1LHNA

Crystal structure of the n-terminal lg-domain of shbg in complex with 5alpha-androstane-3beta,17alpha-diol
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
177
structure length
176
Chain Sequence
PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Steroid Ligands Bind Human Sex Hormone-binding Globulin in Specific Orientations and Produce Distinct Changes in Protein Conformation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords SEX HORMONE-BINDING GLOBULIN
total genus 30
structure length 176
sequence length 177
ec nomenclature
pdb deposition date 2002-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lhnA00
1LHNA 5SV8A 2VW1A 3B9CA 1SLTA 4XIKA 5DUWA 2D43A 4XXPA 1IS4A 3FLRA 3AJZA 4FQZA 3LSEA 3PVNA 3WLUA 1IKQA 4XJAA 1CPNA 2NN8A 3WG4A 1AX0A 2DU1A 5CAZA 1DBNA 1MS8A 2JD4A 3R05A 1AXKA 1DQ5A 2VW0A 1AXYA 4ISQA 3JUUA 4FP2A 4IQPA 3SNMA 4AGRA 1URXA 1WW7A 3VKOA 3ILFA 1S0IA 2CNAA 1MS0A 1MS4A 4AYUA 1LTEA 1W6MA 3AFKA 3IPVB 1DYKA 4XHXA 1DFQA 2Z42A 4KBBA 3N7KA 5H9SA 3O12A 1V00A 2ZHNA 4AWDA 1W6PA 5KXCA 3D4KA 3ILNA 3SITA 2CTVA 2BQPA 3VKLA 2GMMA 3WUCA 3IPVA 5GLZA 1S0BA 4Q1PA 3B3QE 2ES3A 4HL0A 4Q8LA 3ZSJA 1MVEA 1X50A 4D69A 2WNEA 1CJPA 1QDOA 3AYAA 4ISRA 3W59A 1CPMA 3NWKA 2WSVA 2HYKA 2ZGNA 4LBLA 4P14A 4U2AA 5GZCA 1LJ7A 3N35A 2D3SA 5EWSA 4JRAA 2R0FA 1IKPA 1GICA 3LCPA 4AVVA 2FHRA 3M3OA 3D6EA 4Q27A 3AZYA 3AZWA 2W39A 2WJSA 4BMEA 1FAYA 1GZCA 3WDVA 3NV2A 5EYXA 3N7JA 4M3CF 3N7MA 5DUVA 2DVAA 1W6NA 5GZGA 2VXRA 2A6YA 1DQ0A 1FNYA 2OVUA 3B69A 3WHTA 1AX1A 1ZM1A 2NM1A 2DYCA 1RITA 4H55A 1QU0A 1MVQA 4Y1UA 1FNZA 5JOWA 1SLLA 3AZVA 1DQ6A 1O4ZA 3OJBA 4M3CB 1F5FA 1ENRA 2PHXA 3DUIA 1SBDA 3KM5A 4LBQD 2ZHLA 4Q26A 5KXBA 4OZXA 2ZBJA 1GV9A 4FP3A 1YIFA 2D3PA 1A78A 1WD4A 1A3KA 2E53A 2PELA 3D5OA 2YZ4A 1PZ9A 2DTYA 2PHTA 4W65A 5JVVA 3WVJA 3GALA 1SACA 1N47A 2EXHA 1N3OA 2EXKA 1AF9A 3MW3A 4GWMA 1SBEA 2VU9A 2EALA 3SLIA 1N1TA 1WLWA 2SBAA 2GALA 4DS0A 4YG6A 1QDCA 2PHWA 3WV6A 2R49A 3ZPYA 2ZMLA 1JN2P 2TEPA 2ZGSA 3BODA 3BOPA 1LCLA 1ZA4A 2ZMKA 4NO4A 1W6OA 4DRVA 4YZ5A 5HCFA 3SH3A 2E7TA 4YGCA 5F9TA 1GLHA 2DUPA 3WNXA 1LGNA 3V64A 2A70A 2SLIA 3AK0A 3OYWB 3LSDA 1LOFC 4HANA 3ZXKA 3T1LA 1AZDA 1OFSA 3M3EA 3POYA 5CNAA 1LOEA 4FPGA 3C2UA 3ILRA 4XJWA 2UU8A 5GLVA 1LEDA 1G7YA 4GKYA 1AJOA 3APBA 3RMXA 3WOGA 4U36A 2A6WA 3RG0A 2ENRA 1Q8QA 2ZHMA 4FVVA 5IK5A 1BQPA 1JHNA 2D6OX 4XYXA 3USUA 3Q9OA 3WZ1A 3V0AA 2LALA 1ONAA 3SH4A 2V73A 2EXIA 2GMEA 1F31A 1LU1A 5GLTA 3N7LA 1G9FA 1QMJA 1ULCA 2ZKNA 1QGLA 3INAA 3AJYA 5E8AA 1BXHA 3VKFC 4BOWA 1VIWB 4Y1YA 4AGVA 1GNHA 2D6KA 3MW4A 4MYEA 1QKQA 3AYCA 1MS1A 1F9KA 1Q56A 4YW4A 4R9AA 2A6XA 4LBQA 2OUJA 2A6ZA 5LK5A 4LBNA 2E51A 5GLWA 3M2MA 4Y1ZA 5JDBA 2E7QA 2P34A 1SCRA 2A75A 3A4UA 3NV4A 4LBKA 4XE9A 3SH5A 1C1FA 1G9BA 4BM8A 1SLBA 1SCSA 1J1TA 2AYHA 2P37A 2WT1A 2ZGQA 4FPCA 2W68A 1LGCA 1QOTA 2R0HA 5AVAA 1BZWA 1C1LA 1IS6A 1I3HA 2ZGLA 4YZ3A 1HLCA 2DUOA 2D6PA 4AVTA 1ULEA 2NMOA 4I30A 3AXEA 1ULDA 1GSLA 4YGBA 4PF5A 4BMBA 2RHPA 1W6OB 2WQZC 1OKQA 1JYIA 3N36A 4ATEA 3WDTA 1ULFA 1LECA 1RINA 1LGBA 2D6LX 1JW6A 1N1VA 4Y22A 3ZSLA 4WV8A 4DQAA 4YG3A 4LBOA 4XMAA 2DVGA 1SLAA 1CVNA 2ARBA 4XHBA 4FPHA 2Q5TA 2EIGA 4GKXA 4R9DA 1WLDA 1YXWA 4LBJA 1LOGA 2ARXA 3VUOA 1R1ZA 3O0VA 5GM0A 5KXDA 3ZYPA 1WLCA 3ASIA 4YGDA 1C57A 1GKBA 4DPNA 3WCSA 2GNTA 3VKMA 1IOAA 1H9PA 1B09A 2EAKA 1DGLA 2ZAAA 4K1YA 4XMIA 4FOVA 3ZYRA 2P3JA 1Q8VA 4YW2A 3WDYA 2PHUA 4FPLA 3AP7A 1GNZA 1Y7BA 1SFYA 2CL2A 4BLJA 1G9DA 1I1EA 2JDZA 2ZZJA 2I2SA 4YM3A 4FPFA 1JOJA 1H9WA 3I4IA 1S1AA 4K21A 4FOYA 1KQRA 1JXNA 4UW6A 2DV9A 3CNAA 2VUAA 3V0BB 2D7FA 2GNDA 1SLCA 4Q1RA 4XBLA 3A0KA 3ZXFA 2DTWA 3AP4A 3AZZA 1BYHA 4WVWA 3WDWA 1V6MA 4ATFA 1FX5A 2GN3A 2ZA9A 1OQ1A 3V65A 1S0CA 1FV3A 2GNMA 4Q8KA 4AVSA 1WUVA 4BQ1A 3T1MA 4JC1A 5DZFA 3PVEA 3FUQA 4F83A 5DXDA 1CR7A 1W6QA 4GXLA 2GMPA 1W6PB 1V6IA 4FPOB 1WCSA 2ZABA 5T5PA 2JKBA 3WG2A 1DLLA 3ENRA 3MW2A 4ASMB 3OYWA 2DVFA 1XQNA 2AREA 2YV8A 1DYPA 3IKWA 5L73A 4YZ1A 1QF3A 3VV1A 2A7AA 3WDUA 5JOZA 1V6NA 1AJKA 2GNBA 1MS3A 2A3WA 4XILA 3POSA 3HN1A 2NYYA 1PZ8A 3AP9A 3FBYA 3OBTA 1CONA 2VY0A 5T54A 1GBGA 2UWCA 5DG1A 3AX4A 3UJQA 1H30A 3ZXEA 3I8TA 1MR5A 1PZ7A 2A3YA 3RQ0A 5T5JA 3DGTA 5CBLA 2AGSA 2C9AA 2ZMNA 4FQ4A 1Q8PA 1V6LA 3N3HA 2CWSA 5FRAA 2FMDA 4YM1A 1LOCA 3NV3A 5T5OA 4YG0A 5T5LA 4BPZA 2XG3A 4UW5A 3MEPA 2ZGKA 1WBFA 3RSJA 1ENQA 4L8QA 2VH9A 3TAYA 5E88A 1HKDA 1MACA 4SLIA 4P9XA 3TB0A 1YO8A 1HQLA 1LULA 1APNA 3V0AB 5EYYA 1UZYA 1U0AA 1UMZA 4R9CA 1O4YA 1S0JA 5DZEA 3O5SA 2JECA 2A5ZA 1KITA 1D0HA 4GALA 1N1YA 2R1BA 3PJQA 3ZXJA 4CRQA 1KRIA 4Q2FA 1LOAA 3WDXA 2W52A 1SBFA 4DRRA 3FLPA 1DQ2A 3MPPG 1G8WA 5CA6A 4YZ4A 3RS6A 4XIOA 4DFSA 1DHKB 1NXD1 5DZGA 4ZXKA 1DZQA 1Q8OA 1LODA 1UPSA 4XTMA 1MZ6A 1JYCA 2AH2A 4K1ZA 1BJQA 3ZVXA 1CQ9A 4NOTA 3OGGA 5H9PA 2JE9A 2UWBA 2UURA 2YMZA 1QOSA 2NZ9A 5T50A 4GWNA 5JOYA 5JMCA 3ZXLA 1UL9A 1GZ9A 1VAMA 4M01A 3RMYA 1LOBA 1NLSA 4PCRA 4UW3A 5IK8A 3B01A 4C1WA 3B00A 4WZFA 3PMEA 2CY6A 4XJUA 2A6VA 3BTAA 3H0OA 5GALA 1LHVA 3USUB 1VLNA 5IK4A 4R9BA 5JLVA 3UJOA 1GZWB 4K20A 4PBPA 2CYFA 1CIWA 1FV2A 1TEIA 1N3QA 5GZFA 1UN1A 2ZACA 5GZEA 2D44A 3AP5A 2ZGOA 2DWRA 2B7YA 1VAVA 5GZDA 4FPYA 4ZKTB 4TZDA 3OY8A 1KJLA 2NMNA 3HMYA 1AXZA 1KDKA 4XOGA 1WD3A 2A71A 2R16A 5IUQA 4YFZA 3FFZA 4Y20B 3QLQA 4BLIA 3W58A 3V0BA 2EXJA 4CZSA 1KDMA 2WSUA 1C4RA 1W6NB 3FLTA 2D6NA 5FREA 1VALA 1ULGA 1FYUA 4C1XA 4YFWA 1S0GA 1WBLA 3AP6A 4FPJA 4XBNA 1YRZA 1DQ1A 1LHOA 2DVDA 2WT0A 4YLZA 2GDFA 1GZWA 3IN9A 4P9YA 1MS9A 1HQWA 2WKKA 4Y1XA 4YZ2A 4M3CE 2P2KA 4LBQB 3PVOA 5H9QA 3SISA 4XJ8A 4AGGA 1DIWA 5T55A 1D2SA 2AR6A 4FOWA 2A3XA 1Z78A 3WUDA 3ZSMA 1LESA 2WLQA 1LEMA 2OW4A 1LENA 5E89A 5IK7A 4Y1VA 2ZGRA 1A8DA 3WG1A 5T52A 2ZGUA 2R1DA 5HCAA 1WW4A 2UWAA 2D6MA 1G9CA 3R4SA 3A0NA 4YM2A 3M3QA 2C5DA 1W0OA 2YXSA 2D3RA 1W6MB 3NV1A 5JOXA 4Z8BA 3UK9A 4Y26A 2NP0A 4Y24A 1QNYA 3KQRA 2WT2A 1UKGA 1Z0HA 2PHFA 3UL2A 1LOFA 4XJZA 3AYDA 4LBMA 1WW6A 2LTNA 1LU2A 2AENA 5DUXA 2DURA 3IMNA 1GANA 2V5YA 2GN7A 4GA9A 4XXAA 5DG2A 1SLIA 1UAIA 2JJ6A 4JCKA 1LHWA 4XBQA 3QCWA 1KJRA 2DUQA 1W6QB 2KM2A 2W08A 1JBCA 3O0XA 2EF6A 1V6KA 1N1SA 3VKNA 5KXEA 2E6VA 1JUIA 1EPWA 4FOQA 4PBOA 2H0BA 3GNEA 1MZ5A 5F5QA 1N3PA 4WVVA 3M1HA 3OY8B 3AZXA 5CB7A 1UZZA 3M3CA 1S0DA 5H9RA 1G9AA 1AVBA 1S0FA 5GLUA 5HCBA 4FPKA 1QNWA 1BKZA 1MS5A 4YW3A 1QOOA 1G86A 3U4XA 4FPEA 4M3CA 4XTPA 4RL7A 1YYNA 4UW4A 1DQ4A 3FUOA 1GYKA 1V6JA 2CWMA 2P3KA 3BIWE 3L2YA 1IS5A 2DVBA 2AUYA 2YY1A 1RIRA 4YM0A 2DU0A 3WG3A 1Q8SA 1S0EA 4XDQA 3POWA 5DUUA 2ZGTA 1V6OA 4YGEA 1CESA 4Y22B 3O0WA 2PHRA 3JU9A 5EXOA 3WCRA 2YROA 1FATA 4XZPA 4RA0A 1YI7A 3OBRA 4P9WA 5GJ6A 4CTEA 4PQ9A 3ATGA 3OPZA 3T2TA 2ZHKA 5IT6A 4TYSA 1UX6A 2G4IA 1IS3A 4M00A 1ENSA 3IM0A 3AXDA 1LHUA 2XB6C 4XJ9A 1W0PA 4Y20A 3RRDA 3AYEA 3WHUA 1CN1A 1HDKA 2JE7A 2OUHA 2ZGPA 3HR9A 1WW5A 3ZSKA 5BYNA 2P3IA 2ZGMA 3R4UA 4ITCA 4YW5A 2VW2A 4YW1A 1AX2A 2ERFA
chains in the Genus database with same CATH superfamily
2F4PA 3KGZA 4NJ4A 1SFPA 3RI9A 2ORZA 4QX0A 2P1BA 1OOPA 4GWIA 1W8ZA 1IS4A 3NMBA 3FLRA 4RR3A 3SEEA 3ZR5A 1TNRA 2OPWA 2XGXA 4E4HA 1MZFA 3DYMA 4IV1B 1ND3C 4XJAA 4XUOA 2WR9A 1M4WA 2NN8A 3D0JA 2DU1A 3N9NA 5FYSA 4E4SA 5CAZA 2J1VA 1MS8A 2BW8A 3EHKA 2I45A 2XUEA 3MUZ1 4FFFA 1DQ5A 2VW0A 4META 1JYWA 3LGRA 2Y0OA 4WBBA 1ASJ3 4JVAA 4C90A 1CZSA 5FY9A 3SNMA 1ZZ9A 1URXA 3S57A 5L7OC 2CNAA 5JUVA 2RDSA 2DFCA 4AEDB 4Q0SA 2OIIA 1BLZA 1RVF1 1DFQA 4XAAA 3AKTA 1OLMA 1V00A 5KXCA 1W6PA 3POFA 3D4KA 1GP5A 2JXAA 3SITA 4UT5A 2GMMA 5GLZA 1RVF3 1S0BA 4D94A 4Q1PA 1JU3A 2FCTA 1GQPA 4XFAA 1MVEA 1X50A 2WN3A 3U14A 1CJPA 2QCSB 1UO9A 3CLPA 5IW0A 1A8MA 1EV12 2UY9A 4EYUA 1OUSA 4JGZA 2BOJA 1OBNA 1Q5OA 2HYKA 4LBLA 4P14A 4UOJA 1K5JA 3KSCA 4AQSA 5BNOB 1RUI1 2VTFA 1FOD3 5EFUA 4QWNA 5I0UA 4CUCA 2DFBA 4AVVA 2FHRA 2IZWA 3M3OA 5TSWA 1W8NA 2VGDA 3AZYA 3AZWA 1VMFA 4BMEA 4CUBA 1FAYA 1F5JA 3NV2A 3S7EA 3WP5A 1XNTA 1RVF2 5EYXA 4AK3A 3IIIA 5DUVA 1TVGA 1L7QA 3ELNA 4N90A 2WFF1 2IFWA 2A6YA 1CAVA 1O91A 2XVLA 3CJIB 2OVUA 4AW7A 3R6SA 4EN7B 4A41A 3KV9A 5HI0A 2BVBA 3POBA 5LBFA 1RITA 1QU0A 3KCYA 3ZFFA 1VBE3 3AZVA 1H8VA 2E9QA 3NO8A 4JKMA 4LLFA 2I74A 1TME2 1DZTA 4KH9A 1ZYBA 1GV9A 1YIFA 3WQBA 1WD4A 2E53A 3D5OA 4Q4Y3 4QXKA 1PZ9A 4AEMA 2TBVA 4L92A 4IGOA 5JVVA 3TN92 2VBBA 3GALA 4GJZA 1N47A 3UGFA 3WVJA 5FQ0A 4BQ4A 2EXKA 3WQ0A 2WL1A 5FPUA 4L97A 4DS0A 5A7SA 1QDCA 2PHWA 3K48A 4LMFA 5ABJC 1ND2A 2ZMLA 1JN2P 2TEPA 4NO4A 1LCLA 1W6OA 2W91A 2XHKA 4DRVA 5C8CB 4N43A 2RJLA 1OLME 5J98B 2VVEA 4NUBA 5L7OA 1J59A 3GZEA 3S0MA 4MGYE 2VBDA 4W50A 4HANA 4PJYA 3POGA 5FZLA 1AZDA 3M3EA 3O7OA 4GJYA 3B93A 3M3IA 4NR1A 1F8VA 2QFEA 3GCWA 3IB3A 4BU2A 4CEWB 3J8F2 4W4ZA 4D7YA 2LS6A 4LO8A 3RMXA 3ETPA 5FYTA 4IV3A 2P3YA 2A6WA 3J4UH 4CDWC 4DEQA 1Z7S3 4HK8A 4Q4W2 4FVVA 1BEV3 2KD7A 5HPOA 3USUA 5B4XA 3V0AA 1XE7A 1ONAA 1RL3A 4OI0A 5A33A 2X5IC 2EXIA 4BIFA 2GMEA 3B7MA 1UIJA 5GLTA 3N7LA 4Z07A 2YU2A 5FYUA 3U0ZA 1W8UA 4JRLA 3POJA 2JKXA 3FHAA 3INAA 3LA7A 3VKFC 4QQ2A 4Y1YA 1NCRC 4JKKA 4MYEA 5A1AA 1WCKA 4CYDA 1AUYA 1QKQA 1SDDB 5DAVA 4IEOA 1F9KA 1UCXA 5A3OA 3WY6A 1XC6A 4R9AA 1H2KA 2A6XA 4LBQA 5IJRA 1SPPA 1J84A 2OUJA 2WABA 5A7WA 4ES9A 5F3EA 2XXZA 3MIEA 4B4PA 2ILMA 4LBKA 2BOIA 1L7LA 5FZ4A 4BM8A 2OPKA 3OG2A 5ERLA 1M06G 4Z2AA 4FPCA 2BNMA 3LDKA 5BNPB 1LGCA 5C3PA 1POV3 3RVHA 1QJU2 1LNSA 1W2NA 3JD71 1UYPA 1HLCA 4AE2A 2NMOA 4I30A 1PVC3 1Y43B 2XUMA 1L3JA 1GSLA 4RHV2 1AR73 3WNNA 4BMBA 1NCQB 1W6OB 2WQZC 4HSJA 1PO23 4EROA 1FMD2 5I0DA 5FBZA 3N36A 2UYBA 3HQUA 4Z2WA 1ULFA 1S2KA 1LECA 3WP4A 2D6LX 1JW6A 3ZSLA 3I2JA 4O61A 1D4M3 5LBBA 1RHI1 3HWJA 4XMAA 1CVNA 5CIRA 4FPHA 3S7IA 4R9DA 4GKXA 3RZHA 2RS52 1O8SA 1OLRA 4ZHNA 1JYNA 1QXJA 1R091 3EQEA 1NCQC 1HB1A 2I07B 3C7EA 3DPRA 4P00B 4QM9A 3PNAA 2HWB2 5GM0A 5KXDA 4GULA 4DNYA 1GKBA 1QH7A 3VKMA 1IOAA 1R093 5FLJA 4F3JA 4UBHA 2VZTA 1CIYA 1Q8VA 4LR4A 4YVSC 4E2QA 4L11A 3WDYA 2K2SA 4FPLA 2PAMA 3LF7A 5CYYA 1GNZA 4OHVA 4CCOA 1G9DA 1CAUB 4LE4A 1CX4A 2PLV3 4PI0A 2I2SA 1OA4A 1OFNA 5KHHA 1H9WA 5JR2A 4NPRA 4D6RA 3LA2A 4GH4A 4Q4X3 4YNIA 3K46A 4UW6A 5J1XA 1CX1A 1HQNA 1BMV2 3LA3A 4HLTA 2VOKA 5I0RA 3KMHA 3I2IA 3BTZA 1LB2A 1SLCA 2VZ1A 1RUF1 3DKWA 3NNFA 4XBLA 4BIOA 2VBPA 3ZXFA 3AP4A 1E57A 5L7OB 1AYN2 2W94A 2QBXA 3ZOIA 3X29B 2ZEWA 2MNGA 2GNMA 3E6DA 4AVSA 4BQ1A 4NIGA 4JC1A 4B1LA 5HV4A 3PVEA 3FUQA 5FZMA 4ASKA 4DEVA 1CR7A 1B35C 1W6QA 4GXLA 5F32A 2GMPA 2R063 1W6PB 2VOXA 2RMU1 4QPGB 5FZDA 4WVMA 2JKBA 1UY2A 4LEJA 4QU2A 1QQP1 1DLLA 5FJKA 3KVBA 5JI9A 1W28A 3OYWA 2VUCA 3ZO0B 3MLKA 1WMDA 2YV8A 3IWZA 1QF3A 4N43B 3VV1A 5JOZA 2X5IA 1V6NA 4QDQA 2ZTNA 2GNBA 1WMXA 2WZR3 4CDUB 4OFGA 3POSA 1CJDA 3K3OA 5JOWA 1XYPA 5FUIA 4N53A 3PTYA 3N9QA 3FBYA 1RUE3 3O1TA 2VZUA 4OI2A 4IV3C 3KV6A 4DUVA 1H30A 2XVGA 3H8UA 2A3YA 3IDBB 1RUC1 2R32A 3FL7A 3H50A 5DDJ1 5T5JA 2V5DA 2JB8A 2AGSA 3TN93 2FMDA 2K0GA 3UKVA 3E5QA 2XG3A 4LO7A 5CFCB 1BVP1 5JZGA 5A3MA 4QGMA 3MF9A 4WM8B 1RUOA 2WAAA 5KBFA 3TB0A 1HQLA 1LULA 3H42B 4C91A 2E32A 3NVCA 4Q4X1 3ZFFB 4YVWA 1MQTC 1S0JA 4QM8A 2HLEA 3T08A 3T4VA 5BNOA 3WR0A 2QQPA 2ZJCA 2VR4A 4JGZB 4AEJA 4GALA 4XACA 1N1YA 1RYYA 3E97A 1KRIA 3I3EA 4TTGA 3WDXA 2X09A 4XF1A 2W52A 3QBQA 4COUA 4AVAA 1DQ2A 1QJX3 4E4DX 1OD5A 2Y26A 4YZ4A 3HJRA 3IT8A 1NXD1 4UF0A 4PT6A 3KV4A 4LKDA 2WO7A 1DYOA 4N9HA 3RI8A 4UWDA 1CAXA 1ODMA 5G04L 5LY2A 3VN4A 2ZS6B 1OMIA 3PIJA 3ZVXA 1W90A 3O14A 4NOTA 3QH7A 4AOCA 2JE9A 4QX1A 1QOSA 4DUXA 1YI9A 5FZEA 1RUF2 4MG2A 3ZXLA 1IHMA 1OA3A 4IUGA 4M01A 1NLSA 5K4LA 3UGHA 1NOVA 4UW3A 4GIQA 2CSGA 4JHZA 2NQYA 3HVDA 4XJUA 3ZXDA 4FSJA 5GALA 4CDWB 5EQUA 1J83A 4QD2A 4FTBA 4LO4B 5FPBA 1TG7A 3H8RA 1PGL1 1UZWA 1N3QA 1RUE1 4COVA 3T0BA 4RN5A 2OZJA 4HPKB 4DY5A 2PFWA 2F6BA 5GZEA 5DMYA 2E31A 3CL1A 3LQCA 1RJ7A 2ZGOA 1WA6X 3MIHA 5FZOA 2B7YA 4XUQA 3NRUA 3OY8A 1ULPA 2XOMA 2NMNA 4ZU7A 1AXZA 3A23A 1WD3A 4Y20B 5CZKA 4QMAA 2RS11 4S2DA 1KDMA 2WSUA 1C4RA 5FREA 2WUHA 5FZ3A 1FYUA 1ULGA 2WQ4A 4FBFA 1QQP3 4RD7A 4YFWA 1S0GA 4FPJA 5DQ0A 1DQ1A 2WT0A 4IDZA 4Y3OA 1YC61 2QUOA 3IN9A 5FZGA 1ENXA 4HOOA 4OHWA 3NJYA 3SISA 1XNDA 4NIDA 4XJ8A 1DIWA 1W8OA 2RM23 1AR63 1Z78A 3CZJA 3WUDA 1E5SA 5F39A 2WLQA 5FY5A 1QJY1 3URFA 1AYN1 2OW4A 1UYYA 3N9LA 1HRI1 1BCXA 2OQ6A 4BQWA 5IK7A 1SMVA 2ZGRA 3RZGA 2C1FA 3WG1A 4YRDA 1BMV1 3H1WA 5C3QA 2GU9A 1Z7S2 3HT1A 4NWVA 5BNOC 1UU6A 2IVIB 3F95A 3VDAA 1YHFA 4LIUA 1GQHA 4RFRB 1W6MB 1PGW1 4LUKA 3UK9A 2DF7A 3VZOA 1HW5A 1DGRA 2EICA 2RM22 3I59A 1ZA7A 2WT2A 3N9PA 1LU2A 2CGNA 3WW1A 4BB3A 2AENA 2DURA 4HMZA 1ASJ2 1NG0A 3IMNA 4I02A 3ON7A 4N43C 4Y5TA 4DXTA 1E5RA 3PU8A 1GANA 2P6HA 5JXIA 2W92A 2HWB3 1DGRN 1UAIA 4JCKA 1IGOA 5FZOB 2B5HA 2IXCA 1KJRA 1VRH2 2B9VA 2DUQA 1U5XA 3ECQA 2RDRA 2UYAA 4B4QA 1JBCA 5KXEA 2W9XA 1JUIA 5HXMA 2XWJB 5C3SA 2Y6JA 2OYZA 5A7PA 5FFOC 1XOYA 3FBMA 4CEYC 4LK7A 3HNBM 1UW8A 4MO3M 5F5QA 1UOFA 4WVVA 3MHZA 3AZXA 4AEDC 4UYBA 1S0DA 4CA9A 2VMGA 3MFAA 5GLUA 5C4WB 3VD4A 5F6LB 2WZPP 2JX9A 3I2HA 2E26A 4YW3A 3BUCA 5BPXA 4A42A 1VBE1 4QKDA 5FYBA 4KBZA 4RL7A 2A73B 2QDNA 5JMOA 1RUG2 3AM2A 3JBG3 1HJGA 4UAPA 3FUOA 3NJVA 1GYKA 1QJY3 3BIWE 3CJIC 3VHRA 3WP6A 5I0SA 3TEYA 1QJU1 2AUYA 2Y33A 3M8LA 4QPYA 5FY4A 4TLFA 5BNPC 5I93A 1PK6A 5FUPA 1RIRA 3WG3A 2H6BA 1EP0A 3U37A 3FC0A 1S0EA 2OX0A 2QQWA 5FXWA 3POWA 5DUUA 1PGSA 2BNNA 1K5MB 3OUHA 4YGEA 3B02A 5FZBA 3RJRA 2YROA 3ACIA 4AFMA 4D7SA 2EIBA 4AI2A 1VBE2 4DY3A 3ATGA 3OPZA 3AFGA 1LKNA 2XHNA 3UETA 2JG8C 1CZVA 1ULOA 5LB6A 3KZ4C 2BU9A 4XQDA 2IUWA 3AB0A 1LHUA 4XJ9A 3O1MA 2P4EA 1IPKA 3I3DA 4QGLA 1W39A 4CU6A 3AMMA 3WF4A 2B42B 3AVRA 4JKLA 2JDYA 4IEQA 1H8TC 1IZ3A 1TME1 4ITCA 4HONA 4B3NA 5A7QA 1H2MA 2JDMA 1FNYA 1SDWA 1NA1B 1AYM3 1XE0A 1LHNA 3H9AA 3ITQA 4IEPA 5SV8A 2CV6A 1ZBE3 5CG9A 5C4WC 1NY71 3B9CA 1SLTA 4Y33A 3OPTA 1HXS2 5FJHA 4I09A 3WLUA 5C71A 4CDWA 1CPNA 3C3VA 4C0BA 3WG4A 2CDOA 1FOD1 1DBNA 2Q0AA 2VULA 2RS32 3BOWA 1OI6A 4DINB 4CVUA 2WNVA 1UOJA 2DDUA 2YC2A 3JUUA 4FP2A 5BNPA 4IQPA 5IVJA 3RFRA 1RXGA 3THDA 4AGRA 1K5MC 1S0IA 3PMSA 1X9PA 1YJKA 3M7AA 1C5HA 4AHZA 3IPVB 3PUSA 1PO12 1DYKA 2IXKA 3AVSA 3WW3A 4XEZA 4EWEA 1FPN1 2OA2A 2Z42A 5H9SA 1PO22 3GCXA 1Y9QA 2VUDA 3GBFA 3DXUA 2RS51 3WUCA 3CF6E 3VKLA 3ALQA 2W47A 4XUPA 4XFIA 2OZ6A 3JQWA 1UWWA 2ES3A 1NX9A 2AACA 4Q8LA 3NSTA 5AC93 2VZSA 5LWBA 2WNEA 1QDOA 5C3OA 5C9AB 5FZ8A 2DCTA 4ISRA 5FP3A 3W59A 4BISA 2RR12 2WSVA 2ZGNA 3CO2A 4Q4Y1 5FZFA 1LJ7A 2CU5A 1OVPA 3N35A 2OKXA 3ZYIB 5LA0A 4H7MA 5FMOL 4AG4A 2WDBA 3LCPA 4WM8A 2HEYF 3AMHA 2VZRA 4ET7A 2DBNA 2CGPA 2WJSA 1W9TA 3DN7A 3RDIA 3WDVA 4R52A 4JDOA 3ZIXA 4OYUA 1L7RA 2DVAA 2QKDA 4CEWA 5I91A 2BDRA 2NPIA 2VXRA 4KU8A 4INDA 4YSFA 1PK6B 2FDKA 5KC5A 2VZQA 4YYOA 3I2OA 1AX1A 1QHDA 3TNQA 5CEHA 1ZM1A 1A34A 1DF0A 2DYCA 3GF6A 1TMF3 1MVQA 1O7FA 2FQPA 1KFUL 1SLLA 2CHHA 3JBG1 3P5BA 1FOD2 3W21A 2JG8B 4RFT0 5AFEA 1DQ6A 1O4ZA 4M3CB 1ST8A 1F5FA 1ENRA 1NXMA 2D93A 2ZXQA 1RUE2 4LBQD 4QX8A 3ZFGA 1RJ8A 3GM8A 2ZCWA 4QAWA 4BWOA 5KXBA 3IIAA 4FP3A 1A78A 4CXXA 4AFAA 4LK6A 4DXZA 5JAXA 2XJUA 5A3LA 2BWAA 3MIFA 4BDVB 5AC92 1RMU2 1SACA 2QVSB 4FFHA 5FPZA 4GWMA 1SBEA 3JB8A 4CCKA 2B4KA 1MEC3 1OH3A 1WLWA 2SBAA 4MGKE 1LR5A 1EPZA 3EMRA 2W3JA 3WV6A 3ZPYA 1ZZCA 3BOPA 2QTWB 4R8HA 1PX3A 1ZA4A 3I7DA 4PLMA 2R30A 5HBAA 2VMEA 2E7TA 1GWKA 1RC6A 2ZEXA 2R6QA 4K8FA 5FUNA 3V64A 5JZGC 1JZ5A 3BVCA 3SKVA 3ZXKA 1VAKA 3T1LA 4OHXA 3V56A 4FPGA 3C2UA 4XJWA 5GLVA 2YBSA 4KG0A 1AJOA 2QQVA 2HWC3 2J1UA 3ZFEC 3WOGA 1PVC2 4U36A 4BCUA 1LAJA 3RG0A 3LIHA 5F5AA 2BVVA 2ENRA 2D6OX 2XVKA 3THTA 4MGSA 1VMJA 4XYXA 4BHPA 3GHMA 1VP6A 2LALA 3ST7A 1D2QA 1VPHA 4MGTA 3PIGA 4SBVA 3H7JA 3VHNA 4QB1A 1W9SA 3VL9A 4BQ2A 2FDGA 2CDPA 3WEZA 3AL6A 5E8AA 3VZJA 4TLGA 5IHRA 4BOWA 1VIWB 4PF1A 4XF3A 5EJ3A 2WYSA 1AR61 5IVYA 2XLFA 4HXCA 1MS1A 4EWAA 4PHZA 4JHTA 4WM8C 1W2OA 2XJRA 2E51A 2G19A 1J3RA 2P34A 3NV4A 1SCRA 2A75A 3A4UA 3H1YA 4XCAA 3TBDA 2WFF2 4BK5A 2Y60A 2WNVC 1J1TA 2AYHA 4NHXA 4QU1A 4DZGA 2D98A 2R0HA 3AKSA 3LEGA 5AVAA 1C1LA 3UGGA 2QJVA 1REEA 2HWE3 3VBUA 3RZLA 4E8CA 1IG3A 3I2DA 1QQP2 1RUD3 3DECA 1ULEA 4OQ8A 2Y0IA 1ULDA 1PGW2 1PO13 2VNVA 4YGBA 4XZUG 5E6HA 1OOPB 1OKQA 1JYIA 4NVPA 2EA7A 4A45A 3WDTA 4G3YC 5CFDB 1UYZA 1VBC1 4XFGA 3LB9A 5FXVA 1POQA 3P1IA 4Y22A 1QJEA 1Y9MA 2RS33 4QX3A 4YG3A 5CVRA 4GMP1 3IAPA 1X9TA 3S6PA 3K2OA 2ARBA 4XHBA 4GQ7A 4WM7B 5L9BA 3T3YA 1EAH3 1DGWX 1YQ5A 1YXWA 2ZX0A 1LOGA 1W2UA 1YQ6A 4IE4A 4JV4A 4KWLA 4NRQA 1JZ8A 1R1ZA 3NAPA 5IAXA 1XYOA 3ASIA 1A6CA 3HN3A 4HPKA 2J1EA 2WZR1 3GHNA 1UX7A 4IESA 3WCSA 2GNTA 5ISLA 1B09A 1POV1 2EAKA 2JDHA 4K1YA 4FOVA 5C4WA 3NAPB 3USSA 5FWEA 1UU4A 3ZYRA 4D8MA 4EN9B 2BBAA 4V2WA 3D0SA 4W8JA 2WNVB 4MUVA 2WFF3 3TRSB 3VBFB 2WFPA 4AAXA 4D3WA 4E27A 2OQ7A 3CJIA 4EJRA 5FY0A 4YPJA 1CAWB 3WXPA 1YFWA 5FZ9A 3W5MA 1Y7BA 1US3A 4QX5A 2CL2A 4BLJA 2WO1A 1FXZA 2RS53 4QXCA 4COYA 4L9BA 1JI6A 4Y4YA 4YM3A 3I4IA 1OC1A 1S1AA 2QNKA 1AYM1 2VD7A 3K4AA 4FOYA 1KQRA 1JXNA 1RTVA 4A7ZA 2DV9A 3CNAA 2VUAA 4EV0A 3J7HA 4ARXA 1ALYA 2HEVF 2D7FA 1E5IA 1ND3B 2GNDA 3R0RA 2R043 4YW6A 2DTWA 2WO2A 4LA2A 1P8JA 4MGQA 5FYCA 2XPJA 1V6MA 1COV1 4C8DA 5KR7A 1FX5A 2XBO1 2ZA9A 2QE3A 4X6QB 3V65A 3VBUC 4E4ZA 4H14A 5LATA 4Q8KA 1WUVA 5DZFA 2VL4A 1ND2B 3Q8AA 1VRH1 4F83A 1YIPA 4RR3C 5DXDA 2PLV2 5FO7B 2YHJA 4LLOA 1NA1A 1XXNA 5A70A 5IYYA 1TME3 1O6UA 1J3PA 3C7OA 5FMBA 4CE8A 1FPN3 1X8EA 1GOFA 4AEDA 3H3LA 4HKOA 2JD9A 5FCCA 1S2EA 3D8CA 4QHBA 4MV2A 1R081 2VNOA 3ZMOA 4JTOA 3IKWA 2RM21 3DYPA 4LIVA 4YZ1A 4IE0A 1S4CA 1WZXA 2BFUS 5L19A 2VQAA 1HJFA 2WS92 4HVOA 1H6XA 2A3WA 4LITA 4O65A 5ABJB 5KWRA 1B35A 3BB6A 1OVSA 5APAA 1PZ8A 2IXJA 3WX5A 3ZYHA 5A3NA 2PAKA 3SCFA 3OBTA 2VY0A 4MLOA 2UWCA 2PHLA 3AX4A 5K7PA 3ZFEA 2RV9A 2VNRA 4XFCA 3ZXEA 3NJZA 5K0UA 1GU3A 4IGQA 2ZMNA 4B1MA 5KC6A 1Q8PA 5FRAA 3MPBA 1PK6C 4YM1A 3NNGA 3PJYA 4XUTA 4YG0A 5ANQA 3H1MA 3I3MA 4UW5A 2G1MA 1WBFA 2VCCA 3OUJA 3TAYA 2GC2A 1AR71 4QPWA 4GH4C 4P9XA 5FK8A 4FAGA 3FZ3A 4L99A 5DDJ2 3ES4A 3MLJA 2BBVA 1WWYA 1XU1A 2PQQA 2JICA 4RGAA 5DZEA 3O5SA 2JECA 4P5HA 5LA1A 2A5ZA 5A6YA 2VZ3A 5B2GB 2R1BA 4A7KA 1AL23 1C8M3 1JUHA 4Q2FA 2MEV2 1MZEA 3JZVA 1HRV2 4DRRA 2EIDA 2QDRA 1G8WA 1Y4WA 4AFBA 3FJSA 4NRMA 4XIOA 3VBSB 3WT3A 4HN1A 4DFSA 3ACHA 1VBA3 2HWE2 1OLQA 2WBKA 4Q0PA 3K51A 4DO0A 5CKMA 2VMIA 4K1ZA 1BJQA 4G9SB 3WSOA 4JGYA 4C0HA 5C33A 3TOJA 2VVFA 2UWBA 5FPLA 2FD8A 5A7NA 5T50A 4P5YA 1UZVA 5JOYA 5FPAA 2JG9C 5JMCA 1JYTA 3K4DA 1GZ9A 5FP9A 5BV6A 1KS4A 5IVEA 1H1IA 4C1WA 2ZEYA 3B00A 3MBWA 3PMEA 4WZFA 4AI8A 5IVVA 3BTAA 1QJU3 3J7NA 5LBCA 1LHVA 5EPAA 5IK4A 5IVCA 2ZEZA 3O1OA 2XMLA 2P17A 1CIWA 3JB4C 4FCAA 5F37A 4EN8B 5AFBA 5JXJA 3AP5A 2EAAA 1RUI3 1O5LA 1UIKA 2WN2A 3PVBB 4FPYA 5GZDA 4A3ZA 2D97A 2B39A 3HMYA 3VBUB 1DCSA 1PIV1 4XOGA 4MX3A 4CPBA 1HRV3 1GWLA 1S55A 1W6NB 2QQNA 2D6NA 2WZR2 5LBEA 4C1XA 4K9SA 4BJ0A 4MADA 3J9SA 4KWJA 4YLZA 2DVDA 2GDFA 2Q8CA 4NHYA 2WKKA 4LORA 3HQXA 1JS9A 4Q29A 3PVOA 5H9QA 3KS7A 4AGGA 2J1SA 2KXLA 5T55A 1RUI2 5C8CC 2HWB1 4IL7A 4IE7A 3CMGA 4BE3A 4Z1VA 3ACFA 1W3XA 4PIYA 3Q8CA 2XJSA 2Y38A 1LESA 1ZNPA 1UMHA 5C8WA 1COV2 1HRI3 5C9AA 3OUIA 3AC0A 2ADDA 1HN0A 5E89A 2W46A 5F6KA 4Y1VA 4CUGA 1A8DA 1I5PA 5T52A 3O1PA 1C3HA 5IVFA 1CAUA 4QX2A 3A0NA 4YM2A 1UY1A 4IEVA 4OZOA 1W0OA 1HXS3 5HCHA 3VBOA 3H8XA 2D3RA 5FZ1A 2ORXA 4Y26A 2PXJA 1OUXA 3VBSA 2PTMA 2WWUA 1NUKA 1PMIA 2IVJA 3KQRA 1X82A 1LOFA 4FFIA 1VRBA 3AYDA 1HB3A 4XJZA 3WINE 1WW6A 5GKAC 4XF0A 4AHXA 4KMQA 4NPMA 4LOSA 3T30A 3VD9A 2V5YA 4ARYA 2JJ6A 1SLIA 3ETQA 1LHWA 3RYPA 2IC1A 3QCWA 5DN2A 4H7LA 3NNMA 2KM2A 4E2GA 4FFGA 3T09A 5F8PA 1NZCA 5L9RA 1CD3G 2EF6A 1V6KA 1XSQA 5A3WA 1QJX1 1YQCA 3W9AA 3TN91 1EPWA 1PVXA 3KLSA 1UYXA 2H0BA 3GNEA 5CFDA 4WZCA 1HV0A 4QHOA 5FXXA 4GD4A 3M3CA 5G05L 1AVBA 3N9OA 1C28A 4FPKA 1I6XA 1MS5A 1QOOA 5FOBB 1WCQA 4FPEA 4M3CA 4JAAA 2GP3A 3ZIWA 1DQ4A 3VBRA 1K5MA 1IS5A 1GUIA 1F15A 1VB2A 1O3RA 4CEYA 2DCZA 3B5LB 3CEWA 1XNKA 4MHUA 4IEUA 2WS93 2ZGTA 4FO9A 3ZYFA 1LRHA 2Q1FA 2W87A 2YUEA 5FZHA 3WF1A 5GJ6A 3HBKA 4RA0A 1DZRA 1YI7A 1UD1A 3OBRA 4P9WA 4XZPA 5DAWA 1JZ4A 4CXYA 2G9FA 2ET7A 3JD73 4Q0UA 5JWPA 2G4IA 5FP7A 3H8OA 2W95A 1R092 1OSGA 1EV11 1D7PM 1QJZA 3MGUA 3IM0A 4QDRA 5FP8A 5FZ7A 2H0VA 4RYDA 4NRPA 3RRDA 4UFIA 4CP9A 3HIFA 3NNLA 4LKFA 1HDKA 4CCJA 3VBRC 3VDDA 1CAVB 1WW5A 3HNMA 2P3IA 4CDXB 2ZGMA 1SHWB 4WVMB 4ORFA 4YW1A 1AX2A 2ERFA 2VZVA 3HBZA 4KI5M 4X8NA 2Q8DA 1GZTA 2VW1A 5FZCA 2Y64A 5DUWA 5M0TA 3WNOA 5A80A 4XXPA 1OF3A 1PMHX 2BRTA 3GZUC 2BNOA 2HWD2 2XBO3 3DXTA 1IKQA 2ZKLA 3PVNA 2YU1A 5JPMB 3DPRC 3JD72 1AX0A 5LRRA 3MO4A 2BYVE 4AHYA 3A21A 5ANNA 2JD4A 3WNLA 1AXYA 3EO6A 5C6CA 4HBNA 5CISA 5C7GA 2RJKA 1WW7A 4OUEA 3VHOA 3VKOA 2HWD1 5C8CA 5A1LA 5I8TA 1MS0A 1MS4A 1DDLA 1LTEA 1W6MA 5DDJ3 2QZ3A 3LIGA 4XHXA 1UNBA 1W9FA 4KBBA 3N7KA 1OHFA 3HOBA 4Z82A 5HV0A 4UFHA 2R062 3ILNA 1B35B 1GNYA 4XQ4A 2BQPA 1F4HA 2XJPA 2Z5WA 4GB32 3IPVA 3M4FA 4CDQA 4ZZ8A 2FZ2A 1RUJ2 3B3QE 1Y9GA 4QT6A 2YC4A 1UMIA 3I3QA 1VMHA 3FHIB 5CFDC 2VCMA 3BPSA 4AI1A 3AYAA 3VBOC 3LFMA 3AKQA 3DF0A 1CPMA 1CGPA 3NWKA 4U2AA 4J1XA 1MEC2 4KNCA 2QQMA 2D3SA 2JG8A 5C5TA 2R0FA 1RUJ1 4OUSA 1IKPA 4JX0A 2BWCA 5F7UA 4GB31 1NKGA 4KQ7A 4QKFA 3D6EA 2W39A 3BPZA 3BALA 2WA3A 1GZCA 2Q1MA 3JBG2 3MV01 3ZX7A 1DP0A 3TEWA 3J8F1 4P9IA 1ZX5A 3N7JA 4L2NA 2R042 1GMMA 1W6NA 4KU7A 5F5IA 5GZGA 1T6BX 4PIZA 2AZ5A 1QJFA 4MXWB 4IE6A 3J8F3 4OUMA 2PYTA 3WHTA 2NM1A 2W5FA 2WNUC 5KHJA 4JDMA 4Y1UA 1RXFA 4Q4W3 3ZKUA 4HSLA 5F3IA 3PUQA 2ZOEB 2XQXA 3OJBA 3KM5A 3S30A 1NE6A 2ZHLA 4Q26A 5LA2A 4BXFA 3KGLA 4XF4A 2D3PA 2PELA 3OEAA 5FKCA 2YZ4A 3I2KA 1OXCA 1NZIA 2DTYA 2GC0A 2PHTA 2X8KA 2HWF2 2Y6LA 4JDNA 5FY8A 2Z79A 1U5YA 3KCXA 4ZPIA 1AF9A 1KFXL 3MW3A 3I49A 3SLIA 3WP3A 3W5NA 1N1TA 3UNPA 2YBPA 4QQHA 1X36A 5A32B 2R49A 3OPWA 3H3UA 4QPGC 3W20A 2TNFA 1PVC1 4CCLA 2ZMKA 5LCWL 2OXBA 2Q8OA 1PO21 3RWKX 2JG9B 1ND2C 2JE8A 3PUHA 3SH3A 4YGCA 1PO11 3EBRA 3I3BA 1GLHA 4KGQA 3WNXA 4DB5A 5F9TA 1JYVA 5LRSA 2A70A 2IXHA 2VG9A 3AK0A 3LSDA 2VTXJ 1GWMA 4LO6B 2XQRA 3POYA 4PDWC 1EUUA 3O1RA 3GGLA 1WMFA 5F5CA 3HQRA 2RS31 3WF3A 4CCDA 1G7YA 4EZHA 5F1RA 1OF4A 5FYIA 2K46A 2H6CA 3E6BA 3LD8A 1Q8QA 2ZHMA 1D0GA 3PURA 4AVCA 3Q9OA 5FPXA 3FFQA 3SH4A 1GQGA 2V73A 1UQXA 4EN0A 1LU1A 3MZHA 4P9GA 3BU7A 4CPBD 3VDDC 3K75B 2VOWA 3AJYA 3U10A 2XONA 1BXHA 2O8QA 3DEMA 1W04A 4A3XA 4AGVA 4TN7A 1QEXA 3MW4A 1IQAA 1STMA 2VCBA 3MV11 3HD8B 1KXGA 4LA3A 1Q56A 4QQLA 4X6RB 2YGLA 4YW4A 4Q4V1 5FMDA 3VDBA 1NLQA 2JIJA 2Y6KA 4QPGA 5LK5A 3G6JB 2WZ8A 3L2HA 4MSVA 2E7QA 4UFLA 3WNKA 5JDBA 1C1FA 2VUJA 2WS91 1IPSA 3E1F1 1SCSA 3TEXA 2ZGQA 5LASA 1BHGA 1RUH2 2W68A 1QOTA 1BZWA 1I3HA 2ZGLA 5J09A 4IEWA 4E9KA 1SFNA 4QB2A 2VMDA 4URAA 3TEZA 4E2SA 3FWEA 3AMNA 1JZ3A 2B45X 4MZUA 2D6PA 4AVTA 4LHSA 1GR3A 4J6GA 1RUG1 2HH9A 4W6WA 2BV4A 3KWVA 3TWIA 4RQPA 5JXHA 3OOXA 4YVWC 4HT1T 2PLV1 5E1RA 3LPFA 3J7MA 4TSVA 1XBFA 3RJ2X 1QJY2 2IXIA 1ZBE1 2XKPA 3ZXAC 2C9KA 2YFUA 1K45A 1LGBA 1ZBA2 1N1VA 2O8OA 2CGOA 4LBOA 1HB2A 2DVGA 1AL21 1C8M1 3BTXA 2Q5TA 2EIGA 3T4HB 2VC9A 1WLDA 3K77A 2V09A 3OGRA 4LBJA 2ARXA 4YVWB 4CUAA 4W6XA 3KT1A 5FYHA 1WLCA 3ZYPA 4YGDA 1XNBA 1C57A 1C8NA 4JQTA 4DPNA 1VBA1 4N53C 4IETA 2PN5A 2RS12 4IERA 2UY8A 1JH5A 2ZAAA 5F2SA 1XSRA 1O3QA 5JCTA 2GH2A 2P3JA 4YW2A 5J36A 4CCCA 3MIGA 4Q0QA 2XLGA 1SEFA 3VD7A 1WA4A 1YWKA 2PHUA 1ZBA3 2D5FA 2JDUA 3LZZA 4P02B 2WO3A 1ZZBA 4CU7A 4HETA 5FIXA 1POV0 3LDBA 4ZZ5A 1D4VB 1SFYA 4M0HA 1HXS1 1PIV2 1OPOA 2RDNA 4P9LA 1I1EA 2JDZA 2ZZJA 1H1MA 4MOAA 3U78A 1NA1C 4M4RA 3RZZA 3ZFGB 2QQKA 5EV7A 2J1TA 2XL9A 2VTXA 2YPJA 3OBZA 2KR2A 4XURA 4CU8A 5C5UA 4S2GA 1CZTA 4EZ4A 4RGGA 3QH6A 4Q1RA 3A0KA 1C5IA 3SXWA 1HRI2 1PX4A 3AZZA 1BYHA 4NAOA 4ATFA 4A6SA 2Z69A 3FX3A 2GN3A 2HYXA 4QKBA 2PAEA 4QGNA 1BEV1 1OQ1A 1S0CA 4DIQA 4YARA 1FV3A 2VPVA 5BUVA 3T1MA 3ZXGA 1GOHA 1VRH3 1NCQA 4CCMA 1YQ2A 1FMD3 1SPPB 1WCSA 1XJAA 2ZABA 4LHLA 4V1PA 5T5PA 5A3PA 3NL1A 3WG2A 2E63A 5D8AA 2V4VA 2WLPA 4CCEA 1V9U1 1IPJA 1WCUA 3MW2A 3LEKA 3U07A 1R083 2RVAA 2IFRA 2DVFA 1ZRRA 1DYPA 3J7LA 5L73A 3SEPA 3RYRA 2A7AA 1YFXA 1V9U3 5FZ0A 3WDUA 3WNPA 5K8SA 2J7MA 3FHQA 4DUWA 5LA9A 1EY2A 2D5HA 2NYYA 5JSPA 3AP9A 1W8TA 4RS5C 4XUNA 1CONA 5T54A 2QQLA 3I8TA 1MR5A 5DAXA 1PZ7A 5E16A 3RQ0A 1I5ZA 1DG6A 2VQ0A 4KG8A 3DGTA 5CBLA 2AC1A 1AR82 2FMYA 4FQ4A 3N9MA 1X8MA 4O7XA 2HWF3 3D82A 5T5OA 3NV3A 4BPZA 1ACCA 3MEPA 2ZGKA 3WF2A 3POIA 2W1WA 3H7YA 3TYJA 4I2OA 3KV5A 4N7IA 2X29A 1AR91 1ENQA 3C7HA 4L8QA 4QKNA 2ID4A 5E88A 1MACA 4SLIA 3RZKA 2WQ8A 1YO8A 3V0AB 2BFUL 5EYYA 1UZYA 4R9CA 1UMZA 5SV5A 1O4YA 3PUAA 3B9IA 5IFTA 3A22A 2TUNA 1NCRA 3LAGA 4IEYA 3SQOA 4XVHA 5I8YA 1D0HA 4GMP3 4I0AA 3PJQA 3T0AA 3ZXJA 4CRQA 4QXBA 2A1XA 3GBGA 1LOAA 3LEMA 3Q8EA 3KD4A 1RUH1 2DBIA 4CDXA 1RUNA 3DYOA 3H3ZA 1SBFA 3FLPA 3R4DB 2GH8A 4YW7A 3MPPG 3PU3A 3C7FA 4EWDA 1X33A 1K3IA 3HT2A 4JQRA 3KT7A 4S2FA 5DZGA 4V2VA 4ZXKA 1YJLA 1BK1A 4D6SA 1DZQA 3KCCA 5FK7A 3FE5A 1UPSA 4XTMA 3ZFGC 1MZ6A 2OS2A 1H6YA 2AH2A 1BEV2 1YEWA 1O8PA 3WQ1A 3OTFA 4YWAA 5H9PA 3MLLA 3POEA 2UURA 4QXHA 4NIAA 1TQ5A 5FY1A 4HKWA 4GWNA 1R1A3 4XW3A 4AZZA 4AR2A 1VAMA 1W05A 3RMYA 1LOBA 4HVRA 1OURA 2VM9A 3ROUA 4CEYB 2XKOA 4UXAA 5AC91 2A6VA 2B46X 2BTVC 3CIHA 4HZFA 1YNAA 3VBRB 1VLNA 4XPVA 3CJXA 2N7GA 5JLVA 5A7WB 3ZKYA 4OHYA 3K4ZA 2JB4A 2VOTA 3MDPA 3WF0A 2JDKA 2CYFA 1TEIA 1FV2A 1VJ2A 2VECA 5GZFA 4NWWA 1UN1A 2ZACA 4F8AA 2X5IB 3IAQA 2HWE1 3MICA 3WNMA 4COWA 3RWNA 3RZJA 2DWRA 2RS13 1VAVA 3NKTA 5CKQA 3UESA 3MIBA 1KJLA 2XDVA 2XJQA 3FN9A 2A71A 2R16A 4NE9A 4P9JA 4AQ6A 1O59A 3FFZA 4YFZA 5CG8A 4FI9A 2EXJA 3FLTA 1ZVFA 5ACA2 2ETEA 4AFDA 1OA2A 3PUIA 1WBLA 3AP6A 1YQ8A 4PIXA 4W6YA 4XBNA 1XNAA 1YRZA 1MQTA 2GAUA 1OT5A 2QQJA 2FDHA 1GZWA 4Y1XA 4YZ2A 1HQWA 1YCIA 4AEKA 5LEJA 5JR7B 2C24A 4M3CE 1XB9A 2P2KA 4LBQB 1BVVA 4QPIA 1AR83 2W1QA 1D2SA 2AR6A 4Q4Y2 3SMHA 2V72A 4GMP0 1LEMA 1QIQA 3OSDA 1LENA 4LXLA 4HK9A 1UF2C 2BPA2 5D1IA 5K0UB 3VBOB 2ZGUA 2R1DA 3L9JT 4MH0E 3MI8A 1WW4A 2UWAA 2WWJA 3R4SA 4NN0A 1HB4A 3FMGA 2C5DA 4O9EA 4AVBA 5JOXA 1W2TA 3NV1A 4CP1A 4BA6A 2NP0A 4Y24A 4TXWA 1H2NA 3RNSA 1QNYA 3UL2A 5FYMA 1Z0HA 2LRPA 1JZ2A 4IGPA 4GWJA 4LBMA 1NLRA 1OQDA 2LTNA 2YB7A 4CEWC 5DUXA 5DABA 2FDFA 2VO5A 1VBB2 5JIAA 4AAPA 3O1UA 4GA9A 5EJ1B 3MUY1 4LJHA 4XXAA 4XQWA 5DG2A 3VLBB 1O3SA 4XBQA 1VR3A 1UKRA 2GC3A 3D3AA 3HAGA 2YGMA 1AR92 2W08A 4UFKA 5FYVA 2Q1ZB 3SHRA 2VZPA 1W9WA 3O0XA 2BP6A 1RMU1 1N1SA 3CQOA 3VBFC 2E6VA 5BNNC 1AR62 3WD5A 4FOQA 4K6BA 4COZA 5FWJA 2JENA 5FOJB 5FYYA 3VBHC 3DCQA 2WRAA 1N3PA 1ND3A 3M1HA 4HFSA 1ZBA1 5CB7A 1Q43A 1UZZA 5FMCA 4Y4RA 4PI2A 3JCIA 4N9IA 5HCBA 2YC0A 5JIUA 1QNWA 1BKZA 1UY3A 4D7TA 2DCYA 1G86A 3U4XA 1ZREA 4RHV1 4AQ2A 2FZ1A 2FBEA 1TZOA 4PLOA 2P3KA 3TNPB 3VBHA 1UZ0A 2DVBA 2P5BA 1JZ7A 4FXGB 2QQUA 2MHFA 2VAUA 4WVZA 4YM0A 5BNNA 4Q5OA 4B7EA 5FQ0B 2J1RA 4XDQA 2YYOA 5IAVA 3VHPA 4OVEA 2PHRA 3JU9A 3WCRA 4D0QA 1REDA 4CXWA 1FATA 4X8PA 3P3PA 3GZTB 3ZLIA 3LDRA 4PQ9A 3U1XA 1CWPA 4ZU5A 2ZX3A 5A6XA 1RUD1 4M00A 5J96B 1KGYA 1ENSA 1BK0A 2P6CA 3AXDA 1WKYA 2X05A 3ZDSA 3SCGA 2F17A 4HG6B 1RGSA 3GDBA 1CN1A 3ZN5A 2WC2A 1V70A 4CSWA 2VW2A 1VBB3 1UY4A 2WA4A 4K8RB 2Q4SA 4IE5A 2GP5A 3BYWA 2D43A 4M4PA 4RQPC 4HKLA 4IV3B 4XIKA 3VD3A 4Q4V3 3AJZA 4FQZA 3LSEA 3ZN4A 2HWC1 4NIIA 4LUMA 3WW2A 3VZNA 5A6QA 3R05A 3A7QA 1JMUB 4RGKA 5F3CA 1AXKA 2VXJA 5LEKA 4XF9A 2Y6GA 1SQ4A 2ARCA 4ISQA 5JSRA 3BIEA 1EYBA 2G9ZA 4LE3A 3ZYBA 2MPFA 2VQTA 5FMOS 1PNFA 3ILFA 4FTSA 3OD4A 4AYUA 1JYXA 3AFKA 1MEC1 3ZFEB 4B8EA 2ZX4A 3O12A 5FZIA 1X7NA 2ZHNA 3QOPA 3ZYGA 2BGCA 4AWDA 1PMJX 4RR3B 2CTVA 5HXVA 1QXRA 2VCAA 4B7KA 1W0NA 4UI9L 5IVBA 4CDUA 2X53S 2YDEA 4HL0A 1JOBA 3CKHA 5DAQA 3ZSJA 4D69A 3UT0A 2RR11 1HX6A 5KHKA 2DCJA 4NHMA 5KHGA 3ZN6A 4JGYB 1OQEA 4Q0VA 1JOPA 4M0NA 3GJBA 5EWSA 4JRAA 4QQPA 2FCUA 1CAXB 4BQXA 1GICA 4MHRA 3BCWA 4GZ9A 3NAPC 4Q27A 1T6GC 4KWKA 3NKGA 2V4AA 4AQTA 1FPN2 2W0XA 3DV8A 4M3CF 3N7MA 1NQDA 3VZMA 4XCBA 3KT4A 1OPMA 1DQ0A 1VE0A 4AF9A 3AL5A 1R1A1 3B69A 1QWRA 2NLRA 4MGZE 4H55A 3AKPA 3GJAA 4ZS2A 3AMQA 1FNZA 1HV1A 1SG3A 5ABJA 4GH4B 2HEWF 2PHXA 3DUIA 2ZPXA 1SBDA 4CP2A 1W8WA 3SC7X 5JZGB 4ZS3A 4XFFA 4OZXA 2ZBJA 1GFF2 1IQDC 2GZWA 4LQRA 5CFCA 1A3KA 4DXSA 1QY4A 1NY72 2VOVA 2BUKA 4W65A 5C9AC 4AXOA 1YFUA 2EXHA 4B4RA 1N3OA 2AEZA 2ET1A 1KS5A 2GC1A 3U4SA 3VBHB 2JDAA 3U11A 2VU9A 2EALA 4N53B 2GALA 4YG6A 4H2AA 3BODA 3LWCA 2ZGSA 4O9GA 4YZ5A 2WNUA 5HCFA 3MIDA 3LOIA 2DUPA 3PLQA 1LGNA 3OGVA 5IATA 3VZKA 1YUDA 5I0TA 2SLIA 2Q30A 3OYWB 1LOFC 3Q8FA 5FXZA 1JZ6A 1OFSA 1W2AX 1K12A 1UOGA 5CNAA 1LOEA 3ABZA 3ILRA 4NROA 2UU8A 4N7UA 1LEDA 4GKYA 4LHKA 2DCKA 3APBA 4K40A 1Z7S1 3PL0A 3UYJA 1EUTA 4EQVA 2PQSA 4XFHA 2WAOA 5A32A 1UY0A 3LFIA 4PQQA 5IK5A 3PTRB 1BQPA 1JHNA 1VBD3 4EN6B 5IFPA 4Q4X2 3WZ1A 1CAWA 1PM7A 3OD0A 1F31A 1JU4A 4CDXC 1G9FA 3NJXA 3LOBA 2E7AA 1H8TA 2YPDA 1QMJA 1ULCA 2ZKNA 4AI9A 1QGLA 4I01A 4DOUA 2R7EB 1U12A 2JG9A 4P08A 1AR81 1GNHA 2D6KA 3K3NA 3BTYA 1TMF2 4BZ4A 4CDQB 3LPGA 3AYCA 5FLIA 2XH6A 5LZ6A 2OT7A 4OMCA 1IG0A 1GP4A 4OI1A 3ZPOA 3NQHA 1S2BA 2A6ZA 2HBTA 2J42A 5A1FA 2FCVA 5C70A 1QH6A 4LBNA 5GLWA 5AVPA 2XWBB 3M2MA 4Y1ZA 2WYFA 4XE9A 3SH5A 5BNNB 1U5IA 3ACLA 1PHMA 2ZX2A 4G4FA 1G9BA 4I0BA 1GOGA 1SLBA 3ORJA 4JGZC 2P37A 2R041 2WT1A 4DXRA 1ODNA 3E5XA 1O4TA 1ASJ1 2MEV1 1F2NA 4XDPA 1IS6A 5DPNA 2RG4A 3IDCB 3ZM8A 4Y5SA 4FTEA 2WWSA 4YZ3A 1V9U2 4ZONA 1PIV3 2DUOA 4N8MA 4RS5B 2HWC2 2PHDA 4H3WA 5A33B 4R4ZA 5LW9A 5EJZB 5IWFA 3UKNA 3JXSA 5DAPA 3AXEA 4FAHA 4PF5A 2RMU2 2RHPA 2YFZA 2CAVA 3RPQA 1NE4A 1W9YA 3T2PA 4ATEA 1XRUA 4MXWA 4AHWA 2HBUA 4YVSB 4Z92B 3KVAA 1RINA 1BBT3 3VB9A 4DQAA 3HPNA 4I3GA 4WV8A 4A6OA 2RE9A 3QD6A 4R4XA 3Q8BA 4FT8A 1SLAA 1RUH3 1BBT1 4AFCA 5FO9B 2GSYA 2W2IA 5K0UC 1I9RA 4JGYC 2Y6HA 4NPLA 3VUOA 2WZEA 3O0VA 5LK7B 1Q3EA 2W1UA 1W8HA 2BGPA 4UFMA 1H9PA 3ZN6B 4LNVA 3T0DA 1AL0G 1DGLA 3AMPA 4XMIA 4EE2A 4PLNA 3DPRB 5FZ6A 1HIXA 2YBKA 1DGWA 4IEXA 4TWTA 1TE1B 2BZDA 2CAUA 1RUC3 2QQIA 3GYDA 3AP7A 5J7MA 3CHXA 5FV3A 3OEBA 1W06A 4RSUA 3ZSEA 4BYYA 5EHDA 1JODA 2LW8A 1XU2A 1JOJA 1MQTB 4FPFA 1H0BA 4K21A 5BXXA 1RB8G 4LTAA 4K3UA 3IBMA 5K9YA 2R072 5FDBA 3MYXA 1V0AA 3GZAA 4CU9A 4BH9A 3LE0A 3VZLA 3VDDB 4HVQA 3V0BB 3I54A 1OH4A 4KL1A 3HEIA 4BQYA 2MEV3 5LY1A 4MVTA 1XE8A 2KA3A 2LM3A 4WVWA 4GAZA 3WDWA 1UPIA 5GZCA 1RUC2 1UOBA 4ZY9A 2ATFA 5FZKA 1VBD1 5FO8B 4QX7A 2IXLA 3N4MA 4NAMA 1AHSA 4OLLA 1YFYA 3QACA 1NCRB 1ZZ8A 1FMD1 4CP0A 5FR3A 4HN0A 2HKXA 1V6IA 4FPOB 3I2GA 5A3UA 1NAEA 4OULA 3O1VA 1UXXX 1VBB1 2VVDA 4JZRA 4MGIE 4PDWB 3I2FA 2XJVA 3ENRA 4ASMB 2XR4A 4CP9B 1D4M2 3ME2A 5EIYB 1XQNA 2AREA 2LUWA 5BY5A 3VBSC 3ES1A 2VJXA 2ZX1A 3I59B 3O1SA 1AYN3 1ZRDA 1H8TB 2Y6FA 5FAXA 1AJKA 3OF1A 5C3RA 1KEXA 1MS3A 1F4AA 5J37A 5EZWA 4XILA 1AR72 3HN1A 4XDOA 4XC9A 2D40A 1NQJA 1GBGA 5DG1A 3E5UA 4Q4V2 4DMIA 3UJQA 3KQ4B 1OD3A 3T2OA 5L9VA 2VNGA 2R073 1BBT2 4XAEA 3CU7A 2C9AA 3DKQA 1V6LA 3N3HA 2CWSA 1LOCA 3VD5A 1PNGA 5T5LA 1QJX2 4QDSA 3S5AA 4J25A 5JI7A 1VBC2 3RSJA 2VH9A 2O0OA 3F2ZA 1HKDA 5T3NA 5B4NA 1APNA 3CDZB 1U0AA 2JWPA 2WNUB 1KD7A 2Y34A 4A2UA 4BK4A 2JDPA 4LKSA 5D21A 1KITA 3BI3A 1WLTA 1D4M1 5ACA1 1ZZ6A 3WQ7A 1RHI3 5I8SA 5CKNA 1QXPA 4OQ9A 1J1LA 2C6SA 4ASLA 2PA7A 4YVSA 1COV3 3VGIA 3P3NA 2QZ2A 1NT0A 5CA6A 5ACA3 3BKZA 2VE1A 4OHZA 3RS6A 3I97A 1U5ZA 1DHKB 5JSOA 5JXGA 3JQXA 2VZOA 1Q8OA 4QPIC 1LODA 1H1AA 4KGGA 1JYCA 1PGL2 1VBD2 1CQ9A 5JPNB 2HWD3 2XBO2 4QB6A 3OGGA 3BGAA 3ZMNA 5BNQA 1H4HA 2AEYA 2XJTA 3LEIA 2YMZA 3CBNA 3MFCA 5F3GA 4IW3A 2NZ9A 1WCDJ 5FYZA 4BQ5A 4OI4A 2B8MA 4A4AA 2JDNA 1UL9A 4LT5A 2VMHA 1WGPA 4PCRA 5IK8A 1W3VA 3B01A 1YLLA 3RGBA 2CY6A 3GXUA 4I3PA 1AYM2 1XYNA 3H0OA 4QPIB 5FY7A 4ES8A 3USUB 1O5UA 2JIGA 4A7YA 4R9BA 1H4GA 3UJOA 3UKTA 4F7ZA 1GP6A 1GZWB 4BQ3A 3PDQA 3OB8A 4K20A 4PBPA 2J1AA 4IV1C 3KF5A 2VMFA 4AI0A 5F2WA 4QHZA 2D44A 4RQPB 2ADEA 1TNFA 2ZZQA 1J3QA 3SCHA 1XPWA 1RUJ3 4ZKTB 1RUG3 4UF0B 4TZDA 5D2AA 1KDKA 5IUQA 4PDWA 2EIEA 3QLQA 1WMEA 4BLIA 3W58A 4E8DA 3EXUA 3GBWA 4NMIA 4CZSA 3V0BA 2ZAHA 2O14A 4OCTA 1VALA 2VMCA 5FLHA 5CADA 1DU3D 1G6NA 3E6CC 1LHOA 2RMU3 3EYPA 2F4LA 4P9YA 1MS9A 5FBJA 1W03A 4UBGA 4URTA 3WW4A 1DLCA 4LO5B 4NHKA 5KHIA 3M70A 3OBAA 4IXLA 2IWGB 3NNJA 5FP4A 2W1SA 4FOWA 1RUF3 2A3XA 4ONUA 3ZSMA 2BGOA 3RYKA 4FXKB 4NIHA 1H2LA 4MXVA 2RR13 2ARAA 4NHLA 4LHNA 3ACGA 2QQOA 3B94A 2K9ZA 1JTZX 1SZBA 2EVXA 5CFCC 3RZMA 3EB7A 5L36A 2R071 2WNOA 4D6QA 5HCAA 1ZBE2 2L9LA 2R061 2Z4FA 3IZOA 5FTTC 2D6MA 4IV1A 5J48A 3SKJE 1G9CA 5A7OA 3M3QA 5CU1A 2YXSA 3IDEA 4J1WA 3ZFFC 4AL9A 3IMMA 4Z8BA 3C7GA 5EP9A 1R1A2 1HRV1 2Z2SB 4LPLA 4LOTA 5FKBA 1UXZA 2LROA 1ZRFA 1K42A 1UKGA 1W99A 2PHFA 4CDUC 5J3UA 2E33A 2GN7A 4XFBA 1TMF1 4LULA 2RJ2A 4UFJA 3THPA 4B29A 3ZYJB 1REFA 3HNYM 3PHMA 4RS5A 1W6QB 3KF3A 3DL3A 1UU5A 3T2QA 2YG0A 3VDCA 2BJSA 3VKNA 1ZZ7A 2HWF1 2PMWB 1JHJA 5FZAA 1RMU3 2WIIB 2C4XA 2J22A 3AKRA 1FT9A 4PBOA 1MZ5A 1J58A 1T2XA 4ZU4A 3NW4A 3U75A 3OY8B 4XABA 2HJIA 2WINB 1VBC3 4JTNA 4CDQC 5H9RA 5D8AC 1G9AA 4OMDA 1OOPC 2RDQA 3KHCA 1S0FA 2G9GA 1E5HA 1O3TA 3IDAA 3OCPA 4BXSV 1NYWA 1HN1A 3KHBA 3OGSA 4RHV3 3S5QA 3J26N 2FDIA 3ZDVA 4XTPA 2VQUA 1PM4A 4KWUA 1EAH1 1YYNA 4AI3A 2Y8KA 4I0WB 4Q4W1 1W8FA 4UW4A 4XETA 3BN6A 1V6JA 4ZXEA 2CWMA 1R082 3L2YA 1FI2A 2B9UA 2YY1A 1F35A 2C0ZA 2DU0A 4K7JA 5D8AB 1Q8SA 3CZUA 1OKOA 3VBFA 3ZR6A 3KB5A 3UV9A 1V6OA 1MPXA 5A3TA 1CESA 4Y22B 3O0WA 5EXOA 5FPVA 4QQOA 4A44A 4IEZA 1EAH2 2C26A 3EJKA 4LKEA 1VBA2 4CTEA 2O1QA 3C8XA 1ZRCA 5A6ZA 1XNCA 3T2TA 1Y3TA 3LKJA 2ZHKA 4S2HA 5IT6A 4TYSA 1R64A 1AR93 1UX6A 4GB33 2X10A 1IS3A 1US2A 3MF6A 3VL8A 2XB6C 4L0PA 1W0PA 1AL22 1C8M2 4WM7A 4Y20A 1RHI2 3AYEA 3BU0A 3WHUA 2XL7A 4CCNA 2JE7A 2OUHA 2ZGPA 3HR9A 3P6BA 1ZRIA 1EV13 3ZSKA 1VB4A 3G7DA 3R4UA 2Q8EA 3OGJA 2XLAA 2BEOA 4WM7C 4YW5A 3THCA 4Y5Z0 5BYNA 2BERA 2FDJA 2JEMA 1RUD2
chains in the Genus database with same CATH topology
2F4PA 3KGZA 3RI9A 1OOPA 4BWOA 1IS4A 3FLRA 4RR3A 1TNRA 2XGXA 1MZFA 4IV1B 1ND3C 4XJAA 1M4WA 2NN8A 3D0JA 2DU1A 4E4SA 5CAZA 3EHKA 1MS8A 2BW8A 2I45A 1DQ5A 2VW0A 4META 3LGRA 2Y0OA 4WBBA 1ASJ3 4JVAA 4C90A 3SNMA 1ZZ9A 1URXA 5L7OC 2CNAA 2DFCA 4AEDB 4Q0SA 2OIIA 1RVF1 1DFQA 3AKTA 1V00A 5KXCA 1W6PA 3D4KA 2JXAA 3SITA 2GMMA 5GLZA 1RVF3 1S0BA 4D94A 4Q1PA 4XFAA 1MVEA 1X50A 1CJPA 2QCSB 3CLPA 1A8MA 1EV12 2UY9A 4JGZA 1Q5OA 4LBLA 2HYKA 4P14A 5GZCA 3KSCA 4AQSA 5BNOB 1RUI1 1FOD3 5EFUA 5I0UA 2DFBA 4AVVA 2FHRA 2IZWA 3M3OA 5TSWA 2VGDA 3AZYA 3AZWA 4BMEA 1FAYA 1F5JA 3NV2A 3S7EA 3WP5A 1RVF2 5EYXA 4AK3A 5DUVA 3ELNA 4N90A 2WFF1 2IFWA 2A6YA 1CAVA 1O91A 2XVLA 3CJIB 2OVUA 4AW7A 3R6SA 4EN7B 5HI0A 2BVBA 1RITA 1QU0A 3KCYA 3ZFFA 1VBE3 3AZVA 1H8VA 2E9QA 3NO8A 4LLFA 2I74A 1TME2 1DZTA 4KH9A 1ZYBA 1GV9A 1YIFA 1WD4A 2E53A 3D5OA 4Q4Y3 4QXKA 1PZ9A 4AEMA 2TBVA 4L92A 5JVVA 3TN92 3WVJA 3GALA 5FQ0A 5I8TA 1N47A 2EXKA 3WQ0A 2WL1A 4L97A 4DS0A 1QDCA 2PHWA 3K48A 5ABJC 1ND2A 2ZMLA 1JN2P 2TEPA 4NO4A 1LCLA 1W6OA 2XHKA 4DRVA 5C8CB 4N43A 2RJLA 5J98B 2VVEA 5L7OA 1J59A 3S0MA 4MGYE 4HANA 4PJYA 1AZDA 3M3EA 3O7OA 4NR1A 3B93A 3M3IA 1F8VA 2QFEA 4CEWB 3J8F2 4D7YA 4LO8A 3RMXA 4IV3A 3J4UH 2A6WA 4CDWC 1Z7S3 4HK8A 4Q4W2 4FVVA 1BEV3 3USUA 3V0AA 1XE7A 1ONAA 1RL3A 4OI0A 5A33A 2X5IC 2EXIA 4BIFA 2GMEA 3B7MA 1UIJA 5GLTA 3N7LA 4Z07A 3U0ZA 4JRLA 3INAA 3LA7A 3VKFC 4QQ2A 4Y1YA 1NCRC 4MYEA 1WCKA 4CYDA 1AUYA 1QKQA 4IEOA 1F9KA 1UCXA 3WY6A 4R9AA 1O3RA 1H2KA 2A6XA 4LBQA 4ES9A 2OUJA 3MIEA 4B4PA 2ILMA 4LBKA 4BM8A 2OPKA 1M06G 4FPCA 2BNMA 5BNPB 1LGCA 1POV3 1QJU2 3JD71 1HLCA 4AE2A 2NMOA 4I30A 1PVC3 1Y43B 2XUMA 1L3JA 1GSLA 4RHV2 1AR73 4BMBA 1NCQB 1W6OB 2WQZC 4HSJA 1PO23 4EROA 1FMD2 5FBZA 3N36A 2UYBA 4Z2WA 1ULFA 1S2KA 1LECA 3WP4A 2D6LX 1JW6A 3ZSLA 1D4M3 1RHI1 3HWJA 4XMAA 1CVNA 5CIRA 4FPHA 3S7IA 4R9DA 4GKXA 2RS52 1OLRA 1QXJA 1R091 3EQEA 1NCQC 2I07B 3DPRA 4QM9A 3PNAA 2HWB2 5GM0A 5KXDA 4GULA 4DNYA 1GKBA 1QH7A 3VKMA 1IOAA 1R093 5FLJA 4F3JA 4UBHA 1Q8VA 4LR4A 4YVSC 4E2QA 4L11A 3WDYA 2K2SA 4FPLA 2PAMA 1GNZA 4OHVA 1G9DA 1CAUB 4LE4A 1CX4A 2PLV3 2I2SA 1OA4A 1OFNA 5KHHA 1H9WA 4NPRA 3LA2A 4GH4A 4Q4X3 4YNIA 4UW6A 1HQNA 1BMV2 3LA3A 4HLTA 2VOKA 5I0RA 3KMHA 1LB2A 1SLCA 3DKWA 1RUF1 4XBLA 4BIOA 3ZXFA 3AP4A 1E57A 5L7OB 1AYN2 3X29B 2MNGA 2GNMA 3E6DA 4AVSA 4BQ1A 4JC1A 3PVEA 3FUQA 1CR7A 1B35C 1W6QA 4GXLA 2GMPA 2R063 1W6PB 2VOXA 2RMU1 4QPGB 4WVMA 2JKBA 4LEJA 4QU2A 1QQP1 1DLLA 5JI9A 3OYWA 3ZO0B 3MLKA 1WMDA 2YV8A 3IWZA 1QF3A 4N43B 3VV1A 5JOZA 2X5IA 1V6NA 2ZTNA 2GNBA 2WZR3 4CDUB 4OFGA 3POSA 1CJDA 1XYPA 4N53A 3PTYA 3FBYA 1RUE3 4OI2A 4IV3C 1H30A 2XVGA 3H8UA 2A3YA 3IDBB 1RUC1 2R32A 3H50A 5DDJ1 5T5JA 2AGSA 3TN93 2FMDA 2K0GA 3UKVA 3E5QA 2XG3A 4LO7A 5CFCB 1BVP1 5JZGA 5A3MA 4QGMA 3MF9A 4WM8B 1RUOA 5KBFA 3TB0A 1HQLA 1LULA 4C91A 4Q4X1 3NVCA 3ZFFB 4YVWA 1MQTC 1S0JA 4QM8A 2QQPA 5BNOA 3WR0A 2ZJCA 4JGZB 4AEJA 4GALA 1N1YA 3E97A 1KRIA 3WDXA 4XF1A 2W52A 3QBQA 4COUA 4AVAA 1DQ2A 1QJX3 4E4DX 1OD5A 2Y26A 4YZ4A 3IT8A 1NXD1 4N9HA 3RI8A 1CAXA 3VN4A 2ZS6B 1OMIA 3ZVXA 3O14A 4NOTA 3QH7A 2JE9A 1QOSA 1YI9A 1RUF2 3ZXLA 1IHMA 1OA3A 4M01A 1NLSA 1NOVA 4UW3A 4GIQA 2NQYA 4XJUA 3ZXDA 4FSJA 5GALA 4CDWB 4QD2A 4FTBA 4LO4B 1PGL1 1N3QA 1RUE1 4COVA 2OZJA 4HPKB 4DY5A 2PFWA 2F6BA 5GZEA 3CL1A 1RJ7A 2ZGOA 3MIHA 2B7YA 3OY8A 2NMNA 4ZU7A 1AXZA 1WD3A 4Y20B 4QMAA 2RS11 4S2DA 1KDMA 2WSUA 1C4RA 5FREA 1FYUA 1ULGA 2WQ4A 4FBFA 1QQP3 4RD7A 4YFWA 1S0GA 4FPJA 1DQ1A 2WT0A 2QUOA 3IN9A 1ENXA 4OHWA 3SISA 1XNDA 4XJ8A 1DIWA 2RM23 1AR63 1Z78A 3WUDA 3URFA 2WLQA 1QJY1 1AYN1 2OW4A 1HRI1 1BCXA 5IK7A 1SMVA 2ZGRA 2C1FA 3WG1A 4YRDA 1BMV1 3H1WA 2GU9A 1Z7S2 3HT1A 4NWVA 5BNOC 1UU6A 1YHFA 1GQHA 1W6MB 1PGW1 4LUKA 3UK9A 2DF7A 3VZOA 1HW5A 1DGRA 2RM22 3I59A 2WT2A 1LU2A 2CGNA 3WW1A 2AENA 2DURA 4HMZA 1ASJ2 1NG0A 3IMNA 4I02A 4N43C 1GANA 2HWB3 1DGRN 1UAIA 4JCKA 1IGOA 2B5HA 2IXCA 1KJRA 1VRH2 2DUQA 1U5XA 3ECQA 2UYAA 4B4QA 1JBCA 5KXEA 1JUIA 2XWJB 2OYZA 5FFOC 4CEYC 3FBMA 1UW8A 5F5QA 4WVVA 3AZXA 4AEDC 1S0DA 2VMGA 3MFAA 5GLUA 5C4WB 5F6LB 2WZPP 2JX9A 4YW3A 5BPXA 1VBE1 4RL7A 2A73B 2QDNA 1RUG2 3AM2A 3JBG3 3FUOA 3VHRA 1GYKA 1QJY3 3BIWE 3CJIC 3WP6A 5I0SA 1QJU1 2AUYA 3M8LA 4QPYA 5BNPC 5I93A 4TLFA 1PK6A 1RIRA 3WG3A 2H6BA 1EP0A 3FC0A 1S0EA 3POWA 5DUUA 1PGSA 2BNNA 1K5MB 4YGEA 3B02A 3RJRA 2YROA 4AFMA 4D7SA 4AI2A 1VBE2 4DY3A 3ATGA 3OPZA 3AFGA 1LKNA 2JG8C 3KZ4C 4XQDA 3AB0A 1LHUA 4XJ9A 1IPKA 4QGLA 1W39A 3AMMA 2B42B 4IEQA 1H8TC 1IZ3A 1TME1 4ITCA 4B3NA 1H2MA 1FNYA 1NA1B 1SDWA 1AYM3 3H9AA 4IEPA 1LHNA 5SV8A 3VBSB 5CG9A 2CV6A 1ZBE3 5C4WC 1NY71 3B9CA 1SLTA 1HXS2 3WLUA 4I09A 4CDWA 1CPNA 3C3VA 4C0BA 3WG4A 1FOD1 1DBNA 2Q0AA 2VULA 2RS32 3BOWA 1OI6A 4DINB 2WNVA 5BNPA 3JUUA 4FP2A 4IQPA 4AGRA 1K5MC 1S0IA 3PMSA 1YJKA 3M7AA 1C5HA 4AHZA 3IPVB 1PO12 1DYKA 2IXKA 3WW3A 4XEZA 4EWEA 1FPN1 2OA2A 2Z42A 5H9SA 1PO22 1Y9QA 3GBFA 2RS51 3WUCA 3CF6E 3VKLA 3ALQA 4XFIA 2OZ6A 3JQWA 2ES3A 4Q8LA 3NSTA 5AC93 2WNEA 1QDOA 5C9AB 2DCTA 4ISRA 3W59A 2RR12 2WSVA 2ZGNA 3CO2A 4Q4Y1 1LJ7A 3N35A 3ZYIB 4H7MA 5FMOL 4AG4A 3LCPA 4WM8A 2HEYF 3AMHA 2CGPA 2WJSA 3DN7A 3RDIA 3WDVA 4R52A 4JDOA 3ZIXA 2DVAA 2QKDA 4CEWA 5I91A 2NPIA 2VXRA 4KU8A 4INDA 4YSFA 1PK6B 5KC5A 4YYOA 1AX1A 1QHDA 3TNQA 1ZM1A 1DF0A 2DYCA 3GF6A 1TMF3 1MVQA 1O7FA 2FQPA 1KFUL 1SLLA 3JBG1 5JOWA 1FOD2 5AFEA 2JG8B 4RFT0 1DQ6A 1O4ZA 4M3CB 3ZFGA 1F5FA 1ENRA 1NXMA 2D93A 4LBQD 1RUE2 1RJ8A 2ZCWA 5KXBA 3IIAA 4FP3A 1A78A 4AFAA 4DXZA 5JAXA 2XJUA 5A3LA 2BWAA 3MIFA 5AC92 1RMU2 1SACA 2QVSB 5FPZA 4GWMA 1SBEA 3JB8A 1MEC3 1WLWA 2SBAA 4MGKE 1LR5A 1EPZA 3ZPYA 3WV6A 1ZZCA 3BOPA 4R8HA 1ZA4A 3I7DA 4PLMA 2R30A 5HBAA 2E7TA 1RC6A 5JZGC 2R6QA 4K8FA 3V64A 3ZXKA 1VAKA 3T1LA 4OHXA 3V56A 4FPGA 3C2UA 4XJWA 5GLVA 4KG0A 1AJOA 2HWC3 3ZFEC 3WOGA 1PVC2 4U36A 4BCUA 3RG0A 2BVVA 2ENRA 2D6OX 2XVKA 3THTA 4XYXA 4BHPA 3GHMA 1VP6A 2LALA 3ST7A 1D2QA 4SBVA 3H7JA 3VHNA 3VL9A 3VZJA 5E8AA 4BOWA 1VIWB 5EJ3A 4XF3A 1AR61 2XLFA 1MS1A 4EWAA 4WM8C 2XJRA 2E51A 1J3RA 2P34A 3NV4A 1SCRA 2A75A 3A4UA 3H1YA 3TBDA 2WFF2 4DZGA 2WNVC 1J1TA 2AYHA 2D98A 2R0HA 3AKSA 5AVAA 1C1LA 2QJVA 1REEA 2HWE3 3VBUA 3I2DA 1QQP2 1RUD3 1ULEA 2Y0IA 1ULDA 1PGW2 1PO13 4YGBA 1OOPB 1OKQA 1JYIA 4NVPA 2EA7A 3WDTA 4G3YC 5CFDB 1VBC1 4XFGA 3LB9A 4Y22A 2RS33 4YG3A 5CVRA 4GMP1 3S6PA 2ARBA 4XHBA 4GQ7A 4WM7B 1EAH3 1DGWX 2ZX0A 1YXWA 1LOGA 1W2UA 4JV4A 4KWLA 1R1ZA 3NAPA 1XYOA 3ASIA 1A6CA 4HPKA 3GHNA 2WZR1 4IESA 3WCSA 2GNTA 1B09A 1POV1 2EAKA 4K1YA 4FOVA 5C4WA 3NAPB 3USSA 3ZYRA 1UU4A 4EN9B 3D0SA 2WNVB 4MUVA 2WFF3 3TRSB 3VBFB 2WFPA 4D3WA 4E27A 3CJIA 4EJRA 1CAWB 3WXPA 1YFWA 1Y7BA 4QX5A 2CL2A 4BLJA 1FXZA 2RS53 4COYA 4L9BA 4YM3A 4Y4YA 3I4IA 1S1AA 2QNKA 1AYM1 4FOYA 1KQRA 1JXNA 1RTVA 4A7ZA 2DV9A 3CNAA 2VUAA 4EV0A 1ALYA 2HEVF 2D7FA 1ND3B 2GNDA 3R0RA 2R043 2DTWA 4LA2A 1V6MA 1COV1 1FX5A 2XBO1 2ZA9A 2QE3A 4X6QB 3V65A 4E4ZA 4H14A 4Q8KA 1WUVA 5DZFA 1ND2B 4F83A 1VRH1 1YIPA 4RR3C 5DXDA 2PLV2 5FO7B 2YHJA 4LLOA 1NA1A 1XXNA 1TME3 1J3PA 1FPN3 1X8EA 4AEDA 4HKOA 5FCCA 3D8CA 4QHBA 4MV2A 1R081 2VNOA 3ZMOA 4JTOA 3IKWA 2RM21 4YZ1A 2BFUS 5L19A 2VQAA 2WS92 4HVOA 2A3WA 5ABJB 5KWRA 1B35A 3BB6A 3WX5A 1PZ8A 2IXJA 2PAKA 3SCFA 3OBTA 2VY0A 4MLOA 2UWCA 2PHLA 3AX4A 5K7PA 3ZFEA 3ZXEA 2VNRA 4XFCA 3NJZA 5K0UA 2ZMNA 5KC6A 1Q8PA 5FRAA 3MPBA 1PK6C 4YM1A 3PJYA 4YG0A 3H1MA 4UW5A 1WBFA 3TAYA 2GC2A 1AR71 4GH4C 4P9XA 4FAGA 3FZ3A 4L99A 5DDJ2 3ES4A 3MLJA 2BBVA 1XU1A 2PQQA 2JICA 4RGAA 5DZEA 3O5SA 2JECA 4P5HA 2A5ZA 5B2GB 2R1BA 4A7KA 1AL23 1C8M3 1JUHA 4Q2FA 2MEV2 1MZEA 3JZVA 1HRV2 4DRRA 2QDRA 1G8WA 4AFBA 3FJSA 4XIOA 3WT3A 4DFSA 4HN1A 1VBA3 2HWE2 1OLQA 4Q0PA 3K51A 2VMIA 4K1ZA 1BJQA 4G9SB 4JGYA 4C0HA 5C33A 3TOJA 2VVFA 2UWBA 5T50A 5JOYA 5JMCA 2JG9C 1GZ9A 5BV6A 1KS4A 1H1IA 4C1WA 3B00A 4WZFA 3PMEA 4AI8A 3BTAA 1QJU3 1LHVA 5IK4A 2P17A 1CIWA 3JB4C