4MPKA 5I2UA 3ECQA 5KZ6A 4DWSB 2VI0A 4UFKA 4AIEA 4WK9A 3GYCA 2WCGA 1ZB5A 4MNJA 2XJ7A 2VVNA 4P7QA 1RP9A 1E40A 3FHAA 4JFVA 2DSZA 3RM4A 2E9LA 4JIEA 3ALGA 3VNYA 4CKQA 3BMVA 2DT1A 1MQRA 2YBTA 1J9YA 4MDPA 2WNWA 2J7GA 3MU7A 1PAMA 5A8NA 4Z2LA 5DO8A 3FHQA 3OGSA 3AICA 3RM9A 4B15A 1NWUA 2EO7A 3WQ8A 1U2YA 3NDYA 1BAGA 1KQYA 1E71M 2DPEA 5E70A 1E6QM 2HISA 2J7FA 1NP2A 1V3LA 3N15A 1B30A 5M5DA 1L0PA 2FGZA 2JEQA 4J3TA 1NWSA 1JZ4A 2OYMA 3F5JA 2WCSA 3M6DA 4X0NA 4GQQA 1UKSA 2WMGA 1V02A 3L2LA 1UD6A 3BSGA 2YL8A 4JL2A 3RIKA 3K8LA 3N9KA 1Q6CA 2XGBA 4D72A 4GXPA 1BGAA 1JG9A 1E73M 1QPKA 2BY2A 4M56A 3O6AA 3VD3A 2X1IA 3WH8A 1SR0A 1XSKA 2XPKA 3L4YA 3WUFA 3RPMA 1V3JA 5BXTA 3LPOA 1UD2A 3ARPA 3LMYA 1J0ZA 3EDJA 1JD7A 3N11A 1WZLA 1E0VA 1UH4A 2Z1KA 4RE2A 3OG2A 2EEXA 1F4AA 1ZL1A 2WAGA 4PMQA 5AYBA 2XM2A 1Y7VA 3GNOA 3BCDA 3GDBA 5A2CA 1E4IA 3GZAA 2GSJA 2J77A 3SURA 4GINA 3EMQA 4PMVA 1TVNA 1R86A 1WB0A 5FKYA 1BG4A 3WDJA 1DWIM 2VVSA 2VZTA 3EMZA 5A8PA 1VEMA 2ZXAA 1ZJBA 2ZUNA 2WLZA 1GVYA 4WKAA 1EA9C 3FN9A 4CU7A 3WKZA 1H09A 1ECEA 4QP0A 1CLVA 2IUZA 4AZHA 2Y8VA 4CD8A 5EMYA 4CN1A 2A3AA 2WW5A 4W8BA 3T2QA 3MV01 4HP5A 5A6LA 4HPHA 4P7RA 4AZGA 2D0GA 2VRKA 2V3GA 2F61A 1C3FA 2XFYA 4B3LA 3RO8A 2F2HA 4BS0A 1JYVA 3L4XA 1J10A 1YHTA 3OGVA 1JYWA 2XGIA 2PWDA 1MFVA 1W3KA 3CMGA 1VJZA 3LPFA 3BAWA 1E3ZA 2W63A 3QR3A 3N04A 1JNDA 4AXNA 4TX6A 4UQCA 3VIMA 4WIWA 3M07A 3VDAA 1E9LA 1QW8A 4W7UA 3W4RA 4YHGA 3BCFA 1H41A 3IANA 5CZKA 3AS3A 3CUJA 4HMDA 4F79A 4X0VA 2XWEA 1VF8A 1NWRA 1RPKA 5FOOA 5A6JA 3KE0A 3PBGA 4U2ZA 2YL6A 3VDCA 5CPQA 3MMWA 1V6VA 4CGTA 1E43A 4AZ5A 1RD6A 1E55A 4AZCB 3PZQA 1TZ7A 3GNPA 4EKJA 1JF5A 5I78A 2VUYA 4V28A 4ATLA 1UR4A 2DGAA 3UG3A 3CZ8A 1DTUA 3WDQA 3AOFA 3LPGA 5I3DA 3WDHA 2ZUVA 1A47A 4PMOA 2CETA 4LXFA 2W67A 4D6HA 4UQBA 1M01A 2YLLA 4PMNA 4BZYA 2YOCA 3A4AA 3TOPA 2XVLA 2G3IA 1XCXA 1FHDA 4OBRA 1GNXA 4P7OA 3UERA 2YDQA 3CUFA 4L4OA 2V3FA 3B9DA 1KXTA 4AZIA 4DWSC 5BYWA 3AYRA 2YBUA 1CGVA 2CXGA 1SFSA 2WMIA 3AHZA 3EBVA 5BWFA 2D0HA 3U7BA 4WSJA 4IPNB 4GI6A 4E4PA 1GVIA 1EXPA 3HMCA 1JI1A 1HL8A 2EPLX 4YHEA 2J8GA 3BLKA 4CN6A 4U5KA 3FY1A 4D6DA 1DWGM 1W1YA 1XH1A 2VCCA 2YA1A 3F5KA 5JIPA 2BNJA 2O9RA 4MB4A 3NCOA 3OZPA 3FW6A 3VMOA 2CERA 2UWFA 4JHOA 3SIMA 4BQ5A 1H49A 1W3LA 4H8VA 4X9YA 1V3KA 5EFFA 1TE1A 1XSJA 1BF2A 3O9NA 1KXQA 5A6BD 4ZXOA 1V6WA 3ZIZA 3CO4A 1E0XA 3BH4A 3ZT6A 3QOKA 2VNCA 3BAJA 3CUGA 1J0YA 5FD0A 1CDGA 2D23A 3WF1A 1QI5A 1W1TA 4PUEA 3VDBA 2A3EA 2YL9A 1HKIA 1RH9A 1AQMA 5D9MA 3ZM8A 1CGUA 3OLEA 4UFIA 1KWGA 3AS1A 3SCOA 4FLSA 1PX4A 3WQ5A 1OIMA 3GXFA 2YDRA 1CXHA 2CBJA 5D8ZA 2W61A 2J47A 1ISYA 2B31A 3RDKA 1CXIA 3DYOA 2ZX9A 4KMQA 3N13A 4DUWA 4E8CA 1KQZA 3FNDA 5LA1A 2AMGA 1V0KA 4M80A 2E8ZA 1EQPA 1CECA 3CH9A 3ARRA 5AC5A 3S2CA 2ZICA 3QHNA 4IM4A 4NSBA 4UQAA 3T0DA 4UQEA 1LWHA 3CPUA 4S3KA 5IFTA 4MB5A 1JYXA 4CN4A 3SCPA 3U5UA 4W8LA 3GTNA 1EGZA 1BVZA 9CGTA 2CHOA 5FIPA 1V3IA 1SMDA 3GBEA 1PJ9A 3NSMA 1KXHA 3VX1A 2WVTA 3WF4A 1E70M 2CBIA 1W9PA 4GZEA 5E6ZA 3CBWA 1OWQA 2DIEA 4M8UA 3W82A 5E6YA 3E1F1 3SCVA 2DT0A 3SCQA 1QHZA 1B0IA 2E8YA 2MANA 2QV4A 4Z2IA 3WQ4A 1WDQA 4ZEPA 4F66A 4KRUA 2XFFA 4F9DA 2XVKA 3EDKA 3VGBA 4ZE4A 1QHPA 1AQ0A 1XV8A 4D6JA 4PTXA 3K4DA 5IHSA 1HL9A 2VRQA 4LYRA 3D3AA 1J18A 3DECA 3ZSTA 3SUSA 1W1PA 2EPNA 3VUPA 1QNRA 2V3EA 4W5ZA 2CESA 4P8UA 1UWQA 3BAYA 4PRWA 4FLQA 3CUIA 4B9ZA 1KCKA 3VM5A 5JBDA 4PCSA 4NRSA 5ABHA 2VTFA 5I0DA 1B1YA 3MV11 1U30A 4PCTA 3RMEA 5E0FA 1M7XA 2J74A 3WNMA 2NT1A 2OYLA 4WLCA 1R85A 1VBRA 4TOQA 2WKLA 1KGWA 1JZ6A 2XYLA 2J8FA 3L4WA 3WQVA 2JALA 4HA4A 4PTMA 2TAAA 1QBAA 3FAWA 4D6FA 2FH8A 1H0GA 1VAHA 2RGLA 1E3XA 4Z2HA 2PWHA 3W81A 1US2A 4PMXA 3WQ6A 1I75A 2ZXQA 2VZVA 4NI3A 5HPOA 5CPTA 1GOIA 2QMKA 2W91A 3WUEA 2GDUA 5IHRA 2YL5A 2A3CA 3L4TA 3AMCA 3SUVA 1R8LA 1QW9A 3HJEA 3NYDA 2PI6A 1ISXA 3ZT5A 1KXVA 1UKOA 2JE8A 5HPCA 1WPCA 4RE3A 1H5VA 1VFOA 2FGLA 3T0BA 4UFHA 7CGTA 3VIJA 1OGBA 3AHXA 1HKKA 1Q6GA 1ZBWA 4H41A 4PMYA 2VQUA 5HOSA 2WB5A 1E6NA 1NARA 5HNNA 1ISWA 5M17A 2ZUUA 1XC6A 2A3HA 1ESWA 2XVGA 4LYQA 1TA3B 4MADA 3MUZ1 1W2PA 1W1VA 2WANA 5M03A 3CZKA 1WO2A 5ABFA 5C71A 1EOKA 1GJWA 3AIEA 3T09A 1PPIA 3AJ7A 5LYRA 1RP8A 3W6MA 1OB0A 2VX4A 2JF7A 2WMFA 3II1A 4J3XA 1H2JA 3VIGA 5CGTA 1IV8A 1F4HA 3WH5A 3WD0A 1B9ZA 3TTSA 3GM8A 4QAWA 3WNPA 4Z2JA 1HXJA 2CBVA 4QCFA 4W5UA 1MW2A 1UD3A 5BXSA 5EBAA 4CU8A 1GOWA 1GCYA 2GUYA 4TXEA 4BA0A 4AYSA 3VKKA 2BVYA 2OWCA 2VL4A 1BVNP 2WMKA 3GXDA 2DH3A 4EE9A 4HZ7A 3CGTA 2V3DA 1UWSA 2OSYA 4UOQA 3W28A 2CIPA 3DYPA 1WDSA 3VU2A 4AEEA 1D3CA 2Y24A 5I24A 5DT5A 2W4XA 1CNVA 4JZ5A 3WDIA 3TTYA 4J3VA 4PEEA 3PZTA 3A4XA 1OD0A 1PBGA 1EH9A 1UD5A 2Y8KA 4V27A 3F5LA 4WJXA 2QMJA 1UR1A 1J0HA 1NH6A 3NJ3A 3AIWA 3K46A 5FCZA 1QNQA 4B9YA 1HX0A 3VIHA 1J01A 1FP8A 3F4VA 3AS0A 4EAMA 1ITXA 3N1AA 1JXKA 4LGXA 1GPFA 1UR0A 4D6GA 3VO0A 3QHOA 1GORA 1MW0A 2VJXA 1WNOA 1CBGA 4CUCA 3CIVA 4GO8A 1UR8A 3RM8A 4W8AA 3AHYA 4PMZA 3AIBA 1JNEA 7A3HA 1Q6DA 5BRPA 1JL8A 5DMYA 3WMCA 1JDCA 4GO9A 4HU0A 1TVPA 2YIHA 2O92A 2DIJA 3CHFA 5AC4A 2XUCA
chains in the Genus database with same CATH superfamily
2O9TA 4EANA 4NKCA 3UQAA 4KIEA 1VFFA 3L5LA 3EIPA 2KI3A 3N3MA 5CLWA 2PGEA 2Z00A 3W07A 3QZ6A 4DBDA 1LWJA 3OEXA 4GZJA 3WD1A 4O52A 3SSZA 3GW0A 3JUGA 1JDAA 2HVNA 3GH5A 3ANYA 3DESA 3CHVA 4WKFA 3MI3A 3RGTA 1O68A 4PH6A 4JTRA 1FRBA 2Y7GA 2XSAA 3AYTA 3MCMA 3SDOA 1PWLA 3UR8A 4MWAE 5C2CA 4JDYA 4K68A 4WVXA 1VJSA 3CQKA 3Q67A 4XBKA 5BU9A 3PBYA 5LHFA 3NM1A 2ZIDA 4PN2A 2Z29A 1EYMA 3DN5A 2XISA 4KGJA 1EJ7L 5IM51 3MKCA 4FX7A 3UJRA 5F2MA 4EACA 3NOYA 3MMUA 4IJCA 3M44A 3MKKA 5K9XA 1ZTVA 3MUAA 4B3ZA 3PAJA 4U3AA 1RK6A 4GFSA 4AF0B 4QITA 4KEMA 1JXJA 4Q33A 3PFMA 5H8PA 4C90A 4IT4A 5D75A 3WJXA 2W6RA 5AECA 3W22A 5FA5A 1U1UA 3AIQA 1C92A 1UWUA 3NQGA 4MWAA 1XBZA 1G69A 3FVDA 1QDSA 2DUAA 3K4AA 3TN6A 1JIBA 1GPWA 2DSUA 1HW6A 2G3NA 1ZJAA 2WV8A 1KR1A 1SU5A 1F40A 3O2LA 3IS4A 1FFRA 3CMJA 3AIUA 4P7NA 2VX6A 1K8XA 2BXVA 2QS8A 3ARZA 3CGNA 3S2MA 3N18A 1NM9A 3LHYA 1TUXA 1SJDA 4AD1A 5DEZA 5DRCA 4LU0A 1UC4A 5FJPA 3FSTA 3N4AA 3QKEA 4PFHA 3V75A 3V7PA 1GOKA 1VFUA 3ARXA 3BQ6A 1TMQA 3I3BA 5D9PA 3KBSA 1SO4A 1SZNA 3PWAA 4M51A 1ODUA 3I6CA 2QEZA 5DBUA 3S2NA 1GG1A 2PTYA 3PR2A 1UD8A 1K4HA 2EG7A 2QCGA 4W89A 2EPMX 2PDJA 3KBJA 2GGHA 2V5DA 3LTYA 1M68A 3U6WA 1NSGA 1SW3A 4L4MA 4Q8QA 4RZ6A 5J8LA 4L80A 4CD6A 5ABGA 2PDNA 1XX1A 2E68A 2OKOA 2BHZA 3H24A 3W1XA 5CC5A 2GJPA 4IFRA 2DG3A 2PDGA 5H6HA 1LYXA 4JX5A 4Q7IA 4ENLA 4ATDA 2VZUA 3NR0A 3FAXA 3IEBA 1EDTA 2VMFA 3GNRA 1QR7A 2ESCA 1PZ3A 2BOFX 4ZO7A 1LL4A 3Q94A 2VFGA 3MVIA 1O12A 3L23A 2A6NA 3SUUA 4LUIA 3TW9A 3CHEA 3BSMA 3ARQA 4LUSB 4PCPA 3W37A 1BHGA 4AMCA 4G6CA 1CZ1A 4NQ1A 1E6SM 4NL1A 3PANA 3OBAA 2OB3A 3SCSA 1LL7A 3VGEA 1JI2A 5CSRA 3PR9A 3A12A 1OVDA 3DBNA 3F4NA 2PF0A 4FAPA 3BLIA 3VINA 2ZWYA 3W76A 3ZMRA 3IIPA 4ZFCA 4DYEA 2J7HA 4B2DA 3OPSA 3I65A 4B5SA 1D8CA 3W38A 2W5FA 2H8XA 5CEWA 2VT0A 3QY8A 4HOXA 4MGVA 3QPYA 1M41A 3NA8A 1GGOA 3DHUA 3S46A 3NVTA 3CV2A 4IP4A 3PTKA 2XIBA 3L4ZA 4OKDA 2BB0A 1HNYA 4IMDA 2BSLA 3M64A 4S3JA 4MJMA 2FB2A 1E15A 1W9UA 3BZJA 4MZYA 1K77A 3BE7A 1XGEA 3BLPX 4MWAD 4XZHA 3TC6A 5XINA 1RJQA 1XLGA 3BW4A 1UBPC 2JF6A 4MUZA 1L8PA 2CEQA 1EHAA 3CYVA 4JN8A 4I3GA 1P0EA 4JGDA 1FHLA 1WE5A 4JIRA 1UPPA 3V5FA 2C8NA 4XWUA 1E56A 3GG0A 4B5VA 3AIVA 1UWIA 1W9DM 4E3VA 5U4NA 1VYSX 2D2OA 4ECLA 3BDKA 3VGFA 4LW7A 3VD5A 3I6RA 3QSTA 1XYAA 3O5IA 2ATSA 4H6QA 1Z7AA 4YVPA 4AZBA 5FF7A 3C6CA 3O5GA 1Q6UA 3ZOAA 1U1HA 4WZHA 4L9ZA 4A21A 2PWEA 1E0TA 1RCXB 3I3EA 4XZ9A 3T0CA 1A80A 1RQBA 1NF0A 1XLEA 4ZENA 2YLAA 5G1MA 3S6DA 1RVGA 1TTJA 4ITZA 4CQAA 5BW6A 1UJPA 5FJUA 1BYDA 3URNA 4I9AA 2CLEA 3P74A 5ECUA 2AQOA 4DZIA 5AVHA 1HJXA 3B8UA 3NURA 1CCWB 3UETA 3NIYA 2CKSA 1TV7A 1TCOC 1XC4A 2ZX8A 3TDBA 4IPIA 4W88A 5CC3A 4WDXA 4O4WA 1XINA 4PA8A 4Y9AA 4AIUA 4MY1A 1OBAA 4AW7A 4S3BA 3ABQA 4LEQA 3STGA 3ZSSA 2E4TA 4Z2GA 4RDZA 1EJVC 3CLMA 4PFMA 3VOGA 4URIA 4C7GA 3QV7A 4KKXA 3VIFA 2PDHA 1DJGA 4LVBA 1VH7A 1R46A 2CLFA 2XIMA 5MKGA 2J78A 1KA9F 2FLIA 4QSHA 7TAAA 2D22A 4ONVA 4YMZA 3I10A 1WDRA 4KIRA 2DSKA 3IVSA 3EWBX 2J8TA 3TKFA 4GQRA 4QNEA 3D0CA 2ACQA 3TTOA 1LP6A 3QM3A 1VCVA 1J79A 1FXQA 3OLGA 2VDGA 4O0QA 2GQ9A 2X42A 5JU6A 2HVMA 1P0NA 3HGJA 1B3VA 4WJEA 1HL2A 4JKLA 2B81A 3GC4A 2ASHA 1NOFA 1CGYA 5DITA 5G1TA 6TIMA 4D71A 5XIMA 3KCJA 4EIVA 2WSKA 2ZOXA 4HJFA 3MDWA 4G7EA 3H54A 3DHPA 2GVYA 4IH3A 1DJZA 2XP6A 5FSEC 1LRTA 3HU7A 1J96A 1MW1A 1U22A 2X1SA 4MPQA 1PS9A 3AS2A 1A3HA 4MKVA 3WBWA 1IXPA 3J7HA 5KMYA 4B5XA 4BWLC 3HV8A 4QJ5B 3WL0A 4CNOA 1J4EA 4F0MA 4GNJA 3T55A 2VC9A 2X09A 1MFUA 4JQ1A 4CVUA 4OFCA 4MGGA 1UWTA 1QTWA 1V6UA 1HKMA 2Y4SA 1B57A 1Q6FA 1PIGA 1V6YA 4B16A 3ES8A 4F0KA 1HVXA 3GTHA 1SFJA 1A0DA 4GVIA 4PUWA 3ZS4A 1R3VA 3L68A 2F21A 1OG0A 1LG1A 3EDFA 4Z1YA 2FDMA 1WDPA 2Y62A 4BI5A 2YSWA 4QISA 3SIZA 3P6LA 5E93A 4FXFA 5M3WA 3TNBA 8TIMA 3HB9A 3I6EA 4TIMA 4FB7A 1G67A 5FL0A 4HN4A 2FKPA 1JZ2A 2X41A 3WLIA 1FKJA 4CCDA 2PPOA 2FVMA 4PTVA 8A3HA 2Y2WA 1MQQA 1TZ9A 4FLRA 5F4SA 3ZVIA 1WBHA 2VGBA 5DF0A 4B2DD 1MEIA 3HPFA 3CXOA 4TTGA 3AISA 1UZ4A 4JQ4A 4C7FA 5HAOA 4L6OA 4GY0A 2C13A 3PUEA 3BV4A 1Z6KA 5CG7A 1OX6A 3GUWA 4CEXC 3FGCB 2J4GA 1IZKA 2WZTA 1RBAA 2OG9A 1RLDA 1VS1A 1CXFA 3VILA 2X8RA 3IAPA 3WNNA 3WN6A 3USBA 1FTXA 1FWAC 1W5MA 1Q7ZA 2FZNA 3IK2A 1TWWA 4O17A 4Z08A 2QDHA 2Z24A 1F8MA 3A5VA 1ME9A 2O7SA 1XLBA 4Y9MA 1BL4A 5DIUA 2VWSA 4D6EA 2HEJA 4XD5A 4IXXA 4KEZA 1IXNA 4H2CA 1HUVA 1HJVA 3SRHA 3WH7A 2NLIA 2DG9A 2WMJA 3URQA 1AJ2A 1GQIA 1WKFA 4MAVA 3B9EA 3ORWA 4LVDA 1EFZA 4NUWA 4O1AA 3VABA 1WKYA 3CV6A 4S1FA 1XF0A 1QPFA 2ZZ7A 2DZSA 2VR4A 4W9PA 5EPDA 4EWJA 2CW6A 4NY2A 1JPHA 4G1KA 4H6RA 3IJ7A 1XLCA 3B8IA 3PZMA 5D05A 3PPHA 6ALDA 5FSDC 1ZENA 4X63A 1J6OA 1WZAA 1YDVA 2WSYA 3R2GA 4IIEA 2UY5A 2I5IA 3H7UA 3DFSA 4DELA 3BARA 1J93A 3ZO9A 4HZ8A 2PC8A 4JFWA 3PAOA 4JFTA 3NSXA 3HGOA 3UPMA 1H1YA 4G7FA 4GUJA 3A21A 1XL9A 3QV6A 1BKHA 1ZBCA 5LA0A 4M7TA 1VQTA 1NU5A 3ZVHA 2R1LA 4KWUA 4RKAA 3RUBL 4ZMGA 1LRQA 1HGWA 3HURA 3CAWA 5CSYA 4DWSA 5B7YA 4JKMA 1QK2A 4UUIA 1EUAA 5L6UA 4CLMA 1A50A 3DG3A 3NOEA 4NJKA 1KFBA 5FI8A 3EWYA 2RJHA 3H2CA 4ZSTA 2PLCA 3GG8A 3LQLA 5CGMA 3SFWA 5HA7A 3FKKA 4PBFA 3PZNA 3NM3A 2EXOA 3M0LA 4PMJA 1LF1A 2E28A 1O94A 3UR5A 2P1FA 3PZUA 1GQKA 5EMJA 3B7XA 4JHZA 1ONRA 3OVGA 4MUPA 3ZJ7A 1H1ZA 2RGMA 2BWGA 3EX1A 1I2QA 2O56A 3UA3A 3FIGA 1AJ0A 2FIQA 1TX2A 4AHOA 1A53A 2QUNA 4LUSA 3OW1A 3OIHA 4XKMA 5B7ZA 1R3RA 1JPMA 5DFAA 4LAYA 2GDVA 4XSLA 3VM7A 4BEQA 1NP0A 3O5QA 2V81A 3EWDA 3H8AA 1FD9A 3W23A 1D7IA 2XPBA 4A29A 3BO9A 4BCEA 3TDFA 1BWVA 4N6FA 5CXPA 4FF5A 3W1TA 4AIOA 3BCJA 3EEGA 4DBEA 1EB3A 1OGSA 3REQA 1K1DA 3KZSA 3LSCA 2ISFA 2PZ0A 3G1VA 2NVDA 1GHSA 4I90A 4D8ZA 3AMGA 5DO2A 2ABAA 3MZ2A 1T6MA 1XS2A 3WFAA 3SCTA 2PDPA 1L2QA 5AHIA 3T40A 2C0AA 3RXZA 2JFEX 1VGAA 1UH2A 4IIBA 4C6CA 4JTAA 3O6DA 3MP3A 3TWBA 1XIHA 3APGA 2YW4A 1LJYA 1JFXA 1F3WA 5DCEA 3CV7A 4M7SA 3KOFA 5FF4A 1M03A 2CFFA 4WGHA 2EHHA 2WVVA 5A2BA 4XVEA 4JTCA 4BF7A 3QJAA 4P8WA 3UXDA 1ICPA 2WYSA 1BD0A 6PTDA 1Y5WA 1E6RA 1BKFA 4PGLA 3IWPA 3TSDA 1EO5A 3PUGA 4QJ4B 2BHYA 3AXXA 1TPUA 3O05A 4UQ9A 2QCCA 1D8WA 3LGEA 4FK9A 3DG7A 4AC1X 5E09A 2HDJA 4TV5A 4C1NB 3P67A 1OK6A 3O15A 3QF0A 3W7KA 4C1NA 3A3WA 3UPWA 1UHVA 4AZ6A 3APTA 3LDVA 4MAZA 3EDDA 1LDCA 3WQEA 5D2VA 3QKZA 2QVHA 3A9IA 1UP3A 5FEWA 4NYUA 2WVUA 4J1OA 4L1XA 3K2GA 3SFKA 2GSEA 2K8IA 2VEGA 4GVFA 2OEKA 2GVLA 2R1PA 3W84A 4NYYA 5G4WA 1V7AA 1E6ZA 3CO8A 4MG4A 2V67A 3KVMA 3FJ6A 1S46A 3LXCA 1N1AA 1W31A 3QOMA 1E6XM 3TZNA 2PPPA 1VRXA 1E6PA 1L6WA 4WXZA 2V0TA 1W9BM 3IGXA 2DU2A 3S83A 3G6MA 4QQUA 1FA2A 3RYSA 3AAMA 1AW5A 1IR2A 4Q8NA 2YXXA 4XZIA 1DVJA 1JF6A 3MANA 3C2YA 4QDMA 3PPFA 3S47A 3ZFHA 1GT8A 2VD9A 3ABOA 1M7OA 3W02A 4OHQA 4PE8A 4XAFA 4QDWA 1B2YA 5C8BB 1TG7A 3VAWA 2PE4A 2VEFA 1CGWA 1KBBA 4UTFA 5FL1A 4IZGA 2I14A 2DT2A 2BS9A 1O66A 3D3FA 1M3UA 5BWAA 4FNSA 2FH6A 2VZOA 2W0UA 1DWFM 1MMFA 4FPSA 1UQYA 2BVTA 4JCLA 4ODMA 3OU8A 4HCLA 1IIGA 1A5CA 3MY9A 1PV8A 3MJMA 4B3KA 3B4UA 4EK7A 2RHGA 4R88A 3UWWA 2EPOA 4RL3A 3W0KA 5F2GA 3QHMA 3EOSA 3TNOA 4HYRA 3A4WA 1X6LA 1V6TA 4DJDC 2J25A 2WSRA 4N02A 5KZ6A 4DWSB 4TR9A 4PUKA 3SB0A 4WK9A 2A21A 1SR9A 3LBOA 1OFQA 3A3XA 2PP1A 3RM4A 4RNHA 4JIEA 3ALGA 4PB3A 3T4WA 1GZ1A 4CKQA 1TPB1 1OF6A 3UVAA 1KFLA 5M1TA 4Q8TA 1MQRA 3VKCA 3H55A 4QIBA 1F6YA 3UZWA 2XP3A 4Z2LA 3AICA 3LN3A 3WQ8A 3UY8A 2A2IA 3NDYA 4Y9PA 8RUCA 4OVXA 1E6QM 2J7FA 4HN8A 1W1ZA 5HW6A 3RG6A 4UR7A 5HULA 2PTZA 3E12A 1L0PA 1C9WA 4J3TA 3KBNA 1VZWA 2OYMA 4X2RA 2IQDA 4WHBA 1X6UA 2OKTA 1W56A 4HK7A 5AKQA 1Q6HA 4K1GA 3TN4A 2WMGA 3PB0A 2UV8G 3LLDA 3L0GA 3DZ1A 3L2LA 3PF3A 4H4IA 2YL8A 1PWMA 3N9KA 5H2ZA 3LA4A 3NQEA 4EOUA 3ONBA 4DZ5A 2FFIA 3N2OA 1D7HA 3P93A 4GGBA 3QC0A 3LM7A 4R3UA 1JG9A 2XIJA 1PHWA 3SRFA 3VD3A 3O6AA 3NRKA 2PRHA 3O5FA 2I7GA 2X1IA 3KP1A 3WH8A 3VFCA 5FF0A 1SR0A 4XQ6A 3L4YA 3WUFA 3TTEA 1XWYA 3O5DA 1WYIA 3REQB 4KW2A 1GYNA 1J0ZA 3CU2A 4LS1A 3R13A 2DJXA 1Y5VA 3G24A 1F4AA 2FZMA 4PMQA 1H61A 3MI2A 3FGCA 5AYBA 4U85A 1HQTA 1Q7QA 3FJNA 1Y7VA 4BHYA 4O0ZA 3BCDA 1FQ0A 3GZAA 2GSJA 5HNRA 2E6AA 1TCDA 1TVNA 1UUMA 2QNEA 3EMZA 2ZXAA 3STCA 3W1RA 1ZJBA 2B7NA 1EA9C 4R34A 4CU7A 3CV1A 2HNEA 3GFXA 3S1GA 1AW1A 3GKFA 4KS0A 4QJ1A 1A49A 3UWZA 1EXBA 1VRDA 4CD8A 3TAOA 1FBAA 4L6DA 3T2QA 1FWCC 3PBUA 4XTIA 4HPHA 1Z3NA 4L6HA 2ZADA 3GQYA 3XINA 2F61A 3RR4A 4UXDA 3E9AA 1NSJA 2GYIA 4DBSA 1R9XA 3TAKA 5CKSA 5LNSA 3MQTA 3N73A 5T9CE 1ME8A 1MFVA 4LAVA 1KRBC 1W1IE 3GDKA 1VJZA 3SN0A 3D6NA 3LPFA 2NLYA 3QR3A 2VELA 3N04A 3IPWA 1Q2SA 1YNYA 1JNDA 2HQAA 3M5XA 2BGSA 4WIWA 3M07A 4K39A 3VDAA 1Y0EA 4W7UA 1GYMA 3KAGA 1H41A 3N25A 1XIEA 3AC0A 2XWEA 1FKXA 1OCNA 4JICA 5REQA 4QZVB 1RY8A 3PBGA 3W7JA 3PJWA 3VDCA 3S6OA 3IGSA 4DRPA 4CGTA 1E43A 3PZQA 2CLPA 1JF5A 3QXBA 1R38A 4V28A 1LBMA 1W8SA 4YIWA 4LAXA 1UR4A 3EWWA 5LIXX 1Q66A 3VK5A 1TPEA 2FVKA 5JMUA 1E44A 4XISA 1A47A 2F2DA 2RDXA 5CGQA 2TYSA 2W67A 1JCNA 4ASTA 2YOCA 3A4AA 3TOPA 1D3HA 3E3HA 2G3IA 1FHDA 5EMUA 2GUUA 4P7OA 3R5EA 2YDQA 1KO0A 2OZ0A 2VHLA 4X2PA 1SZEA 4DWDA 3B9DA 1WQ5A 1KXTA 4PC8A 2A79A 5G4EA 3LB0A 2YBUA 1RR2A 4PUJA 4E5TA 4GD0A 5C7HA 2FGBA 3TE9A 3NZRA 2WMIA 3AHZA 3EBVA 2D0HA 3U7BA 1E1CA 3H2MA 4WSJA 2FKEA 3TC5A 3KTXA 1DJYA 4UTLA 1EXPA 3T6CA 1REQB 2EPLX 4X9SA 2QR6A 1TPFA 4ZA0A 3TQPA 5D30A 4ZPWR 5I06A 3OVQA 1XH1A 2DVXA 3FDKA 4JPGA 4TYOA 2O9RA 2ZVIA 1O5KA 2UWFA 2HNHA 4DJFC 3G3MA 4BQ5A 3GG7A 3UJ2A 1V3KA 3HJZA 1IWPA 1GK8A 1V6WA 5KSWA 1ZAHA 3ZT6A 2P4VA 3GHRA 2X7VA 3QV9A 3WF1A 1QI5A 1L2UA 1W1TA 4NX0A 4PUEA 1ONEA 1HKIA 3GXPA 5D9MA 3AWNA 5DY3A 3TLLA 4QTGA 4F2TA 3IVUA 3P14A 3SCOA 1PX4A 2FAPA 1OIMA 1R30A 1CXHA 1I2NA 4EXQA 2CBJA 3I7RA 4ODOA 5D8ZA 3O5MA 3RPDA 4B5WA 1ISYA 3I68A 2AMXA 1W8GA 3VZZA 3PJXA 4O16A 1UP2A 4KMQA 3T05A 4E8CA 3DUGA 5LA1A 4IIGA 5H8MA 4D9PA 1G4SA 1CECA 1H7OA 3EX2A 2A7RA 1TRDA 2FPVA 1OFRA 4C6JA 4PODA 3LHTA 3F7JA 3PPGA 2ZICA 2H9AB 4IM4A 2NXHA 3GAYA 3RCYA 3N2BA 2CLKA 3VE9A 3W87A 5IFTA 1JYXA 1J4IA 2OODA 3OP2A 4W8LA 4EF9A 3B97A 2AL2A 9CGTA 3GBEA 1PJ9A 3V35A 4HNNA 3T78A 3VX1A 1ZCOA 2ETNA 3LRKA 5E6ZA 1LLWA 5EKYA 5E5CA 4HQVA 1KLYA 3SCVA 4ZTYA 4RK8A 2H90A 3TUUA 2MANA 1G4PA 5LNWA 3WQ4A 4HMNA 4KRUA 2XFFA 3P61A 4F9DA 4M0XA 4ZE4A 2IPWA 4JEQA 4LYRA 3D3AA 4U4MA 5C7VA 2EPNA 3VUPA 2MLYA 1VR6A 3FVMA 1UWQA 1EYEA 3GLCA 4FLQA 2C1IA 4B9ZA 4LUTA 5JBDA 4GGQA 3SY1A 5I0DA 3MV11 5DXXA 1P5BA 3IGHX 4LNCA 3RMEA 2GWGA 3TSBA 3OHMB 4HPXA 2NT1A 3UI4A 3WQVA 2TAAA 3DOPA 3RLVA 4LT9A 3B4YA 2FH8A 3NPWA 1H0GA 1LLZA 2DVTA 1E3XA 4Z2HA 2PWHA 3T9PA 5D2YA 4PMXA 4DI8A 1JDEA 5I02A 4ZBCA 2GDUA 4W9QA 2XIOA 3SO7A 3CIWA 3SUVA 2C15A 1A3WA 1ISXA 4ICMA 4AVNA 4AIBA 5HPCA 4RE3A 4DJFD 3CB3A 3M4HA 3T0BA 3DGBA 2F9RA 3AHXA 1FKBA 4PMYA 2VQUA 4ZO6A 2WB5A 5HNNA 1C8VA 2PDYA 3LTSA 3MYOA 4LYQA 1R6WA 2Z2UA 2HJPA 4PUNA 4XO6A 4DRIA 2C71A 4AH7A 1WO2A 2MNTA 1GJWA 3T09A 1PPIA 3AJ7A 5LYRA 2RURA 3FEMA 1RSCA 3II1A 3P5ZA 4J3XA 3VIGA 2X7WA 5CGTA 3WQFA 2Z26A 3GM8A 4Z2JA 3N19B 2PGFA 3H26A 3UCDA 1OJXA 3BPWA 1GOWA 4CU8A 2GUYA 4NXKA 4I9MA 3R12A 1X98A 2VKZG 2OWCA 2Y7FA 3GXDA 5HW7A 2V3DA 3R43A 3BMBA 3GWQA 3W28A 4QAIA 1YYAA 1UPMB 4J3VA 3LBCA 3BGJA 1OD0A 6ENLA 5J6EA 1EH9A 3GDRA 3XIMA 3F5LA 4HGXA 1NH6A 3NJ3A 3AIWA 4IQ2A 1FJDA 5FCZA 4JQAA 3VCNA 1PINA 4DZHA 3N6HA 1ITXA 3CL8A 2ZCGA 1JXKA 1GPFA 3M5YA 3H4GA 1HTIA 3T4CA 1MW0A 5JXQA 1CBGA 3CIVA 5T9BG 4W8AA 1DJQA 2ZZ2A 1Q6DA 4KT2A 1Q7MA 4A8IA 2YIHA 2HPMA 5HW8A 2X40A 2O92A 3K13A 2ZYFA 2YW3A 4O10A 1OIFA 4MY9A 2OVLA 4ZOAA 4PULA 4Q6XA 1DIKA 3O5PA 3DAQA 5I07A 3FX4A 3RLGA 3GAKA 4Y6GA 2GGGA 1HZYA 1LOLA 1PDYA 3KBMA 1C93A 4CD7A 4TO8A 1EQ3A 1VLWA 2FHFA 2EJ1A 4O1DA 1H7RA 4E4FA 3UESA 4GJ1A 3TFXA 3UWQA 3EPMA 3EA3A 4MM1A 4QHRA 3QYQA 2UY4A 3CTTA 3VD9A 3BK0A 1A0EA 1V77A 4KCUA 3NDZA 3AZTA 3MHGA 3PWIA 3KDOA 4P8XA 1ONWA 4ZODA 2OEJA 1ZQ5A 5HMDA 2WVSA 4MVAA 3HPZA 4H8NA 4O50A 1XSIA 4M24A 4R27A 3VMPA 4O4VA 3EXRA 1KWKA 1T41A 1XBXA 3M47A 3SAZA 3G0XA 2NWRA 4DF1A 3CHDA 4FX8A 5LNVA 3AMKA 2YR1A 4CCZA 1GQLA 2VDIA 4JQ2A 1DQWA 3GR7A 1FWGC 1Z48A 2WSPA 3NDOA 2WKGA 1ZCNA 4LC8A 4MKSA 4QRNA 2GL5A 1D7KA 3LM3A 3STFA 4PCNA 3MUCA 3AXKA 2BG5A 3VI2A 1YBQA 2PZNA 3WY1A 2PS2A 4RJEA 3CZEA 3QZAA 2YJQA 4O12A 4PB5A 2ITKA 4H8UA 3Q4DA 3VIOA 2VRJA 4NXSA 3E6EA 1RALA 2QVNA 2IXVA 4O15A 4J5NA 1KW1A 1TWZA 1L6GA 4WSHA 4GMEA 2BVWA 4HPGA 3HOJA 3NO1A 4INFA 2EBNA 2ICSA 3PZVA 1J2BA 4MFEA 2P88A 4JR5A 4IUGA 3UG4A 4P5UA 1K8CA 1OG6A 1AVAA 1CGXA 3UNTA 5I09A 1DP0A 4I6KA 2ZRVA 1F9CA 3A6OA 3LD5A 1YTDA 4NILA 3VC5A 1US0A 1F5ZA 1XRSA 5HBFA 2BY3A 3U2ZA 1LBFA 3DYMA 5BZAA 1AMYA 2DZBA 2ZUSA 4JTSA 4UQDA 5GJPA 4BK9A 1K7FA 3AHVA 3PTQA 4ERAA 1B3OA 1WUEA 3W9ZA 4L7ZA 1M53A 3LHWA 3TXVA 3WBAA 1GKPA 3OVRA 3EYPA 3H9RB 1HT6A 2VEPA 2ZZ1A 4W84A 1HVQA 1KKOA 1QT1A 3EXTA 3VC6A 5BXPA 1OM0A 4C7DA 1N8FA 2E9MA 4QG8A 4JCMA 1IZCA 4KRZA 5JH1A 1CLXA 4FEZA 1D3GA 4GXWA 5DQPA 1E1FA 4GISA 4A8NA 3NL2A 2NT0A 5A6AA 3R89A 4TW6A 1VHNA 1ECQA 3N2MA 3OLDA 3VD7A 1QPNA 4LVAA 4Y8EA 2Z0IA 2I5QA 1HJUA 3THCA 2J7DA 3VNLA 3W74A 4LOCA 4LAWA 3NQMA 4E4UA 1C8YA 3W1PA 2ZRZA 1OCBA 2G0WA 3QLDA 1FWIC 3WEMA 3TMLA 4TMCA 5EMLA 3S5NA 1UQZA 1NOUA 2HVOA 4M29A 3VGGA 3WO8A 3SECA 3W3OA 1G1YA 1D7FA 1JPKA 5A6MA 4RDVA 3ZJ6A 3KADA 4TUFA 4PBGA 3TCSA 4YYCA 2ZXBA 1OT2A 4MWAC 3R79A 4Q8PA 2FPTA 3DCPA 4YVVA 1XJBA 1H7NA 2WXDM 2HCVA 1V0LA 1FWJC 1UA7A 4IJRA 2WQDA 4LQ1A 4UB9A 3S5OA 4QE5A 1XD0A 2X2YA 2YBVA 3F4WA 2D3NA 3O5OA 1GWJA 2JIWA 3HQPA 4NAEA 1ZAJA 2QAFA 1W26A 2CZFA 3GR4A 4AWEA 1VPYA 2WZIA 4LNYA 4B91A 5HMSA 1JUBA 3OB8A 4CQCA 2YYTA 1QPRA 4ZGYA 1H50A 1QHOA 3EA2A 5HTGA 4JBRA 3DFTA 2BFGA 4HNCA 9XIAA 1FUYA 1C9HA 4MJ2A 3LUTA 4DRKA 1I0BA 1VENA 4WDWA 1QOPA 4DI9A 4UTKA 3LV5A 3C2EA 3JVAA 1GVRA 1G7UA 2X0HA 1JR1A 1KR0A 1M7PA 1JAEA 3SUTA 1SGJA 2KX9A 2XH2A 2FFCA 5ECVA 1AG1O 2A3LA 4A3YA 1W54A 2L5HA 5BRBA 2WHLA 2VQTA 3RRAA 3EGJA 5K9DA 4LYPA 5K9CA 4AFYA 3EZ4A 3CEPA 5CZJA 4AD4A 2DUZA 3SY8A 1IEWA 4QR6A 3CK5A 4AVFA 4UOZA 2FMNA 5DXYA 3SCNA 2E40A 1SW0A 2WNZA 2OMAA 2ZWZA 1VLIA 4IIHA 1DBTA 1RJRA 2QAPA 3WZ0E 3VZXA 5DCBA 3S4TA 3QMTA 1PYMA 1EC9A 2VN1A 1A5AA 4RR4A 1RBOB 1C9DA 3BLEA 1ZGDA 3WFLA 5HMFA 1VIWA 4NAFA 4AC7C 3L4VA 1WAUA 1VEOA 1GOQA 2MUCA 5I3KA 4IT6A 3A9BA 4AD5A 2AGTA 3WBEA 4MJ4A 3HPXA 1WAWA 1RVKA 3K8MA 1OF8A 2GJXB 1SO6A 4LAUA 5BXJA 2CCRA 4TVDA 1AL8A 3TJIA 1XFBA 3RCNA 1TPH1 1UMYA 3G18A 3WF2A 3RCMA 2Z2BA 3BGAA 3OYXA 1R3QA 5DMNA 1FH7A 3ATYA 4JTGA 3WL1A 1OFEA 3TLQA 3GVGA 3I3DA 5I5RA 3H4XA 2R6OA 2BHUA 2OU4A 1FOBA 1VCFA 3W01A 1KFEA 1YBQB 1UWRA 3CIXA 3L66A 4PR4A 3IIZA 4AD0A 1XRVA 2LLEA 1KBJA 3EB2A 1TQJA 1PKNA 1R7AA 3NGJA 2GUBA 4HBOA 1OZQA 2OXNA 4OOUA 2XH4A 1NMWA 3IJ6A 1XFCA 1DJWA 3BV7A 1AD1A 1CXEA 3VNZA 2IKIA 3HZ3A 4D6IA 5KEZA 4DUXA 3APYA 3RFAA 2ZRWA 3UG5A 4ZTXA 4PMDA 1QUMA 2NZLA 5PTDA 4MKNA 1MUWA 1P0DA 1CW2A 3UZZA 5A1AA 2D24A 1BG9A 4L4PA 4LX4A 1P1XA 1BSIA 2PBCA 1PVNA 1TELA 1G4TA 1GKQA 4AXKA 3HBLA 2J79A 1OHLA 1M1BA 4NZFA 1H51A 3TW6A 4DJDD 4AUBA 4OWGA 1ZBVA 2DT3A 3M0IA 3UA4A 4XZMX 3WYZA 2YZ5A 3WLOA 4GXMA 4DRQA 5BOFA 4XAPA 4RDWA 3KZ7A 4IQJA 2Z1XA 3GTXA 3UR2A 2QUUA 1ZALA 5C2XA 4CEUC 3NEVA 5F7UA 4DRSA 2J7EA 1PB0A 3S9ZA 1K9TA 5F1UA 1F8AB 3LCXA 5AHMA 4R0XA 1V02E 1W37A 4LALA 1Q4WA 3GYEA 3NO5A 3W00A 1EIBA 1VYPX 1UG6A 2Z4GA 4CD4A 1TREA 2J7CA 5IRPA 4JN6A 5HUOA 3O6CA 3MW7A 4JYFA 4AEFA 4FNRA 2PC4A 5CAHA 2OGJA 5A95A 3PZOA 4UR9A 1UKQA 2XH0A 4GE8A 5I3FA 2GVJA 1SJCA 3KRUA 3OODA 4O0KA 1KKRA 3VOJA 4XAZA 4QNWA 5F2LA 2PDQA 3NQFA 4TVUA 3DKJA 1M6JA 1E72M 3U2EA 2YZRA 4RDYA 4TQTA 3ARTA 4LAZA 3AYSA 3MVTA 3KCLA 3WMBA 1F6PA 1KTNA 1CWYA 1TPC1 4XKYB 4GIRA 4U5IA 2G41A 2YCEA 2Y6ZA 2VEIA 3IUHA 4JXCA 3W1QA 4UDMA 3QY7A 1KM2A 3CYJA 4GIAA 3B40A 1LL6A 1L6SA 1D6OA 4L72B 3HIJA 3B0PA 1YDNA 1SZGA 2GGJA 1QO2A 4QLJA 3UQIA 4AZ7A 2NW0A 3QN3A 3ATZA 1PCKA 4R7JA 3QBUA 1IIHA 5EL1A 5AYIA 3WK0A 3ZXWA 2B5UB 4UC5A 2N87A 4WD0A 4L1GA 2NQ5A 3ALFA 3KTCA 5A2AA 2WZMA 3QVQA 3MO4A 1VPXA 4C6MA 1EL3A 2VCAA 3KW3A 3IRDA 5TNVA 3WNKA 1EZ2A 2XU2A 3POCA 2D0FA 3KL5A 3KVJA 3W7PA 1RPXA 1V6XA 3O5EA 1JQVA 4EP8C 3VZYA 3U7VA 2PN0A 1XYBA 2XZ9A 3OGRA 5TQLA 3LLFA 4R7OA 5AN7A 1R9HA 3W1LA 5CPOA 1ELSA 3Q2DA 3UZYA 3VOFA 3VFLA 5JVLA 3C4UA 5DLCA 1DJNA 3LPPA 5HINA 4G9PA 1RUSA 4WY0F 2J13A 3QV8A 4UTWC 3V1HA 1LM1A 3SQLA 3RO6A 4NU7A 5AOUA 1S1RA 2OZ3A 1I0DA 1SVDA 3VVGA 3LHVA 2CU0A 3A23A 1X6NA 3W2NA 1K9EA 3NXFA 1MUMA 3UXIA 3B8TA 1AFSA 1V79A 3A13A 3DI1A 4W7WA 2X05A 1LROA 2ZA3A 1XLDA 1AH0A 1ZP3A 3TCZA 4GY7A 3TYBA 3DFHA 2NUWA 4B5UA 2GWNA 1B6CA 3FLUA 3T2OA 4RPPA 3EKZA 3V0SA 2GQ3A 2LGOA 4AD2A 1X7IA 3C0SA 2EULA 3A3HA 3Q37A 3K1DA 3IACA 3MWCA 3R6IA 1TWDA 2BOEX 5CPSA 4NF7A 1F8IA 3HG2A 3LXAA 5LXEA 3L5AA 5CQ1A 3WEOA 4PEKA 3OG3A 1QATA 4UNIA 5G2IA 2V5CA 3O8AA 1TV2A 1SFTA 1MNZA 4HYVA 1CB7B 4YWIA 3BMWA 3TYDA 4GVGA 3W83A 5A94A 3H53A 4RE4A 3N4EA 5A8OA 1KM1A 4NJHA 4LCSA 3FA3A 4HB7A 3W7LA 2ZFAA 4OBSA 3VOIA 1XIMA 2I57A 4M81A 1G0CA 4WOZA 4W9TA 4QBXA 5TAOA 1MVYA 3B9AA 1HIZA 4MZ8A 5J04A 3GXTA 4Y96A 1IXOA 4R9XA 3M0KA 2NVCA 1UZDA 2J27A 1UD4A 2ZDSA 4HPNA 5HJXA 1YXYA 4B5NA 1V51A 4O19A 1H7XA 4L9YA 4ZFMA 2NV9A 1XH2A 4UCGA 5H8UA 2OLHA 3H2NA 1O5XA 4FA3A 4DWSD 2BASA 4J35A 2XHYA 1Q6IA 1UZ1A 4KFPA 4M19A 4HSNA 1YNQA 2WM0A 4U33A 4IP7A 1EQCA 3WH0A 1XLAA 5BMWA 2IS7A 3PVFA 3U57A 2Q09A 3EOLA 2Q8XA 5FACA 1A7XA 2XP7A 1J6YA 1GOMA 2RDWA 4FIQA 3N6JA 1FWFC 4D6CA 5KZDA 1QNPA 4RNIA 5E0CA 1GRJA 4NZJA 3R8RA 3QEZA 1S5TA 1OD8A 4Y7EA 2HE8A 5D09A 3O0KA 2E3ZA 1WDWA 1NDWA 5EBUA 3P80A 1DQXA 4MZ1A 3ISIX 2VFDA 2Z6IA 3WK1A 2PDCA 1O6IA 1X1NA 4JNMA 2PRMA 1W91A 1B3YA 4JS3A 4Q4OA 3NSNA 1DXEA 5I7GA 2DSVA 1TPVA 4YWSA 2ZTKA 2WHJA 1FKSA 1A5NC 4H7VA 1AJZA 3EWXA 3C0QA 4ODKA 2WZHA 2GK1B 4C5ZA 2G8ZA 3LG3A 2WQPA 3GHSA 1KV8A 4WGXA 5K7JA 3TQKA 1CXLA 4N4PA 3RILA 4MYXA 1NWTA 4JFMA 1BFNA 1ZUAX 2XFRA 2JEPA 3IAQA 4FXRA 1I2OA 1XCWA 1G6CA 1GZGA 1FHVA 1QCWA 2MLZA 3HN3A 3T08A 2QDEA 2DV0A 3QZEA 2Q3RA 4KFOA 1QPQA 3TROA 3MKVA 3WDRA 2WWDA 4PTNA 2A6LA 2ZUTA 4Q4KA 1X38A 1GJPA 2ZQTA 3XISA 3NEHA 4X61A 2DP3A 4RXFA 3PY2A 4RCXA 1ICQA 1QPLA 1TKKA 3ZZ1A 2XVNA 1I60A 4MLJA 4CNNA 3KL3A 1F7BA 2ZUWA 3KS5A 4F8XA 1EJSC 2VEMA 4K6AA 1D2KA 4LPCA 5ABFB 2A5HA 1XDLA 1HJSA 3OOBA 1R3WA 4IL0A 1KM3A 5AVNA 1QOQA 5AHFA 2OELA 4C6NA 2EAWA 2PLMA 4CCEA 5AZ0A 3WDPP 3B9OA 3TC7A 1PX3A 2VCDA 5I3GA 1NMVA 3GK0A 1KGUA 3LRLA 4AG0A 2ONEA 2PBGA 4TVCA 2BLEA 2PF8A 4QLLA 1HXVA 1R87A 1JZ8A 3S6TA 3QH2A 4K7YA 3OLIA 4LS2A 4GQ0A 4TX9A 1Q5MA 1UIOA 2DEPA 4U84A 3NL6A 3PN8A 4H6EA 3QPEA 1US3A 6CGTA 1X39A 2QULA 4NIRA 4H9MA 4BQ4A 4DRMA 3GRIA 3T1GA 4JYEA 1HJWA 1JCJA 4A8RA 3GB6A 1IEQA 4HMEA 3W7RA 1KB3A 1RA5A 4F9JA 2WBKA 4N0RA 3K8KA 2P50A 1SQ7A 2IXUA 2J66A 2MF9A 2E0PA 3K30A 1LOQA 3WJZA 2Q3OA 3IVTA 4JAWA 1C29A 1LT8A 3WBXA 4M1BA 4RW5A 1O1HA 1KFWA 1E4MM 2XTKA 2VWTA 4GA8A 3NYZA 5BRQA 2XG9A 1SZRA 3TA6A 3ICJA 4MPKA 3RMJA 1H7PA 5I2UA 1U79A 3O5RA 2VI0A 3ABXA 3C56A 1OX4A 1BWLA 3GYCA 4I7VA 3SR7A 3AUOA 2VVNA 4P7QA 2ZA2A 3TYEA 5HATA 3LSBA 3G1RA 2X16A 4L56A 3JU2A 2WJDA 2DT1A 4ODLA 3O5KA 1UWAA 1J9YA 3UF8A 2P76A 2XSXA 2O4QA 2PLJA 5A8NA 2JQXA 5DO8A 1ZLPA 3C0LA 3CUZA 1VFSA 3JS3A 3V3WA 2NXGA 4B15A 2X1UA 1E71M 1HO4A 3OIXA 3FYYA 3KHJA 3STEA 1BQGA 4J9JA 5HJYA 2J9XA 4UTTC 3QGAC 3N15A 3JZEA 4R7WA 1W5OA 2MPHA 4DYKA 1NWSA 4AYGA 2H6RA 1W3TA 1IF2A 4NZ5A 2WCSA 1UKSA 5AHLA 5G2HA 1O1ZA 1TJ2A 3L65A 3LERA 3NQVA 4PCFA 3R4IA 3K8LA 5D38A 1Z44A 5T26A 5DY2A 1T7LA 1MEWA 1EBHA 4V1XA 1BGAA 3TC3A 3CAQA 1Q3NA 1QPKA 4S3GA 5G1YA 5BXTA 3LPOA 3LMYA 3N11A 1FKTA 1E0VA 2DZXA 1L6YA 2DY3A 1R2SA 1GVFA 3KRZA 3OG2A 1VYRA 2XM2A 1XQLA 4RX0A 5JH2A 4TX0A 5KITA 3GDBA 3TFCA 4GINA 4PMVA 4QS5A 4JTIA 3D46A 3PPCA 3JYMA 2FYMA 1R86A 3WDJA 3NO3A 2OQHA 4AAJA 4HYWA 4HBKA 2ACRA 2RFGA 1GVYA 5CC6A 4WKAA 4RV3A 4CQDA 3FN9A 3F2CA 3NI6A 3UNDA 2PODA 1CLVA 4H83A 1S2VA 4JX6A 3PSVA 1MDLA 3S1VA 3KABA 2AL1A 3O07A 4CN1A 4MJZA 3IIVA 4ORMA 2V2HA 4US6A 2PDLA 4IFOA 4P7RA 4AZGA 4JTTA 1SUXA 1XIFA 2Y5JA 2D2GA 1W3NA 4B3LA 4PZVA 4HHPA 4V15A 2F2HA 3B0XA 1SW7A 3DEQA 1J10A 3L4XA 3WJSA 2ZQVA 3OGVA 2DW6A 2WOQA 4J4KA 2PWDA 3LI1A 2EG8A 3BAWA 2W63A 1TUFA 5HMEA 3W2LA 4JNYA 1YXDA 3SZ8A 4UQCA 3VNIA 4D8LA 2PPNA 4GK8A 4TW8A 1W0MA 4YHGA 1JCYA 3W86A 4ZOBA 3IANA 1EP2A 4F79A 1IX5A 3ES7A 4J4NA 3G8RA 3BWWA 4IHCA 1RPKA 1S5NA 2PP3A 5A6JA 4UTMA 3KX6A 4U2ZA 4YXGA 4S3CA 3U0HA 2Z7KA 4D2JA 3MMWA 3UJFA 1EJWC 3KCEA 1V6VA 3NQ2A 4C6DA 4IF2A 4AZ5A 2DZWA 2E25A 2WNNA 3PTDA 5I78A 2VUYA 4LRSA 1S1PA 4ATLA 3OVPA 3CZ8A 3LPGA 5I3DA 3WDHA 3LCFA 2PMQA 4DIAA 4WOQA 2GOKA 4M5PA 4HHMA 4JTLA 2YLLA 1YEYA 3INPA 3PNZA 4P2VA 3UXKA 2XVLA 1XCXA 4DLFA 3UERA 1FWNA 4L4OA 3W72A 2V3FA 1KCXA 4DWSC 4GYFA 3C8FA 3UF9A 1CGVA 1SFSA 1R9YA 4TW7A 3M0ZA 2NSOA 3GW3A 5U7SA 4XUGA 2KGJA 4MY8A 2PDIA 4E4PA 1LZOA 1WUFA 1X1ZA 4YHEA 2J8GA 3BLKA 3KOWA 4A8LA 4CN6A 2DFAA 4JFJA 2QDGA 2Q8LA 3S0CA 1W1YA 5CC7A 1KNWA 2PTXA 1XLHA 4Y2WA 4ZB2A 1AUSL 3UP8A 1OFOA 3F5KA 3UYCA 5JIPA 3OZPA 4JHOA 2WM1A 2AWGA 4Z42C 3PM6A 1S5VA 1LRNA 1XSJA 4C65A 4LCRA 1YW5A 5A6BD 4ZXOA 3LXBA 3O5LA 4ZO8A 3HPAA 4YVXA 1E0XA 2YGYA 3BH4A 5B80A 1SFLA 3UD6A 2F6XA 2E09A 1NFPA 1W6TA 4F0RA 1BKSA 5I03A 2CC0A 3I4EA 5DANA 4H01A 2ISVA 3UZXA 3UWYA 3VDBA 3ITGA 2A3EA 3KTSA 4LB3A 4S38A 4UFIA 3AS1A 4FLSA 1BXBA 3GU0A 5BOOA 1GKRA 3LZ3A 2J47A 4H2HA 9RUBA 2D69A 3THUA 1LUCB 3UU0A 4EAYA 3AALA 4DUWA 1KQZA 2OT1A 5DCDA 3B05A 1NDZA 4AWUA 3STPA 1EQPA 3V0UA 2ZC1A 1TSIA 4BKNA 4EPKA 3MI6A 1VCGA 1EJUC 1XIDA 4K8EA 5AC5A 2ALRA 1ZPTA 2H9AA 3S2CA 1VFHA 4P61A 3W75A 2AQVA 1GYLA 4FR1A 3W1NA 3AU6A 4RUBA 4UQEA 1LWHA 4YTQA 2RAGA 5FF2A 3GTNA 3NQ7A 1EGZA 2WSQA 4NJIA 5FIPA 3C3UA 2PA6A 3NSMA 1KXHA 5D02A 4JTHA 2GJLA 3V0TA 3QGKC 4RV8A 4N19A 2P53A 5TF0A 4XIMA 2GVEA 3CBWA 5G2WA 3VKJA 2DIEA 4LF2A 5E6YA 3BQ5A 2DT0A 3M5VA 1YNPA 1FDJA 4GJIA 3O0FA 2E8YA 1JCXA 4Z2IA 1WDQA 4ZEPA 3L5MA 2XVKA 3EDKA 3VGBA 2Q6ZA 1X1OA 1Z8AA 1XV8A 2X1RA 4D6JA 3LMZA 1K7XA 4PTXA 5IHSA 1T96A 1HL9A 4UTHA 3SUSA 4JTDA 2V3EA 4W5ZA 2CESA 4P8UA 4IMAA 1BF6A 2IQ0A 4E0CA 2ACSA 4WRHA 1I45A 4NRSA 2VTFA 1B1YA 4PCTA 1T11A 3GC2A 1V5XA 4GY1A 3HGRA 4JY9A 1M7XA 2J74A 2OYLA 5F4XA 3QW3A 4JD4A 1JZ6A 2A7NA 3U2OA 3V5CA 3L4WA 2ZR6A 4F0HA 4PTMA 1X8CA 3N29A 4NNCA 3KZPA 2PDKA 3KOXA 2HBXA 4H3DA 1BSLA 4C6IA 4POCA 3IJIA 5F4WA 3W7CA 1F76A 3TCEA 3C2FA 4LTSA 4O2TA 2ZXQA 4IT1A 1OEPA 2QMKA 4JIPA 5IHRA 3L4TA 9XIMA 4JFKA 3TQ0A 1R8LA 1QW9A 3CC1A 3G1YA 3OYZA 4REQA 1H5VA 1MDRA 2F6UA 1VFOA 2IPFA 4JEJA 2CLHA 3FYOA 1Q63A 2X0SA 1NF7A 1ZBWA 5HOSA 4KQZA 2IMRA 1P48A 4LRTA 1FVPA 2A3HA 1ESWA 3G0SA 2NVAA 3BL3A 4LSBA 1DJIA 4LS0A 4MADA 3MUZ1 3S1WA 4GYKA 1W1VA 4NT0A 2WANA 3QTPA 4UR8A 3SQSA 5ABFA 3C5QA 5C71A 1EOKA 1O60A 1KTBA 2OQYA 2IKGA 1RP8A 2E1DA 3LCIA 2VX4A 5K2ZA 4Q8UA 5EU9A 4BI7A 3N4FA 2PV3A 2XH7A 1SO3A 3TSMA 3WH5A 4HVXA 1HXJA 3G1FA 1T40A 1FKFA 4GYPA 1J4RA 5KTLA 5BXSA 3N9SA 3R58A 3NAVA 4TXEA 4BA0A 4AYSA 3QR0A 3VKKA 2BVYA 2VFEA 4XBJA 2VL4A 4FP1A 3DFOA 5D37A 1UW9A 4EE9A 3GVVA 5DBTA 3WLNA 2L2SA 2NX3A 2V2DA 4EX4A 4I5UA 5DT5A 2W4XA 3BGGA 4JZ5A 1POKA 3TTYA 3PZTA 3KVKA 3A4XA 2B0MA 4FOJA 3T42A 1E9YB 2Y8KA 4V27A 3NGFA 4ROQA 2MLXA 2QMJA 1J0HA 2PDXA 4FZIA 2V82A 4B9YA 4ROPA 4ADSA 1ITQA 3F4VA 3V4BA 2QCHA 4GABA 3HG5A 3GU9A 1I9CB 4WXYA 4ZO9A 2F6KA 3E49A 4FS9A 4G2PA 1UR8A 3RM8A 3E38A 2M08A 4PMZA 4I6VA 2NQZA 3NXLA 1EGVA 1H60A 1FDZA 5BRPA 3OQEA 1FWSA 2PTDA 4DO4A 2ACUA 1JDCA 4DYJA 1TVPA 2GGIA 1XDJA 2DIJA 4LWWA 3WQCA 1X8FA 1EZWA 1F3EA 3PS7A 3TN5A 3VXGA 7ENLA 3CL6A 1BTCA 3L0NA 3PUOA 1LT7A 1MXGA 3VUSA 3W7DA 4Q8VA 1JNTA 3MHUA 1Q8JA 1RCOB 1UKTA 1LUCA 1W17A 3AMDA 4NVTA 4KWWA 1B3WA 1W5QA 3BJSA 1NEYA 2DQXA 3T07A 2OYKA 1EJXC 1WCGA 2PURA 3M46A 4MLRA 2P8BA 1RCQA 4IG2A 3CH0A 1VBJA 2D20A 4PMUA 3CHCA 1FCVA 3P84A 1S38A 2YKKA 4U31A 3SW6A 1VBUA 3H21A 1VP5A 1B90A 1JYNA 1Z41A 1KLZA 4OBTA 2PWGA 3T81A 1ZAIA 3BW3A 4U2YA 4DPQA 2QF7A 1SM9A 3EDEA 1JDDA 1QRQA 3LENA 1TMLA 1N82A 3CT7A 2VYOA 3LCLA 4C02B 4GKLA 4NHVA 4NZCA 2HROA 4FNPA 4GUHA 2BGNE 5HK4A 3ITOA 2J7BA 4ZCWA 1XKJA 2OTDA 4ERGA 5AHEA 2NUYA 3NTYA 4GI4A 5IFPA 1MO0A 4J3UA 2NSXA 1OYCA 1MXSA 1BTMA 1I8JA 2YA2A 2QJJA 1BYCA 4XK2A 3F4CA 3RNDA 2GJNA 2WC7A 1KTCA 3BAKA 1EHNA 5HWNA 1TB3A 4DO5A 1J12A 2KAUC 3T8QA 4C6PA 4FLOA 3GTIA 4G8TA 4TTUA 2DQWA 1HKJA 3M0XA 1TMHA 4OUEA 1IT7A 2CPUA 3YPIA 4ZPTR 1W32A 1TX0A 3W88A 3G1AA 4ATWA 4FMVA 4HU8A 3B8VA 4B4FA 4S23A 1NJJA 4XO7A 5A3HA 4HNTA 1PCWA 5C9UA 3ENLA 3BXWA 2YX0A 1VKFA 1K03A 3TONA 2XVPA 4ZS6A 5D2WA 2PTWA 4C6FA 4H7CA 3PUDA 1U5HA 3ODKA 1IEIA 4YTTA 4E8GA 2E6FA 2R1MA 4YPJA 3DFQA 4KWVA 4FX6M 4KCTA 1TJRA 1NVMA 1Q4NX 2C16A 4HHLA 2JGQA 2JIEA 3CZGA 3NNTA 2E6YA 1H11A 3WUBA 4LF1A 4MNLA 1Z32X 2Z27A 3N14A 4IQLA 1QNOA 3CL7A 3L2MA 3KWXA 2IQTA 3SADA 1XYZA 1UBSA 1PTAA 2Y5SA 2J75A 4P7LA 3MO7A 2QF8A 3GVQA 2GFTA 4AMAA 2CNCA 3R10A 1A4LA 3AHTA 1EPVA 1VJIA 2ALDA 1O95A 4JX4A 4MNKA 2Y8UA 4Z2KA 3JZUA 3P8IA 2WHKA 1Z89A 2OX1A 1FWHC 1N7KA 1F73A 3BMXA 3ID7A 5GPRA 1ZJIA 3HGSA 5HNUA 1IE7C 3IHZA 1FH8A 3BAXA 4H9YA 8CGTA 3WG6A 1X7FA 4Z17A 4MSSA 1V3MA 5CLTA 4MTVA 3G8EA 4XKYA 3A47A 3W29A 3SUWA 4UMAA 5C9RA 4WKHA 3W53A 3ZQ9A 4JHMA 2IPJA 1H1NA 5D9OA 1E5NA 2OR2A 3LTPA 4YTSA 3FYPA 5KINA 1AZ2A 1SSDA 3NQ8A 5HQMA 1N2VA 1XICA 1UKPA 4YCPA 4CCCA 2CHNA 4LUTB 4F4RA 2PGRA 3TQVA 3RK8A 2ABBA 1P0KA 1V0MA 2BTMA 3IKDA 1DIDA 2FHBA 1WP6A 3IUIA 1EWEA 8XIAA 2VX5A 2RKXA 1GZJA 2Y78A 2BBFA 3GH7A 1UH3A 1OY0A 3PZGA 3NPUA 4BQ3A 3QY6A 3W27A 2QV5A 2YXOA 7REQB 2G96A 4EF8A 1EX1A 3FV9A 4YN5A 1A5SA 2BZNA 3M0HA 1XLFA 1I1WA 3WCZA 5AZ1A 1SJBA 5ABEA 2M1IA 1LQ0A 3FAPA 2QZRA 2Q01A 2ODOA 4WDTA 3KOYA 3BLDA 4N6EA 3R11A 1TV5A 2CKRA 4J7RA 1FKDA 4J2PA 4JTJA 2XP4A 1GVOA 1X97A 3PG9A 2J6VA 3VX0A 1S5MA 5LA2A 5I77A 2QYGA 1TFVA 1FWTA 4IPXA 4A6GA 2HK1A 4D1JA 2OSXA 3WMSA 4IXHA 3MSYA 2ISWA 5EYWA 4UTTA 1XG3A 3P8JA 3MMTA 3PWGA 3E2QA 3DKLA 4CD5A 3PK7A 4M6VA 1R47A 4BF9A 4ZQPA 1GJUA 4BY3A 1AH3A 1DIEA 5G5IA 1V8EA 3LU2A 1ZHAA 3FJLA 4A4AA 3ITVA 1Q6EA 1ZU8A 3B8SA 2HRWA 1JFHA 4I9JA 4W7VA 1PIIA 1LQ2A 2M2AA 4S2CA 2ZXDA 1MNSA 1IEXA 1EO7A 4E2BA 3MHFA 1QMLA 4IL2A 3HPSA 5HDRA 4QEEA 4PYSA 3QYSA 4WF7A 2NV1A 4LBSA 5D03A 1W5PA 2V69A 2EPHA 4US5A 2Q8ZA 1JJKA 1QBBA 4JIHA 1DXFA 2PU0A 3W2KA 2V2CA 5C5YA 1S39A 5LGXA 4JFSA 4R5EA 1Q6RA 1EA0A 2NXIA 2F8QA 2XM1A 2Y61A 2Y1HA 4E2DA 2CYGA 3HM7A 1QO5A 1F61A 2QJHA 4IPLA 4UNKA 4M1RA 1HP4A 4M82A 3WF0A 4Z0SA 3A64A 3GVWA 1U5JA 1YKWA 1W9XA 1CPUA 2TSYA 4H00A 2GDQA 3VIIA 1GVQA 4IQEA 4IOTA 4IP5A 2VGFA 1DJXA 5D04C 4NASA 3W1MA 2HV5A 4GNKB 1ZK6A 3PP7A 2INFA 2VFHA 4A2RA 4C6QA 1EGMA 1KBKA 3GFYA 4WX2A 2VURA 2AQWA 1Q6QA 1FAPA 3M0MA 3S3GA 4CNSA 1BYAA 3BVJA 3BG3A 2XWDA 2OLAA 2ZRXA 2HXUA 3CM4A 1WX0A 1TR9A 1VBHA 4BF5A 3GTYX 4O13A 1LCOA 1XYLA 3UCCA 4PL1A 1QFEA 3E5BA 3KLLA 1PBKA 4Q8OA 1XPGA 1C7SA 4IUOA 3SJ3A 4HOWA 1DJHA 4NAEB 3VGDA 1E1CB 2Y85A 1YE6A 3CQ0A 2WMIB 2ZQSA 4HCHA 1DWAM 4QGCA 1QOXA 3PJTA 5K4XA 1KM6A 1PDZA 3OA5A 3TA9A 1F07A 4ACZB 1OX4B 2DZTA 1V03A 1FKIA 3S42A 4DLMA 2EKCA 4JDBA 3C3NA 2G5WA 3E2SA 4QROA 4OE7A 2D1ZA 4Q7NA 1ZZMA 5AC7A 4PTWA 3TU9A 3FA5A 3OBKA 2OSWA 3TWAA 2SFPA 1U33A 2G3FA 2C79A 3VTRA 4QCEA 5FEXA 1VEPA 3PZIA 4FNQA 3GR8A 3VNDA 1SO5A 4GIYA 3VCRA 4L1WA 2P10A 3B0UX 4IMFA 4HNUA 3QQWA 4KBXA 1R3SA 4B4HA 3WJYA 3CWOX 2X1TA 3RX2A 1ZP4A 1XUZA 1VC4A 3LV6A 3QGVA 4DBUA 4M6UA 2WBGA 3UR7A 3KP0A 4ZXLA 1DIOA 5A69A 3KAHA 3MUIA 2J9ZA 2OO6A 3SM0A 1ZS2A 2FZBA 2QHAA 3FOKA 1KRCC 2VGGA 2F2KA 4U28A 4HU4A 4GUIA 4G50A 1K4GA 3PFRA 3CZLA 4QM1A 2GLKA 2VC6A 3N12A 7TIMA 5ABTA 1HP5A 4GLEA 3LCGA 3EOUA 3LHZA 5E9XA 3TX9A 3URAA 3RJYA 5LGZA 3TEVA 1E9ZB 3KUMA 4L4LA 5CAKA 1B3ZA 2C14A 1I2RA 3H2OA 2F38A 2PGWA 1JPIA 1FWDC 3ITCA 3VYLA 2QW5A 5I79A 4ZOCA 1GQJA 1JZ5A 4C1KA 3AU2A 3HQNA 1B5TA 4ACZA 1DORA 1DE5A 1OFAA 1QXLA 3HG3A 4ZOEA 5E9AA 5GJMA 3P5YA 1GONA 4LBUA 3GFZA 1TV4A 1NY1A 3WF3A 1OZMA 3SCUA 3SJNA 1Q45A 4HD5A 3O6YX 3CB8A 4RXGA 3GHTA 3KXQA 1QVBA 1QNVA 4BJHA 2ATMA 4ACYA 2QPXA 3V18A 1M7JA 2PV2A 4ADTA 4O18A 2GOUA 3PA7A 1Z69A 2V38A 2PU1A 3NZPA 1Z42A 3AIRA 1MZRA 1KCZA 3ITYA 5EGRA 1Y65A 2GVGA 1J0KA 2OZTA 4Y9NA 4DM2A 2OOFA 4RW3A 3HQOA 3W7HA 2Y0FA 1FXPA 3MZNA 3R8HA 4UFMA 1BLIA 3MT1A 3I7QA 2HS6A 2V5LA 4NNAA 4AEOA