1LGHB

Crystal structure of the light-harvesting complex ii (b800-850) from rhodospirillum molischianum
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
43
structure length
43
Chain Sequence
RSLSGLTEEEAIAVHDQFKTTFSAFIILAAVAHVLVWVWKPWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIGHT HARVESTING COMPLEX II
publication title The crystal structure of the light-harvesting complex II (B800-850) from Rhodospirillum molischianum.
pubmed doi rcsb
molecule tags Light harvesting complex
total genus 16
structure length 43
sequence length 43
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 1996-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00556 LHC Antenna complex alpha/beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.250 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1lghB00
2FKWB 1LGHB 1NKZB 3WMM0 1JO5A 1DX7A 1IJDB 1KZUB 1WRGA 1JMMA
chains in the Genus database with same CATH superfamily
1BDDA 4NPDA 2D2CB 1SQPK 5AW3B 3LW5J 2A06E 1L0LD 2YXQB 2JWAA 1KFMA 3L70D 1JY3O 3B5NC 1HWTC 4UB6H 1AQ5A 3CXHD 3L74D 3ABVC 1S72P 3TNUB 2OYOA 5APQA 1KD1Q 4H13C 5M1BA 3P8CD 1LTBC 1LP1A 1KB9H 1LTSC 2DW3A 1OXZA 1KILB 4O9BA 1JOCA 1NAYA 4PD4I 3H1LG 4Y99C 1GD2E 5CCHC 1P84I 1Q82Q 5AW5B 4K35A 4ZKUA 2MJZA 2W83C 1SFCA 1PGQA 4IFFA 1KQLA 3AE1C 5KLIB 2YIUB 3TGUJ 2MKVA 3RL0C 4GOEA 3A0BH 1GU5A 3H1IG 1PPJE 5TJHA 1L0NJ 2QA4P 1A02F 1NH4A 1MKMA 5AW4B 4WVZA 3HTKA 4H0LB 1YHQP 1M7LA 1OVRA 5KLVD 1L0LK 2M0BA 3GMAA 3BRVB 1NTZG 2HG5D 4HJGH 2YKQA 3CCVP 2FKWB 1JY3P 2A45I 1QLED 1SQVK 1CZQA 3V6IA 3CC2P 4WY4A 2ZT9D 3T97A 1EZVE 2R5BA 3W67A 4WY4B 3VOPA 1L4AA 1RY3A 1YQ3C 1N2DC 1YITP 2I1JA 3TGUE 4XFJA 2N1TD 3L72J 1L0NE 3QWOC 1YQ4C 3H1LD 3TF5A 2L91A 1HVVA 3IR9A 1GW3A 2XNXA 1NTKG 1SQXJ 2P1JA 1WT6A 1T6AA 1FU1A 1QL2A 3L70J 3Q5RA 1KYOD 2E74D 2KS1A 3WU2H 3O6QB 1VF5C 1IO4A 2WPVB 2KS1B 1GW4A 3AEEC 3H6PA 1SQBK 1N73B 2P10A 2QJPB 3H1ID 2XZRA 1CI6A 1WMKA 1JY2N 3GLMA 4HKZH 3L72E 1FZCB 4A7PA 1NTZD 1QL1A 2O01J 3VMXA 4PJ0H 3I5CA 5CMZA 2C0WA 2JJLA 1SLQA 3FGAD 1UIXA 2I8DA 1SQXE 1GDTA 3H25A 2POHA 1EXJA 2QM8A 2A06G 5BVZA 2FBWC 1KILC 3HD7A 3CXHE 2YMKA 2BCCG 3A0HE 3HD7B 2A45G 2HODB 1KZUB 4RESB 2YKOA 2E76B 1RF0A 3E1IA 2Y0DA 1RE3A 3BCCJ 3ITKA 2QG4A 4ZKPA 5AVTB 3CX5I 2YIUC 3RK3C 1NTKD 3CXHH 3VYIA 2RN0A 1PFIA 3A0HH 1JY2P 3L73D 3WUTA 3CCSP 1AV1A 3N7NA 1RH5B 3JC22 1AQTA 3H1JG 1HBWA 5AVRB 1PV3A 2H7HA 1X22A 2VRSA 3L4FA 4WWIA 1FJKA 2PFXA 1E5WA 3B8EB 4L76A 2W27A 2W8ZA 2RH0A 1J1EB 1Y9BA 4H44D 2O01H 2UWJE 1PPJG 5KJ7D 3HE5B 4PV1B 1G2CB 1KQGB 3MIWA 5EFWB 3HUSC 2OARA 3BCCE 2Q6QA 5GTHH 4C7NB 1Y8AA 5KKZC 1JMMA 4HH2A 1KILE 1URQD 1VQLP 1R8EA 3M9BA 1EC5A 1OFCX 2A06D 5CCGC 3KPEA 1JEKA 2E5TA 1EZVG 1BGYG 2JP3A 2K9JA 1H88A 4JPZB 1JM0A 3M91A 2K9JB 3TGUG 4W7YA 3RK3E 1KMIZ 4M3LA 1SQQK 2LXBA 2O1KA 1IFIA 1M8OB 2NPSD 2Q9IA 2SPZA 2ZXEB 2Z5IA 5APUA 1YI2P 3H1JD 4K3AA 1W5CE 1LTJC 1LT9B 3V4QA 1OMIA 3U59A 3BASA 2B88A 2IZ0A 3NFQA 1Q7YQ 3B4SA 1S9KD 2FYZA 2HLOA 4TLFA 2Y9ZA 5AW8B 1PPJD 1KYOH 1OVUA 3RK2B 1TU3F 4IL6H 4YTPC 1NTKJ 1LTIC 3L72G 5CCHA 1X0TA 2XKMA 3LIDA 2PP6A 2O01N 3H32A 3NMDA 2W6AA 3AE2C 2E76C 3B5ND 3PHLA 1HH0A 3A3YB 1SQXG 3MUDC 2IFMA 2V7QJ 1KTMA 1EZVD 1NU1J 4DT0A 3G9RA 1IK9A 1YJWP 2FXOA 2M3EA 2WSEJ 1BGYD 1S2EA 2JWDA 5AVUB 3CI9A 1EDLA 2HR3A 3TGUD 5BU5A 1Y47A 2OGUA 4U3FJ 5AVQB 3R4YA 4BRYA 1IFDA 1NTKE 1W2EA 1GZLA 3TK1A 3A7OA 1M1JA 3EFFK 2NPSC 1GK4A 1RF1B 1MV8A 1U7MA 4DZOA 1U57A 1IC2A 2WT7A 2BCCJ 3KHUA 3KZIE 3CX5D 4PD4E 4W80A 2P2UA 1MZ9A 3RL0D 2W6JH 1LWUA 2WZ7A 1ZR4A 4EOTA 2K37A 4OVNF 5AW1B 1LWUB 1NU1E 3CC4P 1P84E 4KHXA 1AJYA 1H0TA 2Y9YA 1VQ6P 1H0TB 2YKPA 1T8ZA 2CK3H 1WRGA 3BATA 2KNCA 2NZ2A 3L72D 4U3FE 3S1KA 2ZYGA 3H1JJ 3Q5PA 1YJNP 3BCCG 2Y0EA 3Q2YA 2FYUK 4Z1MH 3M06A 1FAVA 2WSEH 1NTMK 1N7SD 3II6A 1SQXD 3L71J 2PAJA 1FBMA 3AEFC 1DIPA 2BCCE 2FY8A 2K3RA 4AUWA 2OYHA 2O3JA 1L0NK 1H8AA 2OYHB 3F89A 1IJDB 2M5AA 2FYNC 5E79E 4DOJA 2M5AB 1LT9C 1RQVA 4GOFA 1LP1B 1J1DC 5TISE 3TDKA 1FZEA 5AVZB 2A45H 3H1JE 1VF5D 3C8VA 4BXLA 2E75B 4OWFA 2LXCB 1ZR2A 1BGYJ 3L71E 3HRNA 1E79H 1SFCB 2QIWA 2ZT9B 4I7ZC 2XDJA 1S9KE 3V2RA 1PGJA 2WSSH 3L37A 3A5TA 1OIPA 1JTHA 2WSCH 2YMYA 1GL2C 2JDIH 2CPSA 1SQPJ 2N1TA 2WITA 1OW7A 3G6EP 1UIIA 3LW5H 4YXWH 1YJ9P 2QJKB 2LKMA 1BSHA 3BCCD 3HTKB 2N9BA 3KXDA 2HYNA 1KILD 1NKNA 1KB9I 2WTYA 3MGNA 2GM4A 2IDBA 3P8MC 1N7SC 3T97B 1KN7A 1BGYE 1L4AB 2WPRA 4GIFA 3RGUA 3GHGC 1RF1C 3GF7A 4OH8B 3K5BA 4YPCA 1SQPE 1JCDA 3RK3D 3FX0A 3V5BA 3A2AA 1EDJA 2KXPB 2H88C 2N9YB 2G8YA 1OWAA 3NTNA 4H0LD 3CCQP 3CX5E 1JY2O 1EQ7A 2OQQA 4JQ0D 1R5SA 2G3AA 5DJUB 1QGKB 1VQNP 3IF4A 1FOSF 5AW9B 1NU1G 3CMEP 2D2CC 1NGMB 5KLVK 1YTZI 5K5GB 1SQVJ 1HGZA 1GTWA 1CI6B 4W7ZA 2QJYB 3P7KA 3CX5H 2QRXA 4MN4C 2LR2A 4GDOA 2GUSA 4U3FG 2OTJP 2OYIA 1U7JA 4TT3H 5CCGD 5CJ0A 3CC7P 1T3JA 5APYA 2OYIB 1FZAA 1GK6A 3KDPB 3CMAP 5L8RJ 3V2NA 2YO2A 1FS0E 5KAFE 1VQPP 1HUCA 2E75C 1NO4A 5KJ7A 1RE4C 1VDFA 2FXMA 1SQVE 4C46A 1SFCC 2E5YA 5KLIC 3WUUA 3AEDC 2YXRB 1SQBJ 2XNDH 5KAFH 2K9YA 5KAIE 1K8AQ 2FFDA 3VN0A 1URQA 4GT1A 2AXCA 2FFDB 2RMZA 1URQB 1SVFA 1RHZB 2O1JA 4H0LC 1JNMA 2OTKE 4PD4D 3CCEP 3L71G 3SWFA 3CCRP 1NU1D 1P84D 2IX7C 4C7RA 4D6TG 1NTZK 1PZQA 2B89A 1JO5A 4ZMDA 1XTGB 4WY4C 3H1KE 2NPSA 4U3FD 2ZYAA 2E42A 1RQUA 3FXDA 5DJTB 1KC8Q 2E76D 3CCMP 1SQBE 1AVYA 3CPWO 1IFNA 2HPCA 3LIEA 3AEAC 4OGQB 2HPCB 1HTLC 1Q90D 2H8PD 2BCCD 3H1HJ 2E43A 4RKUJ 1VL2A 1CW5A 2J5UA 1S4XA 2PGDA 2GUVA 1NTKK 3VP9A 1LJ2A 3TSIA 2R44A 4ASVA 1SQPG 1OZHA 2KLUA 1HJBA 3WUVA 1NKZB 2IYPA 1N73C 2QJPC 1J2JB 4ASWA 1M1KQ 2HFED 4AQRD 3CD6P 2K1AA 4PV1D 1GU4A 3PP5A 3B5NA 1NAFA 3G71P 1MFTA 2QJYC 3RBZA 1K9MQ 5CBOA 3USSA 1FZCC 3L71D 1DD3A 1D7MA 1X9VA 3H1HE 3RL0g 1S5LE 4H13B 1KV4A 3Q1MA 2IPPA 4XE5B 2W90A 3CCLP 3S9OA 1K04A 3MP7B 5APVA 2W6BA 2C9LY 1ZXGA 4LC1A 4Y99B 4N78D 2J58A 1NOHA 3HD7C 3VMAA 1OVVA 1MUUA 2P58A 3H32B 2C9NY 3BVHA 1VPCA 1RF0C 1SQQJ 2KZIA 1RE3C 1GL2A 4GODA 2KYVA 3E1RA 3SWYA 3NXSA 3AECC 1Q81Q 1ZRTE 3D71A 1L0LG 1S5LX 4R4LA 4XA4A 1FZFA 2M8RA 2R3SA 1HJ0A 5CJ4A 3SFDC 1SQPD 2KSJA 2KZJA 1SQVG 1FC2C 1LNQA 4RO0A 4B86A 5B5EE 4BRYB 3L74G 4N6JA 2YNYA 1J1EC 5GTIE 2XU6A 2IFNA 2XV5A 4KT0J 1DD4A 1IFMA 2ITAA 4IOIH 4UB8E 3QH9A 1M1JB 1N7SA 1EDKA 4EDFA 3SWKA 1JCCA 4PV1C 3V4WA 5APSA 2WT7B 2FXPA 4DCKA 3AE9C 1GL2D 4JBZA 3C9IA 3MTUE 1SQQE 3L35A 1QVGO 1KFNA 5GTIH 1FOSE 2QEXP 3AE4C 3KYQA 4HB1A 3CCUP 3Q3DA 2OTLP 1FDIA 5B66E 4LGDE 1T2KC 3KZIH 1VQ8P 1QVFO 4L73A 2WVRA 2R3CA 4PD4H 2Q1KA 2KNCB 3CL3D 3H1KG 1USEA 4CPGA 2V7QH 1Z56A 1P84H 2QVAA 3I56P 1M56D 3SSUA 1NVOA 1PIXA 2Q3EA 1IK7A 1SQBG 1IFJA 1VF5B 1BE3J 1N7LA 1N86A 1QX8A 1YYCA 3FWNA 2I1KA 1OW6A 4AYCA 4D6TJ 1Q86Q 3AE7C 1FDOA 4QMAA 1KB9E 1NHLA 1DEEG 1OW8A 1JMBA 1SQVD 2CPBA 3AE3C 1KQSO 3TNUA 2Y0CA 1ZW0A 3HE4A 2YO3A 1LGHB 1USDA 3HE4B 1KILA 1JY3N 2RKLA 3OJAB 2JEEA 4L75A 5E79H 3RK2C 3CCJP 3EWKA 4LLHA 1BE3E 1ZV8A 3CWBJ 2IBZI 3L75J 3A0BE 2D2CD 3M9HA 3AE5C 5TISH 1DX7A 1IZNB 4D6TE 4RJTA 2V4HA 5AVVB 1YBKA 1RE4A 2FYUJ 3V2PA 2ZFCA 1JTHB 3H1HG 2ZAEB 3N4XA 1NTMJ 2Z4EA 2N1TB 4N78E 3RK3B 3H1KD 1SQXK 1L2PA 2GA1A 4N3YB 1PP9J 2ZJSE 1YTZT 1SQBD 2AEFA 1KORA 1BCCG 2BEQD 3BRTB 5CHXA 3EQ2A 1VQ9P 2E74B 2KLVA 3CWBE 3L75E 2E75D 4BWNA 1M1JC 1SFCD 1LT1A 2FYUE 3IAOA 3HUSA 3VMZA 5CBNA 5H2FE 3HUSB 1NTME 2KP8A 3TYYA 5KKZB 3FXEA 3OA7A 1LWUC 4NPFX 5CCGA 2WSFJ 3WU2E 1PP9E 3UIAA 2B9BA 3PH0A 1PGPA 4NPEA 1FDMA 1VQ7P 5H2FH 1VQ5P 4ZNCA 5AVWB 1L0LJ 1ZMEC 3MHVA 4EI2A 3L73G 4L74A 1SQQG 3O6QA 3RBXA 3M0DC 4GKGA 3H1HD 4WY4D 4HYTB 4EIJA 3L36A 3L74J 1L4AD 5APTA 1N73A 5C39A 2IBZG 4PJ0E 1VQKP 2BEZF 2OYHC 3S4RA 2B87A 1LTJA 1H89A 3AEGC 2B87B 2QM7A 2C0XA 1ZN5A 1LTJB 1BCCD 3OW2O 1BSNA 1FZCA 2QE7H 3ZDMA 1EZVI 3IN6A 2NRGA 3AE8C 5APWA 3VTPC 1LTGC 1L0LE 1SP4A 2AEJA 1M57D 3L70E 1ZRTD 1LTTC 5AVSB 4H44B 2WSFH 1XTCC 3H1KJ 1FE6A 3L74E 4I1LA 2ZT9C 1X8YA 2WWWA 1VQOP 2HODA 2AXTE 1JB0J 3P8CE 2H43A 5BU8B 3MUDA 2IYOA 1FZGA 1R5LA 1ZLLA 4JF7A 5KLVJ 2Q3IA 2N1TC 1EDIA 2K88A 2J59M 3D6ZA 3D70A 3I55P 2QJKC 4JYBA 5AW6B 1BE3G 2ZVOB 1SQQD 2JR8A 3VP8A 2P67A 1AVOA 3CLQA 2AXTH 3W68A 5KAIH 2WMMA 3VMYA 3U1CA 1N8RQ 3HD7D 5GTHE 3F5HA 2IBZD 2QSIA 2E74C 4I6MC 4JYCA 1DEBA 3MZWB 4IFDK 1FJPA 3PTZA 1L4AC 1AA0A 2NPSB 2H89C 5KTBA 3G4SP 3PLNA 1FZBA 3HE5A 1G2CA 3H1LJ 4KJMA 5AW0B 2BASA 5AW7B 1ZOYC 3GW6A 5KLVE 4U7JA 4C7NA 4Y28J 3O8ZA 4I2LC 3E7KA 3CXHI 5APXA 3V2QA 4R4MA 5AVXB 3CWBG 3L75G 3B71A 2WQYC 2R32A 1EXIA 2Q7CA 3AE6C 1KB9D 1DH3A 1S3JA 2FYUG 1JUNA 3H1IJ 2Q5UA 1T3UA 1NTMG 2KSEA 2JO1A 3AEBC 1OX3A 1BCCJ 1S1CX 1A02J 2ZVNB 1IFPA 1NTZJ 1PP9G 1HGVA 1L0NG 3H1LE 1QEXA 1NU1K 1SS1A 3R2PA 1VQ4P 3B5NB 2KUBA 2ZYDA 1BE3D 2KIKA 3PRJA 1KYOE 2KOGA 3GG2A 1K05A 3PJSK 2FYNB 1LT9A 4D6TD 1T2KD 4IL6E 4OGQD 2WPSA 4WBAA 2OYIC 3OAKA 1J1DB 1GMJA 2WPQA 1X79B 3H1IE 1ZP0C 1CSBA 2KI7B 3P32A 3MD0A 3M0AA 1VQMP 1AFOA 1BCCE 1S5LH 2IZ1A 1MFZA 1G1IA 4H44C 3L73J 1M90Q 1NTZE 5KJ7C 1PGOA 4I7ZB 1NYHA 1LTAC 2KB7P 3G3ZA 3RL0B 1GL2B 2M3BA 3CWBD 3L75D 4DJGA 4IFMA 1K73Q 3JCUE 4EYYQ 2FFDC 3D6YA 4IL6X 1URQC 2FYUD 5AW2B 3L70G 1BDCA 5AVYB 1NTMD 2L5GB 4H13D 2Z5HA 3IFMA 1HF9A 3JSVC 3KQGA 1NWQA 3RK2D 1YIJP 1W2BO 1KYOI 1PP9D 1L0ND 4YXDC 3FWLA 2KK7A 3JCUH 3GF3A 1N7SB 5CCHD 3L73E 1NJIQ 1G1JA 3U1AA 3GHGA 1RF1A 5B5EH 3GHGB 2AEMA 4UB8H 3Q5SA 2PRRA 2IBZE 2R5DA 4OGQC 3WMM0 2P7JA 1PL5A 3M9QA 2JKVA 1KQFB 3C1LA 2WSCJ 3EFGA 4UB6E 2ZXXA 5B66H 4WB4A 5KLVG 1Q2NA 3M0DA 3SFEC
chains in the Genus database with same CATH topology
1SVFA 3OA7A 1SQPK 2O1JA 5AW3B 1LWUC 3RK2B 1JNMA 1LTIC 5CCGA 3SWFA 1KFMA 5CCHA 3UIAA 1JY3O 2IX7C 2XKMA 3B5NC 1HWTC 4C7RA 3LIDA 2PP6A 1AQ5A 1NTZK 3H32A 3NMDA 1FDMA 2W6AA 1JO5A 3TNUB 3B5ND 1XTGB 5APQA 5AVWB 1HH0A 3A3YB 4WY4C 3P8CD 2IFMA 1LTBC 2NPSA 2E42A 3M0DC 4GKGA 1IK9A 1LTSC 1OXZA 1KILB 4O9BA 4WY4D 1JOCA 4HYTB 4EIJA 3L36A 5AVUB 3CI9A 1IFNA 4Y99C 1L4AD 5APTA 2HPCA 1N73A 3LIEA 1GD2E 5BU5A 5CCHC 2HPCB 5AW5B 1HTLC 5AVQB 2H8PD 4ZKUA 2OYHC 2MJZA 1SFCA 1LTJA 1IFDA 1H89A 4IFFA 2E43A 2QM7A 2C0XA 1W2EA 1ZN5A 1KQLA 1LTJB 1FZCA 1CW5A 1GZLA 3TK1A 3A7OA 1M1JA 2GUVA 2NPSC 1NTKK 3VP9A 1GK4A 3RL0C 1RF1B 1MV8A 4DZOA 1IC2A 2WT7A 1GU5A 3TSIA 1A02F 5APWA 3VTPC 1NH4A 4W80A 1LTGC 2P2UA 1SP4A 1MZ9A 3RL0D 5AW4B 1HJBA 1NKZB 1LWUA 2WZ7A 1ZR4A 4EOTA 1N73C 5AW1B 1J2JB 3HTKA 1LWUB 2HFED 4AQRD 1M7LA 1LTTC 4KHXA 5AVSB 1L0LK 1GU4A 3PP5A 3BRVB 2WSFH 1XTCC 2HG5D 3B5NA 1NAFA 2YKQA 4I1LA 1X8YA 2FKWB 2WWWA 1JY3P 2A45I 2YKPA 2HODA 1SQVK 1T8ZA 1CZQA 1FZCC 1WRGA 3BATA 3P8CE 2H43A 4WY4A 5BU8B 1X9VA 3MUDA 3T97A 1FZGA 2R5BA 1ZLLA 4JF7A 4WY4B 3VOPA 1L4AA 1RY3A 2Q3IA 1N2DC 2IPPA 2N1TC 2FYUK 4XE5B 3M06A 2J59M 1FAVA 4JYBA 2WSEH 2I1JA 5APVA 1NTMK 5AW6B 1N7SD 2W6BA 3II6A 2PAJA 2C9LY 1FBMA 2N1TD 4LC1A 3VP8A 4Y99B 2P67A 4N78D 2J58A 1NOHA 3HD7C 3CLQA 4AUWA 2OYHA 1MUUA 3VMYA 2OYHB 1L0NK 1H8AA 3U1CA 1HVVA 3HD7D 3IR9A 1GW3A 2XNXA 3H32B 1IJDB 2C9NY 4I6MC 4JYCA 1DEBA 3BVHA 2P1JA 1VPCA 1WT6A 1RF0C 4DOJA 4IFDK 1FU1A 1FJPA 1QL2A 1RE3C 1GL2A 1L4AC 1LT9C 2NPSB 5KTBA 2KYVA 3SWYA 1FZBA 1J1DC 3HE5A 3NXSA 1IO4A 1G2CA 1GW4A 5AW0B 1FZEA 2BASA 5AVZB 5AW7B 3H6PA 4C7NA 1SQBK 2A45H 4XA4A 1FZFA 1N73B 2M8RA 3O8ZA 4I2LC 2XZRA 5CJ4A 1CI6A 2KSJA 1JY2N 5APXA 3V2QA 4B86A 1ZR2A 3HRNA 5AVXB 1SFCB 4N6JA 2YNYA 1J1EC 2XDJA 2IFNA 2R32A 2XU6A 2Q7CA 2XV5A 1S9KE 3V2RA 1IFMA 1FZCB 3L37A 3A5TA 1DH3A 1JTHA 2WSCH 2YMYA 1GL2C 1QL1A 1M1JB 1JUNA 3VMXA 1N7SA 2CPSA 1JCCA 3I5CA 2N1TA 2WITA 2Q5UA 5CMZA 2C0WA 2JJLA 1SLQA 1T3UA 5APSA 3V4WA 2WT7B 1GL2D 3C9IA 1GDTA 3MTUE 3LW5H 3L35A 2POHA 1A02J 2QM8A 2LKMA 5BVZA 1KILC 1KFNA 3HD7A 3HTKB 1FOSE 2N9BA 1HGVA 3HD7B 1NU1K 3KYQA 3R2PA 2HYNA 3B5NB 1KILD 4LGDE 1T2KC 1NKNA 2A45G 2HODB 1KZUB 4RESB 2YKOA 2R3CA 1RF0A 2WTYA 3E1IA 3MGNA 2KOGA 3CL3D 2GM4A 1RE3A 3P8MC 1LT9A 1N7SC 1T2KD 2WPSA 4WBAA 2OYIC 1Z56A 3OAKA 4ZKPA 5AVTB 1L4AB 2WPRA 3RK3C 1J1DB 4GIFA 3VYIA 1PFIA 2WPQA 1IFJA 3GHGC 1RF1C 1X79B 1JY2P 1N7LA 1N86A 4OH8B 1YYCA 3N7NA 1CSBA 2I1KA 3P32A 1JCDA 3RK3D 1HBWA 4AYCA 3MD0A 5AVRB 3M0AA 3V5BA 2H7HA 1AFOA 3A2AA 2VRSA 3L4FA 1MFZA 1G1IA 1FJKA 1OWAA 3NTNA 1NHLA 1E5WA 3B8EB 2W27A 5KJ7C 1J1EB 1LTAC 3G3ZA 2KB7P 2O01H 3RL0B 1GL2B 2M3BA 2CPBA 1JY2O 1EQ7A 3TNUA 5KJ7D 3HE5B 3HE4A 1G2CB 4IFMA 2YO3A 3MIWA 2FFDC 3HUSC 2OARA 1FOSF 1LGHB 5AW9B 3HE4B 1URQC 5AW2B 1KILA 1JY3N 4C7NB 3OJAB 1JMMA 5AVYB 2JEEA 3RK2C 5KLVK 1YTZI 4HH2A 1HGZA 2L5GB 4LLHA 2Z5HA 3IFMA 1GTWA 1CI6B 4W7ZA 1URQD 1ZV8A 3KQGA 3M9BA 3P7KA 1NWQA 3M9HA 3RK2D 5CCGC 1DX7A 3KPEA 5AVVB 1RE4A 2GUSA 3V2PA 2ZFCA 1JTHB 2OYIA 3N4XA 5CCGD 2Z4EA 1N7SB 5CJ0A 5CCHD 1T3JA 5APYA 2OYIB 1FZAA 1H88A 1GK6A 2N1TB 1G1JA 3U1AA 3KDPB 3GHGA 3M91A 1RF1A 4N78E 3V2NA 3RK3B 4W7YA 2YO2A 3GHGB 1SQXK 4M3LA 1SQQK 4N3YB 2O1KA 1IFIA 1HUCA 2NPSD 1YTZT 2Q9IA 2R5DA 3WMM0 2P7JA 2ZXEB 2Z5IA 5APUA 3BRTB 5CHXA 3EQ2A 1NO4A 5KJ7A 1RE4C 1VDFA 2FXMA 4C46A 2KLVA 1SFCC 1LTJC 3M9QA 1LT9B 3V4QA 3U59A 3BASA 1M1JC 3NFQA 3EFGA 1SFCD 2FFDA 3HUSA 3VMZA 4WB4A 2FYZA 1URQA 2HLOA 4GT1A 3VN0A 1S9KD 5AW8B 3M0DA 2FFDB 3HUSB 2KP8A 1URQB 3TYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FKW B;  1LGH B;  1NKZ B;  3WMM 0;  1JO5 A;  1DX7 A;  1IJD B;  1KZU B;  1WRG A;  1JMM A; 
#chains in the Genus database with same CATH topology
 1BDD A;  4NPD A;  2D2C B;  1SQP K;  5AW3 B;  3LW5 J;  2A06 E;  1L0L D;  2YXQ B;  2JWA A;  1KFM A;  3L70 D;  1JY3 O;  3B5N C;  1HWT C;  4UB6 H;  1AQ5 A;  3CXH D;  3L74 D;  3ABV C;  1S72 P;  3TNU B;  2OYO A;  5APQ A;  1KD1 Q;  4H13 C;  5M1B A;  3P8C D;  1LTB C;  1LP1 A;  1KB9 H;  1LTS C;  2DW3 A;  1OXZ A;  1KIL B;  4O9B A;  1JOC A;  1NAY A;  4PD4 I;  3H1L G;  4Y99 C;  1GD2 E;  5CCH C;  1P84 I;  1Q82 Q;  5AW5 B;  4K35 A;  4ZKU A;  2MJZ A;  2W83 C;  1SFC A;  1PGQ A;  4IFF A;  1KQL A;  3AE1 C;  5KLI B;  2YIU B;  3TGU J;  2MKV A;  3RL0 C;  4GOE A;  3A0B H;  1GU5 A;  3H1I G;  1PPJ E;  5TJH A;  1L0N J;  2QA4 P;  1A02 F;  1NH4 A;  1MKM A;  5AW4 B;  4WVZ A;  3HTK A;  4H0L B;  1YHQ P;  1M7L A;  1OVR A;  5KLV D;  1L0L K;  2M0B A;  3GMA A;  3BRV B;  1NTZ G;  2HG5 D;  4HJG H;  2YKQ A;  3CCV P;  2FKW B;  1JY3 P;  2A45 I;  1QLE D;  1SQV K;  1CZQ A;  3V6I A;  3CC2 P;  4WY4 A;  2ZT9 D;  3T97 A;  1EZV E;  2R5B A;  3W67 A;  4WY4 B;  3VOP A;  1L4A A;  1RY3 A;  1YQ3 C;  1N2D C;  1YIT P;  2I1J A;  3TGU E;  4XFJ A;  2N1T D;  3L72 J;  1L0N E;  3QWO C;  1YQ4 C;  3H1L D;  3TF5 A;  2L91 A;  1HVV A;  3IR9 A;  1GW3 A;  2XNX A;  1NTK G;  1SQX J;  2P1J A;  1WT6 A;  1T6A A;  1FU1 A;  1QL2 A;  3L70 J;  3Q5R A;  1KYO D;  2E74 D;  2KS1 A;  3WU2 H;  3O6Q B;  1VF5 C;  1IO4 A;  2WPV B;  2KS1 B;  1GW4 A;  3AEE C;  3H6P A;  1SQB K;  1N73 B;  2P10 A;  2QJP B;  3H1I D;  2XZR A;  1CI6 A;  1WMK A;  1JY2 N;  3GLM A;  4HKZ H;  3L72 E;  1FZC B;  4A7P A;  1NTZ D;  1QL1 A;  2O01 J;  3VMX A;  4PJ0 H;  3I5C A;  5CMZ A;  2C0W A;  2JJL A;  1SLQ A;  3FGA D;  1UIX A;  2I8D A;  1SQX E;  1GDT A;  3H25 A;  2POH A;  1EXJ A;  2QM8 A;  2A06 G;  5BVZ A;  2FBW C;  1KIL C;  3HD7 A;  3CXH E;  2YMK A;  2BCC G;  3A0H E;  3HD7 B;  2A45 G;  2HOD B;  1KZU B;  4RES B;  2YKO A;  2E76 B;  1RF0 A;  3E1I A;  2Y0D A;  1RE3 A;  3BCC J;  3ITK A;  2QG4 A;  4ZKP A;  5AVT B;  3CX5 I;  2YIU C;  3RK3 C;  1NTK D;  3CXH H;  3VYI A;  2RN0 A;  1PFI A;  3A0H H;  1JY2 P;  3L73 D;  3WUT A;  3CCS P;  1AV1 A;  3N7N A;  1RH5 B;  3JC2 2;  1AQT A;  3H1J G;  1HBW A;  5AVR B;  1PV3 A;  2H7H A;  1X22 A;  2VRS A;  3L4F A;  4WWI A;  1FJK A;  2PFX A;  1E5W A;  3B8E B;  4L76 A;  2W27 A;  2W8Z A;  2RH0 A;  1J1E B;  1Y9B A;  4H44 D;  2O01 H;  2UWJ E;  1PPJ G;  5KJ7 D;  3HE5 B;  4PV1 B;  1G2C B;  1KQG B;  3MIW A;  5EFW B;  3HUS C;  2OAR A;  3BCC E;  2Q6Q A;  5GTH H;  4C7N B;  1Y8A A;  5KKZ C;  1JMM A;  4HH2 A;  1KIL E;  1URQ D;  1VQL P;  1R8E A;  3M9B A;  1EC5 A;  1OFC X;  2A06 D;  5CCG C;  3KPE A;  1JEK A;  2E5T A;  1EZV G;  1BGY G;  2JP3 A;  2K9J A;  1H88 A;  4JPZ B;  1JM0 A;  3M91 A;  2K9J B;  3TGU G;  4W7Y A;  3RK3 E;  1KMI Z;  4M3L A;  1SQQ K;  2LXB A;  2O1K A;  1IFI A;  1M8O B;  2NPS D;  2Q9I A;  2SPZ A;  2ZXE B;  2Z5I A;  5APU A;  1YI2 P;  3H1J D;  4K3A A;  1W5C E;  1LTJ C;  1LT9 B;  3V4Q A;  1OMI A;  3U59 A;  3BAS A;  2B88 A;  2IZ0 A;  3NFQ A;  1Q7Y Q;  3B4S A;  1S9K D;  2FYZ A;  2HLO A;  4TLF A;  2Y9Z A;  5AW8 B;  1PPJ D;  1KYO H;  1OVU A;  3RK2 B;  1TU3 F;  4IL6 H;  4YTP C;  1NTK J;  1LTI C;  3L72 G;  5CCH A;  1X0T A;  2XKM A;  3LID A;  2PP6 A;  2O01 N;  3H32 A;  3NMD A;  2W6A A;  3AE2 C;  2E76 C;  3B5N D;  3PHL A;  1HH0 A;  3A3Y B;  1SQX G;  3MUD C;  2IFM A;  2V7Q J;  1KTM A;  1EZV D;  1NU1 J;  4DT0 A;  3G9R A;  1IK9 A;  1YJW P;  2FXO A;  2M3E A;  2WSE J;  1BGY D;  1S2E A;  2JWD A;  5AVU B;  3CI9 A;  1EDL A;  2HR3 A;  3TGU D;  5BU5 A;  1Y47 A;  2OGU A;  4U3F J;  5AVQ B;  3R4Y A;  4BRY A;  1IFD A;  1NTK E;  1W2E A;  1GZL A;  3TK1 A;  3A7O A;  1M1J A;  3EFF K;  2NPS C;  1GK4 A;  1RF1 B;  1MV8 A;  1U7M A;  4DZO A;  1U57 A;  1IC2 A;  2WT7 A;  2BCC J;  3KHU A;  3KZI E;  3CX5 D;  4PD4 E;  4W80 A;  2P2U A;  1MZ9 A;  3RL0 D;  2W6J H;  1LWU A;  2WZ7 A;  1ZR4 A;  4EOT A;  2K37 A;  4OVN F;  5AW1 B;  1LWU B;  1NU1 E;  3CC4 P;  1P84 E;  4KHX A;  1AJY A;  1H0T A;  2Y9Y A;  1VQ6 P;  1H0T B;  2YKP A;  1T8Z A;  2CK3 H;  1WRG A;  3BAT A;  2KNC A;  2NZ2 A;  3L72 D;  4U3F E;  3S1K A;  2ZYG A;  3H1J J;  3Q5P A;  1YJN P;  3BCC G;  2Y0E A;  3Q2Y A;  2FYU K;  4Z1M H;  3M06 A;  1FAV A;  2WSE H;  1NTM K;  1N7S D;  3II6 A;  1SQX D;  3L71 J;  2PAJ A;  1FBM A;  3AEF C;  1DIP A;  2BCC E;  2FY8 A;  2K3R A;  4AUW A;  2OYH A;  2O3J A;  1L0N K;  1H8A A;  2OYH B;  3F89 A;  1IJD B;  2M5A A;  2FYN C;  5E79 E;  4DOJ A;  2M5A B;  1LT9 C;  1RQV A;  4GOF A;  1LP1 B;  1J1D C;  5TIS E;  3TDK A;  1FZE A;  5AVZ B;  2A45 H;  3H1J E;  1VF5 D;  3C8V A;  4BXL A;  2E75 B;  4OWF A;  2LXC B;  1ZR2 A;  1BGY J;  3L71 E;  3HRN A;  1E79 H;  1SFC B;  2QIW A;  2ZT9 B;  4I7Z C;  2XDJ A;  1S9K E;  3V2R A;  1PGJ A;  2WSS H;  3L37 A;  3A5T A;  1OIP A;  1JTH A;  2WSC H;  2YMY A;  1GL2 C;  2JDI H;  2CPS A;  1SQP J;  2N1T A;  2WIT A;  1OW7 A;  3G6E P;  1UII A;  3LW5 H;  4YXW H;  1YJ9 P;  2QJK B;  2LKM A;  1BSH A;  3BCC D;  3HTK B;  2N9B A;  3KXD A;  2HYN A;  1KIL D;  1NKN A;  1KB9 I;  2WTY A;  3MGN A;  2GM4 A;  2IDB A;  3P8M C;  1N7S C;  3T97 B;  1KN7 A;  1BGY E;  1L4A B;  2WPR A;  4GIF A;  3RGU A;  3GHG C;  1RF1 C;  3GF7 A;  4OH8 B;  3K5B A;  4YPC A;  1SQP E;  1JCD A;  3RK3 D;  3FX0 A;  3V5B A;  3A2A A;  1EDJ A;  2KXP B;  2H88 C;  2N9Y B;  2G8Y A;  1OWA A;  3NTN A;  4H0L D;  3CCQ P;  3CX5 E;  1JY2 O;  1EQ7 A;  2OQQ A;  4JQ0 D;  1R5S A;  2G3A A;  5DJU B;  1QGK B;  1VQN P;  3IF4 A;  1FOS F;  5AW9 B;  1NU1 G;  3CME P;  2D2C C;  1NGM B;  5KLV K;  1YTZ I;  5K5G B;  1SQV J;  1HGZ A;  1GTW A;  1CI6 B;  4W7Z A;  2QJY B;  3P7K A;  3CX5 H;  2QRX A;  4MN4 C;  2LR2 A;  4GDO A;  2GUS A;  4U3F G;  2OTJ P;  2OYI A;  1U7J A;  4TT3 H;  5CCG D;  5CJ0 A;  3CC7 P;  1T3J A;  5APY A;  2OYI B;  1FZA A;  1GK6 A;  3KDP B;  3CMA P;  5L8R J;  3V2N A;  2YO2 A;  1FS0 E;  5KAF E;  1VQP P;  1HUC A;  2E75 C;  1NO4 A;  5KJ7 A;  1RE4 C;  1VDF A;  2FXM A;  1SQV E;  4C46 A;  1SFC C;  2E5Y A;  5KLI C;  3WUU A;  3AED C;  2YXR B;  1SQB J;  2XND H;  5KAF H;  2K9Y A;  5KAI E;  1K8A Q;  2FFD A;  3VN0 A;  1URQ A;  4GT1 A;  2AXC A;  2FFD B;  2RMZ A;  1URQ B;  1SVF A;  1RHZ B;  2O1J A;  4H0L C;  1JNM A;  2OTK E;  4PD4 D;  3CCE P;  3L71 G;  3SWF A;  3CCR P;  1NU1 D;  1P84 D;  2IX7 C;  4C7R A;  4D6T G;  1NTZ K;  1PZQ A;  2B89 A;  1JO5 A;  4ZMD A;  1XTG B;  4WY4 C;  3H1K E;  2NPS A;  4U3F D;  2ZYA A;  2E42 A;  1RQU A;  3FXD A;  5DJT B;  1KC8 Q;  2E76 D;  3CCM P;  1SQB E;  1AVY A;  3CPW O;  1IFN A;  2HPC A;  3LIE A;  3AEA C;  4OGQ B;  2HPC B;  1HTL C;  1Q90 D;  2H8P D;  2BCC D;  3H1H J;  2E43 A;  4RKU J;  1VL2 A;  1CW5 A;  2J5U A;  1S4X A;  2PGD A;  2GUV A;  1NTK K;  3VP9 A;  1LJ2 A;  3TSI A;  2R44 A;  4ASV A;  1SQP G;  1OZH A;  2KLU A;  1HJB A;  3WUV A;  1NKZ B;  2IYP A;  1N73 C;  2QJP C;  1J2J B;  4ASW A;  1M1K Q;  2HFE D;  4AQR D;  3CD6 P;  2K1A A;  4PV1 D;  1GU4 A;  3PP5 A;  3B5N A;  1NAF A;  3G71 P;  1MFT A;  2QJY C;  3RBZ A;  1K9M Q;  5CBO A;  3USS A;  1FZC C;  3L71 D;  1DD3 A;  1D7M A;  1X9V A;  3H1H E;  3RL0 g;  1S5L E;  4H13 B;  1KV4 A;  3Q1M A;  2IPP A;  4XE5 B;  2W90 A;  3CCL P;  3S9O A;  1K04 A;  3MP7 B;  5APV A;  2W6B A;  2C9L Y;  1ZXG A;  4LC1 A;  4Y99 B;  4N78 D;  2J58 A;  1NOH A;  3HD7 C;  3VMA A;  1OVV A;  1MUU A;  2P58 A;  3H32 B;  2C9N Y;  3BVH A;  1VPC A;  1RF0 C;  1SQQ J;  2KZI A;  1RE3 C;  1GL2 A;  4GOD A;  2KYV A;  3E1R A;  3SWY A;  3NXS A;  3AEC C;  1Q81 Q;  1ZRT E;  3D71 A;  1L0L G;  1S5L X;  4R4L A;  4XA4 A;  1FZF A;  2M8R A;  2R3S A;  1HJ0 A;  5CJ4 A;  3SFD C;  1SQP D;  2KSJ A;  2KZJ A;  1SQV G;  1FC2 C;  1LNQ A;  4RO0 A;  4B86 A;  5B5E E;  4BRY B;  3L74 G;  4N6J A;  2YNY A;  1J1E C;  5GTI E;  2XU6 A;  2IFN A;  2XV5 A;  4KT0 J;  1DD4 A;  1IFM A;  2ITA A;  4IOI H;  4UB8 E;  3QH9 A;  1M1J B;  1N7S A;  1EDK A;  4EDF A;  3SWK A;  1JCC A;  4PV1 C;  3V4W A;  5APS A;  2WT7 B;  2FXP A;  4DCK A;  3AE9 C;  1GL2 D;  4JBZ A;  3C9I A;  3MTU E;  1SQQ E;  3L35 A;  1QVG O;  1KFN A;  5GTI H;  1FOS E;  2QEX P;  3AE4 C;  3KYQ A;  4HB1 A;  3CCU P;  3Q3D A;  2OTL P;  1FDI A;  5B66 E;  4LGD E;  1T2K C;  3KZI H;  1VQ8 P;  1QVF O;  4L73 A;  2WVR A;  2R3C A;  4PD4 H;  2Q1K A;  2KNC B;  3CL3 D;  3H1K G;  1USE A;  4CPG A;  2V7Q H;  1Z56 A;  1P84 H;  2QVA A;  3I56 P;  1M56 D;  3SSU A;  1NVO A;  1PIX A;  2Q3E A;  1IK7 A;  1SQB G;  1IFJ A;  1VF5 B;  1BE3 J;  1N7L A;  1N86 A;  1QX8 A;  1YYC A;  3FWN A;  2I1K A;  1OW6 A;  4AYC A;  4D6T J;  1Q86 Q;  3AE7 C;  1FDO A;  4QMA A;  1KB9 E;  1NHL A;  1DEE G;  1OW8 A;  1JMB A;  1SQV D;  2CPB A;  3AE3 C;  1KQS O;  3TNU A;  2Y0C A;  1ZW0 A;  3HE4 A;  2YO3 A;  1LGH B;  1USD A;  3HE4 B;  1KIL A;  1JY3 N;  2RKL A;  3OJA B;  2JEE A;  4L75 A;  5E79 H;  3RK2 C;  3CCJ P;  3EWK A;  4LLH A;  1BE3 E;  1ZV8 A;  3CWB J;  2IBZ I;  3L75 J;  3A0B E;  2D2C D;  3M9H A;  3AE5 C;  5TIS H;  1DX7 A;  1IZN B;  4D6T E;  4RJT A;  2V4H A;  5AVV B;  1YBK A;  1RE4 A;  2FYU J;  3V2P A;  2ZFC A;  1JTH B;  3H1H G;  2ZAE B;  3N4X A;  1NTM J;  2Z4E A;  2N1T B;  4N78 E;  3RK3 B;  3H1K D;  1SQX K;  1L2P A;  2GA1 A;  4N3Y B;  1PP9 J;  2ZJS E;  1YTZ T;  1SQB D;  2AEF A;  1KOR A;  1BCC G;  2BEQ D;  3BRT B;  5CHX A;  3EQ2 A;  1VQ9 P;  2E74 B;  2KLV A;  3CWB E;  3L75 E;  2E75 D;  4BWN A;  1M1J C;  1SFC D;  1LT1 A;  2FYU E;  3IAO A;  3HUS A;  3VMZ A;  5CBN A;  5H2F E;  3HUS B;  1NTM E;  2KP8 A;  3TYY A;  5KKZ B;  3FXE A;  3OA7 A;  1LWU C;  4NPF X;  5CCG A;  2WSF J;  3WU2 E;  1PP9 E;  3UIA A;  2B9B A;  3PH0 A;  1PGP A;  4NPE A;  1FDM A;  1VQ7 P;  5H2F H;  1VQ5 P;  4ZNC A;  5AVW B;  1L0L J;  1ZME C;  3MHV A;  4EI2 A;  3L73 G;  4L74 A;  1SQQ G;  3O6Q A;  3RBX A;  3M0D C;  4GKG A;  3H1H D;  4WY4 D;  4HYT B;  4EIJ A;  3L36 A;  3L74 J;  1L4A D;  5APT A;  1N73 A;  5C39 A;  2IBZ G;  4PJ0 E;  1VQK P;  2BEZ F;  2OYH C;  3S4R A;  2B87 A;  1LTJ A;  1H89 A;  3AEG C;  2B87 B;  2QM7 A;  2C0X A;  1ZN5 A;  1LTJ B;  1BCC D;  3OW2 O;  1BSN A;  1FZC A;  2QE7 H;  3ZDM A;  1EZV I;  3IN6 A;  2NRG A;  3AE8 C;  5APW A;  3VTP C;  1LTG C;  1L0L E;  1SP4 A;  2AEJ A;  1M57 D;  3L70 E;  1ZRT D;  1LTT C;  5AVS B;  4H44 B;  2WSF H;  1XTC C;  3H1K J;  1FE6 A;  3L74 E;  4I1L A;  2ZT9 C;  1X8Y A;  2WWW A;  1VQO P;  2HOD A;  2AXT E;  1JB0 J;  3P8C E;  2H43 A;  5BU8 B;  3MUD A;  2IYO A;  1FZG A;  1R5L A;  1ZLL A;  4JF7 A;  5KLV J;  2Q3I A;  2N1T C;  1EDI A;  2K88 A;  2J59 M;  3D6Z A;  3D70 A;  3I55 P;  2QJK C;  4JYB A;  5AW6 B;  1BE3 G;  2ZVO B;  1SQQ D;  2JR8 A;  3VP8 A;  2P67 A;  1AVO A;  3CLQ A;  2AXT H;  3W68 A;  5KAI H;  2WMM A;  3VMY A;  3U1C A;  1N8R Q;  3HD7 D;  5GTH E;  3F5H A;  2IBZ D;  2QSI A;  2E74 C;  4I6M C;  4JYC A;  1DEB A;  3MZW B;  4IFD K;  1FJP A;  3PTZ A;  1L4A C;  1AA0 A;  2NPS B;  2H89 C;  5KTB A;  3G4S P;  3PLN A;  1FZB A;  3HE5 A;  1G2C A;  3H1L J;  4KJM A;  5AW0 B;  2BAS A;  5AW7 B;  1ZOY C;  3GW6 A;  5KLV E;  4U7J A;  4C7N A;  4Y28 J;  3O8Z A;  4I2L C;  3E7K A;  3CXH I;  5APX A;  3V2Q A;  4R4M A;  5AVX B;  3CWB G;  3L75 G;  3B71 A;  2WQY C;  2R32 A;  1EXI A;  2Q7C A;  3AE6 C;  1KB9 D;  1DH3 A;  1S3J A;  2FYU G;  1JUN A;  3H1I J;  2Q5U A;  1T3U A;  1NTM G;  2KSE A;  2JO1 A;  3AEB C;  1OX3 A;  1BCC J;  1S1C X;  1A02 J;  2ZVN B;  1IFP A;  1NTZ J;  1PP9 G;  1HGV A;  1L0N G;  3H1L E;  1QEX A;  1NU1 K;  1SS1 A;  3R2P A;  1VQ4 P;  3B5N B;  2KUB A;  2ZYD A;  1BE3 D;  2KIK A;  3PRJ A;  1KYO E;  2KOG A;  3GG2 A;  1K05 A;  3PJS K;  2FYN B;  1LT9 A;  4D6T D;  1T2K D;  4IL6 E;  4OGQ D;  2WPS A;  4WBA A;  2OYI C;  3OAK A;  1J1D B;  1GMJ A;  2WPQ A;  1X79 B;  3H1I E;  1ZP0 C;  1CSB A;  2KI7 B;  3P32 A;  3MD0 A;  3M0A A;  1VQM P;  1AFO A;  1BCC E;  1S5L H;  2IZ1 A;  1MFZ A;  1G1I A;  4H44 C;  3L73 J;  1M90 Q;  1NTZ E;  5KJ7 C;  1PGO A;  4I7Z B;  1NYH A;  1LTA C;  2KB7 P;  3G3Z A;  3RL0 B;  1GL2 B;  2M3B A;  3CWB D;  3L75 D;  4DJG A;  4IFM A;  1K73 Q;  3JCU E;  4EYY Q;  2FFD C;  3D6Y A;  4IL6 X;  1URQ C;  2FYU D;  5AW2 B;  3L70 G;  1BDC A;  5AVY B;  1NTM D;  2L5G B;  4H13 D;  2Z5H A;  3IFM A;  1HF9 A;  3JSV C;  3KQG A;  1NWQ A;  3RK2 D;  1YIJ P;  1W2B O;  1KYO I;  1PP9 D;  1L0N D;  4YXD C;  3FWL A;  2KK7 A;  3JCU H;  3GF3 A;  1N7S B;  5CCH D;  3L73 E;  1NJI Q;  1G1J A;  3U1A A;  3GHG A;  1RF1 A;  5B5E H;  3GHG B;  2AEM A;  4UB8 H;  3Q5S A;  2PRR A;  2IBZ E;  2R5D A;  4OGQ C;  3WMM 0;  2P7J A;  1PL5 A;  3M9Q A;  2JKV A;  1KQF B;  3C1L A;  2WSC J;  3EFG A;  4UB6 E;  2ZXX A;  5B66 H;  4WB4 A;  5KLV G;  1Q2N A;  3M0D A;  3SFE C; 
#chains in the Genus database with same CATH homology
 1SVF A;  3OA7 A;  1SQP K;  2O1J A;  5AW3 B;  1LWU C;  3RK2 B;  1JNM A;  1LTI C;  5CCG A;  3SWF A;  1KFM A;  5CCH A;  3UIA A;  1JY3 O;  2IX7 C;  2XKM A;  3B5N C;  1HWT C;  4C7R A;  3LID A;  2PP6 A;  1AQ5 A;  1NTZ K;  3H32 A;  3NMD A;  1FDM A;  2W6A A;  1JO5 A;  3TNU B;  3B5N D;  1XTG B;  5APQ A;  5AVW B;  1HH0 A;  3A3Y B;  4WY4 C;  3P8C D;  2IFM A;  1LTB C;  2NPS A;  2E42 A;  3M0D C;  4GKG A;  1IK9 A;  1LTS C;  1OXZ A;  1KIL B;  4O9B A;  4WY4 D;  1JOC A;  4HYT B;  4EIJ A;  3L36 A;  5AVU B;  3CI9 A;  1IFN A;  4Y99 C;  1L4A D;  5APT A;  2HPC A;  1N73 A;  3LIE A;  1GD2 E;  5BU5 A;  5CCH C;  2HPC B;  5AW5 B;  1HTL C;  5AVQ B;  2H8P D;  4ZKU A;  2OYH C;  2MJZ A;  1SFC A;  1LTJ A;  1IFD A;  1H89 A;  4IFF A;  2E43 A;  2QM7 A;  2C0X A;  1W2E A;  1ZN5 A;  1KQL A;  1LTJ B;  1FZC A;  1CW5 A;  1GZL A;  3TK1 A;  3A7O A;  1M1J A;  2GUV A;  2NPS C;  1NTK K;  3VP9 A;  1GK4 A;  3RL0 C;  1RF1 B;  1MV8 A;  4DZO A;  1IC2 A;  2WT7 A;  1GU5 A;  3TSI A;  1A02 F;  5APW A;  3VTP C;  1NH4 A;  4W80 A;  1LTG C;  2P2U A;  1SP4 A;  1MZ9 A;  3RL0 D;  5AW4 B;  1HJB A;  1NKZ B;  1LWU A;  2WZ7 A;  1ZR4 A;  4EOT A;  1N73 C;  5AW1 B;  1J2J B;  3HTK A;  1LWU B;  2HFE D;  4AQR D;  1M7L A;  1LTT C;  4KHX A;  5AVS B;  1L0L K;  1GU4 A;  3PP5 A;  3BRV B;  2WSF H;  1XTC C;  2HG5 D;  3B5N A;  1NAF A;  2YKQ A;  4I1L A;  1X8Y A;  2FKW B;  2WWW A;  1JY3 P;  2A45 I;  2YKP A;  2HOD A;  1SQV K;  1T8Z A;  1CZQ A;  1FZC C;  1WRG A;  3BAT A;  3P8C E;  2H43 A;  4WY4 A;  5BU8 B;  1X9V A;  3MUD A;  3T97 A;  1FZG A;  2R5B A;  1ZLL A;  4JF7 A;  4WY4 B;  3VOP A;  1L4A A;  1RY3 A;  2Q3I A;  1N2D C;  2IPP A;  2N1T C;  2FYU K;  4XE5 B;  3M06 A;  2J59 M;  1FAV A;  4JYB A;  2WSE H;  2I1J A;  5APV A;  1NTM K;  5AW6 B;  1N7S D;  2W6B A;  3II6 A;  2PAJ A;  2C9L Y;  1FBM A;  2N1T D;  4LC1 A;  3VP8 A;  4Y99 B;  2P67 A;  4N78 D;  2J58 A;  1NOH A;  3HD7 C;  3CLQ A;  4AUW A;  2OYH A;  1MUU A;  3VMY A;  2OYH B;  1L0N K;  1H8A A;  3U1C A;  1HVV A;  3HD7 D;  3IR9 A;  1GW3 A;  2XNX A;  3H32 B;  1IJD B;  2C9N Y;  4I6M C;  4JYC A;  1DEB A;  3BVH A;  2P1J A;  1VPC A;  1WT6 A;  1RF0 C;  4DOJ A;  4IFD K;  1FU1 A;  1FJP A;  1QL2 A;  1RE3 C;  1GL2 A;  1L4A C;  1LT9 C;  2NPS B;  5KTB A;  2KYV A;  3SWY A;  1FZB A;  1J1D C;  3HE5 A;  3NXS A;  1IO4 A;  1G2C A;  1GW4 A;  5AW0 B;  1FZE A;  2BAS A;  5AVZ B;  5AW7 B;  3H6P A;  4C7N A;  1SQB K;  2A45 H;  4XA4 A;  1FZF A;  1N73 B;  2M8R A;  3O8Z A;  4I2L C;  2XZR A;  5CJ4 A;  1CI6 A;  2KSJ A;  1JY2 N;  5APX A;  3V2Q A;  4B86 A;  1ZR2 A;  3HRN A;  5AVX B;  1SFC B;  4N6J A;  2YNY A;  1J1E C;  2XDJ A;  2IFN A;  2R32 A;  2XU6 A;  2Q7C A;  2XV5 A;  1S9K E;  3V2R A;  1IFM A;  1FZC B;  3L37 A;  3A5T A;  1DH3 A;  1JTH A;  2WSC H;  2YMY A;  1GL2 C;  1QL1 A;  1M1J B;  1JUN A;  3VMX A;  1N7S A;  2CPS A;  1JCC A;  3I5C A;  2N1T A;  2WIT A;  2Q5U A;  5CMZ A;  2C0W A;  2JJL A;  1SLQ A;  1T3U A;  5APS A;  3V4W A;  2WT7 B;  1GL2 D;  3C9I A;  1GDT A;  3MTU E;  3LW5 H;  3L35 A;  2POH A;  1A02 J;  2QM8 A;  2LKM A;  5BVZ A;  1KIL C;  1KFN A;  3HD7 A;  3HTK B;  1FOS E;  2N9B A;  1HGV A;  3HD7 B;  1NU1 K;  3KYQ A;  3R2P A;  2HYN A;  3B5N B;  1KIL D;  4LGD E;  1T2K C;  1NKN A;  2A45 G;  2HOD B;  1KZU B;  4RES B;  2YKO A;  2R3C A;  1RF0 A;  2WTY A;  3E1I A;  3MGN A;  2KOG A;  3CL3 D;  2GM4 A;  1RE3 A;  3P8M C;  1LT9 A;  1N7S C;  1T2K D;  2WPS A;  4WBA A;  2OYI C;  1Z56 A;  3OAK A;  4ZKP A;  5AVT B;  1L4A B;  2WPR A;  3RK3 C;  1J1D B;  4GIF A;  3VYI A;  1PFI A;  2WPQ A;  1IFJ A;  3GHG C;  1RF1 C;  1X79 B;  1JY2 P;  1N7L A;  1N86 A;  4OH8 B;  1YYC A;  3N7N A;  1CSB A;  2I1K A;  3P32 A;  1JCD A;  3RK3 D;  1HBW A;  4AYC A;  3MD0 A;  5AVR B;  3M0A A;  3V5B A;  2H7H A;  1AFO A;  3A2A A;  2VRS A;  3L4F A;  1MFZ A;  1G1I A;  1FJK A;  1OWA A;  3NTN A;  1NHL A;  1E5W A;  3B8E B;  2W27 A;  5KJ7 C;  1J1E B;  1LTA C;  3G3Z A;  2KB7 P;  2O01 H;  3RL0 B;  1GL2 B;  2M3B A;  2CPB A;  1JY2 O;  1EQ7 A;  3TNU A;  5KJ7 D;  3HE5 B;  3HE4 A;  1G2C B;  4IFM A;  2YO3 A;  3MIW A;  2FFD C;  3HUS C;  2OAR A;  1FOS F;  1LGH B;  5AW9 B;  3HE4 B;  1URQ C;  5AW2 B;  1KIL A;  1JY3 N;  4C7N B;  3OJA B;  1JMM A;  5AVY B;  2JEE A;  3RK2 C;  5KLV K;  1YTZ I;  4HH2 A;  1HGZ A;  2L5G B;  4LLH A;  2Z5H A;  3IFM A;  1GTW A;  1CI6 B;  4W7Z A;  1URQ D;  1ZV8 A;  3KQG A;  3M9B A;  3P7K A;  1NWQ A;  3M9H A;  3RK2 D;  5CCG C;  1DX7 A;  3KPE A;  5AVV B;  1RE4 A;  2GUS A;  3V2P A;  2ZFC A;  1JTH B;  2OYI A;  3N4X A;  5CCG D;  2Z4E A;  1N7S B;  5CJ0 A;  5CCH D;  1T3J A;  5APY A;  2OYI B;  1FZA A;  1H88 A;  1GK6 A;  2N1T B;  1G1J A;  3U1A A;  3KDP B;  3GHG A;  3M91 A;  1RF1 A;  4N78 E;  3V2N A;  3RK3 B;  4W7Y A;  2YO2 A;  3GHG B;  1SQX K;  4M3L A;  1SQQ K;  4N3Y B;  2O1K A;  1IFI A;  1HUC A;  2NPS D;  1YTZ T;  2Q9I A;  2R5D A;  3WMM 0;  2P7J A;  2ZXE B;  2Z5I A;  5APU A;  3BRT B;  5CHX A;  3EQ2 A;  1NO4 A;  5KJ7 A;  1RE4 C;  1VDF A;  2FXM A;  4C46 A;  2KLV A;  1SFC C;  1LTJ C;  3M9Q A;  1LT9 B;  3V4Q A;  3U59 A;  3BAS A;  1M1J C;  3NFQ A;  3EFG A;  1SFC D;  2FFD A;  3HUS A;  3VMZ A;  4WB4 A;  2FYZ A;  1URQ A;  2HLO A;  4GT1 A;  3VN0 A;  1S9K D;  5AW8 B;  3M0D A;  2FFD B;  3HUS B;  2KP8 A;  1URQ B;  3TYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...