1LGHB

Crystal structure of the light-harvesting complex ii (b800-850) from rhodospirillum molischianum
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
43
structure length
43
Chain Sequence
b'RSLSGLTEEEAIAVHDQFKTTFSAFIILAAVAHVLVWVWKPWF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIGHT HARVESTING COMPLEX II
publication title The crystal structure of the light-harvesting complex II (B800-850) from Rhodospirillum molischianum.
pubmed doi rcsb
molecule tags Light harvesting complex
total genus 16
structure length 43
sequence length 43
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 1996-03-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00556 LHC Antenna complex alpha/beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.250 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1lghB00
1DX7A 1LGHB 3WMM0 1JMMA 1IJDB 1JO5A 2FKWB 1KZUB 1WRGA 1NKZB
chains in the Genus database with same CATH superfamily
1L0LK 1EC5A 1JY2N 2VRSA 1MFTA 3BCCE 1LTJB 3GG2A 3W67A 3MUDC 5H2FH 3M0DA 3L71E 3RK3B 2IDBA 2QJYC 1EDKA 2WPQA 4PD4D 4UB8E 3MIWA 1M1KQ 3Q1MA 2R5DA 2W27A 1YITP 1EZVE 2K9JA 3H1HD 4WY4C 4U3FG 5EFWB 4TLFA 1N7LA 1S4XA 2Y0EA 1PP9E 4B86A 2JJLA 4H13B 2WPRA 3AE4C 5GTIH 5M1BA 3N4XA 1IFDA 2I1KA 3H1JD 5B66E 1OW7A 3TNUA 1S1CX 4PD4H 3HE4A 1SQPG 4NPEA 5H2FE 3CCUP 1GDTA 5KLVJ 1ZLLA 1ZOYC 3H1IJ 2QM7A 1GTWA 1MUUA 3ABVC 1X79B 1GD2E 2XDJA 3GMAA 1YJ9P 3B8EB 3TGUG 1T3UA 2GM4A 2BCCE 2QJKC 3RL0C 5AVZB 2MKVA 5KJ7D 1QX8A 2YKOA 3WUUA 1NTMK 1BSHA 5BVZA 1N7SC 3NMDA 1GL2D 2HFED 1OVRA 3A0BH 2KOGA 4IL6E 2WSEJ 3CWBD 2HPCB 2B87A 1MFZA 4IFMA 2HR3A 1Q81Q 4N78E 1CI6B 2L91A 2QVAA 2JO1A 1M56D 2OYIC 1FE6A 1S2EA 1L4AC 1N2DC 1FJKA 1JNMA 2H89C 2DW3A 4QMAA 1NJIQ 2YO3A 3G9RA 3I5CA 2GUSA 2WMMA 1NH4A 4OGQD 1J1EC 2LR2A 2H8PD 5KAIE 1NTKD 3BCCJ 3U1AA 1LP1A 2IBZD 3CLQA 2UWJE 3L73D 1LT9B 4XFJA 2YNYA 3A0BE 2JDIH 1EDJA 3VP8A 3Q2YA 3P8CD 1JEKA 4DCKA 1NGMB 5APUA 5CCHA 2XV5A 1S9KE 3L75E 1KYOH 2KZIA 2FFDA 3MP7B 3H1KJ 3B4SA 3TF5A 4LGDE 1RF0C 1ZR2A 5APSA 2QRXA 2PRRA 1U7JA 3JSVC 5KLVG 2QA4P 2YMYA 3TDKA 2YIUC 3P8MC 1BSNA 1KILE 2OARA 4WB4A 1PFIA 1SQQE 4EOTA 4JQ0D 4OWFA 1L0NJ 1HTLC 1AVYA 3C1LA 4N3YB 4WVZA 1EZVI 4K35A 3L72G 2WSCH 3LIEA 3BRTB 3VP9A 1RF1C 3H1LD 3CC4P 4D6TJ 1IFNA 2V7QH 1KYOE 4WBAA 3B5NB 1SQPD 3HD7B 1NTZD 1SQBJ 4WY4D 2WZ7A 3D71A 1PPJD 1FZEA 2IZ1A 1N73A 1SQVE 3ZDMA 2KUBA 1OMIA 3TGUD 3RK3E 1CW5A 5C39A 3AEFC 3AE1C 2FXMA 1K05A 1VQ4P 3E1IA 1W2BO 1G2CB 1SQXJ 2E75C 3HUSB 2KS1B 3BCCG 4H0LC 1OW8A 1IK7A 2IZ0A 5BU5A 4GOFA 2KLVA 1NU1E 2D2CB 1Q2NA 5KAFH 1KV4A 1NTZK 2Y0CA 2FXPA 5E79H 2IFMA 2HODA 1BE3D 4HKZH 1EZVG 3L70J 1KQGB 1M90Q 3RK2B 2W6BA 2ZAEB 4EIJA 4U3FE 1AJYA 2Q6QA 2QG4A 3KPEA 3RL0D 4ZKUA 1X9VA 3EQ2A 1S5LX 2H43A 1N7SD 3VTPC 1VQ6P 1GK4A 2O01H 1NTMJ 1RHZB 1BCCD 3L36A 1FZCB 5AVYB 2C0WA 1JM0A 3PH0A 2L5GB 1M7LA 3R4YA 5AW4B 1DX7A 3VMAA 1L4AD 2CPSA 4D6TG 2E74C 3SSUA 3SWFA 3HTKB 3HE5B 1H8AA 3H32A 1SLQA 1PGPA 4HYTB 3Q5RA 2FYZA 3O6QB 1SQBG 2FYUE 5KLVD 3SWKA 4LC1A 2WSFJ 1JB0J 2JWAA 2K3RA 1JO5A 5AVSB 2Z4EA 1AQTA 2N1TC 3L37A 4HH2A 2Y0DA 3Q3DA 2O1KA 3LW5J 4L73A 2Y9YA 3EFGA 2C0XA 4HB1A 2E76C 1SQXG 2SPZA 2N9BA 3L72D 3CCEP 1QVGO 1QEXA 1WRGA 3SFDC 3CCLP 4DZOA 3Q5SA 1NAYA 2E5TA 3T97A 4A7PA 3BATA 5TISE 1K9MQ 2ZYGA 5BU8B 3S9OA 1VQ8P 1SFCB 2Y9ZA 1EXIA 2HG5D 1KILC 1JTHB 1PGOA 1URQB 2LXBA 1M1JC 4BXLA 4UB6E 4Y28J 1QLED 3CPWO 4EYYQ 5B5EH 2RMZA 1YHQP 1DH3A 1NU1J 1ZMEC 2FY8A 2K1AA 3AECC 2IPPA 5AVUB 1EXJA 4EDFA 1ZV8A 1VF5C 1SP4A 3L75G 1X0TA 1MV8A 5APYA 4L75A 3BCCD 1LWUC 2AXTH 2WSSH 1T8ZA 1A02F 4GODA 4JPZB 3ITKA 3TSIA 2Z5IA 3F5HA 2NPSC 3L71D 2OQQA 5AVTB 1IFPA 1EZVD 2WT7A 3H1IE 1S5LE 1SQQG 1LTJC 1PP9D 2G3AA 2ITAA 1QL2A 3RK3C 5CBOA 2M5AB 2OYHA 3FXEA 2E75D 4H0LD 5AVWB 2C9NY 5AW3B 1YJWP 2IYOA 1KZUB 3IR9A 4H13C 1NHLA 3CX5I 2O3JA 3AEDC 2IFNA 2C9LY 2JP3A 1JOCA 1VPCA 2QSIA 5KJ7A 5KLIC 3PTZA 1XTCC 2ZXXA 3QH9A 4YPCA 1SQVG 1GL2A 3VYIA 3IAOA 2YMKA 1RE3A 2BCCD 2XKMA 4H44B 3OW2O 2JR8A 1JUNA 2QJPB 1LTTC 1NU1G 2XU6A 4N78D 1GK6A 2O01N 1YJNP 3MZWB 3GW6A 1TU3F 3M9HA 2K9JB 2E74D 3A5TA 1PV3A 3JC22 3H1KE 1JCDA 5CCGC 3I55P 1H88A 3OA7A 3OAKA 3CCQP 3TNUB 3E1RA 4IL6H 2N1TD 3GHGA 3V2RA 1VQ7P 2PGDA 1VQNP 4DT0A 4W80A 3HE4B 2M3EA 2OTKE 1L0NE 1FAVA 2E76D 1KN7A 1AV1A 2RN0A 3GF3A 2GA1A 1YYCA 4D6TE 1S9KD 3L75D 2YKPA 3VMXA 4I7ZB 2RKLA 2QIWA 1LJ2A 1LT9C 2KZJA 1OVVA 4BWNA 2AEMA 1USDA 4OH8B 2FYUG 4ASVA 1SQBE 1JCCA 5KAIH 2BEZF 1KILD 1KQFB 1YTZI 1SQQD 1FU1A 2R44A 2B87B 1WMKA 1JMMA 1Z56A 3MUDA 3WUTA 5DJTB 2W90A 3PLNA 3A3YB 1VF5D 4PV1B 5AW5B 1IZNB 1SQXE 3VN0A 1KMIZ 4WY4A 5CHXA 1PZQA 3U1CA 1KTMA 2NPSD 1KYOD 4NPDA 1J2JB 3PRJA 2ZT9B 2Z5HA 4I2LC 3VMYA 2KSJA 2OTLP 3L70E 1K04A 3D6ZA 1LP1B 1SQVD 2YO2A 4AYCA 3FWNA 3V6IA 3RK3D 1LNQA 3B5NC 3M91A 1PGJA 3P7KA 3HD7C 4RKUJ 1ZRTE 2Q5UA 1LTBC 2FBWC 5DJUB 3LW5H 2FFDB 1NTME 5CJ4A 1BGYJ 2A06E 1NVOA 4H13D 1NU1D 1ZN5A 1LT9A 4KHXA 1W5CE 4GOEA 1NTKK 3GLMA 3H1IG 3HUSC 1N7SA 1NAFA 2M8RA 1FZBA 1YQ4C 3AE6C 4U3FD 1EQ7A 3L74J 2D2CC 4XA4A 1NWQA 3CI9A 2ZXEB 2WPSA 1JY2P 3MTUE 2A45I 2OYIA 3RK2C 1L4AA 1L0LJ 1QGKB 1JY3N 2IX7C 1IO4A 3K5BA 3AEGC 4BRYA 1IJDB 1FZFA 1N73B 4NPFX 5AW6B 1LTSC 4N6JA 2K88A 1NKZB 3OJAB 5CCGD 1FZCC 1HUCA 3CXHI 3CX5H 3M06A 5AW1B 2FYUD 4GKGA 2CPBA 4U7JA 2PFXA 2KP8A 1LTGC 4C46A 1JMBA 1SQPK 2KI7B 2HODB 1RF0A 2P2UA 5APVA 3WMM0 3A0HE 1MKMA 4C7NA 1WT6A 2A45G 3H1HJ 3CL3D 4RESB 3AEBC 3H1KG 2BEQD 4KT0J 2WVRA 4GT1A 3HRNA 5AVRB 4IOIH 1XTGB 3CX5E 3NFQA 3H1JJ 4RJTA 1P84E 2J59M 1RF1A 1NOHA 2P7JA 3L74G 1L0NG 2R5BA 1FOSE 2ZJSE 1LTIC 3S1KA 2Q1KA 2AXCA 3H1LE 1SFCC 2R3SA 1R5SA 1L0LG 1ZW0A 1URQC 3H32B 1DD4A 5TISH 1L2PA 2JEEA 3KQGA 3CCSP 2Q9IA 1RE4C 1Y8AA 4UB6H 3H1ID 3CWBJ 1IC2A 3AE2C 2KXPB 1H0TA 3IFMA 3CD6P 3B5ND 3HD7D 1YBKA 3MD0A 2P1JA 2XZRA 3C8VA 2AEFA 3T97B 1AVOA 3W68A 2NRGA 5KLVK 2POHA 2KIKA 4AQRD 2W6JH 3M0AA 3QWOC 1SS1A 3L70G 1HWTC 1S5LH 1MZ9A 2H88C 1T6AA 1NTKJ 3L73J 3WU2H 3AE9C 2D2CD 3C9IA 2E43A 1GU5A 1FZAA 3PP5A 1PL5A 1VQPP 2E42A 2WITA 3CCRP 3U59A 3H1JG 1OW6A 3RK2D 1UIIA 2WSEH 2FYNB 1NTMG 2WSCJ 1GW3A 2V4HA 2A06G 4TT3H 2N9YB 2V7QJ 1IFIA 3AEEC 4W7ZA 2P10A 4H44C 2WT7B 1DEEG 1HBWA 4R4LA 2KNCA 2N1TA 2QJPC 3FXDA 3O8ZA 3H1KD 2Q7CA 2GUVA 4GIFA 3WU2E 1OFCX 3PHLA 2OYHB 4L74A 4Y99B 3F89A 3H1LJ 1VQKP 3CWBG 3WUVA 3KHUA 3USSA 1BDCA 1YI2P 1FJPA 1L0ND 1SQPJ 1QVFO 3MHVA 2M5AA 1P84I 1NTZJ 3M9QA 2A45H 5GTHH 2BASA 4D6TD 1U7MA 1GL2B 4DOJA 2JWDA 1KILA 3LIDA 1K8AQ 1M1JA 1X22A 1FS0E 4WWIA 3H6PA 1KB9E 4ZMDA 1SQBD 5CMZA 3CMEP 3UIAA 2K9YA 1OVUA 4W7YA 1LWUA 4Z1MH 4I7ZC 2NPSA 3CXHH 5KKZB 1R5LA 2ZVNB 1BE3J 1H89A 1FC2C 1SFCD 1EDLA 3G71P 1HJ0A 1VDFA 1SQXD 1Q86Q 4OGQB 1URQD 1BGYE 1VQ9P 5GTHE 1LTJA 4GDOA 2QM8A 1GU4A 1SQBK 4CPGA 2W83C 1EDIA 1VQOP 4PV1C 5CBNA 3L70D 3GHGB 2HYNA 3V4WA 3KYQA 1BCCJ 1IK9A 4XE5B 3L74E 2ZT9C 1ZR4A 2M3BA 1SQXK 3CCMP 2I8DA 3CXHE 3H1LG 1ZRTD 4L76A 1R8EA 5KLIB 2KSEA 2H7HA 1NTMD 1L0LE 3G6EP 4DJGA 2A06D 3TYYA 2M0BA 3G3ZA 2G8YA 1U57A 2OYOA 1KD1Q 1T3JA 3V4QA 1J1DB 1NTZG 5CJ0A 3D6YA 5CCHC 2Q3IA 3NXSA 1LT1A 2OGUA 1PPJG 2FFDC 1FDOA 4PJ0H 1HVVA 2QJYB 1Q90D 2FXOA 5GTIE 3L72J 2ZYAA 1BDDA 4WY4B 1E79H 1RH5B 1VL2A 2B9BA 1NO4A 2HPCA 5CCGA 1BE3G 4PD4E 1M57D 2K37A 4YTPC 3EWKA 4H44D 1ZXGA 3FGAD 3L35A 1SQQK 1CI6A 3TK1A 3V2PA 3Q5PA 3NTNA 1FZGA 3BRVB 3H1HE 1OWAA 2KB7P 1KQLA 4ZNCA 2MJZA 1IFMA 2WSFH 4PJ0E 1K73Q 1OXZA 2PAJA 3H1JE 2OTJP 2KK7A 2R32A 1N73C 1BCCG 4M3LA 3RGUA 1RQUA 5KTBA 1N86A 1ZP0C 1FOSF 1HJBA 1KB9I 2QJKB 3L71J 3RL0B 3RL0g 1OX3A 1KFMA 5AVQB 1N7SB 3V2QA 1VQMP 1SQVK 1GZLA 1JY2O 1PP9J 4RO0A 1AA0A 3RBZA 2R3CA 1YTZT 1M8OB 1LTAC 2OYIB 3E7KA 3CX5D 1L4AB 2ZFCA 1P84D 1NU1K 4IFFA 3CWBE 1X8YA 1A02J 2B88A 4ASWA 1HGVA 3A0HH 3CC7P 5AW9B 4BRYB 2LXCB 3N7NA 3IF4A 4JYCA 4JF7A 4C7RA 1J1EB 1LGHB 2RH0A 5AVXB 3SWYA 5TJHA 4O9BA 2BCCJ 2FKWB 3B5NA 2YXRB 3JCUH 3A2AA 4PV1D 1P84H 2YKQA 3HD7A 4YXDC 3G4SP 1NTKE 2IYPA 3B71A 1UIXA 2IBZE 2WWWA 3L73E 3V5BA 3AE3C 2ZT9D 4I6MC 1CZQA 3EFFK 3P8CE 4C7NB 2YIUB 1KQSO 4EI2A 2KLUA 1G2CA 3H25A 4AUWA 3HUSA 1BGYG 2KS1A 4I1LA 3L71G 3II6A 2FYUK 5APWA 4LLHA 1DEBA 4IFDK 5CCHD 2W8ZA 2AEJA 1FDIA 1RF1B 1Y9BA 1VQLP 2PP6A 2J58A 3JCUE 1W2EA 2NZ2A 1PP9G 3BVHA 1RY3A 3RBXA 1Q7YQ 2WPVB 4PD4I 1T2KC 3I56P 1G1IA 1PGQA 1GMJA 2WQYC 2Q3EA 3CCVP 3L75J 2W6AA 2XNDH 2HLOA 5AW2B 3L4FA 1FZCA 2JKVA 1SQPE 5AVVB 5KAFE 5E79E 1NTZE 2LKMA 2E75B 4H0LB 2FYNC 1SQQJ 1PPJE 1H0TB 5L8RJ 3HTKA 2BCCG 3TGUE 3HE5A 2YXQB 2B89A 3BASA 1KC8Q 3CC2P 4JBZA 3O6QA 5APXA 3AEAC 3FX0A 1Y47A 2XNXA 2J5UA 2ZYDA 2QE7H 3KZIH 2KYVA 1KFNA 2ZVOB 4JYBA 3KDPB 1G1JA 1YIJP 3CCJP 1HH0A 1BE3E 4MN4C 2OYHC 2WTYA 3A7OA 4Y99C 1AQ5A 5APQA 3H1HG 3AE5C 5APTA 1USEA 1NYHA 3KXDA 1SQVJ 4ZKPA 5AW7B 3D70A 4K3AA 1YQ3C 1JY3O 1KB9D 1FDMA 3R2PA 1DIPA 3AE8C 5KJ7C 1OZHA 3CMAP 2E74B 1SFCA 1KYOI 1GL2C 1JTHA 3MGNA 1BCCE 3PJSK 1URQA 1RE3C 1JY3P 1KORA 1IFJA 1HF9A 3KZIE 1HGZA 1GW4A 1Q82Q 1RE4A 2KNCB 2IBZI 3V2NA 2N1TB 2I1JA 4U3FJ 1BGYD 2P58A 1KB9H 3M0DC 1S3JA 5KKZC 2P67A 2E76B 1CSBA 1DD3A 5KLVE 1QL1A 4OGQC 1FBMA 3S4RA 1E5WA 3L74D 4HJGH 5B5EE 2CK3H 4YXWH 2E5YA 4R4MA 3CXHD 3IN6A 3L72E 4IL6X 4KJMA 3GHGC 3GF7A 1KILB 3VMZA 2QEXP 1M1JB 1L0LD 3M9BA 3P32A 1NKNA 4UB8H 2AXTE 3TGUJ 3VOPA 1PIXA 1SVFA 5AW0B 1N8RQ 2FYUJ 3SFEC 1VF5B 3FWLA 2O1JA 1NTKG 1AFOA 1LWUB 3AE7C 1L0NK 1S72P 2IBZG 3L73G 1VQ5P 1T2KD 2O01J 5K5GB 2NPSB 4OVNF 5B66H 1D7MA 1J1DC 1OIPA 5AW8B 1RQVA
chains in the Genus database with same CATH topology
1OWAA 1L0LK 2KB7P 1JY2N 2VRSA 2HODB 5BU8B 1KQLA 1RF0A 1SFCB 2P2UA 5APVA 1LTJB 3WMM0 2HG5D 1KILC 1JTHB 2MJZA 1URQB 4C7NA 1M1JC 1IFMA 2WSFH 1OXZA 3M0DA 1WT6A 2A45G 3RK3B 2WPQA 1DH3A 3CL3D 4RESB 2PAJA 3MIWA 1SQPK 2R32A 2R5DA 1N73C 2W27A 4M3LA 2IPPA 5KTBA 1N86A 5AVUB 4GT1A 1FOSF 4WY4C 1ZV8A 3HRNA 1HJBA 1N7LA 5AVRB 1SP4A 3RL0B 1XTGB 4B86A 1MV8A 5APYA 2JJLA 3NFQA 1LWUC 2WPRA 1T8ZA 1A02F 2J59M 1RF1A 1KFMA 5AVQB 2Z5IA 3TSIA 1N7SB 2NPSC 3V2QA 3N4XA 1SQVK 1NOHA 2P7JA 1GZLA 2R5BA 1JY2O 1IFDA 2I1KA 1FOSE 3TNUA 1LTIC 5AVTB 2WT7A 1SFCC 2R3CA 1LTJC 1YTZT 3HE4A 1LTAC 2OYIB 1GDTA 1L4AB 1URQC 1QL2A 3H32B 2ZFCA 1NU1K 4IFFA 1ZLLA 2JEEA 3RK3C 3KQGA 1X8YA 2QM7A 1GTWA 2OYHA 1MUUA 1A02J 1X79B 1HGVA 1GD2E 2XDJA 2Q9IA 3B8EB 1RE4C 1T3UA 5AVWB 2C9NY 5AW3B 5AW9B 2GM4A 3N7NA 3RL0C 5AVZB 4JYCA 4JF7A 4C7RA 3IR9A 1KZUB 1J1EB 1IC2A 5KJ7D 1LGHB 2YKOA 1NTMK 1NHLA 5AVXB 3IFMA 5BVZA 1N7SC 2IFNA 3B5ND 3SWYA 3NMDA 2C9LY 1GL2D 1JOCA 4O9BA 1VPCA 2HFED 2KOGA 2FKWB 3HD7D 5KJ7A 3MD0A 2HPCB 2P1JA 1MFZA 1XTCC 3B5NA 4IFMA 3A2AA 2XZRA 1GL2A 4N78E 3VYIA 2YKQA 3HD7A 1RE3A 1CI6B 2XKMA 2OYIC 1L4AC 1N2DC 5KLVK 1FJKA 1JNMA 2POHA 2WWWA 3V5BA 4AQRD 3M0AA 4I6MC 1CZQA 1HWTC 1MZ9A 1JUNA 3P8CE 2YO3A 1LTTC 4C7NB 3I5CA 2XU6A 2GUSA 4N78D 1GK6A 1G2CA 3C9IA 2E43A 4AUWA 1GU5A 3HUSA 1FZAA 1NH4A 1J1EC 3PP5A 2H8PD 3M9HA 4I1LA 3U1AA 2E42A 3II6A 2WITA 2FYUK 5APWA 3CLQA 4LLHA 3U59A 3A5TA 1LT9B 1DEBA 2YNYA 3RK2D 2WSEH 4IFDK 5CCHD 3VP8A 1GW3A 1RF1B 1JCDA 5CCGC 2PP6A 2J58A 3P8CD 1W2EA 1H88A 3BVHA 3OA7A 5APUA 5CCHA 2XV5A 1IFIA 1RY3A 1S9KE 3OAKA 1T2KC 4W7ZA 3TNUB 1G1IA 2FFDA 2N1TD 2WT7B 3GHGA 3V2RA 4LGDE 1RF0C 4W80A 1ZR2A 3HE4B 5APSA 1HBWA 1FAVA 2N1TA 3O8ZA 2W6AA 2YMYA 2Q7CA 2GUVA 3P8MC 2HLOA 2OARA 4WB4A 5AW2B 4GIFA 1PFIA 2OYHB 4EOTA 3L4FA 4Y99B 1FZCA 1YYCA 1S9KD 5AVVB 2YKPA 1HTLC 3VMXA 4N3YB 2LKMA 1LT9C 2WSCH 3LIEA 1FJPA 3BRTB 3VP9A 1RF1C 4OH8B 1IFNA 3HTKA 1JCCA 3HE5A 1KILD 3BASA 1YTZI 3M9QA 2A45H 1FU1A 4WBAA 3B5NB 2BASA 1JMMA 1GL2B 5APXA 4DOJA 1KILA 1Z56A 3MUDA 3LIDA 1M1JA 3HD7B 3A3YB 4WY4D 2WZ7A 2XNXA 5AW5B 3H6PA 1FZEA 1N73A 2KYVA 1KFNA 4JYBA 3VN0A 3KDPB 1G1JA 1HH0A 5CMZA 4WY4A 2OYHC 5CHXA 3U1CA 2WTYA 3A7OA 4Y99C 3UIAA 1AQ5A 1CW5A 2NPSD 5APQA 1J2JB 4W7YA 2Z5HA 5APTA 2FXMA 1LWUA 4I2LC 3E1IA 3VMYA 1G2CB 3HUSB 2KSJA 2NPSA 4ZKPA 5AW7B 1H89A 1SFCD 5BU5A 2KLVA 1JY3O 1VDFA 1FDMA 3R2PA 1NTZK 2YO2A 1URQD 2IFMA 4AYCA 5KJ7C 2HODA 1SFCA 3RK3D 1LTJA 3B5NC 3M91A 1GL2C 2QM8A 1JTHA 3MGNA 3P7KA 3RK2B 1GU4A 1SQBK 1URQA 3HD7C 2W6BA 1RE3C 1JY3P 2Q5UA 1LTBC 4EIJA 1IFJA 3LW5H 2FFDB 3KPEA 5CJ4A 3GHGB 3RL0D 2HYNA 4ZKUA 1X9VA 1HGZA 1GW4A 3V4WA 1ZN5A 1RE4A 1LT9A 3KYQA 4KHXA 3EQ2A 3V2NA 1IK9A 2N1TB 2H43A 2I1JA 1N7SD 4XE5B 3VTPC 1GK4A 2O01H 1NTKK 1ZR4A 2M3BA 1SQXK 3M0DC 3HUSC 1N7SA 1NAFA 3L36A 1FZCB 2M8RA 1FZBA 2P67A 5AVYB 2C0WA 1CSBA 2L5GB 1EQ7A 1M7LA 2H7HA 5AW4B 1DX7A 4XA4A 1NWQA 1QL1A 3CI9A 2ZXEB 3TYYA 1L4AD 2CPSA 3G3ZA 1FBMA 2WPSA 1JY2P 3MTUE 3SWFA 1T3JA 1E5WA 2A45I 3HTKB 3V4QA 1J1DB 2OYIA 5CJ0A 3HE5B 3RK2C 1L4AA 1H8AA 5CCHC 3H32A 5AW8B 1SLQA 2Q3IA 3NXSA 4HYTB 2FYZA 2FFDC 1JY3N 3GHGC 2IX7C 1KILB 3VMZA 4LC1A 1IO4A 1M1JB 3M9BA 1HVVA 3P32A 1JO5A 1NKNA 5AVSB 2Z4EA 2N1TC 1IJDB 3L37A 4HH2A 1FZFA 1N73B 2O1KA 3VOPA 1SVFA 5AW6B 1LTSC 4N6JA 5AW0B 1NKZB 3OJAB 4WY4B 5CCGD 3EFGA 1FZCC 1HUCA 2C0XA 2O1JA 1AFOA 1LWUB 3M06A 2N9BA 1L0NK 1NO4A 2HPCA 5AW1B 5CCGA 1T2KD 4GKGA 2CPBA 2NPSB 1WRGA 3L35A 1SQQK 1CI6A 3TK1A 3V2PA 4DZOA 3NTNA 3T97A 2KP8A 1LTGC 4C46A 1FZGA 1J1DC 3BRVB 3BATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DX7 A;  1LGH B;  3WMM 0;  1JMM A;  1IJD B;  1JO5 A;  2FKW B;  1KZU B;  1WRG A;  1NKZ B; 
#chains in the Genus database with same CATH topology
 1L0L K;  1EC5 A;  1JY2 N;  2VRS A;  1MFT A;  3BCC E;  1LTJ B;  3GG2 A;  3W67 A;  3MUD C;  5H2F H;  3M0D A;  3L71 E;  3RK3 B;  2IDB A;  2QJY C;  1EDK A;  2WPQ A;  4PD4 D;  4UB8 E;  3MIW A;  1M1K Q;  3Q1M A;  2R5D A;  2W27 A;  1YIT P;  1EZV E;  2K9J A;  3H1H D;  4WY4 C;  4U3F G;  5EFW B;  4TLF A;  1N7L A;  1S4X A;  2Y0E A;  1PP9 E;  4B86 A;  2JJL A;  4H13 B;  2WPR A;  3AE4 C;  5GTI H;  5M1B A;  3N4X A;  1IFD A;  2I1K A;  3H1J D;  5B66 E;  1OW7 A;  3TNU A;  1S1C X;  4PD4 H;  3HE4 A;  1SQP G;  4NPE A;  5H2F E;  3CCU P;  1GDT A;  5KLV J;  1ZLL A;  1ZOY C;  3H1I J;  2QM7 A;  1GTW A;  1MUU A;  3ABV C;  1X79 B;  1GD2 E;  2XDJ A;  3GMA A;  1YJ9 P;  3B8E B;  3TGU G;  1T3U A;  2GM4 A;  2BCC E;  2QJK C;  3RL0 C;  5AVZ B;  2MKV A;  5KJ7 D;  1QX8 A;  2YKO A;  3WUU A;  1NTM K;  1BSH A;  5BVZ A;  1N7S C;  3NMD A;  1GL2 D;  2HFE D;  1OVR A;  3A0B H;  2KOG A;  4IL6 E;  2WSE J;  3CWB D;  2HPC B;  2B87 A;  1MFZ A;  4IFM A;  2HR3 A;  1Q81 Q;  4N78 E;  1CI6 B;  2L91 A;  2QVA A;  2JO1 A;  1M56 D;  2OYI C;  1FE6 A;  1S2E A;  1L4A C;  1N2D C;  1FJK A;  1JNM A;  2H89 C;  2DW3 A;  4QMA A;  1NJI Q;  2YO3 A;  3G9R A;  3I5C A;  2GUS A;  2WMM A;  1NH4 A;  4OGQ D;  1J1E C;  2LR2 A;  2H8P D;  5KAI E;  1NTK D;  3BCC J;  3U1A A;  1LP1 A;  2IBZ D;  3CLQ A;  2UWJ E;  3L73 D;  1LT9 B;  4XFJ A;  2YNY A;  3A0B E;  2JDI H;  1EDJ A;  3VP8 A;  3Q2Y A;  3P8C D;  1JEK A;  4DCK A;  1NGM B;  5APU A;  5CCH A;  2XV5 A;  1S9K E;  3L75 E;  1KYO H;  2KZI A;  2FFD A;  3MP7 B;  3H1K J;  3B4S A;  3TF5 A;  4LGD E;  1RF0 C;  1ZR2 A;  5APS A;  2QRX A;  2PRR A;  1U7J A;  3JSV C;  5KLV G;  2QA4 P;  2YMY A;  3TDK A;  2YIU C;  3P8M C;  1BSN A;  1KIL E;  2OAR A;  4WB4 A;  1PFI A;  1SQQ E;  4EOT A;  4JQ0 D;  4OWF A;  1L0N J;  1HTL C;  1AVY A;  3C1L A;  4N3Y B;  4WVZ A;  1EZV I;  4K35 A;  3L72 G;  2WSC H;  3LIE A;  3BRT B;  3VP9 A;  1RF1 C;  3H1L D;  3CC4 P;  4D6T J;  1IFN A;  2V7Q H;  1KYO E;  4WBA A;  3B5N B;  1SQP D;  3HD7 B;  1NTZ D;  1SQB J;  4WY4 D;  2WZ7 A;  3D71 A;  1PPJ D;  1FZE A;  2IZ1 A;  1N73 A;  1SQV E;  3ZDM A;  2KUB A;  1OMI A;  3TGU D;  3RK3 E;  1CW5 A;  5C39 A;  3AEF C;  3AE1 C;  2FXM A;  1K05 A;  1VQ4 P;  3E1I A;  1W2B O;  1G2C B;  1SQX J;  2E75 C;  3HUS B;  2KS1 B;  3BCC G;  4H0L C;  1OW8 A;  1IK7 A;  2IZ0 A;  5BU5 A;  4GOF A;  2KLV A;  1NU1 E;  2D2C B;  1Q2N A;  5KAF H;  1KV4 A;  1NTZ K;  2Y0C A;  2FXP A;  5E79 H;  2IFM A;  2HOD A;  1BE3 D;  4HKZ H;  1EZV G;  3L70 J;  1KQG B;  1M90 Q;  3RK2 B;  2W6B A;  2ZAE B;  4EIJ A;  4U3F E;  1AJY A;  2Q6Q A;  2QG4 A;  3KPE A;  3RL0 D;  4ZKU A;  1X9V A;  3EQ2 A;  1S5L X;  2H43 A;  1N7S D;  3VTP C;  1VQ6 P;  1GK4 A;  2O01 H;  1NTM J;  1RHZ B;  1BCC D;  3L36 A;  1FZC B;  5AVY B;  2C0W A;  1JM0 A;  3PH0 A;  2L5G B;  1M7L A;  3R4Y A;  5AW4 B;  1DX7 A;  3VMA A;  1L4A D;  2CPS A;  4D6T G;  2E74 C;  3SSU A;  3SWF A;  3HTK B;  3HE5 B;  1H8A A;  3H32 A;  1SLQ A;  1PGP A;  4HYT B;  3Q5R A;  2FYZ A;  3O6Q B;  1SQB G;  2FYU E;  5KLV D;  3SWK A;  4LC1 A;  2WSF J;  1JB0 J;  2JWA A;  2K3R A;  1JO5 A;  5AVS B;  2Z4E A;  1AQT A;  2N1T C;  3L37 A;  4HH2 A;  2Y0D A;  3Q3D A;  2O1K A;  3LW5 J;  4L73 A;  2Y9Y A;  3EFG A;  2C0X A;  4HB1 A;  2E76 C;  1SQX G;  2SPZ A;  2N9B A;  3L72 D;  3CCE P;  1QVG O;  1QEX A;  1WRG A;  3SFD C;  3CCL P;  4DZO A;  3Q5S A;  1NAY A;  2E5T A;  3T97 A;  4A7P A;  3BAT A;  5TIS E;  1K9M Q;  2ZYG A;  5BU8 B;  3S9O A;  1VQ8 P;  1SFC B;  2Y9Z A;  1EXI A;  2HG5 D;  1KIL C;  1JTH B;  1PGO A;  1URQ B;  2LXB A;  1M1J C;  4BXL A;  4UB6 E;  4Y28 J;  1QLE D;  3CPW O;  4EYY Q;  5B5E H;  2RMZ A;  1YHQ P;  1DH3 A;  1NU1 J;  1ZME C;  2FY8 A;  2K1A A;  3AEC C;  2IPP A;  5AVU B;  1EXJ A;  4EDF A;  1ZV8 A;  1VF5 C;  1SP4 A;  3L75 G;  1X0T A;  1MV8 A;  5APY A;  4L75 A;  3BCC D;  1LWU C;  2AXT H;  2WSS H;  1T8Z A;  1A02 F;  4GOD A;  4JPZ B;  3ITK A;  3TSI A;  2Z5I A;  3F5H A;  2NPS C;  3L71 D;  2OQQ A;  5AVT B;  1IFP A;  1EZV D;  2WT7 A;  3H1I E;  1S5L E;  1SQQ G;  1LTJ C;  1PP9 D;  2G3A A;  2ITA A;  1QL2 A;  3RK3 C;  5CBO A;  2M5A B;  2OYH A;  3FXE A;  2E75 D;  4H0L D;  5AVW B;  2C9N Y;  5AW3 B;  1YJW P;  2IYO A;  1KZU B;  3IR9 A;  4H13 C;  1NHL A;  3CX5 I;  2O3J A;  3AED C;  2IFN A;  2C9L Y;  2JP3 A;  1JOC A;  1VPC A;  2QSI A;  5KJ7 A;  5KLI C;  3PTZ A;  1XTC C;  2ZXX A;  3QH9 A;  4YPC A;  1SQV G;  1GL2 A;  3VYI A;  3IAO A;  2YMK A;  1RE3 A;  2BCC D;  2XKM A;  4H44 B;  3OW2 O;  2JR8 A;  1JUN A;  2QJP B;  1LTT C;  1NU1 G;  2XU6 A;  4N78 D;  1GK6 A;  2O01 N;  1YJN P;  3MZW B;  3GW6 A;  1TU3 F;  3M9H A;  2K9J B;  2E74 D;  3A5T A;  1PV3 A;  3JC2 2;  3H1K E;  1JCD A;  5CCG C;  3I55 P;  1H88 A;  3OA7 A;  3OAK A;  3CCQ P;  3TNU B;  3E1R A;  4IL6 H;  2N1T D;  3GHG A;  3V2R A;  1VQ7 P;  2PGD A;  1VQN P;  4DT0 A;  4W80 A;  3HE4 B;  2M3E A;  2OTK E;  1L0N E;  1FAV A;  2E76 D;  1KN7 A;  1AV1 A;  2RN0 A;  3GF3 A;  2GA1 A;  1YYC A;  4D6T E;  1S9K D;  3L75 D;  2YKP A;  3VMX A;  4I7Z B;  2RKL A;  2QIW A;  1LJ2 A;  1LT9 C;  2KZJ A;  1OVV A;  4BWN A;  2AEM A;  1USD A;  4OH8 B;  2FYU G;  4ASV A;  1SQB E;  1JCC A;  5KAI H;  2BEZ F;  1KIL D;  1KQF B;  1YTZ I;  1SQQ D;  1FU1 A;  2R44 A;  2B87 B;  1WMK A;  1JMM A;  1Z56 A;  3MUD A;  3WUT A;  5DJT B;  2W90 A;  3PLN A;  3A3Y B;  1VF5 D;  4PV1 B;  5AW5 B;  1IZN B;  1SQX E;  3VN0 A;  1KMI Z;  4WY4 A;  5CHX A;  1PZQ A;  3U1C A;  1KTM A;  2NPS D;  1KYO D;  4NPD A;  1J2J B;  3PRJ A;  2ZT9 B;  2Z5H A;  4I2L C;  3VMY A;  2KSJ A;  2OTL P;  3L70 E;  1K04 A;  3D6Z A;  1LP1 B;  1SQV D;  2YO2 A;  4AYC A;  3FWN A;  3V6I A;  3RK3 D;  1LNQ A;  3B5N C;  3M91 A;  1PGJ A;  3P7K A;  3HD7 C;  4RKU J;  1ZRT E;  2Q5U A;  1LTB C;  2FBW C;  5DJU B;  3LW5 H;  2FFD B;  1NTM E;  5CJ4 A;  1BGY J;  2A06 E;  1NVO A;  4H13 D;  1NU1 D;  1ZN5 A;  1LT9 A;  4KHX A;  1W5C E;  4GOE A;  1NTK K;  3GLM A;  3H1I G;  3HUS C;  1N7S A;  1NAF A;  2M8R A;  1FZB A;  1YQ4 C;  3AE6 C;  4U3F D;  1EQ7 A;  3L74 J;  2D2C C;  4XA4 A;  1NWQ A;  3CI9 A;  2ZXE B;  2WPS A;  1JY2 P;  3MTU E;  2A45 I;  2OYI A;  3RK2 C;  1L4A A;  1L0L J;  1QGK B;  1JY3 N;  2IX7 C;  1IO4 A;  3K5B A;  3AEG C;  4BRY A;  1IJD B;  1FZF A;  1N73 B;  4NPF X;  5AW6 B;  1LTS C;  4N6J A;  2K88 A;  1NKZ B;  3OJA B;  5CCG D;  1FZC C;  1HUC A;  3CXH I;  3CX5 H;  3M06 A;  5AW1 B;  2FYU D;  4GKG A;  2CPB A;  4U7J A;  2PFX A;  2KP8 A;  1LTG C;  4C46 A;  1JMB A;  1SQP K;  2KI7 B;  2HOD B;  1RF0 A;  2P2U A;  5APV A;  3WMM 0;  3A0H E;  1MKM A;  4C7N A;  1WT6 A;  2A45 G;  3H1H J;  3CL3 D;  4RES B;  3AEB C;  3H1K G;  2BEQ D;  4KT0 J;  2WVR A;  4GT1 A;  3HRN A;  5AVR B;  4IOI H;  1XTG B;  3CX5 E;  3NFQ A;  3H1J J;  4RJT A;  1P84 E;  2J59 M;  1RF1 A;  1NOH A;  2P7J A;  3L74 G;  1L0N G;  2R5B A;  1FOS E;  2ZJS E;  1LTI C;  3S1K A;  2Q1K A;  2AXC A;  3H1L E;  1SFC C;  2R3S A;  1R5S A;  1L0L G;  1ZW0 A;  1URQ C;  3H32 B;  1DD4 A;  5TIS H;  1L2P A;  2JEE A;  3KQG A;  3CCS P;  2Q9I A;  1RE4 C;  1Y8A A;  4UB6 H;  3H1I D;  3CWB J;  1IC2 A;  3AE2 C;  2KXP B;  1H0T A;  3IFM A;  3CD6 P;  3B5N D;  3HD7 D;  1YBK A;  3MD0 A;  2P1J A;  2XZR A;  3C8V A;  2AEF A;  3T97 B;  1AVO A;  3W68 A;  2NRG A;  5KLV K;  2POH A;  2KIK A;  4AQR D;  2W6J H;  3M0A A;  3QWO C;  1SS1 A;  3L70 G;  1HWT C;  1S5L H;  1MZ9 A;  2H88 C;  1T6A A;  1NTK J;  3L73 J;  3WU2 H;  3AE9 C;  2D2C D;  3C9I A;  2E43 A;  1GU5 A;  1FZA A;  3PP5 A;  1PL5 A;  1VQP P;  2E42 A;  2WIT A;  3CCR P;  3U59 A;  3H1J G;  1OW6 A;  3RK2 D;  1UII A;  2WSE H;  2FYN B;  1NTM G;  2WSC J;  1GW3 A;  2V4H A;  2A06 G;  4TT3 H;  2N9Y B;  2V7Q J;  1IFI A;  3AEE C;  4W7Z A;  2P10 A;  4H44 C;  2WT7 B;  1DEE G;  1HBW A;  4R4L A;  2KNC A;  2N1T A;  2QJP C;  3FXD A;  3O8Z A;  3H1K D;  2Q7C A;  2GUV A;  4GIF A;  3WU2 E;  1OFC X;  3PHL A;  2OYH B;  4L74 A;  4Y99 B;  3F89 A;  3H1L J;  1VQK P;  3CWB G;  3WUV A;  3KHU A;  3USS A;  1BDC A;  1YI2 P;  1FJP A;  1L0N D;  1SQP J;  1QVF O;  3MHV A;  2M5A A;  1P84 I;  1NTZ J;  3M9Q A;  2A45 H;  5GTH H;  2BAS A;  4D6T D;  1U7M A;  1GL2 B;  4DOJ A;  2JWD A;  1KIL A;  3LID A;  1K8A Q;  1M1J A;  1X22 A;  1FS0 E;  4WWI A;  3H6P A;  1KB9 E;  4ZMD A;  1SQB D;  5CMZ A;  3CME P;  3UIA A;  2K9Y A;  1OVU A;  4W7Y A;  1LWU A;  4Z1M H;  4I7Z C;  2NPS A;  3CXH H;  5KKZ B;  1R5L A;  2ZVN B;  1BE3 J;  1H89 A;  1FC2 C;  1SFC D;  1EDL A;  3G71 P;  1HJ0 A;  1VDF A;  1SQX D;  1Q86 Q;  4OGQ B;  1URQ D;  1BGY E;  1VQ9 P;  5GTH E;  1LTJ A;  4GDO A;  2QM8 A;  1GU4 A;  1SQB K;  4CPG A;  2W83 C;  1EDI A;  1VQO P;  4PV1 C;  5CBN A;  3L70 D;  3GHG B;  2HYN A;  3V4W A;  3KYQ A;  1BCC J;  1IK9 A;  4XE5 B;  3L74 E;  2ZT9 C;  1ZR4 A;  2M3B A;  1SQX K;  3CCM P;  2I8D A;  3CXH E;  3H1L G;  1ZRT D;  4L76 A;  1R8E A;  5KLI B;  2KSE A;  2H7H A;  1NTM D;  1L0L E;  3G6E P;  4DJG A;  2A06 D;  3TYY A;  2M0B A;  3G3Z A;  2G8Y A;  1U57 A;  2OYO A;  1KD1 Q;  1T3J A;  3V4Q A;  1J1D B;  1NTZ G;  5CJ0 A;  3D6Y A;  5CCH C;  2Q3I A;  3NXS A;  1LT1 A;  2OGU A;  1PPJ G;  2FFD C;  1FDO A;  4PJ0 H;  1HVV A;  2QJY B;  1Q90 D;  2FXO A;  5GTI E;  3L72 J;  2ZYA A;  1BDD A;  4WY4 B;  1E79 H;  1RH5 B;  1VL2 A;  2B9B A;  1NO4 A;  2HPC A;  5CCG A;  1BE3 G;  4PD4 E;  1M57 D;  2K37 A;  4YTP C;  3EWK A;  4H44 D;  1ZXG A;  3FGA D;  3L35 A;  1SQQ K;  1CI6 A;  3TK1 A;  3V2P A;  3Q5P A;  3NTN A;  1FZG A;  3BRV B;  3H1H E;  1OWA A;  2KB7 P;  1KQL A;  4ZNC A;  2MJZ A;  1IFM A;  2WSF H;  4PJ0 E;  1K73 Q;  1OXZ A;  2PAJ A;  3H1J E;  2OTJ P;  2KK7 A;  2R32 A;  1N73 C;  1BCC G;  4M3L A;  3RGU A;  1RQU A;  5KTB A;  1N86 A;  1ZP0 C;  1FOS F;  1HJB A;  1KB9 I;  2QJK B;  3L71 J;  3RL0 B;  3RL0 g;  1OX3 A;  1KFM A;  5AVQ B;  1N7S B;  3V2Q A;  1VQM P;  1SQV K;  1GZL A;  1JY2 O;  1PP9 J;  4RO0 A;  1AA0 A;  3RBZ A;  2R3C A;  1YTZ T;  1M8O B;  1LTA C;  2OYI B;  3E7K A;  3CX5 D;  1L4A B;  2ZFC A;  1P84 D;  1NU1 K;  4IFF A;  3CWB E;  1X8Y A;  1A02 J;  2B88 A;  4ASW A;  1HGV A;  3A0H H;  3CC7 P;  5AW9 B;  4BRY B;  2LXC B;  3N7N A;  3IF4 A;  4JYC A;  4JF7 A;  4C7R A;  1J1E B;  1LGH B;  2RH0 A;  5AVX B;  3SWY A;  5TJH A;  4O9B A;  2BCC J;  2FKW B;  3B5N A;  2YXR B;  3JCU H;  3A2A A;  4PV1 D;  1P84 H;  2YKQ A;  3HD7 A;  4YXD C;  3G4S P;  1NTK E;  2IYP A;  3B71 A;  1UIX A;  2IBZ E;  2WWW A;  3L73 E;  3V5B A;  3AE3 C;  2ZT9 D;  4I6M C;  1CZQ A;  3EFF K;  3P8C E;  4C7N B;  2YIU B;  1KQS O;  4EI2 A;  2KLU A;  1G2C A;  3H25 A;  4AUW A;  3HUS A;  1BGY G;  2KS1 A;  4I1L A;  3L71 G;  3II6 A;  2FYU K;  5APW A;  4LLH A;  1DEB A;  4IFD K;  5CCH D;  2W8Z A;  2AEJ A;  1FDI A;  1RF1 B;  1Y9B A;  1VQL P;  2PP6 A;  2J58 A;  3JCU E;  1W2E A;  2NZ2 A;  1PP9 G;  3BVH A;  1RY3 A;  3RBX A;  1Q7Y Q;  2WPV B;  4PD4 I;  1T2K C;  3I56 P;  1G1I A;  1PGQ A;  1GMJ A;  2WQY C;  2Q3E A;  3CCV P;  3L75 J;  2W6A A;  2XND H;  2HLO A;  5AW2 B;  3L4F A;  1FZC A;  2JKV A;  1SQP E;  5AVV B;  5KAF E;  5E79 E;  1NTZ E;  2LKM A;  2E75 B;  4H0L B;  2FYN C;  1SQQ J;  1PPJ E;  1H0T B;  5L8R J;  3HTK A;  2BCC G;  3TGU E;  3HE5 A;  2YXQ B;  2B89 A;  3BAS A;  1KC8 Q;  3CC2 P;  4JBZ A;  3O6Q A;  5APX A;  3AEA C;  3FX0 A;  1Y47 A;  2XNX A;  2J5U A;  2ZYD A;  2QE7 H;  3KZI H;  2KYV A;  1KFN A;  2ZVO B;  4JYB A;  3KDP B;  1G1J A;  1YIJ P;  3CCJ P;  1HH0 A;  1BE3 E;  4MN4 C;  2OYH C;  2WTY A;  3A7O A;  4Y99 C;  1AQ5 A;  5APQ A;  3H1H G;  3AE5 C;  5APT A;  1USE A;  1NYH A;  3KXD A;  1SQV J;  4ZKP A;  5AW7 B;  3D70 A;  4K3A A;  1YQ3 C;  1JY3 O;  1KB9 D;  1FDM A;  3R2P A;  1DIP A;  3AE8 C;  5KJ7 C;  1OZH A;  3CMA P;  2E74 B;  1SFC A;  1KYO I;  1GL2 C;  1JTH A;  3MGN A;  1BCC E;  3PJS K;  1URQ A;  1RE3 C;  1JY3 P;  1KOR A;  1IFJ A;  1HF9 A;  3KZI E;  1HGZ A;  1GW4 A;  1Q82 Q;  1RE4 A;  2KNC B;  2IBZ I;  3V2N A;  2N1T B;  2I1J A;  4U3F J;  1BGY D;  2P58 A;  1KB9 H;  3M0D C;  1S3J A;  5KKZ C;  2P67 A;  2E76 B;  1CSB A;  1DD3 A;  5KLV E;  1QL1 A;  4OGQ C;  1FBM A;  3S4R A;  1E5W A;  3L74 D;  4HJG H;  5B5E E;  2CK3 H;  4YXW H;  2E5Y A;  4R4M A;  3CXH D;  3IN6 A;  3L72 E;  4IL6 X;  4KJM A;  3GHG C;  3GF7 A;  1KIL B;  3VMZ A;  2QEX P;  1M1J B;  1L0L D;  3M9B A;  3P32 A;  1NKN A;  4UB8 H;  2AXT E;  3TGU J;  3VOP A;  1PIX A;  1SVF A;  5AW0 B;  1N8R Q;  2FYU J;  3SFE C;  1VF5 B;  3FWL A;  2O1J A;  1NTK G;  1AFO A;  1LWU B;  3AE7 C;  1L0N K;  1S72 P;  2IBZ G;  3L73 G;  1VQ5 P;  1T2K D;  2O01 J;  5K5G B;  2NPS B;  4OVN F;  5B66 H;  1D7M A;  1J1D C;  1OIP A;  5AW8 B;  1RQV A; 
#chains in the Genus database with same CATH homology
 1OWA A;  1L0L K;  2KB7 P;  1JY2 N;  2VRS A;  2HOD B;  5BU8 B;  1KQL A;  1RF0 A;  1SFC B;  2P2U A;  5APV A;  1LTJ B;  3WMM 0;  2HG5 D;  1KIL C;  1JTH B;  2MJZ A;  1URQ B;  4C7N A;  1M1J C;  1IFM A;  2WSF H;  1OXZ A;  3M0D A;  1WT6 A;  2A45 G;  3RK3 B;  2WPQ A;  1DH3 A;  3CL3 D;  4RES B;  2PAJ A;  3MIW A;  1SQP K;  2R32 A;  2R5D A;  1N73 C;  2W27 A;  4M3L A;  2IPP A;  5KTB A;  1N86 A;  5AVU B;  4GT1 A;  1FOS F;  4WY4 C;  1ZV8 A;  3HRN A;  1HJB A;  1N7L A;  5AVR B;  1SP4 A;  3RL0 B;  1XTG B;  4B86 A;  1MV8 A;  5APY A;  2JJL A;  3NFQ A;  1LWU C;  2WPR A;  1T8Z A;  1A02 F;  2J59 M;  1RF1 A;  1KFM A;  5AVQ B;  2Z5I A;  3TSI A;  1N7S B;  2NPS C;  3V2Q A;  3N4X A;  1SQV K;  1NOH A;  2P7J A;  1GZL A;  2R5B A;  1JY2 O;  1IFD A;  2I1K A;  1FOS E;  3TNU A;  1LTI C;  5AVT B;  2WT7 A;  1SFC C;  2R3C A;  1LTJ C;  1YTZ T;  3HE4 A;  1LTA C;  2OYI B;  1GDT A;  1L4A B;  1URQ C;  1QL2 A;  3H32 B;  2ZFC A;  1NU1 K;  4IFF A;  1ZLL A;  2JEE A;  3RK3 C;  3KQG A;  1X8Y A;  2QM7 A;  1GTW A;  2OYH A;  1MUU A;  1A02 J;  1X79 B;  1HGV A;  1GD2 E;  2XDJ A;  2Q9I A;  3B8E B;  1RE4 C;  1T3U A;  5AVW B;  2C9N Y;  5AW3 B;  5AW9 B;  2GM4 A;  3N7N A;  3RL0 C;  5AVZ B;  4JYC A;  4JF7 A;  4C7R A;  3IR9 A;  1KZU B;  1J1E B;  1IC2 A;  5KJ7 D;  1LGH B;  2YKO A;  1NTM K;  1NHL A;  5AVX B;  3IFM A;  5BVZ A;  1N7S C;  2IFN A;  3B5N D;  3SWY A;  3NMD A;  2C9L Y;  1GL2 D;  1JOC A;  4O9B A;  1VPC A;  2HFE D;  2KOG A;  2FKW B;  3HD7 D;  5KJ7 A;  3MD0 A;  2HPC B;  2P1J A;  1MFZ A;  1XTC C;  3B5N A;  4IFM A;  3A2A A;  2XZR A;  1GL2 A;  4N78 E;  3VYI A;  2YKQ A;  3HD7 A;  1RE3 A;  1CI6 B;  2XKM A;  2OYI C;  1L4A C;  1N2D C;  5KLV K;  1FJK A;  1JNM A;  2POH A;  2WWW A;  3V5B A;  4AQR D;  3M0A A;  4I6M C;  1CZQ A;  1HWT C;  1MZ9 A;  1JUN A;  3P8C E;  2YO3 A;  1LTT C;  4C7N B;  3I5C A;  2XU6 A;  2GUS A;  4N78 D;  1GK6 A;  1G2C A;  3C9I A;  2E43 A;  4AUW A;  1GU5 A;  3HUS A;  1FZA A;  1NH4 A;  1J1E C;  3PP5 A;  2H8P D;  3M9H A;  4I1L A;  3U1A A;  2E42 A;  3II6 A;  2WIT A;  2FYU K;  5APW A;  3CLQ A;  4LLH A;  3U59 A;  3A5T A;  1LT9 B;  1DEB A;  2YNY A;  3RK2 D;  2WSE H;  4IFD K;  5CCH D;  3VP8 A;  1GW3 A;  1RF1 B;  1JCD A;  5CCG C;  2PP6 A;  2J58 A;  3P8C D;  1W2E A;  1H88 A;  3BVH A;  3OA7 A;  5APU A;  5CCH A;  2XV5 A;  1IFI A;  1RY3 A;  1S9K E;  3OAK A;  1T2K C;  4W7Z A;  3TNU B;  1G1I A;  2FFD A;  2N1T D;  2WT7 B;  3GHG A;  3V2R A;  4LGD E;  1RF0 C;  4W80 A;  1ZR2 A;  3HE4 B;  5APS A;  1HBW A;  1FAV A;  2N1T A;  3O8Z A;  2W6A A;  2YMY A;  2Q7C A;  2GUV A;  3P8M C;  2HLO A;  2OAR A;  4WB4 A;  5AW2 B;  4GIF A;  1PFI A;  2OYH B;  4EOT A;  3L4F A;  4Y99 B;  1FZC A;  1YYC A;  1S9K D;  5AVV B;  2YKP A;  1HTL C;  3VMX A;  4N3Y B;  2LKM A;  1LT9 C;  2WSC H;  3LIE A;  1FJP A;  3BRT B;  3VP9 A;  1RF1 C;  4OH8 B;  1IFN A;  3HTK A;  1JCC A;  3HE5 A;  1KIL D;  3BAS A;  1YTZ I;  3M9Q A;  2A45 H;  1FU1 A;  4WBA A;  3B5N B;  2BAS A;  1JMM A;  1GL2 B;  5APX A;  4DOJ A;  1KIL A;  1Z56 A;  3MUD A;  3LID A;  1M1J A;  3HD7 B;  3A3Y B;  4WY4 D;  2WZ7 A;  2XNX A;  5AW5 B;  3H6P A;  1FZE A;  1N73 A;  2KYV A;  1KFN A;  4JYB A;  3VN0 A;  3KDP B;  1G1J A;  1HH0 A;  5CMZ A;  4WY4 A;  2OYH C;  5CHX A;  3U1C A;  2WTY A;  3A7O A;  4Y99 C;  3UIA A;  1AQ5 A;  1CW5 A;  2NPS D;  5APQ A;  1J2J B;  4W7Y A;  2Z5H A;  5APT A;  2FXM A;  1LWU A;  4I2L C;  3E1I A;  3VMY A;  1G2C B;  3HUS B;  2KSJ A;  2NPS A;  4ZKP A;  5AW7 B;  1H89 A;  1SFC D;  5BU5 A;  2KLV A;  1JY3 O;  1VDF A;  1FDM A;  3R2P A;  1NTZ K;  2YO2 A;  1URQ D;  2IFM A;  4AYC A;  5KJ7 C;  2HOD A;  1SFC A;  3RK3 D;  1LTJ A;  3B5N C;  3M91 A;  1GL2 C;  2QM8 A;  1JTH A;  3MGN A;  3P7K A;  3RK2 B;  1GU4 A;  1SQB K;  1URQ A;  3HD7 C;  2W6B A;  1RE3 C;  1JY3 P;  2Q5U A;  1LTB C;  4EIJ A;  1IFJ A;  3LW5 H;  2FFD B;  3KPE A;  5CJ4 A;  3GHG B;  3RL0 D;  2HYN A;  4ZKU A;  1X9V A;  1HGZ A;  1GW4 A;  3V4W A;  1ZN5 A;  1RE4 A;  1LT9 A;  3KYQ A;  4KHX A;  3EQ2 A;  3V2N A;  1IK9 A;  2N1T B;  2H43 A;  2I1J A;  1N7S D;  4XE5 B;  3VTP C;  1GK4 A;  2O01 H;  1NTK K;  1ZR4 A;  2M3B A;  1SQX K;  3M0D C;  3HUS C;  1N7S A;  1NAF A;  3L36 A;  1FZC B;  2M8R A;  1FZB A;  2P67 A;  5AVY B;  2C0W A;  1CSB A;  2L5G B;  1EQ7 A;  1M7L A;  2H7H A;  5AW4 B;  1DX7 A;  4XA4 A;  1NWQ A;  1QL1 A;  3CI9 A;  2ZXE B;  3TYY A;  1L4A D;  2CPS A;  3G3Z A;  1FBM A;  2WPS A;  1JY2 P;  3MTU E;  3SWF A;  1T3J A;  1E5W A;  2A45 I;  3HTK B;  3V4Q A;  1J1D B;  2OYI A;  5CJ0 A;  3HE5 B;  3RK2 C;  1L4A A;  1H8A A;  5CCH C;  3H32 A;  5AW8 B;  1SLQ A;  2Q3I A;  3NXS A;  4HYT B;  2FYZ A;  2FFD C;  1JY3 N;  3GHG C;  2IX7 C;  1KIL B;  3VMZ A;  4LC1 A;  1IO4 A;  1M1J B;  3M9B A;  1HVV A;  3P32 A;  1JO5 A;  1NKN A;  5AVS B;  2Z4E A;  2N1T C;  1IJD B;  3L37 A;  4HH2 A;  1FZF A;  1N73 B;  2O1K A;  3VOP A;  1SVF A;  5AW6 B;  1LTS C;  4N6J A;  5AW0 B;  1NKZ B;  3OJA B;  4WY4 B;  5CCG D;  3EFG A;  1FZC C;  1HUC A;  2C0X A;  2O1J A;  1AFO A;  1LWU B;  3M06 A;  2N9B A;  1L0N K;  1NO4 A;  2HPC A;  5AW1 B;  5CCG A;  1T2K D;  4GKG A;  2CPB A;  2NPS B;  1WRG A;  3L35 A;  1SQQ K;  1CI6 A;  3TK1 A;  3V2P A;  4DZO A;  3NTN A;  3T97 A;  2KP8 A;  1LTG C;  4C46 A;  1FZG A;  1J1D C;  3BRV B;  3BAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...