1LGBC

Interaction of a legume lectin with the n2 fragment of human lactotransferrin or with the isolated biantennary glycopeptide: role of the fucose moiety
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
159
structure length
159
Chain Sequence
HYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLKDGAGDVAFIRESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of a legume lectin complexed with the human lactotransferrin N2 fragment, and with an isolated biantennary glycopeptide: role of the fucose moiety.
pubmed doi rcsb
molecule tags Complex(lectin/transferrin)
molecule keywords LEGUME ISOLECTIN II (ALPHA CHAIN)
total genus 40
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 1994-01-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1lgbC00
4EF1A 1DMBA 3RTFB 2QJEA 4O3BA 3SEUA 5DYHA 3GZGA 1MH3A 1TT1A 4G68A 5AA4B 4Z0IA 3JZJA 2G93A 4R9GA 3TEPA 2F34A 1US4A 3GXAA 3MZ9A 4ISUA 4C1UA 3DP6A 2XXYA 5B7DA 2H4IA 5CM6A 1GVCA 5I56A 1XT8A 3PPRA 4LATA 5I84A 1N84A 1R9LA 1UTHA 3K0VA 1IXIA 4OESA 4QSCA 4BDQA 4F29A 4F1VA 5CRYA 4LZ5A 1VR5A 3O6GA 4OFJA 3IB1A 4THIA 1MQJA 4RK9A 3VXCA 4MBPA 3ZS6A 4NF5A 3VVFA 1B51A 2ZYMA 1PEBA 2F5XA 4QSEA 4KFQA 4OQOA 3U72A 1EZPA 1UIUA 1B5IA 1IQ7A 3CIJA 4OENA 1TWYA 2RF1A 1MPBA 3A3UA 3IR1A 4OXVA 1M5BA 2GRVA 1VE4A 1JEVA 3CFLA 5ITOA 3TKDA 3TELA 2F7BA 4FEBA 3VVEA 4KI0E 3LC8A 3AXFA 1USYH 2CMOA 5CMCA 2I0BA 4BDLA 5ICTA 2F78A 2DQVA 4EQ7A 4Q30B 1R9QA 2ZNUA 5CMBA 5H8HA 5I57A 1ZTYA 2VP1A 3G3JA 3OSQA 2AIXA 1B1XA 1TFAA 3L6HA 4IO4A 1J1NA 4RY1A 3BKIB 5DTBA 5TPAB 3TTNA 4IO7A 3MPKA 3C33A 1NNKA 5CI5A 1B4HA 2RC9A 1JW4A 2E1SA 3Q28A 3Q26A 2HEUA 5H8NA 2HZLA 5BUUA 5H8FA 5EYFA 3QAXA 2XHDA 2A5TA 1US5A 3KEIA 1EZOA 1IXHA 3MVYA 4WEDA 4ELQA 4F3GA 2ZYNA 4H5GA 4F22A 2XX7A 1HSEA 3RN8A 1MY4A 2UVJA 2RCAA 3K4UA 1ZLQA 5DT6A 1M5FA 4QHQA 1KWHA 2YPNA 3UA8A 2Y7WA 1AH5A 4H6DA 5J1DA 1LB8A 2M8CA 3U93A 3VE1B 5ICQA 1R6ZA 2XX8A 3S2VA 3FVOA 2XD2A 1II5A 3FIRA 3FJ7A 1H3DA 1NL5A 1QULA 3FJGA 3OSRA 4LZ7A 4R73A 2H5YA 1ZKBA 2BJJX 3ZKLA 5CMKA 3HPIA 5I59B 4U1ZA 1LB9A 3UN6A 1B05A 3DLNA 3IOWA 4MLQA 4BDNA 4N6PA 4FAJA 1H76A 3OEMA 2ONRA 5EHSA 1QUKA 4TOZA 4F18A 3HCQA 1UIVA 2DS9A 3O66A 1OQGA 1POTA 4KHZE 1IIWA 1FTJA 5TP9B 2GFEA 1LAGE 1JEUA 2Q2CA 4TLMB 1NH8A 3K6UA 1LBBA 4RYAA 5ELVA 2Q8JA 3SESA 1SW2A 1YPNA 4F19A 3S9MC 3PMXA 5AA1A 4PQJA 3IOVA 4FECA 4DXUA 2F35A 3CRBA 1AL3A 3DELB 4U23A 1P99A 5FHMA 5AA2A 5AA2D 2B65A 1MDP1 2XXUA 2THIA 3R6UA 4PETA 4G4PA 1FTMA 1N7XA 4QSDA 4R72A 3TTMA 4FATA 1H43A 4I8CA 3MVZA 1EZ9A 1HSJA 2X7QA 3IB2A 3PPPA 4YICA 4ZE9A 2VHAA 5FTIA 3EQ1A 4YMAA 4OEVA 2ZNTA 3C32A 3G3KA 4IO6A 4JWYA 1D3KA 3ECRA 4F39A 3OO7A 3B6WA 3O6IA 4JBZA 2V3TA 3JYRA 1B40A 3PPNA 4IO5A 1B52A 1NKXA 3MBPA 1RKMA 2F97A 4ND9A 1FTOA 3CI8A 2HZKA 3K2DA 5I2NB 3A3CA 3TTLA 4GLIA 1O64A 1QUIA 1N76A 2E0SA 4MLVA 4NF8B 4OERA 1UTBB 4X9TA 4BDOA 5H8QA 4Q8RA 1URGA 3USDA 3H4ZA 4AB5A 1NNFA 4FORA 4GF8A 2XXQA 5I2KB 4Z7EA 3FASA 4HCYA 5ITPA 1B3FA 3KJTA 4G8HA 4PFTA 3PUVE 2V84A 2DP8A 1GR2A 3SEXA 5AA3A 3ILTB 4PFUA 1SBPA 1B0HA 1GGGA 1AMFA 3UP9A 2DOJA 4JDFA 3CG3A 1EU8A 4ECFA 4DZ1A 1SYHA 3H6UA 1A40A 4QFKA 2B3FA 1JW1A 2HFBA 3LR1A 4NF6B 2Z8DA 2ZMBA 3IK6B 3W15C 2DVCA 4EQ9A 2Y7KA 2P1SA 5JTYA 3K01A 2FYIA 1LLSA 3OO9A 5L9OA 4OEUA 5JTYB 1YAEA 3UGWA 4OETA 1TFDA 2O7UA 4NF6A 2NWJA 4P0IA 1XC1A 4XTCQ 2X7PA 2Q9TA 2O68A 3HHFA 4RA1A 1OVBA 4YKKA 4EDPA 2AL5A 2B3BA 1LGBC 2XXHA 3PUZE 4QRZA 4JWOA 5F7VA 5B70A 4LQ2A 2V93A 4GL8A 1B32A 4U2RA 1S50A 5CBSA 2QS3A 2ZYKA 4F1UA 4H0WA 4DCYA 3OO8A 2DXYA 2QS4A 1XS5A 1MH4A 1B7UA 3C9HA 3CFZA 3Q27A 4I9DA 2R9JA 3TAJA 1WVJA 5H8QB 5H8SA 4GD5A 4NF8A 2Q88A 4O3CA 3UORA 1MXXA 2ANJA 2ESNA 2XXTA 3VVDA 4ELPA 5I2NA 2OWTA 1CE2A 1LAFE 2O69A 3BBRA 2NUVA 3M3LA 3P7IA 3VFJA 1OMPA 2F7CA 3H7MA 4YKPA 4ZEDA 2ZNSA 2XD3A 1MQGA 1P1NA 3SERA 4R6YA 3TTRA 3U8QA 3B6QA 4GFRA 3M8UA 4JXIA 3VV5A 1FQBA 1SYIA 2DXRA 4Q0CA 4HS7A 3VLVA 4YMBA 4R9FA 3KGCA 2QS1A 4BDMA 3OELA 4NE4A 3U94A 2R71A 2REGA 1DTZA 3Q29A 3QK6A 1VFDA 1Y1ZA 2RCBA 3UIFA 3EHUA 2V25A 2I0CA 1B58A 3O28A 3TFLA 3SETA 1N0TA 3SEWA 2F6GA 5DVIA 1FTKA 2QSXA 4MF3A 4GVOA 4LP2B 3K1NA 4ZE8A 2I3WA 1FQDA 1DPPA 2ABHA 4U4SA 5L8DA 3T9UA 4H65A 4EQBA 5TP9A 2PBWA 2GH9A 4X48A 4DXBA 1MG1A 5I2KA 2G29A 1B3EA 1XVYA 3K6XA 3MVWA 3W9WA 5K2YA 5L9MA 2PT1A 3RQTA 1ANFA 2QPQA 1B2HA 1M5CA 1MDQA 2YJPA 3GBAA 4GWOA 1UTBA 1EH3A 3C34A 3KBRA 3LSXA 5FHNA 1M5DA 3KSXA 1BIYA 3TQWA 3TPAA 2O51A 5HPQA 2WKYA 3MP1A 3E13X 1MS7A 3FATA 3IX1A 2QMXA 4LA9A 4QFNA 4GXAA 2F7AA 1A8FA 4OFLA 4WEPA 2XXWA 3T66A 2ALUA 3IOTA 2O1MA 2AL4A 2IEEA 2XX9A 1BTJA 3TCHA 3CSGA 3H6TA 3FVNA 4ZECA 4LVQA 4IB2A 3IL1B 1LCTA 2UVHA 3FXUA 3CR9A 4GXSB 3SEYA 2PX1A 3EN3A 4WKMA 4R6HA 4DCXA 1B0LA 1N3WA 4JSOA 4ESWA 1PC3A 3GLBA 3RT6B 4EXKA 3QIMA 3RPWA 4YB6A 3H6VA 3LBSA 4GL0A 1B5JA 2A5TB 1F9BA 1Y9UA 4JB7A 3TYHA 5AA2B 3IJXB 3TCFA 3L6GA 2UYFA 1I6AA 2Q89A 3T93B 2O1LA 5KZTA 4LZ8A 4F2OA 3PPOA 3FGSA 5HBCA 3T9HB 4ESXA 4KYDA 2RC8A 1P1UA 3IOUA 3HO7A 1MXYA 4KR5A 4K3FA 1N04A 3KFMA 3PUWE 2O84X 1LAXA 3R26A 1B3HA 2QS2A 1PB7A 4KCCA 3TTKA 2DE4A 2F36A 1ZJLA 2P2AA 3M3KA 4ZZAA 5IKBA 1WDNA 1P1QA 4XXUA 1A99A 3C4MA 4QFOA 1IEJA 1IZ1A 1PDAA 1USYE 2UYEA 1MQDA 3FV2A 3WAFA 5BWJA 3HHGA 3ZSFA 1OLAA 1QJMA 4DXCA 3PPQA 4ZDMA 3MP6A 5I59A 4OWDA 1AIVA 1MM7A 2R6GE 2Y7RA 1IITA 1DSNA 1I69A 2GHBA 2LAOA 2OBGA 2Y7IA 3O6HA 4H67A 4IO3A 4MH5A 4OFOA 4DIGA 5CC2A 4H1XA 2HAVA 4NF5B 3O9PA 4O3AA 2VD2A 1OIBA 3LSLA 1MXWA 3DP8A 3FUZA 4AB6A 4HW8A 2I58A 3T96B 4P0GA 2I49A 4ZEKA 3LUYA 3PMWA 1S7YA 1UTHB 1BP5A 1RYXA 4DE8A 2DWHA 3R7XA 4F31B 4M4GA 3LSFB 2OZZA 3OD7A 3WAEA 5I56B 5IAIA 1POY1 1LFHA 2H9BA 1Y3QA 2OJTA 1B4ZA 3OMBA 5H8FB 3VLUA 5H8NB 1ZIUA 5AA4A 2V3QA 2I6EA 3T9VA 4MFIA 2P0SA 2HXWA 2OWSA 2O7IA 4U1OA 4NMYA 3TDJA 3DM0A 2PMSA 1XHYA 1Y20A 2RINA 2ZXTA 3CFXA 3KN7A 3PV0E 1LFIA 1MPCA 4R74A 2XXRA 4YB7A 3Q25A 4LONB 3K00A 5DEXA 5H8HB 4ZEFA 1B5HA 4U4XA 5TU0A 3FZVA 4KYSA 2O6AA 4IGTA 3ZKKA 3IO4A 3PUYE 3DP4A 4EF2A 4EXLA 1AOVA 1MY3A 1MXZA 4Q5TA 3FVKA 4X1BA 1FCKA 2XXXA 4ZZEA 4U22A 4YZZA 4WXJA 3MC2A 1JQFA 3RGYA 3G3HA 5ISUA 1I6QA 2F6PA 4G8MA 4NTLA 4U21A 3V5AA 3KOSA 4G68C 3V83A 2I4BA 4EUOA 3RLFE 2CZLA 4LUBA 4ZS9A 1JVXA 3EHTA 1JNFA 1YTVA 1LBCA 2A5SA 5I58A 2QL3A 3H6WA 2AYSA 3EHSA 5HM4B 3C31A 1MPDA 1ZU0A 3PGFA 4JWXA 3OO6A 1CB6A 4G8NA 1H45A 3MP8A 5LOMA 1OVTA 1ZMGA 1SD3A 3TUSA 1D9YA 4HTGA 5KCJB 4H8JA 3SEVA 4ZEIA 2VD3A 4N13A 1B7HA 1JVYA 2H98A 1B6HA 1UQWA 3GBBA 3G7WA 3ILUB 1R1NA 3O97A 1B7ZA 4G68B 4I1DA 2D3IA 4OTEA 1B3LA 1Y4CA 3V8XB 1Y3NA 3KSJA 3QUFA 2DWIA 1MRPA 2YLNA 4XKNA 1N7WA 1NH7A 1FW0A 4GIZA 4G2ZA 4N07A 3BFTA 4OZ9A 1IUDA 4F3PA 4NF4B 3CG1A 1Z7NE 1A55A 1MXVA 4GQOA 4ONYA 4XKPA 5CMMA 3FD3A 3I3VA 3PMVA 1VFEA 4NWDA 1IXGA 4YU0A 3OEKA 5DVJA 4E0XA 1YCJA 3KOTA 2Z8FA 2DSFA 1MM6A 1Q35A 4NEDA 2H99A 1JETA 1O7TA 1MY1A 3H06B 1N3XA 2RC7A 3E4RA 3G3FA 3PD9A 4FJPA 3N5LA 1ZBMA 4YAHX 5FTHA 1SVXB 3JV9A 3I6VA 3LSWA 5KDTB 1O63A 1SW4A 4R75A 1OLCA 3C36A 3MWBA 1NFTA 1SW5A 5DEXB 3MAMA 4IGRA 4XIGQ 2UVIA 3IAZA 2VGQA 3QYTA 4FEDA 1SI0A 3RT8A 2OLBA 1QKAA 4BLAA 2Z22A 4DLDA 1FQFA 3OXNA 3FV1A 3N94A 3I5OA 3KZGA 4E0WA 3KN3A 4FIMA 2XXIA 5F1QA 1PB9A 4YKIA 3T22A 4BDRA 3ONMA 5CBRA 1DTGA 3IORA 1PB8A 2XXVA 1QUJA 2W7YA 4OYVA 3QXMA 2V3UA 2Y7PA 4KQPA 2I4CA 2Q2AA 4FE8A 4UA8A 3RUMA 2DYXA 3SKPA 3FXRA 4OHNA 3RTWB 1Z7ME 1DOTA 2GHAA 3E3KA 3M3FA 3O2AA 5EHMA 2IA4A 3MVXA 1MXUA 3MZBA 3OENA 4ELOA 2DVZA 4RPOA 5M2VA 1A54A 3TCGA 4F3SA 4R6KA 1B3GA 1Y4TA 4H8IA 1H44A 2F8DA 1D9VA 2Y84A 4QFPA 1P1WA 4R2FA 1FTLA 3W9VA 4IY6A 1FQEA 2UXAA 3N6TA 3KG2A 4F1YA 4PFYA 4ELRA 1Y1MA 1M5EA 3FVGA 3B7DA 3TZAA 5JEIA 3TODA 3S9NC 1LFGA 1QKBA 3QSLA 1L5TA 1SI1A 3V89B 3G3GA 4DDDA 5A5XB 1VSOA 4XKQA 3G3IA 4GOTA 4POWA 2UVGA 4QFLA 3VDFA 2NXOA 3PUXE 2QMWA 3H03A 4OVJA 1S9TA 1URDA 3VXBA 2REJA 3K02A 3A09A 4IY5A 4OMBA 4QF9A 3CSBA 2HCAA 5KDTA 3THIA 1A7LA 1LCFA 1ELJA 3T9XB 2PT2A 4R2BA 3MZ1A 4KYEA 5I57B 4IO2A 1SQYA 4YB5A 4YKJA 3BFUA 4RJZA 4ZEBA 1MY2A 3QUJA 3PU5A 3HV1A 3C35A 2DE3A 3IJOB 3S4UA 5A5XA 1D4NA 2NVUB 1BLFA 1HSLA 4XKRA 2I48A 3HSTA 4KD5A 4RPNA 3UK4A 1I6BA 1GV8A 2ONKE 4RK2A 3S9LC 2ZYOA 5AE4A 3O29A 1T0KA 3B6TA 1B46A 2DWAA 1BKAA 1QVSA 1SDXA 3EF7A 1Y3PA 3IO6A 3OOAA 2OK2A 4POXA 4RXLA 3TQLA 4JSDA 1RYOA 1NNPA 2X26A 3K1MA 4PE5B 1PBQA 3D4CA 2OCUA 3FJMA 1Q1KA 3N26A 2VOZA 4UACA 1LSTA 3TMGA 1IXCA 4X1DA 2HAUA 1SW1A 4C1TA 3KN8A 3F11A 3MW0A 5L9SA 2FNCA 3H3GA 2FA7A 1ATGA 3CVGA 1B1HA 2DWJA 3K6VA 3U92A 5KCJA 4L17A 4AQ4A 2QRYA 1PBPA 1QW0A 3ODBA 4RNSA 5K2XA 3SDFA 2KLFA 1JW5A 4I62A 3RNNA 2DE2A 2Z8EA 3N6UA 2ONSA 1DPEA 4M1VA 4PFWA 3RY3A 1XOCA 4G77A 3MJNA 1XVXA 3K1PA 5FHOA 1URSA 5I58B 2Z23A 2D21A 2D5WA 4GRKA 5JK4A 2RKMA 1NNTA 3PD8A 1MY0A 1OQHA 1WODA 4C0RA 3VLWA 3E9XA 3HN0A 3FXQA 4H5FA 2HQ0A 4F2QA 2PVUA 4KCDA 4PP0A 1MQIA 2I3VA 4NWCA 1FQAA 5TPAA 1NMUA 2H25A 3MQ9A 2NOOA 1FQCA 3MUQA 1P1OA 1B9JA 2XXPA 3K6WA 4KPTA 4NF4A 4TQUQ 3S9EA 3MPLA 1GTKA 5DVFA 4LQ5A 1TXFA 1MQHA 3EPEA 3KJ7A 1A8EA 1LAHE 4F3BA 3IB0A 3U1OA 4HCWA 3D4GA 2PYYA 4P11A 4TLLB
chains in the Genus database with same CATH superfamily
1DMBA 3GZGA 5AA4B 4GX3A 1RDXA 1US4A 5I56A 5CM6A 5B7DA 2H4IA 1LBVA 5I84A 4F1VA 4BDQA 5CRYA 4LZ5A 4OFJA 4PAFA 1B51A 3U72A 4MJOA 4OENA 2RF1A 3A3UA 1MPBA 5ET8A 1DK4A 3CFLA 3TKDA 3LC8A 2CMOA 2I0BA 4Q30B 1R9QA 5CMBA 2VP1A 2AIXA 5HPQA 3L6HA 4N6KA 2RC9A 2XHDA 1EZOA 4ELQA 4F22A 1HSEA 2PFYA 2UVJA 4I3YA 5DT6A 1KWHA 2YPNA 2Y7WA 1AH5A 1LB8A 3VE1B 1R6ZA 3FVOA 3OSRA 3FJ7A 4R74A 1H3DA 1NL5A 4LZ7A 1ZKBA 2FBPA 1LB9A 4MNPA 3IOWA 1QUKA 3O66A 1POTA 4PC9A 5TP9B 1LAGE 1NH8A 1LBBA 4RYAA 5A5LA 5AA1A 4N15A 4FECA 1AL3A 3DELB 1P99A 2B65A 3TTMA 1FPKA 2XWKA 3MVZA 1HSJA 4YICA 3PPPA 2VHAA 4OEVA 2ZNTA 3C32A 4PE3A 3PPNA 1B52A 3IFAA 4ND9A 4NX1A 4P9KA 1O64A 4OERA 3RYDA 1UTBB 4Q8RA 1URGA 3USDA 1FBPA 4FORA 3FASA 1B3FA 3KJTA 4JDFA 3CG3A 4ECFA 1SYHA 2B3FA 2CZHA 2ZMBA 1LLSA 5L9OA 3UGWA 4OETA 4P0IA 4EDPA 4YKKA 4GL8A 2F3BA 4U2RA 2ZYKA 4DCYA 3Q27A 1MH4A 1B7UA 4UABA 4NF8A 3UORA 1MXXA 2ANJA 4ELPA 3BBRA 3P7IA 4YKPA 2XD3A 3U8QA 4JXIA 1SYIA 2DXRA 4R9FA 1INPA 3Q29A 1FJ9A 3QK6A 2RCBA 1FJ6A 3SEWA 2F6GA 4LP2B 4ZE8A 2ABHA 4U4SA 3T9UA 5TP9A 1NUZA 1XVYA 3K6XA 2PT1A 1B2HA 1M5CA 1MDQA 1UTBA 1IMFA 5EQAA 1NV5A 3KBRA 3TQWA 1M5DA 3KSXA 2B4LA 3IX1A 2F7AA 3T66A 5I5PA 1BTJA 4JVDA 4DCXA 4WKMA 4P47A 4O7IA 4YB6A 3LBSA 1B5JA 4JB7A 5ET5A 2UYFA 1I6AA 2Q89A 2XWIA 5KZTA 4LZ8A 3FGSA 4GWSA 1PB7A 4N8GA 1ZJLA 4PTKA 2FIXA 3BIGA 1MQDA 1OLAA 3PPQA 4OWDA 2R6GE 1IITA 4NF0A 4OFOA 4IR8A 5CC2A 5IZZA 3O9PA 3E78A 3CHGA 4P0GA 4ZEKA 3PMWA 2FVZA 4M4GA 2OZZA 3OD7A 4O94A 2OJTA 3OMBA 5H8FB 2I6EA 3T9VA 3TDJA 1Y20A 4P56A 2ZXTA 4ZEFA 3FZVA 4KYSA 1K9YA 3PUYE 4EXLA 2WBBA 4PBHA 4WXJA 1JQFA 4NN3A 1JP4A 4G8MA 2VPOA 3KOSA 4ZS9A 2A5SA 2QL3A 3S9LC 1MPDA 1ZU0A 3PGFA 1H45A 1SD3A 3TUSA 4HTGA 5KCJB 4P1LA 3SEVA 4ZEIA 2H98A 1UQWA 3ILUB 1R1NA 3O97A 4I1DA 2D3IA 1B3LA 1Y4CA 4XKNA 4F3PA 3T0JA 4NF4B 4BDLA 1A55A 1IMCA 5CMMA 1VFEA 3KOTA 2Z8FA 2DSFA 1FPJA 3E4RA 5FTHA 2RC7A 1SVXB 1NV7A 5KDTB 3C36A 3MAMA 2ZZXA 3IAZA 2HXRA 3RT8A 4BLAA 3KZGA 3KN3A 4FIMA 2XXIA 1Q9DA 1PB8A 2V3UA 4UA8A 2Y7PA 2I4CA 3SZPA 4OHNA 3M3FA 5EHMA 3MZBA 2DVZA 3TCGA 4R6KA 1H44A 2F8DA 2Y84A 3W9VA 1FQEA 4F1YA 4ELRA 3TODA 3V89B 5A5XB 3VXBA 2NXOA 3TEPA 1URDA 3K02A 4IY5A 3CSBA 5KDTA 3MZ1A 1SQYA 3BFUA 3QUJA 3PU5A 3IJOB 2DE3A 5A5XA 2I48A 3HSTA 4KD5A 1IMAA 3B6TA 1FPFA 2DWAA 3IO6A 4POXA 1RYOA 2X26A 4PE5B 2OCUA 3TMGA 1Q1KA 5L9SA 2FNCA 4XFEA 4PFIA 3H3GA 3K6VA 5KCJA 1B1HA 1QW0A 3ODBA 4RNSA 5K2XA 1NV1A 3RY3A 1DPEA 5EQ7A 4G77A 5FHOA 1URSA 2Z23A 4OVQA 1MY0A 3FXQA 4H5FA 2P3NA 1FQAA 2NOOA 4KPTA 2XXPA 3K6WA 3ZKKA 1DBZA 4TLLB 4EF1A 1MH3A 2GQ1A 4R9GA 2F34A 3GXAA 4C1UA 3DP6A 1XT8A 1NV3A 3K0VA 1IXIA 4QSCA 1MQJA 4MBPA 2ZYMA 1PEBA 1NUXA 4QSEA 3CIJA 2GRVA 1JEVA 3TELA 2F7BA 4IO4A 3KC1A 3G3JA 3OSQA 4RY1A 3TTNA 3MPKA 1NNKA 1JW4A 2E1SA 3B8BA 2L5VA 2HZLA 5EYFA 2ZYNA 4HE2A 3K4UA 4F19A 1ZLQA 4QHQA 5J1DA 2XD2A 1QULA 5CMKA 2H5YA 5I59B 3UN6A 4GX6A 4N6PA 5EHSA 5IZ3A 4TOZA 2CZIA 1FTJA 2Q8JA 2Q2CA 3K6UA 3RPLA 3S9MC 2F35A 4U23A 5AA2A 4PETA 3R6UA 2THIA 4R72A 1H43A 4I8CA 3IB2A 3G3KA 4IO6A 4JWYA 4F39A 3B6WA 4GBWA 1B40A 4AS4A 1RKMA 3CI8A 2HZKA 3K2DA 4NQ8A 5T3JA 4GLIA 1QUIA 1N76A 4NF8B 4X9TA 4BDOA 1RDYA 1NNFA 5I2KB 3PUVE 2V84A 5AA3A 1AMFA 3UP9A 1EU8A 3QMFA 1JW1A 4EQ9A 2Z8DA 2DVCA 4FBPA 3OO9A 1TFDA 4NF6A 1XC1A 2O68A 4O8MA 4RA1A 1OVBA 1LGBC 2XXHA 3PUZE 4QRZA 5B70A 4PAIA 2V93A 2PCRA 2KQZA 1RDZA 1S50A 3OO8A 4I9DA 5EYHA 5H8QB 2OWZA 3VVDA 5I2NA 5IGAA 2ZNSA 3TTRA 1FSAA 3VV5A 4Q0CA 4YMBA 2QS1A 4GWXA 1DTZA 3UIFA 1DCUA 3EHUA 2V25A 4GWYA 3TFLA 1N0TA 4PF6A 4MF3A 4GVOA 1FQDA 4H65A 3U65A 2GH9A 3MVWA 5K2YA 3RQTA 2MKZA 2YJPA 3GBAA 4GWOA 1EH3A 5FHNA 2WKYA 4QFNA 4LA9A 1A8FA 2XXWA 2O1MA 2IEEA 3H6TA 3FVNA 3FXUA 4PDHA 4JVCA 1B0LA 4ESWA 3RT6B 4EXKA 3TYHA 3L6GA 3PPOA 3T9HB 4ESXA 4KYDA 3HO7A 1MXYA 4K3FA 2O84X 1LAXA 3R26A 4KCCA 3TTKA 2P2AA 5IKBA 3C4MA 3FV2A 5BWJA 1NV2A 4ZDMA 3MP6A 1AIVA 1LBXA 4MH5A 4DIGA 1FTAA 4NF5B 4O3AA 2VD2A 3LSLA 3FUZA 2I58A 3T96B 1RYXA 4DE8A 2DWHA 3R7XA 5I56B 5IAIA 3WAEA 1POY1 1LFHA 1Y3QA 1BK4A 1ZIUA 5AA4A 4MFIA 2HXWA 2OWSA 4N81A 3PV0E 3CFXA 5DEXA 1LFIA 1MPCA 3Q25A 3K00A 3MYUA 1B5HA 5TU0A 2O6AA 2CEXA 3IO4A 3DP4A 4EF2A 4Q5TA 1FCKA 4U22A 3MC2A 3LUZA 5ISUA 4NTLA 3V83A 4PF8A 4EUOA 2CZLA 4LUBA 1JVXA 3EHSA 5HM4B 4JWXA 1FPBA 1B7HA 4GWUA 4QXDA 3G7WA 4G68B 1Y3NA 3QUFA 2YLNA 1MRPA 1FBHA 4G2ZA 4N07A 4OZ9A 1IUDA 3CG1A 3FD3A 3I3VA 3OEKA 1YCJA 1O7TA 5I57A 4FJPA 3JV9A 1O63A 1SW4A 1SW5A 2VGQA 3QYTA 1SI0A 4DLDA 3OXNA 3N94A 3I5OA 5CBRA 1FPEA 3IORA 2XXVA 2W7YA 3QXMA 1FRPA 1YYZA 3SKPA 1KA0A 3RTWB 1Z7ME 2IA4A 1XI6A 2Y5KA 1A54A 1Y4TA 4H8IA 2UXAA 4NHBA 1Y1MA 3S9NC 1QKBA 3QSLA 3G3IA 4POWA 2QMWA 2REJA 3T9XB 1ELJA 4R2BA 5I57B 3FXBA 4RJZA 2OX3A 3HV1A 4XKRA 3UK4A 2QVRA 1FBCA 4RK2A 2ZYOA 5AE4A 3O29A 2Y5LA 1QVSA 4AS5A 2OK2A 4RXLA 3TQLA 4JSDA 3N26A 2VOZA 4NGUA 1LSTA 1IXCA 1SPIA 1SW1A 4C1TA 3MW0A 1ATGA 3CVGA 2FIEA 4MCOA 3U92A 1PBPA 2KLFA 1JW5A 2DE2A 3MJNA 3K1PA 4GRKA 1NNTA 3PD8A 4C0RA 3VLWA 4OVTA 4PP0A 1MQIA 4NWCA 2H25A 3MQ9A 1FQCA 3NOHA 1GTKA 3IB0A 4HCWA 3D4GA 4O3BA 3SEUA 5DYHA 1TT1A 4G68A 4Z0IA 3JZJA 2G93A 4PFBA 1GVCA 3PPRA 1N84A 1UTHA 4F29A 1VR5A 3O6GA 4THIA 3IB1A 3VXCA 4RK9A 3ZS6A 4NF5A 2F5XA 3LV0A 1IQ7A 3IR1A 4OXVA 3VVEA 4KI0E 3AXFA 4OVPA 2F78A 4OANA 5DEXB 1B1XA 1TFAA 5TPAB 5J16A 1J1NA 5DTBA 3BKIB 1LBWA 4IO7A 5CI5A 1B4HA 3Q26A 3Q28A 4I40A 5H8NA 5H8FA 3QAXA 2A5TA 1US5A 3KEIA 4MX6A 2XX7A 1MY4A 3UA8A 4H6DA 2M8CA 5ICQA 3ZKLA 4R73A 3FJGA 2BJJX 4U1ZA 1B05A 3DLNA 4MLQA 3OEMA 2ONRA 1EYIA 4F18A 3IFCA 1UIVA 2DS9A 4X04A 2GFEA 4TLMB 3SESA 4XF5A 4GBVA 3PMXA 4PQJA 3CRBA 5AA2D 2XXUA 4G4PA 1FTMA 1N7XA 2X7QA 5FTIA 3EQ1A 4YMAA 4DI4B 1D3KA 3O6IA 2V3TA 4IO5A 1NKXA 3MBPA 2F97A 2VPNA 3A3CA 2E0SA 2WX9A 4MLVA 3H4ZA 2XXQA 4Z7EA 4HCYA 4G8HA 4PFTA 3SEXA 3KBZA 1SBPA 1GGGA 4DZ1A 4QFKA 4N17A 4NF6B 1YXIA 5JTYA 2P1SA 4OEUA 1YAEA 1NV0A 2NWJA 4N8YA 4XTCQ 2Q9TA 3HHFA 4HE1A 4NG7A 2B3BA 4GWZA 1B32A 1LBZA 4N91A 5CBSA 4F1UA 2QS4A 5FBPA 1AWBA 3CFZA 1WVJA 2P3VA 2WBDA 5IM2A 2ESNA 2XXTA 1CE2A 2NUVA 3M3LA 3VFJA 1OMPA 2F7CA 1MQGA 1P1NA 4R6YA 3E79A 3M8UA 1FQBA 4HS7A 3VLVA 3KGCA 3OELA 3U94A 5ET7A 1VFDA 1Y1ZA 4N4UA 2I0CA 3O28A 1CNQA 1FTKA 3K1NA 2I3WA 1DPPA 5L8DA 2PBWA 4X48A 4XEQA 3W9WA 5L9MA 4X8RA 1ANFA 2QPQA 1BIYA 3TPAA 2O51A 4LN5A 3E13X 1MS7A 2QMXA 4GXAA 4OFLA 2Q8MA 2XWOA 3IOTA 2XX9A 4ZECA 4LVQA 4IB2A 2PX1A 3EN3A 4R6HA 4JSOA 1N3WA 1PC3A 2V4CA 1KA1A 3H6VA 1F9BA 1Y9UA 5AA2B 3IJXB 5DW8A 3T93B 4F2OA 2KR0A 5HBCA 2RC8A 1P1UA 3RPLB 4KR5A 4MAGA 1N04A 3KFMA 2XWVA 1B3HA 4PFRA 3M3KA 1WDNA 1P1QA 4XXUA 4QFOA 1IZ1A 1USYE 3WAFA 3ZSFA 2B4MA 1QJMA 4DXCA 2VT5A 1DSNA 4BDMA 2LAOA 2OBGA 5I7IA 4H67A 4H1XA 2HAVA 1OIBA 3LUYA 4P1EA 1BP5A 4F31B 3BIHA 2WYKA 2XXKA 3VLUA 1B4ZA 2V3QA 4U1OA 2PMSA 1XHYA 2RINA 4YB7A 5ET6A 4U4XA 3ROJA 4IGTA 1MXZA 3FVKA 5F24A 4X1BA 4ZZEA 1LBYA 3RGYA 1I6QA 2F6PA 4U21A 3V5AA 4G68C 1G0IA 4NAPA 2WYPA 5I58A 3H6WA 2AYSA 3C31A 3OO6A 2QVVA 4I3EA 5LOMA 1D9YA 1G0HA 4H8JA 2VD3A 4N13A 3GBBA 3HFUA 1N7WA 1NH7A 1FW0A 4GIZA 3BFTA 4GQOA 1Z7NE 4XKPA 5DVJA 1NUWA 3PMVA 4NWDA 4E0XA 3KC0A 4NEDA 1MY1A 3H06B 1N3XA 4YAHX 1ZBMA 4OVRA 4R75A 3MWBA 4IGRA 4XIGQ 4FEDA 2OLBA 4H46A 1QKAA 2Z22A 1FQFA 3FV1A 3PTYA 4MHFA 5F1QA 1PB9A 4YKIA 3T22A 1DTGA 1EYKA 1NV6A 4OYVA 1QUJA 2Q2AA 2DYXA 3FXRA 2GHAA 3O2AA 1MXUA 3OENA 4OVSA 4F3SA 1B3GA 4QFPA 1D9VA 1P1WA 1FTLA 4IY6A 3N6TA 4PDDA 1FPIA 5JEIA 1M5EA 3B7DA 1L5TA 1SI1A 3G3GA 4DDDA 1VSOA 4GOTA 3VDFA 2UVGA 3PUXE 1S9TA 4P3LA 1FBGA 1A7LA 1LCFA 2PT2A 4YB5A 4YKJA 4ZEBA 2HPGA 3C35A 1I6BA 1GV8A 1BKAA 3EF7A 1NNPA 3FJMA 4UACA 4X1DA 4AQ4A 2QRYA 3SDFA 2Z8EA 3N6UA 4PAKA 2ONSA 1XOCA 5I58B 2D21A 2WEFA 1OQHA 3E9XA 3HN0A 2HQ0A 4F2QA 2PVUA 3MUQA 2CZKA 3S9EA 1B9JA 4NF4A 4TQUQ 5DVFA 1MQHA 4QBAA 3EPEA 3KJ7A 1LAHE 3U1OA 3C34A 2PYYA 1K9ZA 2Q74A 3RTFB 2QJEA 2ZZWA 3MZ9A 4ISUA 2BJIA 2XXYA 4LATA 1R9LA 4OESA 5LDZA 3VVFA 2XA5A 4KFQA 4OQOA 1EZPA 1UIUA 1B5IA 1TWYA 1M5BA 1VE4A 5ITOA 4JVIA 4FEBA 1USYH 5CMCA 5ICTA 2DQVA 4EQ7A 2ZNUA 5H8HA 1ZTYA 2QVUA 3C33A 2HEUA 2JJKA 5BUUA 1IXHA 3MVYA 4WEDA 4F3GA 4H5GA 4MMPA 3RN8A 2RCAA 5ESYA 1M5FA 3U93A 2XX8A 3S2VA 1II5A 3FIRA 1LEVA 2PFZA 3HPIA 3A29A 4BDNA 4FAJA 1H76A 3HCQA 1OQGA 4KHZE 1IIWA 1JEUA 5ELVA 1SW2A 1YPNA 3IOVA 4DXUA 5FHMA 1YZ0A 4N6DA 1MDP1 4FATA 4QSDA 1EZ9A 4ZE9A 3ECRA 3OO7A 4JBZA 3JYRA 5LTCA 1FTOA 5I2NB 3TTLA 5H8QA 4AB5A 4GF8A 5ITPA 2DP8A 1GR2A 3ILTB 4PFUA 1B0HA 1FPGA 2DOJA 3H6UA 1A40A 2HFBA 3LR1A 3IK6B 3B50A 2Y7KA 3K01A 2FYIA 5JTYB 2O7UA 1FBFA 2X7PA 2AL5A 4HE0A 5F7VA 3D1RA 4JWOA 4LQ2A 5I3SA 2QS3A 4H0WA 2DXYA 4DI3D 1XS5A 3C9HA 3TAJA 2R9JA 3GYYA 5H8SA 4GD5A 2Q88A 4O3CA 2OWTA 1LAFE 2O69A 3H7MA 4ZEDA 3SERA 3B6QA 4GFRA 4H45A 3FBPA 4NE4A 2R71A 2REGA 4P8BA 1B58A 3SETA 5DVIA 2QSXA 4EQBA 4DXBA 1MG1A 5I2KA 2G29A 1B3EA 1QGXA 1IMEA 3LSXA 4OA4A 3MP1A 3FATA 4WEPA 2ALUA 1D9QA 2AL4A 3TCHA 3CSGA 3MSTA 3IL1B 1LCTA 2UVHA 3SEYA 3CR9A 4GXSB 3GLBA 3QIMA 3RPWA 4GL0A 2A5TB 3TCFA 2O1LA 3IOUA 1IMBA 3PUWE 2QS2A 2DE4A 2F36A 4ZZAA 2F3DA 5IZ3B 1A99A 1IEJA 1PDAA 2UYEA 1IMDA 3HHGA 5I59A 1MM7A 2Y7RA 3W15C 2GHBA 1I69A 4IO3A 2Y7IA 3O6HA 4AB6A 1KZ8A 1MXWA 3DP8A 4HW8A 2I49A 1S7YA 1UTHB 4KXPA 3LSFB 4GX4A 2H9BA 5H8NB 2P0SA 2O7IA 4NMYA 3DM0A 4MIJA 2R8TA 3KN7A 5TPAA 2XXRA 4LONB 5H8HB 4G61A 1AOVA 1MY3A 2XXXA 4MEVA 4YZZA 3G3HA 2QFLA 2I4BA 3RLFE 1FPDA 3EHTA 1JNFA 1YTVA 1LBCA 4G8NA 1CB6A 3MP8A 1OVTA 1ZMGA 1JVYA 1B6HA 4PCDA 4OTEA 1B7ZA 4PGPA 2DDKA 3V8XB 3KSJA 2DWIA 4MNCA 2ZZVA 2HHMA 4ONYA 1MXVA 4YU0A 1IXGA 4GWWA 1MM6A 1Q35A 2H99A 1JETA 3PD9A 3G3FA 3N5LA 1VDWA 3I6VA 3LSWA 1OLCA 1NFTA 2UVIA 3ISPA 1NI9A 4E0WA 4BDRA 1FBEA 3ONMA 4XKQA 4KQPA 4FE8A 5IZ1A 3RUMA 1DOTA 3E3KA 3MVXA 4ELOA 4RPOA 5M2VA 4MNIA 5EQ8A 4R2FA 1NV4A 3KG2A 4PFYA 3FVGA 3TZAA 1LFGA 2FHYA 4PGNA 4QFLA 4OVJA 3H03A 1NUYA 3A09A 4OMBA 4QF9A 1FPLA 2HCAA 3THIA 5EQ9A 4KYEA 4IO2A 1MY2A 3S4UA 1D4NA 2NVUB 1BLFA 1HSLA 4RPNA 2ONKE 1EYJA 1T0KA 1B46A 1SDXA 1Y3PA 3OOAA 4HXVA 3K1MA 1PBQA 3D4CA 2HAUA 3KN8A 3F11A 4PBQA 2FA7A 2DWJA 4L17A 3RNNA 4I62A 4PFWA 4M1VA 1XVXA 1FBDA 3EKIA 2D5WA 5JK4A 2RKMA 1WODA 2CEYA 4KCDA 2I3VA 4O7MA 1NMUA 1P1OA 3MPLA 4LQ5A 1TXFA 1A8EA 4F3BA 3T1BA 4P11A 5EYGA
chains in the Genus database with same CATH topology
4EF1A 1DMBA 3RTFB 2QJEA 4O3BA 3SEUA 5DYHA 3GZGA 1MH3A 1TT1A 4G68A 5AA4B 4Z0IA 3JZJA 2G93A 4R9GA 3TEPA 2F34A 1US4A 3GXAA 3MZ9A 4ISUA 4C1UA 3DP6A 2XXYA 5B7DA 2H4IA 5CM6A 1GVCA 5I56A 1XT8A 3PPRA 4LATA 5I84A 1N84A 1R9LA 1UTHA 3K0VA 1IXIA 4OESA 4QSCA 4BDQA 4F29A 4F1VA 5CRYA 4LZ5A 1VR5A 3O6GA 4OFJA 3IB1A 4THIA 1MQJA 4RK9A 3VXCA 4MBPA 3ZS6A 4NF5A 3VVFA 1B51A 2ZYMA 1PEBA 2F5XA 4QSEA 4KFQA 4OQOA 3U72A 1EZPA 1UIUA 1B5IA 1IQ7A 3CIJA 4OENA 1TWYA 2RF1A 1MPBA 3A3UA 3IR1A 4OXVA 1M5BA 2GRVA 1VE4A 1JEVA 3CFLA 5ITOA 3TKDA 3TELA 2F7BA 4FEBA 3VVEA 4KI0E 3LC8A 3AXFA 1USYH 2CMOA 5CMCA 2I0BA 4BDLA 5ICTA 2F78A 2DQVA 4EQ7A 4Q30B 1R9QA 2ZNUA 5CMBA 5H8HA 5I57A 1ZTYA 2VP1A 3G3JA 3OSQA 2AIXA 1B1XA 1TFAA 3L6HA 4IO4A 1J1NA 4RY1A 3BKIB 5DTBA 5TPAB 3TTNA 4IO7A 3MPKA 3C33A 1NNKA 5CI5A 1B4HA 2RC9A 1JW4A 2E1SA 3Q28A 3Q26A 2HEUA 5H8NA 2HZLA 5BUUA 5H8FA 5EYFA 3QAXA 2XHDA 2A5TA 1US5A 3KEIA 1EZOA 1IXHA 3MVYA 4WEDA 4ELQA 4F3GA 2ZYNA 4H5GA 4F22A 2XX7A 1HSEA 3RN8A 1MY4A 2UVJA 2RCAA 3K4UA 1ZLQA 5DT6A 1M5FA 4QHQA 1KWHA 2YPNA 3UA8A 2Y7WA 1AH5A 4H6DA 5J1DA 1LB8A 2M8CA 3U93A 3VE1B 5ICQA 1R6ZA 2XX8A 3S2VA 3FVOA 2XD2A 1II5A 3FIRA 3FJ7A 1H3DA 1NL5A 1QULA 3FJGA 3OSRA 4LZ7A 4R73A 2H5YA 1ZKBA 2BJJX 3ZKLA 5CMKA 3HPIA 5I59B 4U1ZA 1LB9A 3UN6A 1B05A 3DLNA 3IOWA 4MLQA 4BDNA 4N6PA 4FAJA 1H76A 3OEMA 2ONRA 5EHSA 1QUKA 4TOZA 4F18A 3HCQA 1UIVA 2DS9A 3O66A 1OQGA 1POTA 4KHZE 1IIWA 1FTJA 5TP9B 2GFEA 1LAGE 1JEUA 2Q2CA 4TLMB 1NH8A 3K6UA 1LBBA 4RYAA 5ELVA 2Q8JA 3SESA 1SW2A 1YPNA 4F19A 3S9MC 3PMXA 5AA1A 4PQJA 3IOVA 4FECA 4DXUA 2F35A 3CRBA 1AL3A 3DELB 4U23A 1P99A 5FHMA 5AA2A 5AA2D 2B65A 1MDP1 2XXUA 2THIA 3R6UA 4PETA 4G4PA 1FTMA 1N7XA 4QSDA 4R72A 3TTMA 4FATA 1H43A 4I8CA 3MVZA 1EZ9A 1HSJA 2X7QA 3IB2A 3PPPA 4YICA 4ZE9A 2VHAA 5FTIA 3EQ1A 4YMAA 4OEVA 2ZNTA 3C32A 3G3KA 4IO6A 4JWYA 1D3KA 3ECRA 4F39A 3OO7A 3B6WA 3O6IA 4JBZA 2V3TA 3JYRA 1B40A 3PPNA 4IO5A 1B52A 1NKXA 3MBPA 1RKMA 2F97A 4ND9A 1FTOA 3CI8A 2HZKA 3K2DA 5I2NB 3A3CA 3TTLA 4GLIA 1O64A 1QUIA 1N76A 2E0SA 4MLVA 4NF8B 4OERA 1UTBB 4X9TA 4BDOA 5H8QA 4Q8RA 1URGA 3USDA 3H4ZA 4AB5A 1NNFA 4FORA 4GF8A 2XXQA 5I2KB 4Z7EA 3FASA 4HCYA 5ITPA 1B3FA 3KJTA 4G8HA 4PFTA 3PUVE 2V84A 2DP8A 1GR2A 3SEXA 5AA3A 3ILTB 4PFUA 1SBPA 1B0HA 1GGGA 1AMFA 3UP9A 2DOJA 4JDFA 3CG3A 1EU8A 4ECFA 4DZ1A 1SYHA 3H6UA 1A40A 4QFKA 2B3FA 1JW1A 2HFBA 3LR1A 4NF6B 2Z8DA 2ZMBA 3IK6B 3W15C 2DVCA 4EQ9A 2Y7KA 2P1SA 5JTYA 3K01A 2FYIA 1LLSA 3OO9A 5L9OA 4OEUA 5JTYB 1YAEA 3UGWA 4OETA 1TFDA 2O7UA 4NF6A 2NWJA 4P0IA 1XC1A 4XTCQ 2X7PA 2Q9TA 2O68A 3HHFA 4RA1A 1OVBA 4YKKA 4EDPA 2AL5A 2B3BA 1LGBC 2XXHA 3PUZE 4QRZA 4JWOA 5F7VA 5B70A 4LQ2A 2V93A 4GL8A 1B32A 4U2RA 1S50A 5CBSA 2QS3A 2ZYKA 4F1UA 4H0WA 4DCYA 3OO8A 2DXYA 2QS4A 1XS5A 1MH4A 1B7UA 3C9HA 3CFZA 3Q27A 4I9DA 2R9JA 3TAJA 1WVJA 5H8QB 5H8SA 4GD5A 4NF8A 2Q88A 4O3CA 3UORA 1MXXA 2ANJA 2ESNA 2XXTA 3VVDA 4ELPA 5I2NA 2OWTA 1CE2A 1LAFE 2O69A 3BBRA 2NUVA 3M3LA 3P7IA 3VFJA 1OMPA 2F7CA 3H7MA 4YKPA 4ZEDA 2ZNSA 2XD3A 1MQGA 1P1NA 3SERA 4R6YA 3TTRA 3U8QA 3B6QA 4GFRA 3M8UA 4JXIA 3VV5A 1FQBA 1SYIA 2DXRA 4Q0CA 4HS7A 3VLVA 4YMBA 4R9FA 3KGCA 2QS1A 4BDMA 3OELA 4NE4A 3U94A 2R71A 2REGA 1DTZA 3Q29A 3QK6A 1VFDA 1Y1ZA 2RCBA 3UIFA 3EHUA 2V25A 2I0CA 1B58A 3O28A 3TFLA 3SETA 1N0TA 3SEWA 2F6GA 5DVIA 1FTKA 2QSXA 4MF3A 4GVOA 4LP2B 3K1NA 4ZE8A 2I3WA 1FQDA 1DPPA 2ABHA 4U4SA 5L8DA 3T9UA 4H65A 4EQBA 5TP9A 2PBWA 2GH9A 4X48A 4DXBA 1MG1A 5I2KA 2G29A 1B3EA 1XVYA 3K6XA 3MVWA 3W9WA 5K2YA 5L9MA 2PT1A 3RQTA 1ANFA 2QPQA 1B2HA 1M5CA 1MDQA 2YJPA 3GBAA 4GWOA 1UTBA 1EH3A 3C34A 3KBRA 3LSXA 5FHNA 1M5DA 3KSXA 1BIYA 3TQWA 3TPAA 2O51A 5HPQA 2WKYA 3MP1A 3E13X 1MS7A 3FATA 3IX1A 2QMXA 4LA9A 4QFNA 4GXAA 2F7AA 1A8FA 4OFLA 4WEPA 2XXWA 3T66A 2ALUA 3IOTA 2O1MA 2AL4A 2IEEA 2XX9A 1BTJA 3TCHA 3CSGA 3H6TA 3FVNA 4ZECA 4LVQA 4IB2A 3IL1B 1LCTA 2UVHA 3FXUA 3CR9A 4GXSB 3SEYA 2PX1A 3EN3A 4WKMA 4R6HA 4DCXA 1B0LA 1N3WA 4JSOA 4ESWA 1PC3A 3GLBA 3RT6B 4EXKA 3QIMA 3RPWA 4YB6A 3H6VA 3LBSA 4GL0A 1B5JA 2A5TB 1F9BA 1Y9UA 4JB7A 3TYHA 5AA2B 3IJXB 3TCFA 3L6GA 2UYFA 1I6AA 2Q89A 3T93B 2O1LA 5KZTA 4LZ8A 4F2OA 3PPOA 3FGSA 5HBCA 3T9HB 4ESXA 4KYDA 2RC8A 1P1UA 3IOUA 3HO7A 1MXYA 4KR5A 4K3FA 1N04A 3KFMA 3PUWE 2O84X 1LAXA 3R26A 1B3HA 2QS2A 1PB7A 4KCCA 3TTKA 2DE4A 2F36A 1ZJLA 2P2AA 3M3KA 4ZZAA 5IKBA 1WDNA 1P1QA 4XXUA 1A99A 3C4MA 4QFOA 1IEJA 1IZ1A 1PDAA 1USYE 2UYEA 1MQDA 3FV2A 3WAFA 5BWJA 3HHGA 3ZSFA 1OLAA 1QJMA 4DXCA 3PPQA 4ZDMA 3MP6A 5I59A 4OWDA 1AIVA 1MM7A 2R6GE 2Y7RA 1IITA 1DSNA 1I69A 2GHBA 2LAOA 2OBGA 2Y7IA 3O6HA 4H67A 4IO3A 4MH5A 4OFOA 4DIGA 5CC2A 4H1XA 2HAVA 4NF5B 3O9PA 4O3AA 2VD2A 1OIBA 3LSLA 1MXWA 3DP8A 3FUZA 4AB6A 4HW8A 2I58A 3T96B 4P0GA 2I49A 4ZEKA 3LUYA 3PMWA 1S7YA 1UTHB 1BP5A 1RYXA 4DE8A 2DWHA 3R7XA 4F31B 4M4GA 3LSFB 2OZZA 3OD7A 3WAEA 5I56B 5IAIA 1POY1 1LFHA 2H9BA 1Y3QA 2OJTA 1B4ZA 3OMBA 5H8FB 3VLUA 5H8NB 1ZIUA 5AA4A 2V3QA 2I6EA 3T9VA 4MFIA 2P0SA 2HXWA 2OWSA 2O7IA 4U1OA 4NMYA 3TDJA 3DM0A 2PMSA 1XHYA 1Y20A 2RINA 2ZXTA 3CFXA 3KN7A 3PV0E 1LFIA 1MPCA 4R74A 2XXRA 4YB7A 3Q25A 4LONB 3K00A 5DEXA 5H8HB 4ZEFA 1B5HA 4U4XA 5TU0A 3FZVA 4KYSA 2O6AA 4IGTA 3ZKKA 3IO4A 3PUYE 3DP4A 4EF2A 4EXLA 1AOVA 1MY3A 1MXZA 4Q5TA 3FVKA 4X1BA 1FCKA 2XXXA 4ZZEA 4U22A 4YZZA 4WXJA 3MC2A 1JQFA 3RGYA 3G3HA 5ISUA 1I6QA 2F6PA 4G8MA 4NTLA 4U21A 3V5AA 3KOSA 4G68C 3V83A 2I4BA 4EUOA 3RLFE 2CZLA 4LUBA 4ZS9A 1JVXA 3EHTA 1JNFA 1YTVA 1LBCA 2A5SA 5I58A 2QL3A 3H6WA 2AYSA 3EHSA 5HM4B 3C31A 1MPDA 1ZU0A 3PGFA 4JWXA 3OO6A 1CB6A 4G8NA 1H45A 3MP8A 5LOMA 1OVTA 1ZMGA 1SD3A 3TUSA 1D9YA 4HTGA 5KCJB 4H8JA 3SEVA 4ZEIA 2VD3A 4N13A 1B7HA 1JVYA 2H98A 1B6HA 1UQWA 3GBBA 3G7WA 3ILUB 1R1NA 3O97A 1B7ZA 4G68B 4I1DA 2D3IA 4OTEA 1B3LA 1Y4CA 3V8XB 1Y3NA 3KSJA 3QUFA 2DWIA 1MRPA 2YLNA 4XKNA 1N7WA 1NH7A 1FW0A 4GIZA 4G2ZA 4N07A 3BFTA 4OZ9A 1IUDA 4F3PA 4NF4B 3CG1A 1Z7NE 1A55A 1MXVA 4GQOA 4ONYA 4XKPA 5CMMA 3FD3A 3I3VA 3PMVA 1VFEA 4NWDA 1IXGA 4YU0A 3OEKA 5DVJA 4E0XA 1YCJA 3KOTA 2Z8FA 2DSFA 1MM6A 1Q35A 4NEDA 2H99A 1JETA 1O7TA 1MY1A 3H06B 1N3XA 2RC7A 3E4RA 3G3FA 3PD9A 4FJPA 3N5LA 1ZBMA 4YAHX 5FTHA 1SVXB 3JV9A 3I6VA 3LSWA 5KDTB 1O63A 1SW4A 4R75A 1OLCA 3C36A 3MWBA 1NFTA 1SW5A 5DEXB 3MAMA 4IGRA 4XIGQ 2UVIA 3IAZA 2VGQA 3QYTA 4FEDA 1SI0A 3RT8A 2OLBA 1QKAA 4BLAA 2Z22A 4DLDA 1FQFA 3OXNA 3FV1A 3N94A 3I5OA 3KZGA 4E0WA 3KN3A 4FIMA 2XXIA 5F1QA 1PB9A 4YKIA 3T22A 4BDRA 3ONMA 5CBRA 1DTGA 3IORA 1PB8A 2XXVA 1QUJA 2W7YA 4OYVA 3QXMA 2V3UA 2Y7PA 4KQPA 2I4CA 2Q2AA 4FE8A 4UA8A 3RUMA 2DYXA 3SKPA 3FXRA 4OHNA 3RTWB 1Z7ME 1DOTA 2GHAA 3E3KA 3M3FA 3O2AA 5EHMA 2IA4A 3MVXA 1MXUA 3MZBA 3OENA 4ELOA 2DVZA 4RPOA 5M2VA 1A54A 3TCGA 4F3SA 4R6KA 1B3GA 1Y4TA 4H8IA 1H44A 2F8DA 1D9VA 2Y84A 4QFPA 1P1WA 4R2FA 1FTLA 3W9VA 4IY6A 1FQEA 2UXAA 3N6TA 3KG2A 4F1YA 4PFYA 4ELRA 1Y1MA 1M5EA 3FVGA 3B7DA 3TZAA 5JEIA 3TODA 3S9NC 1LFGA 1QKBA 3QSLA 1L5TA 1SI1A 3V89B 3G3GA 4DDDA 5A5XB 1VSOA 4XKQA 3G3IA 4GOTA 4POWA 2UVGA 4QFLA 3VDFA 2NXOA 3PUXE 2QMWA 3H03A 4OVJA 1S9TA 1URDA 3VXBA 2REJA 3K02A 3A09A 4IY5A 4OMBA 4QF9A 3CSBA 2HCAA 5KDTA 3THIA 1A7LA 1LCFA 1ELJA 3T9XB 2PT2A 4R2BA 3MZ1A 4KYEA 5I57B 4IO2A 1SQYA 4YB5A 4YKJA 3BFUA 4RJZA 4ZEBA 1MY2A 3QUJA 3PU5A 3HV1A 3C35A 2DE3A 3IJOB 3S4UA 5A5XA 1D4NA 2NVUB 1BLFA 1HSLA 4XKRA 2I48A 3HSTA 4KD5A 4RPNA 3UK4A 1I6BA 1GV8A 2ONKE 4RK2A 3S9LC 2ZYOA 5AE4A 3O29A 1T0KA 3B6TA 1B46A 2DWAA 1BKAA 1QVSA 1SDXA 3EF7A 1Y3PA 3IO6A 3OOAA 2OK2A 4POXA 4RXLA 3TQLA 4JSDA 1RYOA 1NNPA 2X26A 3K1MA 4PE5B 1PBQA 3D4CA 2OCUA 3FJMA 1Q1KA 3N26A 2VOZA 4UACA 1LSTA 3TMGA 1IXCA 4X1DA 2HAUA 1SW1A 4C1TA 3KN8A 3F11A 3MW0A 5L9SA 2FNCA 3H3GA 2FA7A 1ATGA 3CVGA 1B1HA 2DWJA 3K6VA 3U92A 5KCJA 4L17A 4AQ4A 2QRYA 1PBPA 1QW0A 3ODBA 4RNSA 5K2XA 3SDFA 2KLFA 1JW5A 4I62A 3RNNA 2DE2A 2Z8EA 3N6UA 2ONSA 1DPEA 4M1VA 4PFWA 3RY3A 1XOCA 4G77A 3MJNA 1XVXA 3K1PA 5FHOA 1URSA 5I58B 2Z23A 2D21A 2D5WA 4GRKA 5JK4A 2RKMA 1NNTA 3PD8A 1MY0A 1OQHA 1WODA 4C0RA 3VLWA 3E9XA 3HN0A 3FXQA 4H5FA 2HQ0A 4F2QA 2PVUA 4KCDA 4PP0A 1MQIA 2I3VA 4NWCA 1FQAA 5TPAA 1NMUA 2H25A 3MQ9A 2NOOA 1FQCA 3MUQA 1P1OA 1B9JA 2XXPA 3K6WA 4KPTA 4NF4A 4TQUQ 3S9EA 3MPLA 1GTKA 5DVFA 4LQ5A 1TXFA 1MQHA 3EPEA 3KJ7A 1A8EA 1LAHE 4F3BA 3IB0A 3U1OA 4HCWA 3D4GA 2PYYA 4P11A 4TLLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EF1 A;  1DMB A;  3RTF B;  2QJE A;  4O3B A;  3SEU A;  5DYH A;  3GZG A;  1MH3 A;  1TT1 A;  4G68 A;  5AA4 B;  4Z0I A;  3JZJ A;  2G93 A;  4R9G A;  3TEP A;  2F34 A;  1US4 A;  3GXA A;  3MZ9 A;  4ISU A;  4C1U A;  3DP6 A;  2XXY A;  5B7D A;  2H4I A;  5CM6 A;  1GVC A;  5I56 A;  1XT8 A;  3PPR A;  4LAT A;  5I84 A;  1N84 A;  1R9L A;  1UTH A;  3K0V A;  1IXI A;  4OES A;  4QSC A;  4BDQ A;  4F29 A;  4F1V A;  5CRY A;  4LZ5 A;  1VR5 A;  3O6G A;  4OFJ A;  3IB1 A;  4THI A;  1MQJ A;  4RK9 A;  3VXC A;  4MBP A;  3ZS6 A;  4NF5 A;  3VVF A;  1B51 A;  2ZYM A;  1PEB A;  2F5X A;  4QSE A;  4KFQ A;  4OQO A;  3U72 A;  1EZP A;  1UIU A;  1B5I A;  1IQ7 A;  3CIJ A;  4OEN A;  1TWY A;  2RF1 A;  1MPB A;  3A3U A;  3IR1 A;  4OXV A;  1M5B A;  2GRV A;  1VE4 A;  1JEV A;  3CFL A;  5ITO A;  3TKD A;  3TEL A;  2F7B A;  4FEB A;  3VVE A;  4KI0 E;  3LC8 A;  3AXF A;  1USY H;  2CMO A;  5CMC A;  2I0B A;  4BDL A;  5ICT A;  2F78 A;  2DQV A;  4EQ7 A;  4Q30 B;  1R9Q A;  2ZNU A;  5CMB A;  5H8H A;  5I57 A;  1ZTY A;  2VP1 A;  3G3J A;  3OSQ A;  2AIX A;  1B1X A;  1TFA A;  3L6H A;  4IO4 A;  1J1N A;  4RY1 A;  3BKI B;  5DTB A;  5TPA B;  3TTN A;  4IO7 A;  3MPK A;  3C33 A;  1NNK A;  5CI5 A;  1B4H A;  2RC9 A;  1JW4 A;  2E1S A;  3Q28 A;  3Q26 A;  2HEU A;  5H8N A;  2HZL A;  5BUU A;  5H8F A;  5EYF A;  3QAX A;  2XHD A;  2A5T A;  1US5 A;  3KEI A;  1EZO A;  1IXH A;  3MVY A;  4WED A;  4ELQ A;  4F3G A;  2ZYN A;  4H5G A;  4F22 A;  2XX7 A;  1HSE A;  3RN8 A;  1MY4 A;  2UVJ A;  2RCA A;  3K4U A;  1ZLQ A;  5DT6 A;  1M5F A;  4QHQ A;  1KWH A;  2YPN A;  3UA8 A;  2Y7W A;  1AH5 A;  4H6D A;  5J1D A;  1LB8 A;  2M8C A;  3U93 A;  3VE1 B;  5ICQ A;  1R6Z A;  2XX8 A;  3S2V A;  3FVO A;  2XD2 A;  1II5 A;  3FIR A;  3FJ7 A;  1H3D A;  1NL5 A;  1QUL A;  3FJG A;  3OSR A;  4LZ7 A;  4R73 A;  2H5Y A;  1ZKB A;  2BJJ X;  3ZKL A;  5CMK A;  3HPI A;  5I59 B;  4U1Z A;  1LB9 A;  3UN6 A;  1B05 A;  3DLN A;  3IOW A;  4MLQ A;  4BDN A;  4N6P A;  4FAJ A;  1H76 A;  3OEM A;  2ONR A;  5EHS A;  1QUK A;  4TOZ A;  4F18 A;  3HCQ A;  1UIV A;  2DS9 A;  3O66 A;  1OQG A;  1POT A;  4KHZ E;  1IIW A;  1FTJ A;  5TP9 B;  2GFE A;  1LAG E;  1JEU A;  2Q2C A;  4TLM B;  1NH8 A;  3K6U A;  1LBB A;  4RYA A;  5ELV A;  2Q8J A;  3SES A;  1SW2 A;  1YPN A;  4F19 A;  3S9M C;  3PMX A;  5AA1 A;  4PQJ A;  3IOV A;  4FEC A;  4DXU A;  2F35 A;  3CRB A;  1AL3 A;  3DEL B;  4U23 A;  1P99 A;  5FHM A;  5AA2 A;  5AA2 D;  2B65 A;  1MDP 1;  2XXU A;  2THI A;  3R6U A;  4PET A;  4G4P A;  1FTM A;  1N7X A;  4QSD A;  4R72 A;  3TTM A;  4FAT A;  1H43 A;  4I8C A;  3MVZ A;  1EZ9 A;  1HSJ A;  2X7Q A;  3IB2 A;  3PPP A;  4YIC A;  4ZE9 A;  2VHA A;  5FTI A;  3EQ1 A;  4YMA A;  4OEV A;  2ZNT A;  3C32 A;  3G3K A;  4IO6 A;  4JWY A;  1D3K A;  3ECR A;  4F39 A;  3OO7 A;  3B6W A;  3O6I A;  4JBZ A;  2V3T A;  3JYR A;  1B40 A;  3PPN A;  4IO5 A;  1B52 A;  1NKX A;  3MBP A;  1RKM A;  2F97 A;  4ND9 A;  1FTO A;  3CI8 A;  2HZK A;  3K2D A;  5I2N B;  3A3C A;  3TTL A;  4GLI A;  1O64 A;  1QUI A;  1N76 A;  2E0S A;  4MLV A;  4NF8 B;  4OER A;  1UTB B;  4X9T A;  4BDO A;  5H8Q A;  4Q8R A;  1URG A;  3USD A;  3H4Z A;  4AB5 A;  1NNF A;  4FOR A;  4GF8 A;  2XXQ A;  5I2K B;  4Z7E A;  3FAS A;  4HCY A;  5ITP A;  1B3F A;  3KJT A;  4G8H A;  4PFT A;  3PUV E;  2V84 A;  2DP8 A;  1GR2 A;  3SEX A;  5AA3 A;  3ILT B;  4PFU A;  1SBP A;  1B0H A;  1GGG A;  1AMF A;  3UP9 A;  2DOJ A;  4JDF A;  3CG3 A;  1EU8 A;  4ECF A;  4DZ1 A;  1SYH A;  3H6U A;  1A40 A;  4QFK A;  2B3F A;  1JW1 A;  2HFB A;  3LR1 A;  4NF6 B;  2Z8D A;  2ZMB A;  3IK6 B;  3W15 C;  2DVC A;  4EQ9 A;  2Y7K A;  2P1S A;  5JTY A;  3K01 A;  2FYI A;  1LLS A;  3OO9 A;  5L9O A;  4OEU A;  5JTY B;  1YAE A;  3UGW A;  4OET A;  1TFD A;  2O7U A;  4NF6 A;  2NWJ A;  4P0I A;  1XC1 A;  4XTC Q;  2X7P A;  2Q9T A;  2O68 A;  3HHF A;  4RA1 A;  1OVB A;  4YKK A;  4EDP A;  2AL5 A;  2B3B A;  1LGB C;  2XXH A;  3PUZ E;  4QRZ A;  4JWO A;  5F7V A;  5B70 A;  4LQ2 A;  2V93 A;  4GL8 A;  1B32 A;  4U2R A;  1S50 A;  5CBS A;  2QS3 A;  2ZYK A;  4F1U A;  4H0W A;  4DCY A;  3OO8 A;  2DXY A;  2QS4 A;  1XS5 A;  1MH4 A;  1B7U A;  3C9H A;  3CFZ A;  3Q27 A;  4I9D A;  2R9J A;  3TAJ A;  1WVJ A;  5H8Q B;  5H8S A;  4GD5 A;  4NF8 A;  2Q88 A;  4O3C A;  3UOR A;  1MXX A;  2ANJ A;  2ESN A;  2XXT A;  3VVD A;  4ELP A;  5I2N A;  2OWT A;  1CE2 A;  1LAF E;  2O69 A;  3BBR A;  2NUV A;  3M3L A;  3P7I A;  3VFJ A;  1OMP A;  2F7C A;  3H7M A;  4YKP A;  4ZED A;  2ZNS A;  2XD3 A;  1MQG A;  1P1N A;  3SER A;  4R6Y A;  3TTR A;  3U8Q A;  3B6Q A;  4GFR A;  3M8U A;  4JXI A;  3VV5 A;  1FQB A;  1SYI A;  2DXR A;  4Q0C A;  4HS7 A;  3VLV A;  4YMB A;  4R9F A;  3KGC A;  2QS1 A;  4BDM A;  3OEL A;  4NE4 A;  3U94 A;  2R71 A;  2REG A;  1DTZ A;  3Q29 A;  3QK6 A;  1VFD A;  1Y1Z A;  2RCB A;  3UIF A;  3EHU A;  2V25 A;  2I0C A;  1B58 A;  3O28 A;  3TFL A;  3SET A;  1N0T A;  3SEW A;  2F6G A;  5DVI A;  1FTK A;  2QSX A;  4MF3 A;  4GVO A;  4LP2 B;  3K1N A;  4ZE8 A;  2I3W A;  1FQD A;  1DPP A;  2ABH A;  4U4S A;  5L8D A;  3T9U A;  4H65 A;  4EQB A;  5TP9 A;  2PBW A;  2GH9 A;  4X48 A;  4DXB A;  1MG1 A;  5I2K A;  2G29 A;  1B3E A;  1XVY A;  3K6X A;  3MVW A;  3W9W A;  5K2Y A;  5L9M A;  2PT1 A;  3RQT A;  1ANF A;  2QPQ A;  1B2H A;  1M5C A;  1MDQ A;  2YJP A;  3GBA A;  4GWO A;  1UTB A;  1EH3 A;  3C34 A;  3KBR A;  3LSX A;  5FHN A;  1M5D A;  3KSX A;  1BIY A;  3TQW A;  3TPA A;  2O51 A;  5HPQ A;  2WKY A;  3MP1 A;  3E13 X;  1MS7 A;  3FAT A;  3IX1 A;  2QMX A;  4LA9 A;  4QFN A;  4GXA A;  2F7A A;  1A8F A;  4OFL A;  4WEP A;  2XXW A;  3T66 A;  2ALU A;  3IOT A;  2O1M A;  2AL4 A;  2IEE A;  2XX9 A;  1BTJ A;  3TCH A;  3CSG A;  3H6T A;  3FVN A;  4ZEC A;  4LVQ A;  4IB2 A;  3IL1 B;  1LCT A;  2UVH A;  3FXU A;  3CR9 A;  4GXS B;  3SEY A;  2PX1 A;  3EN3 A;  4WKM A;  4R6H A;  4DCX A;  1B0L A;  1N3W A;  4JSO A;  4ESW A;  1PC3 A;  3GLB A;  3RT6 B;  4EXK A;  3QIM A;  3RPW A;  4YB6 A;  3H6V A;  3LBS A;  4GL0 A;  1B5J A;  2A5T B;  1F9B A;  1Y9U A;  4JB7 A;  3TYH A;  5AA2 B;  3IJX B;  3TCF A;  3L6G A;  2UYF A;  1I6A A;  2Q89 A;  3T93 B;  2O1L A;  5KZT A;  4LZ8 A;  4F2O A;  3PPO A;  3FGS A;  5HBC A;  3T9H B;  4ESX A;  4KYD A;  2RC8 A;  1P1U A;  3IOU A;  3HO7 A;  1MXY A;  4KR5 A;  4K3F A;  1N04 A;  3KFM A;  3PUW E;  2O84 X;  1LAX A;  3R26 A;  1B3H A;  2QS2 A;  1PB7 A;  4KCC A;  3TTK A;  2DE4 A;  2F36 A;  1ZJL A;  2P2A A;  3M3K A;  4ZZA A;  5IKB A;  1WDN A;  1P1Q A;  4XXU A;  1A99 A;  3C4M A;  4QFO A;  1IEJ A;  1IZ1 A;  1PDA A;  1USY E;  2UYE A;  1MQD A;  3FV2 A;  3WAF A;  5BWJ A;  3HHG A;  3ZSF A;  1OLA A;  1QJM A;  4DXC A;  3PPQ A;  4ZDM A;  3MP6 A;  5I59 A;  4OWD A;  1AIV A;  1MM7 A;  2R6G E;  2Y7R A;  1IIT A;  1DSN A;  1I69 A;  2GHB A;  2LAO A;  2OBG A;  2Y7I A;  3O6H A;  4H67 A;  4IO3 A;  4MH5 A;  4OFO A;  4DIG A;  5CC2 A;  4H1X A;  2HAV A;  4NF5 B;  3O9P A;  4O3A A;  2VD2 A;  1OIB A;  3LSL A;  1MXW A;  3DP8 A;  3FUZ A;  4AB6 A;  4HW8 A;  2I58 A;  3T96 B;  4P0G A;  2I49 A;  4ZEK A;  3LUY A;  3PMW A;  1S7Y A;  1UTH B;  1BP5 A;  1RYX A;  4DE8 A;  2DWH A;  3R7X A;  4F31 B;  4M4G A;  3LSF B;  2OZZ A;  3OD7 A;  3WAE A;  5I56 B;  5IAI A;  1POY 1;  1LFH A;  2H9B A;  1Y3Q A;  2OJT A;  1B4Z A;  3OMB A;  5H8F B;  3VLU A;  5H8N B;  1ZIU A;  5AA4 A;  2V3Q A;  2I6E A;  3T9V A;  4MFI A;  2P0S A;  2HXW A;  2OWS A;  2O7I A;  4U1O A;  4NMY A;  3TDJ A;  3DM0 A;  2PMS A;  1XHY A;  1Y20 A;  2RIN A;  2ZXT A;  3CFX A;  3KN7 A;  3PV0 E;  1LFI A;  1MPC A;  4R74 A;  2XXR A;  4YB7 A;  3Q25 A;  4LON B;  3K00 A;  5DEX A;  5H8H B;  4ZEF A;  1B5H A;  4U4X A;  5TU0 A;  3FZV A;  4KYS A;  2O6A A;  4IGT A;  3ZKK A;  3IO4 A;  3PUY E;  3DP4 A;  4EF2 A;  4EXL A;  1AOV A;  1MY3 A;  1MXZ A;  4Q5T A;  3FVK A;  4X1B A;  1FCK A;  2XXX A;  4ZZE A;  4U22 A;  4YZZ A;  4WXJ A;  3MC2 A;  1JQF A;  3RGY A;  3G3H A;  5ISU A;  1I6Q A;  2F6P A;  4G8M A;  4NTL A;  4U21 A;  3V5A A;  3KOS A;  4G68 C;  3V83 A;  2I4B A;  4EUO A;  3RLF E;  2CZL A;  4LUB A;  4ZS9 A;  1JVX A;  3EHT A;  1JNF A;  1YTV A;  1LBC A;  2A5S A;  5I58 A;  2QL3 A;  3H6W A;  2AYS A;  3EHS A;  5HM4 B;  3C31 A;  1MPD A;  1ZU0 A;  3PGF A;  4JWX A;  3OO6 A;  1CB6 A;  4G8N A;  1H45 A;  3MP8 A;  5LOM A;  1OVT A;  1ZMG A;  1SD3 A;  3TUS A;  1D9Y A;  4HTG A;  5KCJ B;  4H8J A;  3SEV A;  4ZEI A;  2VD3 A;  4N13 A;  1B7H A;  1JVY A;  2H98 A;  1B6H A;  1UQW A;  3GBB A;  3G7W A;  3ILU B;  1R1N A;  3O97 A;  1B7Z A;  4G68 B;  4I1D A;  2D3I A;  4OTE A;  1B3L A;  1Y4C A;  3V8X B;  1Y3N A;  3KSJ A;  3QUF A;  2DWI A;  1MRP A;  2YLN A;  4XKN A;  1N7W A;  1NH7 A;  1FW0 A;  4GIZ A;  4G2Z A;  4N07 A;  3BFT A;  4OZ9 A;  1IUD A;  4F3P A;  4NF4 B;  3CG1 A;  1Z7N E;  1A55 A;  1MXV A;  4GQO A;  4ONY A;  4XKP A;  5CMM A;  3FD3 A;  3I3V A;  3PMV A;  1VFE A;  4NWD A;  1IXG A;  4YU0 A;  3OEK A;  5DVJ A;  4E0X A;  1YCJ A;  3KOT A;  2Z8F A;  2DSF A;  1MM6 A;  1Q35 A;  4NED A;  2H99 A;  1JET A;  1O7T A;  1MY1 A;  3H06 B;  1N3X A;  2RC7 A;  3E4R A;  3G3F A;  3PD9 A;  4FJP A;  3N5L A;  1ZBM A;  4YAH X;  5FTH A;  1SVX B;  3JV9 A;  3I6V A;  3LSW A;  5KDT B;  1O63 A;  1SW4 A;  4R75 A;  1OLC A;  3C36 A;  3MWB A;  1NFT A;  1SW5 A;  5DEX B;  3MAM A;  4IGR A;  4XIG Q;  2UVI A;  3IAZ A;  2VGQ A;  3QYT A;  4FED A;  1SI0 A;  3RT8 A;  2OLB A;  1QKA A;  4BLA A;  2Z22 A;  4DLD A;  1FQF A;  3OXN A;  3FV1 A;  3N94 A;  3I5O A;  3KZG A;  4E0W A;  3KN3 A;  4FIM A;  2XXI A;  5F1Q A;  1PB9 A;  4YKI A;  3T22 A;  4BDR A;  3ONM A;  5CBR A;  1DTG A;  3IOR A;  1PB8 A;  2XXV A;  1QUJ A;  2W7Y A;  4OYV A;  3QXM A;  2V3U A;  2Y7P A;  4KQP A;  2I4C A;  2Q2A A;  4FE8 A;  4UA8 A;  3RUM A;  2DYX A;  3SKP A;  3FXR A;  4OHN A;  3RTW B;  1Z7M E;  1DOT A;  2GHA A;  3E3K A;  3M3F A;  3O2A A;  5EHM A;  2IA4 A;  3MVX A;  1MXU A;  3MZB A;  3OEN A;  4ELO A;  2DVZ A;  4RPO A;  5M2V A;  1A54 A;  3TCG A;  4F3S A;  4R6K A;  1B3G A;  1Y4T A;  4H8I A;  1H44 A;  2F8D A;  1D9V A;  2Y84 A;  4QFP A;  1P1W A;  4R2F A;  1FTL A;  3W9V A;  4IY6 A;  1FQE A;  2UXA A;  3N6T A;  3KG2 A;  4F1Y A;  4PFY A;  4ELR A;  1Y1M A;  1M5E A;  3FVG A;  3B7D A;  3TZA A;  5JEI A;  3TOD A;  3S9N C;  1LFG A;  1QKB A;  3QSL A;  1L5T A;  1SI1 A;  3V89 B;  3G3G A;  4DDD A;  5A5X B;  1VSO A;  4XKQ A;  3G3I A;  4GOT A;  4POW A;  2UVG A;  4QFL A;  3VDF A;  2NXO A;  3PUX E;  2QMW A;  3H03 A;  4OVJ A;  1S9T A;  1URD A;  3VXB A;  2REJ A;  3K02 A;  3A09 A;  4IY5 A;  4OMB A;  4QF9 A;  3CSB A;  2HCA A;  5KDT A;  3THI A;  1A7L A;  1LCF A;  1ELJ A;  3T9X B;  2PT2 A;  4R2B A;  3MZ1 A;  4KYE A;  5I57 B;  4IO2 A;  1SQY A;  4YB5 A;  4YKJ A;  3BFU A;  4RJZ A;  4ZEB A;  1MY2 A;  3QUJ A;  3PU5 A;  3HV1 A;  3C35 A;  2DE3 A;  3IJO B;  3S4U A;  5A5X A;  1D4N A;  2NVU B;  1BLF A;  1HSL A;  4XKR A;  2I48 A;  3HST A;  4KD5 A;  4RPN A;  3UK4 A;  1I6B A;  1GV8 A;  2ONK E;  4RK2 A;  3S9L C;  2ZYO A;  5AE4 A;  3O29 A;  1T0K A;  3B6T A;  1B46 A;  2DWA A;  1BKA A;  1QVS A;  1SDX A;  3EF7 A;  1Y3P A;  3IO6 A;  3OOA A;  2OK2 A;  4POX A;  4RXL A;  3TQL A;  4JSD A;  1RYO A;  1NNP A;  2X26 A;  3K1M A;  4PE5 B;  1PBQ A;  3D4C A;  2OCU A;  3FJM A;  1Q1K A;  3N26 A;  2VOZ A;  4UAC A;  1LST A;  3TMG A;  1IXC A;  4X1D A;  2HAU A;  1SW1 A;  4C1T A;  3KN8 A;  3F11 A;  3MW0 A;  5L9S A;  2FNC A;  3H3G A;  2FA7 A;  1ATG A;  3CVG A;  1B1H A;  2DWJ A;  3K6V A;  3U92 A;  5KCJ A;  4L17 A;  4AQ4 A;  2QRY A;  1PBP A;  1QW0 A;  3ODB A;  4RNS A;  5K2X A;  3SDF A;  2KLF A;  1JW5 A;  4I62 A;  3RNN A;  2DE2 A;  2Z8E A;  3N6U A;  2ONS A;  1DPE A;  4M1V A;  4PFW A;  3RY3 A;  1XOC A;  4G77 A;  3MJN A;  1XVX A;  3K1P A;  5FHO A;  1URS A;  5I58 B;  2Z23 A;  2D21 A;  2D5W A;  4GRK A;  5JK4 A;  2RKM A;  1NNT A;  3PD8 A;  1MY0 A;  1OQH A;  1WOD A;  4C0R A;  3VLW A;  3E9X A;  3HN0 A;  3FXQ A;  4H5F A;  2HQ0 A;  4F2Q A;  2PVU A;  4KCD A;  4PP0 A;  1MQI A;  2I3V A;  4NWC A;  1FQA A;  5TPA A;  1NMU A;  2H25 A;  3MQ9 A;  2NOO A;  1FQC A;  3MUQ A;  1P1O A;  1B9J A;  2XXP A;  3K6W A;  4KPT A;  4NF4 A;  4TQU Q;  3S9E A;  3MPL A;  1GTK A;  5DVF A;  4LQ5 A;  1TXF A;  1MQH A;  3EPE A;  3KJ7 A;  1A8E A;  1LAH E;  4F3B A;  3IB0 A;  3U1O A;  4HCW A;  3D4G A;  2PYY A;  4P11 A;  4TLL B; 
#chains in the Genus database with same CATH topology
 1DMB A;  3GZG A;  5AA4 B;  4GX3 A;  1RDX A;  1US4 A;  5I56 A;  5CM6 A;  5B7D A;  2H4I A;  1LBV A;  5I84 A;  4F1V A;  4BDQ A;  5CRY A;  4LZ5 A;  4OFJ A;  4PAF A;  1B51 A;  3U72 A;  4MJO A;  4OEN A;  2RF1 A;  3A3U A;  1MPB A;  5ET8 A;  1DK4 A;  3CFL A;  3TKD A;  3LC8 A;  2CMO A;  2I0B A;  4Q30 B;  1R9Q A;  5CMB A;  2VP1 A;  2AIX A;  5HPQ A;  3L6H A;  4N6K A;  2RC9 A;  2XHD A;  1EZO A;  4ELQ A;  4F22 A;  1HSE A;  2PFY A;  2UVJ A;  4I3Y A;  5DT6 A;  1KWH A;  2YPN A;  2Y7W A;  1AH5 A;  1LB8 A;  3VE1 B;  1R6Z A;  3FVO A;  3OSR A;  3FJ7 A;  4R74 A;  1H3D A;  1NL5 A;  4LZ7 A;  1ZKB A;  2FBP A;  1LB9 A;  4MNP A;  3IOW A;  1QUK A;  3O66 A;  1POT A;  4PC9 A;  5TP9 B;  1LAG E;  1NH8 A;  1LBB A;  4RYA A;  5A5L A;  5AA1 A;  4N15 A;  4FEC A;  1AL3 A;  3DEL B;  1P99 A;  2B65 A;  3TTM A;  1FPK A;  2XWK A;  3MVZ A;  1HSJ A;  4YIC A;  3PPP A;  2VHA A;  4OEV A;  2ZNT A;  3C32 A;  4PE3 A;  3PPN A;  1B52 A;  3IFA A;  4ND9 A;  4NX1 A;  4P9K A;  1O64 A;  4OER A;  3RYD A;  1UTB B;  4Q8R A;  1URG A;  3USD A;  1FBP A;  4FOR A;  3FAS A;  1B3F A;  3KJT A;  4JDF A;  3CG3 A;  4ECF A;  1SYH A;  2B3F A;  2CZH A;  2ZMB A;  1LLS A;  5L9O A;  3UGW A;  4OET A;  4P0I A;  4EDP A;  4YKK A;  4GL8 A;  2F3B A;  4U2R A;  2ZYK A;  4DCY A;  3Q27 A;  1MH4 A;  1B7U A;  4UAB A;  4NF8 A;  3UOR A;  1MXX A;  2ANJ A;  4ELP A;  3BBR A;  3P7I A;  4YKP A;  2XD3 A;  3U8Q A;  4JXI A;  1SYI A;  2DXR A;  4R9F A;  1INP A;  3Q29 A;  1FJ9 A;  3QK6 A;  2RCB A;  1FJ6 A;  3SEW A;  2F6G A;  4LP2 B;  4ZE8 A;  2ABH A;  4U4S A;  3T9U A;  5TP9 A;  1NUZ A;  1XVY A;  3K6X A;  2PT1 A;  1B2H A;  1M5C A;  1MDQ A;  1UTB A;  1IMF A;  5EQA A;  1NV5 A;  3KBR A;  3TQW A;  1M5D A;  3KSX A;  2B4L A;  3IX1 A;  2F7A A;  3T66 A;  5I5P A;  1BTJ A;  4JVD A;  4DCX A;  4WKM A;  4P47 A;  4O7I A;  4YB6 A;  3LBS A;  1B5J A;  4JB7 A;  5ET5 A;  2UYF A;  1I6A A;  2Q89 A;  2XWI A;  5KZT A;  4LZ8 A;  3FGS A;  4GWS A;  1PB7 A;  4N8G A;  1ZJL A;  4PTK A;  2FIX A;  3BIG A;  1MQD A;  1OLA A;  3PPQ A;  4OWD A;  2R6G E;  1IIT A;  4NF0 A;  4OFO A;  4IR8 A;  5CC2 A;  5IZZ A;  3O9P A;  3E78 A;  3CHG A;  4P0G A;  4ZEK A;  3PMW A;  2FVZ A;  4M4G A;  2OZZ A;  3OD7 A;  4O94 A;  2OJT A;  3OMB A;  5H8F B;  2I6E A;  3T9V A;  3TDJ A;  1Y20 A;  4P56 A;  2ZXT A;  4ZEF A;  3FZV A;  4KYS A;  1K9Y A;  3PUY E;  4EXL A;  2WBB A;  4PBH A;  4WXJ A;  1JQF A;  4NN3 A;  1JP4 A;  4G8M A;  2VPO A;  3KOS A;  4ZS9 A;  2A5S A;  2QL3 A;  3S9L C;  1MPD A;  1ZU0 A;  3PGF A;  1H45 A;  1SD3 A;  3TUS A;  4HTG A;  5KCJ B;  4P1L A;  3SEV A;  4ZEI A;  2H98 A;  1UQW A;  3ILU B;  1R1N A;  3O97 A;  4I1D A;  2D3I A;  1B3L A;  1Y4C A;  4XKN A;  4F3P A;  3T0J A;  4NF4 B;  4BDL A;  1A55 A;  1IMC A;  5CMM A;  1VFE A;  3KOT A;  2Z8F A;  2DSF A;  1FPJ A;  3E4R A;  5FTH A;  2RC7 A;  1SVX B;  1NV7 A;  5KDT B;  3C36 A;  3MAM A;  2ZZX A;  3IAZ A;  2HXR A;  3RT8 A;  4BLA A;  3KZG A;  3KN3 A;  4FIM A;  2XXI A;  1Q9D A;  1PB8 A;  2V3U A;  4UA8 A;  2Y7P A;  2I4C A;  3SZP A;  4OHN A;  3M3F A;  5EHM A;  3MZB A;  2DVZ A;  3TCG A;  4R6K A;  1H44 A;  2F8D A;  2Y84 A;  3W9V A;  1FQE A;  4F1Y A;  4ELR A;  3TOD A;  3V89 B;  5A5X B;  3VXB A;  2NXO A;  3TEP A;  1URD A;  3K02 A;  4IY5 A;  3CSB A;  5KDT A;  3MZ1 A;  1SQY A;  3BFU A;  3QUJ A;  3PU5 A;  3IJO B;  2DE3 A;  5A5X A;  2I48 A;  3HST A;  4KD5 A;  1IMA A;  3B6T A;  1FPF A;  2DWA A;  3IO6 A;  4POX A;  1RYO A;  2X26 A;  4PE5 B;  2OCU A;  3TMG A;  1Q1K A;  5L9S A;  2FNC A;  4XFE A;  4PFI A;  3H3G A;  3K6V A;  5KCJ A;  1B1H A;  1QW0 A;  3ODB A;  4RNS A;  5K2X A;  1NV1 A;  3RY3 A;  1DPE A;  5EQ7 A;  4G77 A;  5FHO A;  1URS A;  2Z23 A;  4OVQ A;  1MY0 A;  3FXQ A;  4H5F A;  2P3N A;  1FQA A;  2NOO A;  4KPT A;  2XXP A;  3K6W A;  3ZKK A;  1DBZ A;  4TLL B;  4EF1 A;  1MH3 A;  2GQ1 A;  4R9G A;  2F34 A;  3GXA A;  4C1U A;  3DP6 A;  1XT8 A;  1NV3 A;  3K0V A;  1IXI A;  4QSC A;  1MQJ A;  4MBP A;  2ZYM A;  1PEB A;  1NUX A;  4QSE A;  3CIJ A;  2GRV A;  1JEV A;  3TEL A;  2F7B A;  4IO4 A;  3KC1 A;  3G3J A;  3OSQ A;  4RY1 A;  3TTN A;  3MPK A;  1NNK A;  1JW4 A;  2E1S A;  3B8B A;  2L5V A;  2HZL A;  5EYF A;  2ZYN A;  4HE2 A;  3K4U A;  4F19 A;  1ZLQ A;  4QHQ A;  5J1D A;  2XD2 A;  1QUL A;  5CMK A;  2H5Y A;  5I59 B;  3UN6 A;  4GX6 A;  4N6P A;  5EHS A;  5IZ3 A;  4TOZ A;  2CZI A;  1FTJ A;  2Q8J A;  2Q2C A;  3K6U A;  3RPL A;  3S9M C;  2F35 A;  4U23 A;  5AA2 A;  4PET A;  3R6U A;  2THI A;  4R72 A;  1H43 A;  4I8C A;  3IB2 A;  3G3K A;  4IO6 A;  4JWY A;  4F39 A;  3B6W A;  4GBW A;  1B40 A;  4AS4 A;  1RKM A;  3CI8 A;  2HZK A;  3K2D A;  4NQ8 A;  5T3J A;  4GLI A;  1QUI A;  1N76 A;  4NF8 B;  4X9T A;  4BDO A;  1RDY A;  1NNF A;  5I2K B;  3PUV E;  2V84 A;  5AA3 A;  1AMF A;  3UP9 A;  1EU8 A;  3QMF A;  1JW1 A;  4EQ9 A;  2Z8D A;  2DVC A;  4FBP A;  3OO9 A;  1TFD A;  4NF6 A;  1XC1 A;  2O68 A;  4O8M A;  4RA1 A;  1OVB A;  1LGB C;  2XXH A;  3PUZ E;  4QRZ A;  5B70 A;  4PAI A;  2V93 A;  2PCR A;  2KQZ A;  1RDZ A;  1S50 A;  3OO8 A;  4I9D A;  5EYH A;  5H8Q B;  2OWZ A;  3VVD A;  5I2N A;  5IGA A;  2ZNS A;  3TTR A;  1FSA A;  3VV5 A;  4Q0C A;  4YMB A;  2QS1 A;  4GWX A;  1DTZ A;  3UIF A;  1DCU A;  3EHU A;  2V25 A;  4GWY A;  3TFL A;  1N0T A;  4PF6 A;  4MF3 A;  4GVO A;  1FQD A;  4H65 A;  3U65 A;  2GH9 A;  3MVW A;  5K2Y A;  3RQT A;  2MKZ A;  2YJP A;  3GBA A;  4GWO A;  1EH3 A;  5FHN A;  2WKY A;  4QFN A;  4LA9 A;  1A8F A;  2XXW A;  2O1M A;  2IEE A;  3H6T A;  3FVN A;  3FXU A;  4PDH A;  4JVC A;  1B0L A;  4ESW A;  3RT6 B;  4EXK A;  3TYH A;  3L6G A;  3PPO A;  3T9H B;  4ESX A;  4KYD A;  3HO7 A;  1MXY A;  4K3F A;  2O84 X;  1LAX A;  3R26 A;  4KCC A;  3TTK A;  2P2A A;  5IKB A;  3C4M A;  3FV2 A;  5BWJ A;  1NV2 A;  4ZDM A;  3MP6 A;  1AIV A;  1LBX A;  4MH5 A;  4DIG A;  1FTA A;  4NF5 B;  4O3A A;  2VD2 A;  3LSL A;  3FUZ A;  2I58 A;  3T96 B;  1RYX A;  4DE8 A;  2DWH A;  3R7X A;  5I56 B;  5IAI A;  3WAE A;  1POY 1;  1LFH A;  1Y3Q A;  1BK4 A;  1ZIU A;  5AA4 A;  4MFI A;  2HXW A;  2OWS A;  4N81 A;  3PV0 E;  3CFX A;  5DEX A;  1LFI A;  1MPC A;  3Q25 A;  3K00 A;  3MYU A;  1B5H A;  5TU0 A;  2O6A A;  2CEX A;  3IO4 A;  3DP4 A;  4EF2 A;  4Q5T A;  1FCK A;  4U22 A;  3MC2 A;  3LUZ A;  5ISU A;  4NTL A;  3V83 A;  4PF8 A;  4EUO A;  2CZL A;  4LUB A;  1JVX A;  3EHS A;  5HM4 B;  4JWX A;  1FPB A;  1B7H A;  4GWU A;  4QXD A;  3G7W A;  4G68 B;  1Y3N A;  3QUF A;  2YLN A;  1MRP A;  1FBH A;  4G2Z A;  4N07 A;  4OZ9 A;  1IUD A;  3CG1 A;  3FD3 A;  3I3V A;  3OEK A;  1YCJ A;  1O7T A;  5I57 A;  4FJP A;  3JV9 A;  1O63 A;  1SW4 A;  1SW5 A;  2VGQ A;  3QYT A;  1SI0 A;  4DLD A;  3OXN A;  3N94 A;  3I5O A;  5CBR A;  1FPE A;  3IOR A;  2XXV A;  2W7Y A;  3QXM A;  1FRP A;  1YYZ A;  3SKP A;  1KA0 A;  3RTW B;  1Z7M E;  2IA4 A;  1XI6 A;  2Y5K A;  1A54 A;  1Y4T A;  4H8I A;  2UXA A;  4NHB A;  1Y1M A;  3S9N C;  1QKB A;  3QSL A;  3G3I A;  4POW A;  2QMW A;  2REJ A;  3T9X B;  1ELJ A;  4R2B A;  5I57 B;  3FXB A;  4RJZ A;  2OX3 A;  3HV1 A;  4XKR A;  3UK4 A;  2QVR A;  1FBC A;  4RK2 A;  2ZYO A;  5AE4 A;  3O29 A;  2Y5L A;  1QVS A;  4AS5 A;  2OK2 A;  4RXL A;  3TQL A;  4JSD A;  3N26 A;  2VOZ A;  4NGU A;  1LST A;  1IXC A;  1SPI A;  1SW1 A;  4C1T A;  3MW0 A;  1ATG A;  3CVG A;  2FIE A;  4MCO A;  3U92 A;  1PBP A;  2KLF A;  1JW5 A;  2DE2 A;  3MJN A;  3K1P A;  4GRK A;  1NNT A;  3PD8 A;  4C0R A;  3VLW A;  4OVT A;  4PP0 A;  1MQI A;  4NWC A;  2H25 A;  3MQ9 A;  1FQC A;  3NOH A;  1GTK A;  3IB0 A;  4HCW A;  3D4G A;  4O3B A;  3SEU A;  5DYH A;  1TT1 A;  4G68 A;  4Z0I A;  3JZJ A;  2G93 A;  4PFB A;  1GVC A;  3PPR A;  1N84 A;  1UTH A;  4F29 A;  1VR5 A;  3O6G A;  4THI A;  3IB1 A;  3VXC A;  4RK9 A;  3ZS6 A;  4NF5 A;  2F5X A;  3LV0 A;  1IQ7 A;  3IR1 A;  4OXV A;  3VVE A;  4KI0 E;  3AXF A;  4OVP A;  2F78 A;  4OAN A;  5DEX B;  1B1X A;  1TFA A;  5TPA B;  5J16 A;  1J1N A;  5DTB A;  3BKI B;  1LBW A;  4IO7 A;  5CI5 A;  1B4H A;  3Q26 A;  3Q28 A;  4I40 A;  5H8N A;  5H8F A;  3QAX A;  2A5T A;  1US5 A;  3KEI A;  4MX6 A;  2XX7 A;  1MY4 A;  3UA8 A;  4H6D A;  2M8C A;  5ICQ A;  3ZKL A;  4R73 A;  3FJG A;  2BJJ X;  4U1Z A;  1B05 A;  3DLN A;  4MLQ A;  3OEM A;  2ONR A;  1EYI A;  4F18 A;  3IFC A;  1UIV A;  2DS9 A;  4X04 A;  2GFE A;  4TLM B;  3SES A;  4XF5 A;  4GBV A;  3PMX A;  4PQJ A;  3CRB A;  5AA2 D;  2XXU A;  4G4P A;  1FTM A;  1N7X A;  2X7Q A;  5FTI A;  3EQ1 A;  4YMA A;  4DI4 B;  1D3K A;  3O6I A;  2V3T A;  4IO5 A;  1NKX A;  3MBP A;  2F97 A;  2VPN A;  3A3C A;  2E0S A;  2WX9 A;  4MLV A;  3H4Z A;  2XXQ A;  4Z7E A;  4HCY A;  4G8H A;  4PFT A;  3SEX A;  3KBZ A;  1SBP A;  1GGG A;  4DZ1 A;  4QFK A;  4N17 A;  4NF6 B;  1YXI A;  5JTY A;  2P1S A;  4OEU A;  1YAE A;  1NV0 A;  2NWJ A;  4N8Y A;  4XTC Q;  2Q9T A;  3HHF A;  4HE1 A;  4NG7 A;  2B3B A;  4GWZ A;  1B32 A;  1LBZ A;  4N91 A;  5CBS A;  4F1U A;  2QS4 A;  5FBP A;  1AWB A;  3CFZ A;  1WVJ A;  2P3V A;  2WBD A;  5IM2 A;  2ESN A;  2XXT A;  1CE2 A;  2NUV A;  3M3L A;  3VFJ A;  1OMP A;  2F7C A;  1MQG A;  1P1N A;  4R6Y A;  3E79 A;  3M8U A;  1FQB A;  4HS7 A;  3VLV A;  3KGC A;  3OEL A;  3U94 A;  5ET7 A;  1VFD A;  1Y1Z A;  4N4U A;  2I0C A;  3O28 A;  1CNQ A;  1FTK A;  3K1N A;  2I3W A;  1DPP A;  5L8D A;  2PBW A;  4X48 A;  4XEQ A;  3W9W A;  5L9M A;  4X8R A;  1ANF A;  2QPQ A;  1BIY A;  3TPA A;  2O51 A;  4LN5 A;  3E13 X;  1MS7 A;  2QMX A;  4GXA A;  4OFL A;  2Q8M A;  2XWO A;  3IOT A;  2XX9 A;  4ZEC A;  4LVQ A;  4IB2 A;  2PX1 A;  3EN3 A;  4R6H A;  4JSO A;  1N3W A;  1PC3 A;  2V4C A;  1KA1 A;  3H6V A;  1F9B A;  1Y9U A;  5AA2 B;  3IJX B;  5DW8 A;  3T93 B;  4F2O A;  2KR0 A;  5HBC A;  2RC8 A;  1P1U A;  3RPL B;  4KR5 A;  4MAG A;  1N04 A;  3KFM A;  2XWV A;  1B3H A;  4PFR A;  3M3K A;  1WDN A;  1P1Q A;  4XXU A;  4QFO A;  1IZ1 A;  1USY E;  3WAF A;  3ZSF A;  2B4M A;  1QJM A;  4DXC A;  2VT5 A;  1DSN A;  4BDM A;  2LAO A;  2OBG A;  5I7I A;  4H67 A;  4H1X A;  2HAV A;  1OIB A;  3LUY A;  4P1E A;  1BP5 A;  4F31 B;  3BIH A;  2WYK A;  2XXK A;  3VLU A;  1B4Z A;  2V3Q A;  4U1O A;  2PMS A;  1XHY A;  2RIN A;  4YB7 A;  5ET6 A;  4U4X A;  3ROJ A;  4IGT A;  1MXZ A;  3FVK A;  5F24 A;  4X1B A;  4ZZE A;  1LBY A;  3RGY A;  1I6Q A;  2F6P A;  4U21 A;  3V5A A;  4G68 C;  1G0I A;  4NAP A;  2WYP A;  5I58 A;  3H6W A;  2AYS A;  3C31 A;  3OO6 A;  2QVV A;  4I3E A;  5LOM A;  1D9Y A;  1G0H A;  4H8J A;  2VD3 A;  4N13 A;  3GBB A;  3HFU A;  1N7W A;  1NH7 A;  1FW0 A;  4GIZ A;  3BFT A;  4GQO A;  1Z7N E;  4XKP A;  5DVJ A;  1NUW A;  3PMV A;  4NWD A;  4E0X A;  3KC0 A;  4NED A;  1MY1 A;  3H06 B;  1N3X A;  4YAH X;  1ZBM A;  4OVR A;  4R75 A;  3MWB A;  4IGR A;  4XIG Q;  4FED A;  2OLB A;  4H46 A;  1QKA A;  2Z22 A;  1FQF A;  3FV1 A;  3PTY A;  4MHF A;  5F1Q A;  1PB9 A;  4YKI A;  3T22 A;  1DTG A;  1EYK A;  1NV6 A;  4OYV A;  1QUJ A;  2Q2A A;  2DYX A;  3FXR A;  2GHA A;  3O2A A;  1MXU A;  3OEN A;  4OVS A;  4F3S A;  1B3G A;  4QFP A;  1D9V A;  1P1W A;  1FTL A;  4IY6 A;  3N6T A;  4PDD A;  1FPI A;  5JEI A;  1M5E A;  3B7D A;  1L5T A;  1SI1 A;  3G3G A;  4DDD A;  1VSO A;  4GOT A;  3VDF A;  2UVG A;  3PUX E;  1S9T A;  4P3L A;  1FBG A;  1A7L A;  1LCF A;  2PT2 A;  4YB5 A;  4YKJ A;  4ZEB A;  2HPG A;  3C35 A;  1I6B A;  1GV8 A;  1BKA A;  3EF7 A;  1NNP A;  3FJM A;  4UAC A;  4X1D A;  4AQ4 A;  2QRY A;  3SDF A;  2Z8E A;  3N6U A;  4PAK A;  2ONS A;  1XOC A;  5I58 B;  2D21 A;  2WEF A;  1OQH A;  3E9X A;  3HN0 A;  2HQ0 A;  4F2Q A;  2PVU A;  3MUQ A;  2CZK A;  3S9E A;  1B9J A;  4NF4 A;  4TQU Q;  5DVF A;  1MQH A;  4QBA A;  3EPE A;  3KJ7 A;  1LAH E;  3U1O A;  3C34 A;  2PYY A;  1K9Z A;  2Q74 A;  3RTF B;  2QJE A;  2ZZW A;  3MZ9 A;  4ISU A;  2BJI A;  2XXY A;  4LAT A;  1R9L A;  4OES A;  5LDZ A;  3VVF A;  2XA5 A;  4KFQ A;  4OQO A;  1EZP A;  1UIU A;  1B5I A;  1TWY A;  1M5B A;  1VE4 A;  5ITO A;  4JVI A;  4FEB A;  1USY H;  5CMC A;  5ICT A;  2DQV A;  4EQ7 A;  2ZNU A;  5H8H A;  1ZTY A;  2QVU A;  3C33 A;  2HEU A;  2JJK A;  5BUU A;  1IXH A;  3MVY A;  4WED A;  4F3G A;  4H5G A;  4MMP A;  3RN8 A;  2RCA A;  5ESY A;  1M5F A;  3U93 A;  2XX8 A;  3S2V A;  1II5 A;  3FIR A;  1LEV A;  2PFZ A;  3HPI A;  3A29 A;  4BDN A;  4FAJ A;  1H76 A;  3HCQ A;  1OQG A;  4KHZ E;  1IIW A;  1JEU A;  5ELV A;  1SW2 A;  1YPN A;  3IOV A;  4DXU A;  5FHM A;  1YZ0 A;  4N6D A;  1MDP 1;  4FAT A;  4QSD A;  1EZ9 A;  4ZE9 A;  3ECR A;  3OO7 A;  4JBZ A;  3JYR A;  5LTC A;  1FTO A;  5I2N B;  3TTL A;  5H8Q A;  4AB5 A;  4GF8 A;  5ITP A;  2DP8 A;  1GR2 A;  3ILT B;  4PFU A;  1B0H A;  1FPG A;  2DOJ A;  3H6U A;  1A40 A;  2HFB A;  3LR1 A;  3IK6 B;  3B50 A;  2Y7K A;  3K01 A;  2FYI A;  5JTY B;  2O7U A;  1FBF A;  2X7P A;  2AL5 A;  4HE0 A;  5F7V A;  3D1R A;  4JWO A;  4LQ2 A;  5I3S A;  2QS3 A;  4H0W A;  2DXY A;  4DI3 D;  1XS5 A;  3C9H A;  3TAJ A;  2R9J A;  3GYY A;  5H8S A;  4GD5 A;  2Q88 A;  4O3C A;  2OWT A;  1LAF E;  2O69 A;  3H7M A;  4ZED A;  3SER A;  3B6Q A;  4GFR A;  4H45 A;  3FBP A;  4NE4 A;  2R71 A;  2REG A;  4P8B A;  1B58 A;  3SET A;  5DVI A;  2QSX A;  4EQB A;  4DXB A;  1MG1 A;  5I2K A;  2G29 A;  1B3E A;  1QGX A;  1IME A;  3LSX A;  4OA4 A;  3MP1 A;  3FAT A;  4WEP A;  2ALU A;  1D9Q A;  2AL4 A;  3TCH A;  3CSG A;  3MST A;  3IL1 B;  1LCT A;  2UVH A;  3SEY A;  3CR9 A;  4GXS B;  3GLB A;  3QIM A;  3RPW A;  4GL0 A;  2A5T B;  3TCF A;  2O1L A;  3IOU A;  1IMB A;  3PUW E;  2QS2 A;  2DE4 A;  2F36 A;  4ZZA A;  2F3D A;  5IZ3 B;  1A99 A;  1IEJ A;  1PDA A;  2UYE A;  1IMD A;  3HHG A;  5I59 A;  1MM7 A;  2Y7R A;  3W15 C;  2GHB A;  1I69 A;  4IO3 A;  2Y7I A;  3O6H A;  4AB6 A;  1KZ8 A;  1MXW A;  3DP8 A;  4HW8 A;  2I49 A;  1S7Y A;  1UTH B;  4KXP A;  3LSF B;  4GX4 A;  2H9B A;  5H8N B;  2P0S A;  2O7I A;  4NMY A;  3DM0 A;  4MIJ A;  2R8T A;  3KN7 A;  5TPA A;  2XXR A;  4LON B;  5H8H B;  4G61 A;  1AOV A;  1MY3 A;  2XXX A;  4MEV A;  4YZZ A;  3G3H A;  2QFL A;  2I4B A;  3RLF E;  1FPD A;  3EHT A;  1JNF A;  1YTV A;  1LBC A;  4G8N A;  1CB6 A;  3MP8 A;  1OVT A;  1ZMG A;  1JVY A;  1B6H A;  4PCD A;  4OTE A;  1B7Z A;  4PGP A;  2DDK A;  3V8X B;  3KSJ A;  2DWI A;  4MNC A;  2ZZV A;  2HHM A;  4ONY A;  1MXV A;  4YU0 A;  1IXG A;  4GWW A;  1MM6 A;  1Q35 A;  2H99 A;  1JET A;  3PD9 A;  3G3F A;  3N5L A;  1VDW A;  3I6V A;  3LSW A;  1OLC A;  1NFT A;  2UVI A;  3ISP A;  1NI9 A;  4E0W A;  4BDR A;  1FBE A;  3ONM A;  4XKQ A;  4KQP A;  4FE8 A;  5IZ1 A;  3RUM A;  1DOT A;  3E3K A;  3MVX A;  4ELO A;  4RPO A;  5M2V A;  4MNI A;  5EQ8 A;  4R2F A;  1NV4 A;  3KG2 A;  4PFY A;  3FVG A;  3TZA A;  1LFG A;  2FHY A;  4PGN A;  4QFL A;  4OVJ A;  3H03 A;  1NUY A;  3A09 A;  4OMB A;  4QF9 A;  1FPL A;  2HCA A;  3THI A;  5EQ9 A;  4KYE A;  4IO2 A;  1MY2 A;  3S4U A;  1D4N A;  2NVU B;  1BLF A;  1HSL A;  4RPN A;  2ONK E;  1EYJ A;  1T0K A;  1B46 A;  1SDX A;  1Y3P A;  3OOA A;  4HXV A;  3K1M A;  1PBQ A;  3D4C A;  2HAU A;  3KN8 A;  3F11 A;  4PBQ A;  2FA7 A;  2DWJ A;  4L17 A;  3RNN A;  4I62 A;  4PFW A;  4M1V A;  1XVX A;  1FBD A;  3EKI A;  2D5W A;  5JK4 A;  2RKM A;  1WOD A;  2CEY A;  4KCD A;  2I3V A;  4O7M A;  1NMU A;  1P1O A;  3MPL A;  4LQ5 A;  1TXF A;  1A8E A;  4F3B A;  3T1B A;  4P11 A;  5EYG A; 
#chains in the Genus database with same CATH homology
 4EF1 A;  1DMB A;  3RTF B;  2QJE A;  4O3B A;  3SEU A;  5DYH A;  3GZG A;  1MH3 A;  1TT1 A;  4G68 A;  5AA4 B;  4Z0I A;  3JZJ A;  2G93 A;  4R9G A;  3TEP A;  2F34 A;  1US4 A;  3GXA A;  3MZ9 A;  4ISU A;  4C1U A;  3DP6 A;  2XXY A;  5B7D A;  2H4I A;  5CM6 A;  1GVC A;  5I56 A;  1XT8 A;  3PPR A;  4LAT A;  5I84 A;  1N84 A;  1R9L A;  1UTH A;  3K0V A;  1IXI A;  4OES A;  4QSC A;  4BDQ A;  4F29 A;  4F1V A;  5CRY A;  4LZ5 A;  1VR5 A;  3O6G A;  4OFJ A;  3IB1 A;  4THI A;  1MQJ A;  4RK9 A;  3VXC A;  4MBP A;  3ZS6 A;  4NF5 A;  3VVF A;  1B51 A;  2ZYM A;  1PEB A;  2F5X A;  4QSE A;  4KFQ A;  4OQO A;  3U72 A;  1EZP A;  1UIU A;  1B5I A;  1IQ7 A;  3CIJ A;  4OEN A;  1TWY A;  2RF1 A;  1MPB A;  3A3U A;  3IR1 A;  4OXV A;  1M5B A;  2GRV A;  1VE4 A;  1JEV A;  3CFL A;  5ITO A;  3TKD A;  3TEL A;  2F7B A;  4FEB A;  3VVE A;  4KI0 E;  3LC8 A;  3AXF A;  1USY H;  2CMO A;  5CMC A;  2I0B A;  4BDL A;  5ICT A;  2F78 A;  2DQV A;  4EQ7 A;  4Q30 B;  1R9Q A;  2ZNU A;  5CMB A;  5H8H A;  5I57 A;  1ZTY A;  2VP1 A;  3G3J A;  3OSQ A;  2AIX A;  1B1X A;  1TFA A;  3L6H A;  4IO4 A;  1J1N A;  4RY1 A;  3BKI B;  5DTB A;  5TPA B;  3TTN A;  4IO7 A;  3MPK A;  3C33 A;  1NNK A;  5CI5 A;  1B4H A;  2RC9 A;  1JW4 A;  2E1S A;  3Q28 A;  3Q26 A;  2HEU A;  5H8N A;  2HZL A;  5BUU A;  5H8F A;  5EYF A;  3QAX A;  2XHD A;  2A5T A;  1US5 A;  3KEI A;  1EZO A;  1IXH A;  3MVY A;  4WED A;  4ELQ A;  4F3G A;  2ZYN A;  4H5G A;  4F22 A;  2XX7 A;  1HSE A;  3RN8 A;  1MY4 A;  2UVJ A;  2RCA A;  3K4U A;  1ZLQ A;  5DT6 A;  1M5F A;  4QHQ A;  1KWH A;  2YPN A;  3UA8 A;  2Y7W A;  1AH5 A;  4H6D A;  5J1D A;  1LB8 A;  2M8C A;  3U93 A;  3VE1 B;  5ICQ A;  1R6Z A;  2XX8 A;  3S2V A;  3FVO A;  2XD2 A;  1II5 A;  3FIR A;  3FJ7 A;  1H3D A;  1NL5 A;  1QUL A;  3FJG A;  3OSR A;  4LZ7 A;  4R73 A;  2H5Y A;  1ZKB A;  2BJJ X;  3ZKL A;  5CMK A;  3HPI A;  5I59 B;  4U1Z A;  1LB9 A;  3UN6 A;  1B05 A;  3DLN A;  3IOW A;  4MLQ A;  4BDN A;  4N6P A;  4FAJ A;  1H76 A;  3OEM A;  2ONR A;  5EHS A;  1QUK A;  4TOZ A;  4F18 A;  3HCQ A;  1UIV A;  2DS9 A;  3O66 A;  1OQG A;  1POT A;  4KHZ E;  1IIW A;  1FTJ A;  5TP9 B;  2GFE A;  1LAG E;  1JEU A;  2Q2C A;  4TLM B;  1NH8 A;  3K6U A;  1LBB A;  4RYA A;  5ELV A;  2Q8J A;  3SES A;  1SW2 A;  1YPN A;  4F19 A;  3S9M C;  3PMX A;  5AA1 A;  4PQJ A;  3IOV A;  4FEC A;  4DXU A;  2F35 A;  3CRB A;  1AL3 A;  3DEL B;  4U23 A;  1P99 A;  5FHM A;  5AA2 A;  5AA2 D;  2B65 A;  1MDP 1;  2XXU A;  2THI A;  3R6U A;  4PET A;  4G4P A;  1FTM A;  1N7X A;  4QSD A;  4R72 A;  3TTM A;  4FAT A;  1H43 A;  4I8C A;  3MVZ A;  1EZ9 A;  1HSJ A;  2X7Q A;  3IB2 A;  3PPP A;  4YIC A;  4ZE9 A;  2VHA A;  5FTI A;  3EQ1 A;  4YMA A;  4OEV A;  2ZNT A;  3C32 A;  3G3K A;  4IO6 A;  4JWY A;  1D3K A;  3ECR A;  4F39 A;  3OO7 A;  3B6W A;  3O6I A;  4JBZ A;  2V3T A;  3JYR A;  1B40 A;  3PPN A;  4IO5 A;  1B52 A;  1NKX A;  3MBP A;  1RKM A;  2F97 A;  4ND9 A;  1FTO A;  3CI8 A;  2HZK A;  3K2D A;  5I2N B;  3A3C A;  3TTL A;  4GLI A;  1O64 A;  1QUI A;  1N76 A;  2E0S A;  4MLV A;  4NF8 B;  4OER A;  1UTB B;  4X9T A;  4BDO A;  5H8Q A;  4Q8R A;  1URG A;  3USD A;  3H4Z A;  4AB5 A;  1NNF A;  4FOR A;  4GF8 A;  2XXQ A;  5I2K B;  4Z7E A;  3FAS A;  4HCY A;  5ITP A;  1B3F A;  3KJT A;  4G8H A;  4PFT A;  3PUV E;  2V84 A;  2DP8 A;  1GR2 A;  3SEX A;  5AA3 A;  3ILT B;  4PFU A;  1SBP A;  1B0H A;  1GGG A;  1AMF A;  3UP9 A;  2DOJ A;  4JDF A;  3CG3 A;  1EU8 A;  4ECF A;  4DZ1 A;  1SYH A;  3H6U A;  1A40 A;  4QFK A;  2B3F A;  1JW1 A;  2HFB A;  3LR1 A;  4NF6 B;  2Z8D A;  2ZMB A;  3IK6 B;  3W15 C;  2DVC A;  4EQ9 A;  2Y7K A;  2P1S A;  5JTY A;  3K01 A;  2FYI A;  1LLS A;  3OO9 A;  5L9O A;  4OEU A;  5JTY B;  1YAE A;  3UGW A;  4OET A;  1TFD A;  2O7U A;  4NF6 A;  2NWJ A;  4P0I A;  1XC1 A;  4XTC Q;  2X7P A;  2Q9T A;  2O68 A;  3HHF A;  4RA1 A;  1OVB A;  4YKK A;  4EDP A;  2AL5 A;  2B3B A;  1LGB C;  2XXH A;  3PUZ E;  4QRZ A;  4JWO A;  5F7V A;  5B70 A;  4LQ2 A;  2V93 A;  4GL8 A;  1B32 A;  4U2R A;  1S50 A;  5CBS A;  2QS3 A;  2ZYK A;  4F1U A;  4H0W A;  4DCY A;  3OO8 A;  2DXY A;  2QS4 A;  1XS5 A;  1MH4 A;  1B7U A;  3C9H A;  3CFZ A;  3Q27 A;  4I9D A;  2R9J A;  3TAJ A;  1WVJ A;  5H8Q B;  5H8S A;  4GD5 A;  4NF8 A;  2Q88 A;  4O3C A;  3UOR A;  1MXX A;  2ANJ A;  2ESN A;  2XXT A;  3VVD A;  4ELP A;  5I2N A;  2OWT A;  1CE2 A;  1LAF E;  2O69 A;  3BBR A;  2NUV A;  3M3L A;  3P7I A;  3VFJ A;  1OMP A;  2F7C A;  3H7M A;  4YKP A;  4ZED A;  2ZNS A;  2XD3 A;  1MQG A;  1P1N A;  3SER A;  4R6Y A;  3TTR A;  3U8Q A;  3B6Q A;  4GFR A;  3M8U A;  4JXI A;  3VV5 A;  1FQB A;  1SYI A;  2DXR A;  4Q0C A;  4HS7 A;  3VLV A;  4YMB A;  4R9F A;  3KGC A;  2QS1 A;  4BDM A;  3OEL A;  4NE4 A;  3U94 A;  2R71 A;  2REG A;  1DTZ A;  3Q29 A;  3QK6 A;  1VFD A;  1Y1Z A;  2RCB A;  3UIF A;  3EHU A;  2V25 A;  2I0C A;  1B58 A;  3O28 A;  3TFL A;  3SET A;  1N0T A;  3SEW A;  2F6G A;  5DVI A;  1FTK A;  2QSX A;  4MF3 A;  4GVO A;  4LP2 B;  3K1N A;  4ZE8 A;  2I3W A;  1FQD A;  1DPP A;  2ABH A;  4U4S A;  5L8D A;  3T9U A;  4H65 A;  4EQB A;  5TP9 A;  2PBW A;  2GH9 A;  4X48 A;  4DXB A;  1MG1 A;  5I2K A;  2G29 A;  1B3E A;  1XVY A;  3K6X A;  3MVW A;  3W9W A;  5K2Y A;  5L9M A;  2PT1 A;  3RQT A;  1ANF A;  2QPQ A;  1B2H A;  1M5C A;  1MDQ A;  2YJP A;  3GBA A;  4GWO A;  1UTB A;  1EH3 A;  3C34 A;  3KBR A;  3LSX A;  5FHN A;  1M5D A;  3KSX A;  1BIY A;  3TQW A;  3TPA A;  2O51 A;  5HPQ A;  2WKY A;  3MP1 A;  3E13 X;  1MS7 A;  3FAT A;  3IX1 A;  2QMX A;  4LA9 A;  4QFN A;  4GXA A;  2F7A A;  1A8F A;  4OFL A;  4WEP A;  2XXW A;  3T66 A;  2ALU A;  3IOT A;  2O1M A;  2AL4 A;  2IEE A;  2XX9 A;  1BTJ A;  3TCH A;  3CSG A;  3H6T A;  3FVN A;  4ZEC A;  4LVQ A;  4IB2 A;  3IL1 B;  1LCT A;  2UVH A;  3FXU A;  3CR9 A;  4GXS B;  3SEY A;  2PX1 A;  3EN3 A;  4WKM A;  4R6H A;  4DCX A;  1B0L A;  1N3W A;  4JSO A;  4ESW A;  1PC3 A;  3GLB A;  3RT6 B;  4EXK A;  3QIM A;  3RPW A;  4YB6 A;  3H6V A;  3LBS A;  4GL0 A;  1B5J A;  2A5T B;  1F9B A;  1Y9U A;  4JB7 A;  3TYH A;  5AA2 B;  3IJX B;  3TCF A;  3L6G A;  2UYF A;  1I6A A;  2Q89 A;  3T93 B;  2O1L A;  5KZT A;  4LZ8 A;  4F2O A;  3PPO A;  3FGS A;  5HBC A;  3T9H B;  4ESX A;  4KYD A;  2RC8 A;  1P1U A;  3IOU A;  3HO7 A;  1MXY A;  4KR5 A;  4K3F A;  1N04 A;  3KFM A;  3PUW E;  2O84 X;  1LAX A;  3R26 A;  1B3H A;  2QS2 A;  1PB7 A;  4KCC A;  3TTK A;  2DE4 A;  2F36 A;  1ZJL A;  2P2A A;  3M3K A;  4ZZA A;  5IKB A;  1WDN A;  1P1Q A;  4XXU A;  1A99 A;  3C4M A;  4QFO A;  1IEJ A;  1IZ1 A;  1PDA A;  1USY E;  2UYE A;  1MQD A;  3FV2 A;  3WAF A;  5BWJ A;  3HHG A;  3ZSF A;  1OLA A;  1QJM A;  4DXC A;  3PPQ A;  4ZDM A;  3MP6 A;  5I59 A;  4OWD A;  1AIV A;  1MM7 A;  2R6G E;  2Y7R A;  1IIT A;  1DSN A;  1I69 A;  2GHB A;  2LAO A;  2OBG A;  2Y7I A;  3O6H A;  4H67 A;  4IO3 A;  4MH5 A;  4OFO A;  4DIG A;  5CC2 A;  4H1X A;  2HAV A;  4NF5 B;  3O9P A;  4O3A A;  2VD2 A;  1OIB A;  3LSL A;  1MXW A;  3DP8 A;  3FUZ A;  4AB6 A;  4HW8 A;  2I58 A;  3T96 B;  4P0G A;  2I49 A;  4ZEK A;  3LUY A;  3PMW A;  1S7Y A;  1UTH B;  1BP5 A;  1RYX A;  4DE8 A;  2DWH A;  3R7X A;  4F31 B;  4M4G A;  3LSF B;  2OZZ A;  3OD7 A;  3WAE A;  5I56 B;  5IAI A;  1POY 1;  1LFH A;  2H9B A;  1Y3Q A;  2OJT A;  1B4Z A;  3OMB A;  5H8F B;  3VLU A;  5H8N B;  1ZIU A;  5AA4 A;  2V3Q A;  2I6E A;  3T9V A;  4MFI A;  2P0S A;  2HXW A;  2OWS A;  2O7I A;  4U1O A;  4NMY A;  3TDJ A;  3DM0 A;  2PMS A;  1XHY A;  1Y20 A;  2RIN A;  2ZXT A;  3CFX A;  3KN7 A;  3PV0 E;  1LFI A;  1MPC A;  4R74 A;  2XXR A;  4YB7 A;  3Q25 A;  4LON B;  3K00 A;  5DEX A;  5H8H B;  4ZEF A;  1B5H A;  4U4X A;  5TU0 A;  3FZV A;  4KYS A;  2O6A A;  4IGT A;  3ZKK A;  3IO4 A;  3PUY E;  3DP4 A;  4EF2 A;  4EXL A;  1AOV A;  1MY3 A;  1MXZ A;  4Q5T A;  3FVK A;  4X1B A;  1FCK A;  2XXX A;  4ZZE A;  4U22 A;  4YZZ A;  4WXJ A;  3MC2 A;  1JQF A;  3RGY A;  3G3H A;  5ISU A;  1I6Q A;  2F6P A;  4G8M A;  4NTL A;  4U21 A;  3V5A A;  3KOS A;  4G68 C;  3V83 A;  2I4B A;  4EUO A;  3RLF E;  2CZL A;  4LUB A;  4ZS9 A;  1JVX A;  3EHT A;  1JNF A;  1YTV A;  1LBC A;  2A5S A;  5I58 A;  2QL3 A;  3H6W A;  2AYS A;  3EHS A;  5HM4 B;  3C31 A;  1MPD A;  1ZU0 A;  3PGF A;  4JWX A;  3OO6 A;  1CB6 A;  4G8N A;  1H45 A;  3MP8 A;  5LOM A;  1OVT A;  1ZMG A;  1SD3 A;  3TUS A;  1D9Y A;  4HTG A;  5KCJ B;  4H8J A;  3SEV A;  4ZEI A;  2VD3 A;  4N13 A;  1B7H A;  1JVY A;  2H98 A;  1B6H A;  1UQW A;  3GBB A;  3G7W A;  3ILU B;  1R1N A;  3O97 A;  1B7Z A;  4G68 B;  4I1D A;  2D3I A;  4OTE A;  1B3L A;  1Y4C A;  3V8X B;  1Y3N A;  3KSJ A;  3QUF A;  2DWI A;  1MRP A;  2YLN A;  4XKN A;  1N7W A;  1NH7 A;  1FW0 A;  4GIZ A;  4G2Z A;  4N07 A;  3BFT A;  4OZ9 A;  1IUD A;  4F3P A;  4NF4 B;  3CG1 A;  1Z7N E;  1A55 A;  1MXV A;  4GQO A;  4ONY A;  4XKP A;  5CMM A;  3FD3 A;  3I3V A;  3PMV A;  1VFE A;  4NWD A;  1IXG A;  4YU0 A;  3OEK A;  5DVJ A;  4E0X A;  1YCJ A;  3KOT A;  2Z8F A;  2DSF A;  1MM6 A;  1Q35 A;  4NED A;  2H99 A;  1JET A;  1O7T A;  1MY1 A;  3H06 B;  1N3X A;  2RC7 A;  3E4R A;  3G3F A;  3PD9 A;  4FJP A;  3N5L A;  1ZBM A;  4YAH X;  5FTH A;  1SVX B;  3JV9 A;  3I6V A;  3LSW A;  5KDT B;  1O63 A;  1SW4 A;  4R75 A;  1OLC A;  3C36 A;  3MWB A;  1NFT A;  1SW5 A;  5DEX B;  3MAM A;  4IGR A;  4XIG Q;  2UVI A;  3IAZ A;  2VGQ A;  3QYT A;  4FED A;  1SI0 A;  3RT8 A;  2OLB A;  1QKA A;  4BLA A;  2Z22 A;  4DLD A;  1FQF A;  3OXN A;  3FV1 A;  3N94 A;  3I5O A;  3KZG A;  4E0W A;  3KN3 A;  4FIM A;  2XXI A;  5F1Q A;  1PB9 A;  4YKI A;  3T22 A;  4BDR A;  3ONM A;  5CBR A;  1DTG A;  3IOR A;  1PB8 A;  2XXV A;  1QUJ A;  2W7Y A;  4OYV A;  3QXM A;  2V3U A;  2Y7P A;  4KQP A;  2I4C A;  2Q2A A;  4FE8 A;  4UA8 A;  3RUM A;  2DYX A;  3SKP A;  3FXR A;  4OHN A;  3RTW B;  1Z7M E;  1DOT A;  2GHA A;  3E3K A;  3M3F A;  3O2A A;  5EHM A;  2IA4 A;  3MVX A;  1MXU A;  3MZB A;  3OEN A;  4ELO A;  2DVZ A;  4RPO A;  5M2V A;  1A54 A;  3TCG A;  4F3S A;  4R6K A;  1B3G A;  1Y4T A;  4H8I A;  1H44 A;  2F8D A;  1D9V A;  2Y84 A;  4QFP A;  1P1W A;  4R2F A;  1FTL A;  3W9V A;  4IY6 A;  1FQE A;  2UXA A;  3N6T A;  3KG2 A;  4F1Y A;  4PFY A;  4ELR A;  1Y1M A;  1M5E A;  3FVG A;  3B7D A;  3TZA A;  5JEI A;  3TOD A;  3S9N C;  1LFG A;  1QKB A;  3QSL A;  1L5T A;  1SI1 A;  3V89 B;  3G3G A;  4DDD A;  5A5X B;  1VSO A;  4XKQ A;  3G3I A;  4GOT A;  4POW A;  2UVG A;  4QFL A;  3VDF A;  2NXO A;  3PUX E;  2QMW A;  3H03 A;  4OVJ A;  1S9T A;  1URD A;  3VXB A;  2REJ A;  3K02 A;  3A09 A;  4IY5 A;  4OMB A;  4QF9 A;  3CSB A;  2HCA A;  5KDT A;  3THI A;  1A7L A;  1LCF A;  1ELJ A;  3T9X B;  2PT2 A;  4R2B A;  3MZ1 A;  4KYE A;  5I57 B;  4IO2 A;  1SQY A;  4YB5 A;  4YKJ A;  3BFU A;  4RJZ A;  4ZEB A;  1MY2 A;  3QUJ A;  3PU5 A;  3HV1 A;  3C35 A;  2DE3 A;  3IJO B;  3S4U A;  5A5X A;  1D4N A;  2NVU B;  1BLF A;  1HSL A;  4XKR A;  2I48 A;  3HST A;  4KD5 A;  4RPN A;  3UK4 A;  1I6B A;  1GV8 A;  2ONK E;  4RK2 A;  3S9L C;  2ZYO A;  5AE4 A;  3O29 A;  1T0K A;  3B6T A;  1B46 A;  2DWA A;  1BKA A;  1QVS A;  1SDX A;  3EF7 A;  1Y3P A;  3IO6 A;  3OOA A;  2OK2 A;  4POX A;  4RXL A;  3TQL A;  4JSD A;  1RYO A;  1NNP A;  2X26 A;  3K1M A;  4PE5 B;  1PBQ A;  3D4C A;  2OCU A;  3FJM A;  1Q1K A;  3N26 A;  2VOZ A;  4UAC A;  1LST A;  3TMG A;  1IXC A;  4X1D A;  2HAU A;  1SW1 A;  4C1T A;  3KN8 A;  3F11 A;  3MW0 A;  5L9S A;  2FNC A;  3H3G A;  2FA7 A;  1ATG A;  3CVG A;  1B1H A;  2DWJ A;  3K6V A;  3U92 A;  5KCJ A;  4L17 A;  4AQ4 A;  2QRY A;  1PBP A;  1QW0 A;  3ODB A;  4RNS A;  5K2X A;  3SDF A;  2KLF A;  1JW5 A;  4I62 A;  3RNN A;  2DE2 A;  2Z8E A;  3N6U A;  2ONS A;  1DPE A;  4M1V A;  4PFW A;  3RY3 A;  1XOC A;  4G77 A;  3MJN A;  1XVX A;  3K1P A;  5FHO A;  1URS A;  5I58 B;  2Z23 A;  2D21 A;  2D5W A;  4GRK A;  5JK4 A;  2RKM A;  1NNT A;  3PD8 A;  1MY0 A;  1OQH A;  1WOD A;  4C0R A;  3VLW A;  3E9X A;  3HN0 A;  3FXQ A;  4H5F A;  2HQ0 A;  4F2Q A;  2PVU A;  4KCD A;  4PP0 A;  1MQI A;  2I3V A;  4NWC A;  1FQA A;  5TPA A;  1NMU A;  2H25 A;  3MQ9 A;  2NOO A;  1FQC A;  3MUQ A;  1P1O A;  1B9J A;  2XXP A;  3K6W A;  4KPT A;  4NF4 A;  4TQU Q;  3S9E A;  3MPL A;  1GTK A;  5DVF A;  4LQ5 A;  1TXF A;  1MQH A;  3EPE A;  3KJ7 A;  1A8E A;  1LAH E;  4F3B A;  3IB0 A;  3U1O A;  4HCW A;  3D4G A;  2PYY A;  4P11 A;  4TLL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...