1LHNA

Crystal structure of the n-terminal lg-domain of shbg in complex with 5alpha-androstane-3beta,17alpha-diol
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
177
structure length
176
Chain Sequence
b'PPAVHLSNGPGQEPIAVMTFDLTKITKTSSSFEVRTWDPEGVIFYGDTNPKDDWFMLGLRDGRPEIQLHNHWAQLTVGAGPRLDDGRWHQVEVKMEGDSVLLEVDGEEVLRLRQVSGPLTSKHPIMRIALGGLLFPASNLRLPLVPALDGCLRRDSWLDKQAEISASAPTSLRSCD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Steroid Ligands Bind Human Sex Hormone-binding Globulin in Specific Orientations and Produce Distinct Changes in Protein Conformation
pubmed doi rcsb
molecule keywords SEX HORMONE-BINDING GLOBULIN
source organism Homo sapiens
molecule tags Transport protein
total genus 30
structure length 176
sequence length 177
ec nomenclature
pdb deposition date 2002-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00054 Laminin_G_1 Laminin G domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 1lhnA00
1WLDA 1KITA 4WZFA 1VAVA 2UURA 3MW3A 3OJBA 5IT6A 1WW5A 5KXCA 2ZGLA 1DQ2A 4C1XA 1LEMA 1VAMA 2D6NA 1KDMA 1HLCA 2AENA 1W6OA 1QF3A 4PCRA 1BKZA 3SISA 4U36A 2AYHA 3V64A 2ZGNA 4DPNA 1F31A 2ZGOA 3OYWA 1SBDA 3AYEA 3ASIA 1SFYA 1HQLA 4M3CB 1N1VA 3JUUA 1UZYA 4SLIA 2DVGA 1C1FA 3O0VA 2EALA 4FVVA 5JDBA 1RIRA 4F83A 1NLSA 1ULEA 3O0XA 3PJQA 4YW2A 3ZSLA 3BTAA 1Z78A 4AVTA 1LHUA 1WW4A 1LHNA 3VKLA 4GALA 2A75A 1C57A 2WSVA 3BIWE 4LBQA 1G8WA 3B00A 4BQ1A 4Q26A 1AZDA 1U0AA 2ZHMA 3NWKA 1W6MA 1LGNA 4FPKA 1QNWA 2AREA 3WCRA 4XILA 1JXNA 3B3QE 4FQ4A 1MZ5A 4Y22A 1IS6A 2AGSA 4FPGA 2JECA 1H30A 3AK0A 4NO4A 1DQ4A 1JN2P 3MEPA 3RMXA 3PVOA 4YZ4A 4YM0A 3ZSJA 3L2YA 3AXDA 2E7QA 1H9PA 1W6QA 4FPOB 4Q1RA 4TYSA 3ILRA 4YGBA 4ASMB 3ILNA 5FREA 4LBJA 2D6KA 4UW6A 2NMOA 1TEIA 1UL9A 5T52A 4YFZA 2ZABA 5GZDA 5DUVA 1PZ8A 5LK5A 4FPHA 1GICA 1FNZA 4DS0A 1S0FA 2WKKA 2ZBJA 1DYKA 4UW3A 4R9BA 2ZMNA 2FMDA 1CIWA 2HYKA 4GKYA 3H0OA 1B09A 4YLZA 5T5OA 2JDZA 3WZ1A 5HCAA 5KXEA 1N3OA 3PVEA 2A3WA 2ZGSA 5H9SA 4P9WA 2VH9A 5DZEA 1UPSA 2A3YA 1BJQA 1LENA 4FOVA 1RITA 2XG3A 2W68A 3AXEA 3UK9A 1LGBA 3RMYA 4C1WA 4YZ1A 3UJOA 1N1TA 1KRIA 1NXD1 4YW5A 2ZGPA 1LOFA 4HL0A 2CNAA 2GN7A 1DFQA 5JVVA 1VALA 3OBRA 2P3KA 1GYKA 2D3SA 4FP3A 3USUB 3M2MA 1GNZA 1FAYA 1N47A 1GLHA 1S0EA 3KQRA 5JOYA 1UAIA 2YROA 3AYDA 4Y1YA 5H9PA 1SBEA 3RSJA 1ENRA 4AGVA 1GNHA 2A71A 1N3QA 4Y20A 3RS6A 3WHUA 2A70A 1QDCA 4XJUA 3HN1A 4K1YA 3FLPA 4CRQA 4YG3A 2R16A 3MW2A 5GLVA 1MACA 1A3KA 5HCBA 1O4ZA 5T5PA 4Q2FA 1AJOA 4Y1XA 1WW6A 3VV1A 4DQAA 2DVFA 3B9CA 4TZDA 2VXRA 3NV4A 2XB6C 3ZPYA 1AXZA 4YW4A 3I8TA 4Q1PA 4WVVA 3WG2A 3WDWA 5EYXA 3M3OA 4XYXA 4WV8A 4DRRA 2Z42A 4XJWA 2WSUA 4XZPA 1AX2A 2ZAAA 2VW1A 1KDKA 3V0BA 1LOCA 1V6JA 1W0PA 3WUCA 5JOZA 5T50A 1Y7BA 3SNMA 3WCSA 2DU1A 4Y26A 3AP7A 2G4IA 1LJ7A 3IMNA 3SH3A 1DHKB 2WJSA 4RA0A 1JUIA 1FYUA 2PHUA 1DZQA 1IKPA 1SLIA 1W6PA 1W6NA 1LGCA 2A5ZA 2GN3A 3A4UA 3D6EA 3M3QA 4XBQA 4BLJA 5DZFA 1G9DA 4JCKA 5DG2A 4ATFA 2WNEA 4K1ZA 1IS3A 1MS3A 1YXWA 3RRDA 4YGDA 1I1EA 2C5DA 1Q8OA 4UW4A 2V73A 2VUAA 1GZWB 2E51A 4LBLA 5AVAA 2R1DA 3V0AB 4BM8A 1D2SA 2GMEA 3U4XA 2WQZC 3APBA 5F9TA 2A6WA 5JOWA 4AWDA 2WLQA 3W58A 3N36A 1O4YA 1LOFC 2A6ZA 1S1AA 5CNAA 1YYNA 1SBFA 2ZGUA 2YZ4A 3N7KA 5CBLA 4YZ3A 3BOPA 3Q9OA 4RL7A 2ZMLA 3T2TA 3WNXA 1DQ1A 2SBAA 3N35A 1Q8SA 5BYNA 1LHWA 3AP6A 1HQWA 3M1HA 3RG0A 3QLQA 2EF6A 4MYEA 5DUWA 3WG4A 4Z8BA 3WLUA 1AX0A 2P34A 1YRZA 3MW4A 1CPNA 3DGTA 4YGCA 3WDXA 2LALA 1MVQA 4FPJA 1V6IA 2P3IA 3WDUA 1LULA 1A78A 4ZXKA 4CZSA 3NV1A 2R0HA 2JKBA 2GNMA 1G9AA 4CTEA 1W0OA 2DURA 1LTEA 4PBPA 1DYPA 1QU0A 2D6PA 5DZGA 5GLWA 1G86A 1V6LA 5DG1A 5T54A 1S0DA 4AVVA 3OBTA 1CVNA 2OUHA 1LESA 3SH5A 2DUQA 3POYA 4LBMA 4BOWA 1Q8QA 2PELA 3WOGA 5JMCA 2CY6A 3OY8B 4XXAA 1BQPA 4XIKA 5EXOA 4YM1A 4FP2A 2UWAA 3WV6A 5IK4A 4AGGA 3VKOA 1KJRA 1S0BA 4GWNA 1FNYA 1G9CA 3N7MA 1AJKA 3WG1A 1WD4A 3N7JA 4UW5A 3R4UA 3AZXA 4Q8LA 1UZZA 2ARXA 5IUQA 5E8AA 5KXBA 1ZM1A 1SLCA 1WD3A 3CNAA 1ULDA 4GWMA 1APNA 3AYAA 3KM5A 1LEDA 2W52A 4AVSA 4YZ2A 4Y1UA 1GKBA 1GSLA 1J1TA 1SCSA 1CQ9A 1F5FA 1UKGA 1W6OB 2EXJA 2PHFA 2ZACA 3D4KA 3WDTA 1ULCA 2ZKNA 4PBOA 1GZCA 1ONAA 2AR6A 3OYWB 1YIFA 3WDYA 5DUXA 1JHNA 3JU9A 2LTNA 3AFKA 5CA6A 1JOJA 3OPZA 2P2KA 1HDKA 4M3CA 4FPLA 2P37A 3ZSKA 1LHVA 1RINA 3ILFA 2TEPA 1LU1A 4GA9A 5DUUA 1LU2A 4DRVA 2P3JA 4GKXA 4K20A 2JD4A 4AGRA 4YW3A 1QMJA 2R1BA 2NZ9A 1KQRA 2Q5TA 1JYCA 2EAKA 2SLIA 2DVAA 4HANA 3AYCA 4LBQB 4Q27A 4XDQA 4XIOA 4XMAA 3WG3A 1QNYA 2UWBA 2KM2A 4ISRA 3WDVA 3ZXKA 4YM3A 1PZ9A 1AXYA 5EYYA 2CWMA 1N3PA 1W6MB 4JRAA 3V65A 5T5LA 1AX1A 1V6NA 3AZYA 2C9AA 2DTWA 2GNDA 1Q8PA 3R05A 4L8QA 3N3HA 1AVBA 1WW7A 1CN1A 2YV8A 5T55A 2UWCA 4R9AA 3O12A 4XTPA 4XHXA 2GDFA 4XXPA 2DVDA 3GNEA 5GZFA 4YZ5A 2DVBA 2ZZJA 3SITA 2D3RA 4BLIA 1MS1A 2CWSA 1CR7A 3VKFC 2BQPA 1C1LA 1FX5A 3O0WA 5DXDA 2NM1A 4LBQD 3M3CA 3PMEA 3RQ0A 4I30A 4M01A 2DUOA 4BPZA 1FV3A 1S0CA 1ENQA 3VKMA 1DGLA 1SACA 1EPWA 4FPYA 4ITCA 5H9QA 1V00A 4M3CE 2A6XA 3ZXFA 4XTMA 2PHXA 2WT1A 1Z0HA 3ZYRA 4YGEA 2VU9A 3GALA 2ES3A 1ULFA 1UN1A 3DUIA 2ZGQA 3MPPG 3ZXEA 3IKWA 3UJQA 1BYHA 2ZGKA 4XOGA 4YW1A 2WT0A 1LODA 3ZXJA 1LHOA 3WHTA 3WUDA 2WT2A 3N7LA 3FUOA 4U2AA 1OKQA 3O5SA 4ZKTB 1LOEA 1Q8VA 4XMIA 5F5QA 3AX4A 1G9FA 2DV9A 5CB7A 5KXDA 3USUA 2YXSA 4LBOA 1CJPA 3AJYA 2EXHA 1ZA4A 1GBGA 2E7TA 1BXHA 5GZEA 1YO8A 4XBLA 3W59A 5GZGA 2GALA 2YY1A 1LCLA 1V6KA 1FATA 3LSEA 1IKQA 4XHBA 1QOTA 5GLTA 2JJ6A 3WVJA 4Y20B 3FBYA 3M3EA 5GALA 2EIGA 3B01A 2OVUA 1SLLA 2VY0A 1QOSA 2AH2A 1DIWA 3ATGA 2ZHKA 2DWRA 4M3CF 4H55A 3B69A 3T1LA 1LOGA 5GLZA 4Y24A 1H9WA 3T1MA 2D6LX 1MS4A 2ARBA 1IOAA 2GNBA 3TAYA 1IS4A 5HCFA 2A3XA 3IPVB 4LBNA 1V6OA 2GMPA 4FPFA 4R9CA 1QOOA 4NOTA 2ZGRA 2DUPA 1S0IA 1WUVA 4FOQA 4R9DA 4Y1VA 1MR5A 2AUYA 2ZMKA 3POSA 3AP9A 3V0BB 3A0KA 1N1SA 2VW0A 4YG6A 5FRAA 2V5YA 1DQ5A 1DLLA 1MZ6A 2D6MA 2PHRA 2ZGMA 3HMYA 4KBBA 3PVNA 2B7YA 3SH4A 4BMEA 4P9YA 1WCSA 2D6OX 1QDOA 2ENRA 1YI7A 1URXA 2OUJA 1MS9A 1PZ7A 2EXKA 4FQZA 5H9RA 1W6PB 1W6NB 3FFZA 3VKNA 5T5JA 4IQPA 1IS5A 5IK5A 1KJLA 4WVWA 1MS8A 2A6VA 3ZSMA 3ZVXA 1LECA 1OQ1A 4XJZA 4BMBA 4YM2A 4XJAA 5IK7A 3VUOA 5JLVA 5IK8A 2GNTA 1GZWA 2CTVA 2OW4A 3I4IA 1AF9A 2I2SA 5EWSA 1HKDA 1X50A 3AZZA 3V0AA 4PF5A 1QKQA 1XQNA 5GLUA 4FPCA 1FV2A 3A0NA 3D5OA 4XJ8A 1S0GA 4LBKA 1DQ6A 4YG0A 1BZWA 1C4RA 2UU8A 2A6YA 1WLWA 3ZYPA 1VIWB 3C2UA 3LSDA 3AP4A 3QCWA 2NP0A 1F9KA 1SLTA 3ZXLA 4GXLA 1CESA 1SLAA 2E6VA 4W65A 4P14A 3INAA 2DTYA 1AXKA 1LOAA 1MS5A 1S0JA 2CYFA 2R49A 1Q56A 3TB0A 4DFSA 1QGLA 2PHTA 2ERFA 4M00A 4XJ9A 2W08A 1CPMA 1V6MA 2NN8A 2ZA9A 2H0BA 2ZHLA 1JBCA 3LCPA 3NV2A 4ISQA 2D7FA 2D43A 4FPEA 4K21A 2JE7A 5SV8A 5E88A 4PQ9A 1GV9A 2NMNA 4ATEA 1DQ0A 5JOXA 4Y22B 1WBFA 1MVEA 1JYIA 1CONA 1UX6A 3IM0A 1WBLA 4YFWA 1N1YA 1OFSA 3NV3A 2E53A 5GM0A 2R0FA 4Q8KA 5CAZA 2ZGTA 1JW6A 1W6QB 2D44A 4OZXA 2DYCA 3AZWA 5L73A 2NYYA 3FUQA 2YMZA 2DU0A 1R1ZA 3BODA 4FOYA 4XBNA 3IPVA 1GZ9A 5GZCA 4D69A 1WLCA 1I3HA 3OY8A 2VW2A 3POWA 3FLTA 1MS0A 3R4SA 2RHPA 1D0HA 1DBNA 4FOWA 1A8DA 2PHWA 3AP5A 2W39A 3FLRA 1G9BA 3AJZA 1SLBA 2CL2A 3UL2A 5E89A 5GJ6A 1ULGA 2ZHNA 4JC1A 3AZVA 4P9XA 1ENSA 3IN9A 4AYUA 4XE9A 1LOBA 1GANA 2D3PA 3OGGA 1SCRA 2EXIA 1VLNA 3HR9A 3SLIA 2JE9A 1G7YA 2GMMA 4Y1ZA 1UMZA 3ENRA 2FHRA 2A7AA
chains in the Genus database with same CATH superfamily
4UF0A 3WXPA 2X29A 1AUYA 3CJIB 3OJBA 4WZFA 4A6SA 5LK7B 5LBFA 3VDDB 1RHI2 1LEMA 1EY2A 2G19A 4EN9B 2YFZA 3ZPOA 1O7FA 3LB9A 2WA3A 4NAMA 4PIXA 5DDJ2 5LEKA 4JTOA 5FYVA 4FTBA 1AYN2 2YPJA 2ORXA 1OQEA 1K45A 3BI3A 4QX0A 4BJ0A 1JYNA 1VJ2A 3HT2A 4OCTA 1W8HA 1RIRA 4RHV3 2X5IC 4GAZA 5APAA 3VZOA 4E27A 4F83A 1NLSA 5B2GB 3RI8A 5I0DA 3PJQA 3ZSLA 2ZEWA 3CIHA 3BTAA 4AVTA 4JGYB 1AYM3 4DEQA 4AEMA 3BIWE 2ADDA 3HT1A 1H8VA 3L9JT 4LBQA 4KI5M 2FBEA 2Y6KA 2R6QA 1AZDA 1WCUA 2ZX0A 5FY8A 1OHFA 3H7YA 3H8XA 1W6MA 1LGNA 4YVWB 2H6BA 5FR3A 3WX5A 4LT5A 3WCRA 2W1SA 1JXNA 4DIQA 4A44A 4IEQA 1ZBE1 3NMBA 4LJHA 3ZFFB 3TEXA 1J1LA 2WAOA 1G6NA 2E7QA 1FOD2 2WLPA 4LORA 4Q1RA 4ASMB 3ILNA 5FREA 1X9PA 4UW6A 3GDBA 2NMOA 5LA2A 5A80A 2R073 1FMD3 2DCTA 4FPHA 4H7LA 4XZUG 1AR72 1PGSA 1FNZA 1S0FA 5FZ7A 2FDGA 3IBMA 3T3YA 1DYKA 1DP0A 3LD8A 1H2KA 3H8RA 4GKYA 4IE6A 3HNBM 3H0OA 4OI4A 4P02B 4WZCA 3WZ1A 1UZ0A 5ANNA 5KXEA 5I0SA 1Y43B 4LXLA 2K46A 3K3NA 3OGJA 1BJQA 2BNOA 4GULA 1RITA 3AXEA 1LGBA 2WZR1 3RMYA 3I2OA 1N1TA 3K48A 5K0UA 2RS52 5CFCC 1UXXX 2WZ8A 1V0AA 4FXGB 4DXZA 5FUNA 4XCAA 5JVVA 3U14A 4YW7A 5BNNA 1JZ6A 4QGNA 1NZIA 3BYWA 4NN0A 1VB2A 2XONA 1C5IA 1GYKA 5J3UA 2BOIA 1FAYA 5JZGA 3S7EA 4MXWA 1UAIA 1W2TA 1W8WA 2VVDA 5FJKA 3GZEA 1Q5OA 5FCCA 4Y33A 5H9PA 5FZEA 2ZAHA 4Q4W2 1C3HA 3MDPA 1QJX1 3C7FA 4OHZA 5HI0A 1KEXA 5FYTA 1N3QA 4UWDA 2VMGA 3WHUA 4O61A 5A7PA 2VR4A 3HN1A 4K1YA 1CGPA 3D82A 1IPKA 1YWKA 1MACA 4DB5A 2HEWF 5CVRA 1HRV3 2XBO3 4N43B 4N90A 4Q2FA 5HCBA 5T5PA 4B4RA 1WW6A 3WQBA 4CXXA 1CAWB 4TZDA 4QXCA 1WLTA 3U78A 3I2GA 3OGRA 3ZPYA 3CF6E 2OKXA 5BNQA 5FP3A 4YW4A 3DPRB 5JCTA 4A45A 4D7YA 3WG2A 3SQOA 4WV8A 1BVP1 5L7OB 4QPIC 4XZPA 3QD6A 3K3OA 5C3OA 1QQP1 3WUCA 3NAPC 3O1TA 4XFCA 3AC0A 3MLLA 5K8SA 3SNMA 3R0RA 4NAOA 3WCSA 3ZDVA 2DU1A 4Y26A 2LUWA 5FZ9A 2XHNA 4LHNA 1NT0A 3UYJA 4HOOA 2JG8B 3A7QA 1LJ7A 1US2A 1SHWB 1RUG2 4XF3A 4RA0A 1FI2A 1DZQA 1SLIA 1W6PA 5CAZA 1HN1A 3M3QA 3T08A 4UBGA 1KFXL 3G7DA 1UIKA 4RS5C 5F3GA 1IS3A 3KLSA 1MS3A 4N7IA 1PM7A 1UWWA 2JDKA 3MIGA 4XUTA 4COVA 1V9U1 2E51A 4WM8B 2R1DA 3V0AB 3U4XA 3RVHA 1XE7A 2O14A 1DGWX 3APBA 5HCHA 2P3YA 3OGSA 3QOPA 1H4GA 2QQIA 2ETEA 2WFF1 2VMCA 2WLQA 4BK4A 3N36A 5I8YA 4N53C 1JZ2A 1LOFC 4RR3A 1PM4A 1SBFA 2Y6GA 2WBKA 1KGYA 5CISA 5EJZB 2P17A 2X5IB 4ZS3A 4RL7A 3T2TA 3VBHC 1DQ1A 2SBAA 1PIV1 5FZFA 3AP6A 5J96B 4MVTA 2XJQA 3KV4A 5FXVA 1COV1 4ARXA 4Z8BA 4BZ4A 2GC2A 4BQ4A 5HPOA 5CFDC 1AX0A 2P34A 2GC1A 4N7UA 1YRZA 4A7KA 1CPNA 4YGCA 3ZXAC 5EJ1B 3ACHA 3H1WA 3SHRA 4FPJA 1V6IA 4SBVA 4BU2A 4ZXKA 2Z4FA 4AEJA 4O7XA 3I59B 5K9YA 2JKBA 3I97A 4CTEA 2W9XA 2DURA 1LTEA 3SMHA 4EQVA 4ZZ5A 1RUD1 3U1XA 1TQ5A 2FMYA 2QQUA 3AM2A 3FHAA 5GLWA 1YQ8A 3H1YA 2ORZA 2WZR3 4ZZ8A 4QKDA 1ND3A 3S6PA 3KCYA 5FPZA 5E1RA 2J22A 3LDBA 1WCDJ 2J1AA 3DPRA 4WVZA 3WNOA 4LKEA 3ZYIB 1VBD1 3OTFA 4LQRA 4XIKA 4Y5SA 5EXOA 2Y8KA 4QPGB 4HSLA 1FNYA 3THCA 5F3EA 1F8VA 1QJX3 4QMAA 3WNPA 1UY0A 5IUQA 5IVCA 5E8AA 2VG9A 4GMP0 4OYUA 1I5PA 2RR11 3CNAA 2EIBA 3T4VA 2WWUA 4BQ5A 1W39A 3NNMA 1VAKA 4XCBA 1XSRA 3LIGA 3DN7A 4Y1UA 1XU2A 2VQUA 2AEZA 4S2HA 1GSLA 1UW8A 4YNIA 1W2AX 1EP0A 2XLGA 1F5FA 3HNMA 3HN3A 5FMBA 2CGPA 2ZKNA 4WM8A 2B9VA 2VZVA 4W50A 3ZMOA 4D7SA 4UFIA 2AR6A 3POIA 1LR5A 3VBFA 3ZR5A 1RUOA 3RJ2X 2JB4A 5FZ8A 4ASKA 4MGIE 5GKAC 1VBE1 1X9TA 2P2KA 3IIIA 4QU2A 5CA6A 4Q4Y2 1EAH2 2VQ0A 4AFDA 1QQP3 2W91A 4QWNA 3MLKA 3H3UA 1RINA 3POJA 4Y5TA 1LU1A 2VE1A 4YVSC 4DXSA 1XXNA 4GKXA 4K20A 2JD4A 3H1MA 4NIDA 4YW3A 1QMJA 1RHI1 1E5RA 1JYCA 2SLIA 2PTMA 1HX6A 4XIOA 3ACGA 3WDVA 1K5MB 1HB2A 2KM2A 4AF9A 3LIHA 4HVQA 1PZ9A 1O3SA 3VDAA 5FZDA 3RWKX 3MPBA 2XHKA 5DDJ1 5A3OA 2YDEA 3WP3A 1AYN1 3AZYA 2C9AA 1Q8PA 4P00B 4QPIB 3RZKA 1AVBA 1CAXB 1UF2C 1V9U3 3I59A 3NAPB 4UFHA 4XHXA 4R9AA 3O12A 2HWE1 3J8F2 4TXWA 4B1MA 4OI1A 3IDEA 3W5MA 1VBA2 4IXLA 2W46A 1JTZX 3GNEA 1S2BA 3ZN6B 4YZ5A 2WFF3 3OG2A 3LAGA 2R072 3LF7A 1C1LA 2P5BA 2VOKA 4RS5B 3RQ0A 5FV3A 1GUIA 3ZOIA 5A6YA 1FV3A 1PIV3 1ENQA 1POQA 4M4RA 2ZX2A 4UAPA 4QM9A 5EFUA 3PUIA 1K5JA 1V00A 5KR7A 1COV3 3AKQA 3WR0A 4CCJA 3LEGA 2WT1A 1Z0HA 5FYZA 3ZYRA 2BPA2 4D6QA 2XJPA 4FTEA 5CG8A 3DUIA 2ZGQA 5CU1A 4YPJA 1RUF1 2QTWB 4JKKA 5JSPA 1JYVA 4N8MA 2WT0A 3CL1A 1SG3A 3CMGA 4LA2A 5FMOL 3PL0A 5C9AA 1ZRFA 1SFPA 2WO2A 1HJGA 3N7LA 3KVBA 3DXTA 1OKQA 4XMIA 3BPZA 2IZWA 5A33B 4CEYA 2YUEA 4RN5A 2RM21 2FQPA 2YXSA 1XU1A 3LEIA 1AR71 2R061 1UOJA 4HFSA 2EICA 2G1MA 2JIJA 2X53S 1YO8A 1GP5A 5C4WC 2UYAA 1VBD3 4BXSV 1O59A 3PU3A 5FKBA 1LCLA 1NCRA 1FATA 1UD1A 1V6KA 2VZUA 2BVVA 3NL1A 4K9SA 2VBDA 5FYMA 3WW3A 3M3EA 5FY0A 1HQNA 1W8NA 1W9WA 2EIGA 3B01A 4FFIA 1SLLA 1ALYA 5A3NA 5AC91 4FSJA 2N7GA 2V4VA 2A1XA 1HRV2 2WNVC 2ZHKA 5F3IA 4H55A 5JR2A 2CSGA 3T1LA 4Y24A 2GNBA 3POEA 3ZIXA 5JSOA 2D5HA 2RR13 2DCYA 5CKMA 2ZCWA 4JDMA 4TLFA 4BQYA 1ZREA 1R093 2HWB1 3JCIA 1Q3EA 1K5MA 1R64A 4X8NA 2QJVA 4OUMA 5IVJA 5JPMB 1V6OA 2YC4A 2GMPA 2P6CA 5JXJA 1QWRA 3Q8CA 4QQ2A 3AVRA 4KGGA 4NOTA 4COUA 4R9DA 1GR3A 1MR5A 2VNRA 3POSA 3AP9A 4UFJA 3TN92 4AL9A 5AFBA 5F37A 1N1SA 2VW0A 4EE2A 2V5YA 1MZ6A 2D6MA 2PHRA 2XJUA 2X8KA 4KBBA 1PGW2 2B7YA 3AMPA 3HPNA 3ZFEA 1WCSA 4IV1C 1QDOA 2ENRA 3LPFA 5EJ3A 4UFLA 1VBE3 5H9RA 1QJU1 1F4HA 3U75A 1GNYA 1KJLA 5F5AA 3O1VA 1DG6A 2HJIA 4IEPA 4BMBA 1UNBA 4A7YA 5F6KA 2VECA 4LHLA 3ACFA 5ABJA 1RHI3 1L7QA 1HN0A 1GZWA 2CTVA 2I2SA 1HKDA 1CX4A 4WVMA 3AZZA 4D6SA 2R30A 3RZLA 3TNPB 2O1QA 4CDXB 4S2GA 1SDDB 1S0GA 2YBKA 3I2FA 1DQ6A 5DDJ3 1C4RA 1DZTA 3IT8A 1H4HA 1AYN3 1NA1A 2CDPA 2UU8A 4FAHA 3POGA 1VIWB 1D0GA 1O8PA 1ZBE2 1HIXA 3GJAA 3ZYGA 4QKFA 3ZR6A 2PA7A 5HV4A 1W8OA 5A7SA 1F9KA 3ZXLA 3EYPA 4NRMA 4B7KA 2LROA 1QJEA 4INDA 4OZOA 4CDWC 2ARAA 1MS5A 1WCQA 5F2WA 4ES8A 1Q56A 4CU7A 1XNKA 5FZOB 4M00A 1O91A 1OLMA 2PHTA 3H8UA 4K3UA 4XJ9A 5D8AB 5LY2A 5J36A 1NLRA 2NN8A 1PO21 4IV3A 1YNAA 3TEWA 5L19A 5JPNB 4S2DA 5FK8A 3LCPA 1W9SA 2PN5A 4AFAA 4K21A 3LEMA 1KS5A 3J9SA 2QQOA 1DQ0A 2IXHA 5JXGA 4I2OA 4IERA 1CONA 1UX6A 3IM0A 3U07A 1OFSA 5F5IA 2VMHA 1J3QA 2FDFA 4Q8KA 2YB7A 2WZR2 2ZGTA 4LOSA 2JDHA 4OZXA 1O5UA 1AHSA 1FPN1 3T0BA 2IXKA 4BQWA 2Q30A 5L73A 2NYYA 2YMZA 4BQ3A 2VGDA 4S2FA 4XAEA 3ORJA 3LA2A 5FPLA 3OF1A 1I3HA 4JDOA 2VVFA 1D0HA 2RM23 2BTVC 1RUE1 3FLRA 5DABA 1AR73 2R063 3AJZA 2JICA 1H6YA 1SLBA 1QJX2 2K2SA 4RYDA 5E89A 4AOCA 3FN9A 2V09A 5A7NA 3S30A 2GC3A 2GZWA 3OGGA 3TEYA 1U12A 4WM7A 2EXIA 3E6BA 1VLNA 4ZU4A 2XLAA 1MZFA 5C9AB 2VMDA 3PTYA 1W2OA 5AC93 2RS53 3WNLA 1ZRRA 1WW5A 2VTXJ 2ZGLA 4UFKA 4C1XA 5IAXA 1VAMA 4XQDA 1KDMA 4CEWB 4XF4A 4OQ9A 3T2QA 4AXOA 1JS9A 4XABA 3IAQA 3V64A 1NUKA 4DPNA 1F31A 3TOJA 1QXRA 3OYWA 4CDXA 4NIHA 4RQPC 5C4WB 1J84A 1SFYA 4A42A 3PDQA 1QQP2 2RMU1 4M3CB 4OI0A 1UZYA 4SLIA 1C1FA 1PVC1 3AMNA 1ND2C 3O0VA 4MGYE 3ZX7A 4CDUA 1Y9GA 1J3PA 4DUVA 3KF5A 4LK7A 1XC6A 5BNOA 3DV8A 2WNVB 1ULEA 2FCTA 3O0XA 5LEJA 4LEJA 2BGCA 3FJSA 1LHUA 1RUNA 5FZOA 1LHNA 5JZGC 1JH5A 4GALA 1UY2A 2WSVA 1OSGA 3BALA 4BQ1A 1QJU3 3B00A 4JHZA 4Q26A 5A3UA 1U0AA 4RD7A 3NWKA 3FHIB 3SKVA 3J7LA 5LATA 1V9U2 2AREA 1PVXA 2D97A 1SFNA 1XNCA 4OULA 2JG9C 2IXJA 3LGRA 4Z2AA 4QX3A 2PFWA 3DEMA 4NO4A 4Q4Y1 1EAH1 2BVBA 3MEPA 3RMXA 1OD3A 2WFF2 3L2YA 1W99A 3AXDA 3QH6A 4IV1B 3RI9A 3VZMA 2HH9A 4LBJA 2D6KA 4H3WA 1RUG3 3A21A 3ZLIA 2VMEA 4AI9A 2Z2SB 5T52A 4YFZA 1PIV2 5KBFA 1PZ8A 5LK5A 4Q0SA 4LO8A 3USSA 1COV2 3KHCA 4HKOA 4IEZA 3THDA 2ZBJA 4Q0UA 1JYTA 3O7OA 4CZSA 2ZMNA 3VD5A 2XQRA 2HYKA 3J26N 1PO23 2ET7A 4ZU7A 4QB2A 1IPJA 5H9SA 2WWSA 2VH9A 1CZTA 1UPSA 3UK9A 1CAVB 1KRIA 1OVPA 3VBOB 4NIGA 3LPGA 4IW3A 2JB8A 3KV9A 4NVPA 4BHPA 1NZCA 4N9HA 2MNGA 4I3PA 1RUD2 4JAAA 1C28A 1VALA 3OBRA 1UY1A 4HXCA 1OOPB 1AL0G 3N9MA 2GAUA 4CDWB 1JOBA 1GNZA 4CDQB 1FPN3 1GLHA 5JOYA 1FXZA 1XNAA 1U5ZA 2HWD2 2NQYA 5IAVA 2WZPP 3HBKA 4Y1YA 3ITQA 1SBEA 1W06A 3RSJA 1ENRA 5A32B 1GNHA 3VBUC 1P8JA 4PF1A 4OUSA 5C33A 1RUE3 3RYPA 4Q0PA 1DCSA 3J7MA 3AL5A 4CRQA 2FZ1A 2B4KA 2IWGB 1J3RA 2R16A 1D4M1 3MW2A 4YG3A 2VZTA 5GLVA 4UYBA 4BWOA 1TME1 2RR12 3BCWA 1HXS1 1ZA7A 3MF6A 1TMF1 3AKPA 2CDOA 5HXMA 3VV1A 4P5YA 2OYZA 3B9CA 3ZFGC 4IGQA 4XURA 4E4ZA 1U5IA 1PMIA 3MIFA 4OI2A 1L3JA 1MEC1 3FL7A 5C8CC 4WVVA 3WDWA 4MG2A 1QEXA 5EYXA 1O3TA 4LIUA 4XJWA 4I01A 1AX2A 2VW1A 1KDKA 3V0BA 1LOCA 2PQQA 1GMMA 1W2NA 3N9NA 5T50A 2Y33A 4JGZC 1ZZBA 4QU1A 3BPSA 3KMHA 4BYYA 5FZ3A 4D7TA 4EN6B 4ZHNA 3AP7A 1VBE2 4AEDA 5DAPA 3SH3A 1PO12 1UZVA 2WJSA 2WNUB 1PMHX 4L97A 2RMU3 4MGQA 1ND3C 4B4QA 1FYUA 4OHYA 3A4UA 3D6EA 4BLJA 1MQTC 4YWAA 4HZFA 3EBRA 3OUJA 5FTTC 4ATFA 2EAAA 4IUGA 3KT7A 3ABZA 2J1EA 3I49A 3GF6A 3J7HA 1YXWA 1VRH1 4YGDA 5L9RA 4XDPA 4EV0A 1OF3A 1Q8OA 4I09A 4UW4A 3Q8BA 2VUAA 1ZBA1 5JXIA 4HBNA 2VQAA 2YU1A 1RUI2 4LBLA 5FZLA 2GMEA 3BB6A 5LCWL 2DDUA 3TN91 4L99A 5F9TA 2A6WA 1ODNA 5JOWA 2WC2A 4RQPB 3H3LA 3POFA 2VCMA 1B35A 3W58A 3GHNA 1PGW1 5F1RA 1CAVA 4CUAA 4NIAA 5KWRA 1QY4A 1H8TA 3IZOA 5FPUA 5CNAA 2HWE2 2VZOA 2G9FA 2FCUA 5IFPA 2CAUA 4DUWA 1NCQC 4Q4Y3 1EAH3 2IVIB 4YZ3A 3BOPA 2ZMLA 2IFWA 2WUHA 3N35A 1Q8SA 5C3RA 1HQWA 3QLQA 2EF6A 4NHMA 4MYEA 4NRPA 3ETPA 1DLCA 3THTA 1ZRIA 1YEWA 2JWPA 3BKZA 1WMXA 1TG7A 5FK7A 3MW4A 3RZHA 3P6BA 4MX3A 5FPAA 3R6SA 4CUBA 1MVQA 3I3BA 2P3IA 2UYBA 5LBBA 1Y9QA 1A78A 1EPZA 1T6BX 1L7LA 3NRUA 3NV1A 4I02A 2JG9B 3FMGA 4XFIA 1DDLA 1PNGA 1UYXA 3EB7A 1AR91 1BLZA 1RUF2 1QU0A 5DZGA 3J8F3 2VULA 5FZAA 3I3MA 1G86A 3Q8EA 2BNNA 1DGWA 1VBA3 1S4CA 4G3YC 3OBTA 3TNQA 2OUHA 2DUQA 3POYA 4LBMA 4QD2A 3KCCA 1D4VB 3A22A 1Q8QA 4TN7A 5JMCA 3OY8B 2RM22 3D0JA 4FP2A 1A34A 3UKTA 3WV6A 2R062 2DF7A 4AGGA 1S0BA 3ZN4A 1G9CA 3WG1A 4IEXA 3J7NA 3R4UA 4UW5A 3ZSEA 3VD3A 1HV1A 5JWPA 1GWLA 2ARXA 2Y0OA 5C3PA 2WNUA 3SKJE 2JX9A 5KXBA 1WD3A 5AC92 2BFUL 2FD8A 4BA6A 4AR2A 1JZ3A 3GBWA 3LKJA 2OS2A 3VL9A 5BV6A 1HJFA 3AYAA 1LEDA 4CU6A 4YZ2A 2WQ8A 3CJIA 3VDDA 1J1TA 2F6BA 1TME3 5DAVA 4L92A 1HXS3 5EZWA 5I0UA 1TMF3 1JU4A 1PX4A 2HWB2 1W6OB 3KVAA 3WDTA 1VBB1 2ZACA 3POBA 2J1TA 1ULCA 5FP8A 3V56A 1ULPA 2BW8A 1YFWA 4PBOA 1T2XA 1ONAA 4K40A 2QZ2A 1MEC3 2RS31 2Y26A 3SC7X 3DCQA 3WDYA 5DUXA 1JHNA 4K8FA 1HDKA 4FPLA 4FAGA 1OKOA 2WS91 4BCUA 1NX9A 3O1PA 2BRTA 5FJHA 3ILFA 4CEYC 3K51A 4JGYA 1QJU2 1NYWA 4QPYA 4ZONA 5L36A 2R1BA 2VBPA 3ZFGB 2Q5TA 4AAXA 4XMAA 4ISRA 2I45A 4YM3A 1UU4A 5TSWA 4CP9B 5FFOC 5EYYA 3V65A 2CWMA 2OT7A 3MIDA 4LR4A 5FZIA 5T5LA 4DEVA 2J1UA 4YVWA 1VRH3 3RZJA 5FO7B 4I3GA 3WW4A 4CCNA 1V6NA 5A6QA 1ZBA3 2LM3A 4L8QA 5E16A 1WW7A 2YV8A 2UWCA 2VNVA 5F2SA 4W6WA 4XXPA 3H50A 4QX2A 3TN93 2XGXA 3ZFFA 5A70A 5ACA1 2EIEA 2DVBA 2QE3A 3CU7A 5BXXA 3SITA 5IWFA 4BLIA 2CWSA 1NLQA 1CR7A 4OMDA 5BNPC 3VKFC 3UV9A 3E5XA 3GGLA 1MQTB 3M70A 3FFQA 1W05A 4CUGA 4DNYA 1OFNA 1AR81 4LKFA 2PLV1 5FZGA 5FXXA 2HBUA 2ZEZA 4M01A 1BCXA 2RVAA 4QQPA 5LBCA 3ZDSA 3VKMA 1QXJA 1DGLA 3O1SA 3E6DA 1PO22 2PHXA 4AQSA 1RMU1 1TNRA 3ME2A 4YGEA 3ZFEC 1XOYA 1ULFA 1UN1A 1U5YA 3ZXEA 2DCJA 1ZZCA 2ZEYA 2ZGKA 3IKWA 4YW1A 5A3PA 3BTZA 1LODA 4EN0A 4XVHA 2VUCA 3GZAA 2R042 3MI8A 4MGZE 1W2UA 4U2AA 1NCQB 4ZKTB 1ZBE3 1LOEA 1SZBA 4A4AA 1AR93 2ATFA 2ZPXA 3ECQA 1FPN2 4AAPA 1NG0A 1UOGA 3S0MA 2BJSA 5CYYA 3FWEA 4AFBA 4XUQA 1A8MA 1JMUB 2BYVE 1KXGA 2EXHA 3CHXA 2XQXA 4IE0A 4QKNA 4XBLA 2WN3A 3AFGA 3O1OA 2YY1A 2WWJA 5GLTA 4GJYA 1RUE2 4XHBA 3AMQA 1MZEA 4QQOA 4LKSA 4Y20B 4FXKB 4H7MA 3WVJA 4E4SA 4ZS2A 3ZXGA 1QOSA 5FWEA 4Y5Z0 3W21A 1WGPA 4CE8A 3B69A 4H14A 1LOGA 2Y34A 3MLJA 4N43A 5GLZA 3TAYA 1MS4A 1K12A 2XJSA 3WP5A 2HEYF 1CAWA 5C7GA 2MPFA 5FYHA 1UMHA 4IV3C 4AHXA 2K0GA 1C8M1 4QKBA 3NO8A 4V2VA 3WF3A 2HWD1 3ST7A 3THPA 3ZMNA 4GWJA 2CGNA 1RUC1 2RE9A 1OXCA 3ZYBA 4EWDA 5F7UA 5L7OA 3O1UA 1OUSA 3DXUA 4I0AA 4PLNA 1WUVA 2AUYA 1VBB3 2ZMKA 4BQXA 4IDZA 4QM8A 4BXFA 4YG6A 5FY1A 1W9TA 1DQ5A 1DLLA 1RJ8A 4MXVA 3HMYA 4QPWA 2RS33 2RMU2 5FY7A 2YGLA 3WNNA 2D6OX 4XDOA 1PVC2 2JG8A 3MF9A 4GH4C 1X82A 3OSDA 1PZ7A 3VKNA 1W6NB 2WS93 1IS5A 5CFCB 1RB8G 4XACA 3T4HB 1NKGA 4XJAA 2FCVA 4E2QA 4JDNA 3WINE 2XWBB 4LK6A 2XR4A 1EUUA 1IG3A 3BIEA 1IGOA 1BVVA 4LUMA 2OW4A 2X10A 1BHGA 3UGFA 1X50A 2EA7A 4W4ZA 3V0AA 4PF5A 1QKQA 4KMQA 5CADA 4RGAA 5GLUA 4PDWC 2R32A 1XYOA 2BEOA 4ARYA 3A0NA 2J1SA 4LO4B 4WM7C 1JZ8A 2YC2A 2B42B 4N9IA 1WLWA 2VAUA 1PO11 3ZYPA 3C2UA 5BPXA 1JZ7A 3GYDA 3LSDA 2BERA 3FC0A 1ZZ8A 3VD4A 1O8SA 1SLTA 2DBIA 2X5IA 4LA3A 1CESA 1SLAA 4FO9A 4P14A 3INAA 3KWVA 4J1XA 1LOAA 2CYFA 4NHKA 4P9JA 1XJAA 2QQLA 3TB0A 1GWKA 5ACA3 1LB2A 1F15A 1TE1B 2J42A 2W08A 4LO7A 3OD4A 5F5CA 2YHJA 1UYYA 3E1F1 5A1FA 4KWLA 3ZO0B 1RUI1 1QJFA 3WT3A 1GZTA 5K4LA 2ZHLA 3NV2A 4LHSA 4DZGA 1AR83 1YUDA 1QH6A 2D43A 2RDQA 4ISQA 2JE7A 2QFEA 4DXTA 1X33A 2PHLA 4PQ9A 1GV9A 1OURA 3MHZA 2NMNA 4ATEA 1AR61 4YARA 4Y22B 4COWA 1MVEA 1REDA 2D40A 4IGPA 1KFUL 5D1IA 5BNOC 2E53A 5EP9A 3NJXA 4V1PA 4Y4YA 2YFUA 4XFHA 1KD7A 4HG6B 4Q0QA 1W6QB 4QX5A 1XE0A 1UCXA 5C8WA 3ALQA 4FOYA 1R1ZA 2FDIA 1J59A 4RSUA 3MFAA 1UPIA 4Z82A 4Q0VA 3WF0A 1WLCA 4IEVA 5FPVA 2BNMA 1VMFA 1H2NA 3R4DB 2RHPA 1O3QA 1ASJ1 1HW5A 3LFMA 4GZ9A 4QPGA 1G9BA 2VVEA 3B9IA 3VBSC 2B9UA 3LOIA 4AYUA 3RGBA 2D3PA 5FY4A 2W94A 4ONUA 3HR9A 3SLIA 1G7YA 4N53B 3S7IA 3OEAA 2ZZQA 1D4M2 2FHRA 3MUZ1 3I2DA 4XUNA 1TME2 4X6QB 1HXS2 1YFYA 1M4WA 1TMF2 2UURA 2ZJCA 3MW3A 3CZUA 5LRRA 3UGGA 3VBHB 1RUD3 4C8DA 5KXCA 2D6NA 3S5QA 4C0HA 5L9VA 1HLCA 1EV11 4EJRA 4J25A 2FDHA 1MEC2 4PCRA 1BKZA 1OUXA 3SISA 4PQQA 1C8M3 5CFDB 2AYHA 3EQEA 3RJRA 3BOWA 2HWD3 3FX3A 1SBDA 3NJVA 1UU5A 1I6XA 2CU5A 4CCKA 1OPOA 1HB4A 1XB9A 2L9LA 1UOFA 4FVVA 4A6OA 5JDBA 2E32A 1BBT2 5KC6A 3OPTA 4WBBA 2JDAA 4KWKA 5J1XA 3ZYHA 4CP1A 4DMIA 1M06G 1Z78A 1ENXA 3VDBA 4L0PA 4GWIA 4ORFA 4B4PA 4YSFA 3P3PA 4MZUA 1VRH2 3MFCA 1Y9MA 4QDRA 3BVCA 4MLOA 4NWVA 3ZN5A 1ZBA2 3K4AA 4FPKA 5C71A 1BK0A 2F4PA 1WA4A 3DYOA 3LA7A 4FQ4A 4QPIA 4Y22A 1CAXA 5JI7A 1PK6C 5A7WB 4FPGA 2BBAA 3NAPA 5FBJA 1CJDA 2VUDA 1IQDC 1FT9A 4YZ4A 2C1FA 3LDRA 3T09A 3ZN6A 5HBAA 1W6QA 4FPOB 4UBHA 4TYSA 4GH4B 3P3NA 1POV0 3ES1A 4YGBA 3LZZA 4OMCA 2W0XA 3VBRC 4C91A 1PO13 4LIVA 4JV4A 5FZMA 1TEIA 4FBFA 5FXWA 2FZ2A 2ZABA 4RS5A 2PHDA 1UX7A 1GICA 3NW4A 4DS0A 2KA3A 3IB3A 2WKKA 4LKDA 2ZS6B 4R9BA 4UW3A 3KV5A 2J1VA 1R1A1 2JDPA 1XYPA 1B09A 2TNFA 2VC9A 4RGGA 5L9BA 5HCAA 4HN1A 1RUI3 1NE6A 2ZGSA 4CU8A 1OPMA 5J37A 4GQ7A 4P9WA 3L2HA 4AEDC 4PDWB 5DZEA 1LENA 4FOVA 4NUBA 5FZ6A 2VCCA 2DBNA 3I3QA 4A3XA 1AR63 3I2KA 4YW5A 2BP6A 3GCXA 3OOXA 2ZGPA 1LOFA 4NIIA 3SEPA 4HL0A 4D8MA 3UESA 3MV11 5DAWA 1AR92 5A3LA 3BTYA 2F4LA 2HWE3 2RS11 5I93A 4GJZA 5A33A 1CWPA 4LPLA 5DQ0A 4YVSB 2RDNA 2ARCA 2D3SA 4FP3A 3JQWA 3USUB 3M2MA 5FYIA 4XF0A 4CA9A 1S0EA 2E31A 5DPNA 4LE3A 3WP4A 1PX3A 3AYDA 1YJKA 5CFDA 4AGVA 4QB6A 4E9KA 1GQPA 3WSOA 1UOBA 3VZJA 1VPHA 2A71A 1H8TC 4QQHA 5FQ0B 1LRHA 1ASJ3 3I2IA 4Q29A 1WKYA 4F7ZA 3VHOA 2A70A 1QDCA 3MIHA 4J1WA 1SMVA 2BUKA 4XJUA 1I9RA 4QT6A 3FLPA 2JD9A 2R041 5F6LB 1A3KA 3OBZA 2D5FA 3RPQA 3KV6A 1RUF3 2ZEXA 5DN2A 4DQAA 2ET1A 2VXRA 2W92A 2WIIB 2ZX4A 3M8LA 4X6RB 1NQDA 4L11A 3KF3A 4Q1PA 2AEYA 3M3OA 4W8JA 1VBB2 3PUSA 1HB3A 1VP6A 2VCAA 1NOVA 5FIXA 1OA3A 2MHFA 3U10A 1EV13 2B5HA 2O0OA 1W3XA 2BZDA 2EIDA 2FDJA 2RS32 3EO6A 5IYYA 1LKNA 3VBSB 2UY8A 1Z7S1 3URFA 2WS92 1DHKB 3CQOA 2QDNA 3N9QA 1GQHA 2PHUA 4JC1A 4XTPA 1IKPA 1D2QA 2A5ZA 4PHZA 3W20A 1G9DA 1EYBA 4JCKA 2WNEA 4DO0A 4NHXA 1W3VA 3HWJA 4D0QA 4MGTA 2JEMA 3RRDA 3OEBA 2C5DA 3M4FA 4AHWA 4PJYA 3GCWA 5BY5A 1AL21 4W6YA 4NHLA 2EVXA 2HWB3 1D2SA 4YW6A 5DAQA 2WQZC 5FOBB 3HQUA 3PJYA 4KWUA 2RDRA 4QB1A 5EPAA 1T6GC 3H42B 5LW9A 4AWDA 1IPSA 5C3SA 1YIPA 5K0UC 1O4YA 1GP6A 2VZ3A 1YI9A 2A6ZA 3N9OA 1YYNA 4HPKB 3F2ZA 3N7KA 3OD0A 4QHBA 5BNNC 4CCMA 5ACA2 3ZYFA 1MPXA 1QIQA 3Q9OA 4IE4A 4Z2WA 2Y6JA 5IFTA 2C9KA 3WNXA 2W2IA 4YVSA 3Q8AA 1W03A 5D8AA 3WG4A 1AR82 4XQ4A 3WLUA 4AHYA 1XSQA 2PLV2 1CZVA 3PLQA 3WDXA 4O9EA 1QH7A 4NE9A 3WDUA 3IDCB 1QXPA 1H1AA 1RMU2 3GM8A 4MUVA 4MV2A 1R1A3 1OH4A 2OA2A 2YBPA 3P5BA 4HKLA 3SEEA 1UU6A 1WWYA 3NNLA 1VE0A 3EHKA 2D6PA 4MH0E 5JAXA 5T54A 4AVVA 3NJZA 1CVNA 2PYTA 4P9LA 3SH5A 4JKMA 1C5HA 2H6CA 2Y60A 3C7GA 3AKSA 1E5HA 1S55A 4BOWA 2CY6A 4XXAA 2Q1ZB 1BQPA 1E5SA 2QQJA 2Y0IA 4NPMA 3AKTA 4AW7A 2BWAA 2UWAA 2X05A 1BMV2 1JUHA 3NNGA 3PVBB 1KJRA 3VDCA 1Y3TA 3FE5A 2WAAA 4GB31 4K6BA 1ZZ6A 1ACCA 2BOJA 1JODA 3N7MA 3Q8FA 3S57A 2Y38A 1WD4A 3RYRA 5LA9A 1DGRA 3WF2A 1RL3A 3AZXA 1K42A 1AYM1 3VN4A 4LULA 5J7MA 1WMDA 1ZM1A 1DYOA 1SLCA 3HBZA 3HQRA 4D94A 4IL7A 2WYFA 1RC6A 1YLLA 4ET7A 3K2OA 4GWMA 4XFGA 2W52A 1XNTA 3CO2A 4UF0B 4BB3A 3VZKA 5JXHA 3VHNA 2R043 4LUKA 1WMEA 4P5HA 4KNCA 4RFT0 3DKQA 3I7DA 2ZX3A 4YYOA 3UGHA 4AE2A 1TZOA 3FHQA 2W95A 4CEWA 5IHRA 3NJYA 1C8M2 1UKGA 1W04A 2EXJA 2IXLA 3HJRA 3NNJA 4XUPA 2C24A 2C26A 4AFMA 2VOWA 1RUC2 4ZY9A 1WCKA 4CSWA 3T0DA 3TBDA 5C4WA 4AVAA 3QACA 3AFKA 1JOJA 2VOTA 3KGZA 3OPZA 4M3CA 4RR3C 2P37A 4R8HA 5FZ0A 1ST8A 2E7AA 4HPKA 1GOHA 2WO3A 3TEZA 3CEWA 2VO5A 4OHVA 2WNVA 2VTFA 1OMIA 3GBGA 3BUCA 1Z7S3 4IESA 5A1AA 3BTXA 4AEKA 1KQRA 2Z79A 4YW2A 2EAKA 4HANA 2VOXA 3AYCA 4LBQB 3B7MA 4HSJA 3WG3A 3F95A 3DYPA 2UWBA 5FYYA 4QX1A 1AXYA 1N3PA 1W6MB 4JRAA 4LTAA 5C6CA 1AX1A 1XE8A 5J98B 4DINB 1IG0A 5HV0A 3ROUA 2VXJA 1BEV2 2OQ6A 1GP4A 3SCHA 1AL23 2ADEA 3PUAA 1CN1A 2JXAA 3KSCA 5T55A 4AI1A 2HYXA 5LBEA 5G05L 4AHZA 3BGAA 3MO4A 1BBT1 2VNOA 4N43C 3VZNA 3RZGA 4IV1A 1H1MA 1F5JA 2HWC1 4GMP1 2D3RA 2E26A 1OQDA 1PVC3 2B46X 3KHBA 3N9PA 4KL1A 4MGKE 1V70A 4NPRA 4XEZA 3DPRC 1FX5A 5DXDA 1XRUA 5FP7A 3WQ1A 3H9AA 4OLLA 3ZXDA 1C8NA 3OB8A 2XJTA 1PNFA 4PT6A 4BPZA 1SACA 4ITCA 1EPWA 4UFMA 3JB4C 2A6XA 2JDMA 1GOFA 1WMFA 4XPVA 1SDWA 4XTMA 5I0TA 3JZVA 3UKNA 4A3ZA 3GHMA 2ES3A 1U5XA 2IVJA 1AR62 2XBO1 3OUHA 3MPPG 3VGIA 3UJQA 1BYHA 3VBOA 5K0UB 3C7HA 1H0BA 5IW0A 3HVDA 1ND2B 3ZXJA 2PMWB 1LHOA 2XL9A 3WHTA 3HOBA 3WUDA 5BNNB 1YHFA 3FUOA 1Q8VA 5F5QA 1F4AA 1OOPA 2QQVA 1G9FA 3PURA 5D21A 3MUY1 5CB7A 1IQAA 4CDWA 2Z5WA 5KXDA 5I0RA 4CDQA 4PI0A 5JZGB 2VZPA 1CJPA 4MXWB 4QX8A 4WM8C 1ZA4A 2XUEA 1GBGA 4DUXA 1BXHA 1JYWA 5GZEA 1OD5A 3VBFC 4Z07A 2WO1A 3KT4A 3OGVA 1L7RA 4CCOA 5A32A 1ASJ2 3LWCA 3LSEA 4XW3A 1QOTA 2G9ZA 1VBC1 5FUIA 2XXZA 2WINB 4GB33 2VY0A 3I54A 4LLFA 2AH2A 1DIWA 2XOMA 3ATGA 4B1LA 3A23A 5IVFA 2I74A 2VNGA 2NLRA 2DWRA 2PXJA 4UXAA 5FYCA 1I1EA 1H9WA 2ARBA 4KWJA 1IOAA 1IS4A 5HCFA 2AC1A 4KG8A 2BV4A 3W9AA 3IPVB 3O1MA 2RV9A 2MEV1 1O5LA 1E57A 4KU8A 5KHHA 1ULOA 4UI9L 2Y6HA 1EV12 4JVAA 4P9GA 1UQXA 3BU7A 1QOOA 3HNYM 4HVRA 3WEZA 1H6XA 1S0IA 2HLEA 4OVEA 4Y1VA 2AACA 1UY4A 4JQTA 4LNVA 1RUH1 4ZU5A 4BQ2A 1GQGA 3WY6A 2ZGMA 3PVNA 4P9YA 2WR9A 1URXA 2OUJA 1MS9A 2EXKA 4FQZA 1VB4A 3E97A 1W6PB 1PGL2 3FFZA 3AB0A 1SPPB 5LB6A 4NJ4A 4WVWA 5IVBA 3UNPA 2VBBA 3ZVXA 1OQ1A 4XJZA 5M0TA 3J4UH 4YM2A 3RDIA 2WYSA 5J48A 1D4M3 4OQ8A 3MZHA 1NXMA 5IK7A 4ZPIA 2VZRA 2Q8DA 3VUOA 4QPGC 5IK8A 3JBG1 4OUEA 2QBXA 3ZIWA 2RJKA 2VCBA 3AL6A 3C7OA 2OQ7A 1XQNA 2P1BA 4AQ2A 2XDVA 1FV2A 2IUWA 4RQPA 4LBKA 3VBUB 1BZWA 4Q4V1 3WNMA 1GOGA 1NY71 4IETA 5FKCA 3E5UA 4CCDA 4RR3B 5C9AC 5K7PA 5IVYA 4JX0A 3I2JA 1ND2A 4NR1A 3QCWA 2VZSA 5SV5A 2WO7A 4AVCA 4GXLA 3KGLA 4W65A 1BBT3 1AXKA 1S0JA 3ZM8A 1YFXA 2GP3A 1QGLA 2HWC3 2PQSA 3BN6A 3GXUA 1PMJX 4GMP3 5A6ZA 2Y6FA 4IE7A 5C5UA 1CPMA 2WRAA 1V6MA 4XQWA 4E4DX 1NAEA 2O8QA 4PLMA 5C8CB 1NCRC 5SV8A 3PIGA 5E88A 4BDVB 1YQ6A 1R1A2 1GU3A 3HQXA 2XH6A 4FFGA 5JOXA 5FMOS 4E8DA 1WBFA 5CKQA 1W9YA 2JG9A 4CXYA 1H2LA 2VM9A 4JGZB 5G04L 5GM0A 1CZSA 2Y6LA 4C0BA 3MYXA 5KC5A 3KQ4B 1JW6A 2Q4SA 5EHDA 2DYCA 1POV1 3AZWA 1ND3B 4IEOA 5FUPA 3BODA 2RS12 1RGSA 1K5MC 4XBNA 3ES4A 3IPVA 4BIFA 4D69A 2VQTA 3EMRA 4CCLA 3OY8A 3POWA 2VW2A 1SEFA 3FLTA 1OF4A 1MS0A 1I5ZA 2QCSB 4CVUA 1A8DA 2VUJA 3AP5A 2W39A 4JKLA 3DYMA 4E2SA 4IGOA 1CD3G 2YBSA 3UL2A 5GJ6A 1OLQA 2ZHNA 3N9LA 1S2KA 3AZVA 3T30A 4CP2A 1H2MA 3IN9A 3KS7A 5J09A 4AFCA 4QX7A 1LOBA 1RYYA 3B93A 1X8EA 3UT0A 1UXZA 1VBC3 2JE9A 3DF0A 3RZMA 2GMMA 1SPPA 2ZX1A 3IWZA 3T0AA 3WNKA 4DY3A 3ENRA 4DXRA 1O3RA 1WLDA 1KITA 1W8TA 4XAAA 3WP6A 1VAVA 2HEVF 4KG0A 5IT6A 2KR2A 4IEYA 1DQ2A 1OVSA 2V4AA 4B8EA 3QBQA 2TBVA 3IDBB 5ABJC 5JUVA 2AENA 1W6OA 1XBFA 2NPIA 3TRSB 1QF3A 1BMV1 4C90A 4U36A 2ZGNA 2W47A 2MEV3 2ZGOA 3VBFB 2W3JA 2PAKA 4OHWA 1CIYA 3AYEA 3RFRA 2ZTNA 4M4PA 3ASIA 3IDAA 2Q1FA 1HQLA 3LDKA 3VBUA 1NA1C 1N1VA 3JUUA 5JI9A 2DVGA 3MGUA 1ZRDA 2IC1A 5D2AA 2EALA 4TWTA 2V72A 4TTGA 1RUH3 1Z7S2 1VMHA 2WZEA 2ID4A 2QDRA 2HBTA 3NSTA 5FZBA 3UKVA 1WW4A 2HWF2 2IXCA 4B7EA 5FMDA 2YC0A 3VKLA 4URAA 3ZFGA 3FZ3A 2A75A 1C57A 1G8WA 3H8OA 3PTRB 4K7JA 1Q43A 3B02A 2J7MA 2ZHMA 4CP9A 2CHHA 3WW2A 5C8CA 2QUOA 1QNWA 4FT8A 1AL22 4XILA 1O4TA 4K8RB 4KU7A 1YC61 4MADA 3B3QE 3JBG3 1MZ5A 1IS6A 2AGSA 2WA4A 5C70A 2JECA 1H30A 3AK0A 4HLTA 1DQ4A 1JN2P 2LS6A 4XF9A 4QAWA 3PVOA 4JGZA 4YM0A 3VD7A 3ZSJA 2QZ3A 5A3TA 1OH3A 1H9PA 3CDZB 4GD4A 5FDBA 3MICA 4Q4V3 3ILRA 4MOAA 4HK8A 1YFUA 2PAMA 2D93A 3K4ZA 3E5QA 5FYSA 3M3IA 4EZHA 4AI3A 1UL9A 1KS4A 1MQTA 3GZUC 1W28A 5GZDA 2VPVA 5DUVA 3WD5A 4CXWA 4COYA 2QQNA 1JOPA 4R4XA 4BISA 2BGPA 2Q8EA 2FMDA 1CIWA 4YLZA 5T5OA 2JIGA 1BEV1 2JDZA 5FZKA 1QJY2 1N3OA 3PVEA 2A3WA 4XETA 4O9GA 5FBZA 5FZ4A 4X8PA 2A3YA 2XG3A 2W68A 4Q4X1 4C1WA 2PAEA 4YZ1A 3PUHA 3UJOA 4Q5OA 1NXD1 5FZHA 4XFBA 1UYZA 4CCEA 1R091 2CNAA 1DZRA 2GN7A 1DFQA 1F35A 2RJLA 3JD71 4MHUA 4AK3A 5C3QA 1NCQA 3M7AA 2P3KA 3LEKA 4ZXEA 3OBAA 3T2OA 4CEYB 4P9IA 1US3A 2RDSA 4UOJA 5JIAA 3IAPA 5FAXA 1N47A 1POV3 2C4XA 3KQRA 1RVF1 1RUJ1 2YROA 4EN8B 4KBZA 4CCCA 3PU8A 1ZNPA 4AQTA 4CDXC 2P6HA 4CYDA 2PLV3 3U37A 1NCRB 4GB32 5FZ1A 5LA0A 1E5IA 2OPWA 4Y20A 3RS6A 1R081 1X36A 4RHV2 3VHRA 4CDUC 3AVSA 5EIYB 2BBVA 1RMU3 2JKXA 3ZKUA 1HRI1 4EYUA 1AYM2 4RGKA 1RXFA 3AMHA 5A6XA 2DFCA 3LA3A 1O4ZA 2JDYA 1AJOA 4Y1XA 3ON7A 5D8AC 2DVFA 3SCGA 3NV4A 5F39A 2XB6C 1AXZA 1UMIA 5AFEA 4UT5A 2I07B 5BNPB 4BE3A 4KGQA 4NHYA 5T3NA 3I8TA 1JI6A 4XYXA 1F2NA 4KQ7A 2OPKA 3D3AA 4DRRA 2Z42A 2E33A 2WSUA 4COZA 2ZAAA 4CU9A 1V6JA 1W0PA 5JOZA 4QHZA 2Z69A 1Y7BA 4B3NA 1YQ2A 3ZFEB 2VTXA 4GIQA 4IEUA 4I0WB 1DF0A 2G4IA 1ZVFA 3S5AA 3IMNA 4F8AA 2VOVA 5FYBA 2XL7A 1JUIA 4CPBD 4R52A 2KXLA 1W6NA 5F32A 1OLME 1LGCA 2GN3A 1WZXA 2WQ4A 1FMD2 1IZ3A 1VR3A 2Q0AA 1X8MA 3DKWA 4XBQA 5DZFA 5CFCA 5DG2A 3PMSA 4K1ZA 5A7OA 1OI6A 1VMJA 3MBWA 3HD8B 2V73A 2VL4A 5ABJB 1GZWB 5AVAA 5KHIA 2WDBA 4WVMB 2Y64A 2QVSB 4BM8A 4LOTA 4NROA 1RUC3 2VJXA 3OUIA 3B5LB 5IATA 3MIBA 4A7ZA 1NA1B 3WF4A 1S1AA 1FOD1 2ZGUA 3OCPA 2YZ4A 5CBLA 1PGL1 2DFBA 3ACIA 4MO3M 1OT5A 2FDKA 5FPBA 2HWC2 3ZKYA 4E2GA 5LA1A 3JQXA 3O14A 3SXWA 1LHWA 5BYNA 4CEWC 1K3IA 3M1HA 2OIIA 3RG0A 2ZKLA 2W87A 4E8CA 2XLFA 5DUWA 1A6CA 2XVLA 4HKWA 3NKTA 4IV3B 5FLHA 5B4XA 2E63A 1CAUB 1ZZ9A 2C6SA 4Y4RA 3DGTA 5FYUA 2LALA 1LULA 5FXZA 4A41A 3U0ZA 4HVOA 4CP0A 3E6CC 2WN2A 4PIZA 2R0HA 1BEV3 2RS51 3KD4A 2GNMA 4QHOA 3UETA 1G9AA 2XBO2 1W0OA 1X7NA 4PBPA 1DYPA 5ISLA 4JHTA 1UIJA 1V6LA 5DG1A 1S0DA 2W1QA 4Q4X3 3ETQA 2DCZA 3CJXA 1LESA 3LQCA 3NQHA 2VD7A 2OXBA 1O6UA 3JD73 3TYJA 5BNPA 3ACLA 2PELA 3WOGA 1CX1A 2JE8A 3C7EA 4AI2A 4YM1A 2AZ5A 4NRQA 4Q4W1 3U11A 5IK4A 3TWIA 5FMCA 3VKOA 4MGSA 3ELNA 4GWNA 1RVF3 1RUJ3 2LRPA 1TNFA 4FCAA 3N4MA 1AJKA 2KD7A 3N7JA 3PIJA 1VBC2 4D3WA 3AKRA 4FFFA 4Q8LA 1UZWA 2Q8CA 1HV0A 1UZZA 4PI2A 1OBNA 4WM7B 3VD9A 3K46A 4M0HA 3FBMA 4P08A 5A3MA 1REFA 1R083 4I0BA 1ULDA 4N53A 1YCIA 2CAVA 2GSYA 1APNA 3JXSA 3KM5A 3CLPA 4AVSA 1W90A 2WFPA 1HRI3 4HMZA 2BGOA 1W8FA 1GKBA 4HK9A 2W1WA 3VZLA 3VB9A 3VBHA 1SCSA 1CQ9A 5LY1A 2PHFA 3D4KA 4XF1A 2W1UA 1UO9A 2MEV2 1GZCA 1ZZ7A 3OYWB 2QQKA 4ES9A 4LITA 1YIFA 1B35C 3IMMA 1YJLA 4DOUA 3VL8A 3JU9A 2CGOA 2LTNA 3RYKA 5IJRA 3VBOC 4A2UA 4QGLA 2GH2A 2HKXA 1RUH2 2XWJB 3ZSKA 4CDUB 1RUG1 1STMA 1GWMA 4BK5A 1LHVA 5B4NA 5IVVA 2JDNA 5CIRA 4TSVA 5BNOB 2TEPA 1OOPC 4LO6B 4GA9A 1RTVA 5DUUA 1LU2A 4DRVA 2P3JA 4LMFA 4CDQC 4AGRA 5FOJB 2NZ9A 2V5DA 4OHXA 4Q27A 3B94A 2DVAA 4XDQA 3RZZA 1ZYBA 4EZ4A 4H2AA 5I8TA 2QQPA 1QNYA 3ZXKA 1CAUA 2W5FA 3DECA 1XYNA 3JBG2 2XPJA 2XVGA 4QDSA 4F3JA 2GNDA 2DTWA 4AG4A 1HB1A 3R05A 3N3HA 2B45X 4MSVA 5E6HA 5A7WA 4OFGA 5C5TA 3IIAA 2E9QA 2GDFA 5JIUA 5KHKA 2DVDA 3H7JA 3X29B 1J58A 4Q4V2 3C8XA 1NY72 1W8UA 4RFRB 4LLOA 4META 5GZFA 3H3ZA 3PUQA 4E4HA 5CEHA 4L2NA 2ZZJA 4GH4A 2BWCA 1JZ4A 1MS1A 2IXIA 4QQLA 1FOD3 4EROA 2HWF1 3WQ7A 2BQPA 5I8SA 3O0WA 2NM1A 4LBQD 3AMMA 2ILMA 3M3CA 3PMEA 1H1IA 4I30A 1VRBA 2DUOA 1S0CA 4XFAA 5JLVA 4FPYA 3ZXFA 5H9QA 4M3CE 3WF1A 2X09A 5FLIA 1JU3A 3GJBA 2VU9A 4HETA 3D8CA 3GALA 4JTNA 4PIYA 1OC1A 3PNAA 4YRDA 3CBNA 4PDWA 2WNUC 1DGRN 4G4FA 1W9FA 2VZ1A 2P4EA 5LWBA 3O1RA 1LNSA 2QQWA 4ASLA 4XOGA 5KHJA 3PHMA 4L9BA 2G9GA 4W6XA 2WT2A 3CJIC 3HIFA 3O5SA 5FWJA 3VDDC 1YQCA 3WW1A 3AX4A 2DV9A 3D0SA 5ERLA 3U4SA 2J1RA 3USUA 5I91A 4LE4A 4LBOA 1QJZA 2QKDA 1Y4WA 2ZOEB 3AJYA 2Q1MA 2E7TA 1S2EA 3JB8A 3W5NA 3C3VA 1GFF2 3W59A 5GZGA 2GALA 4QXHA 2H0VA 1QJY1 5FO9B 2VMIA 1IKQA 1UYPA 5F3CA 4Q4W3 5FO8B 2JJ6A 4QDQA 5FQ0A 1NE4A 2BFUS 2YGMA 3CZJA 3FBYA 3LE0A 5GALA 2OVUA 2O8OA 1PK6B 2GC0A 1D7PM 4JQRA 4FTSA 1J83A 3K75B 3EJKA 2OZ6A 3BU0A 2XJRA 4M3CF 1NQJA 1WA6X 2B39A 4JGYC 1DU3D 2XKOA 2YG0A 3T1MA 4AZZA 4CPBA 1XPWA 2D6LX 1PHMA 2JDUA 4Z1VA 3VBRB 1JZ5A 2A3XA 2RJ2A 2A73B 3KCXA 4AVBA 4LBNA 1OLRA 2TUNA 2RS13 2XKPA 4NPLA 4YVWC 4AI0A 4PLOA 4FPFA 4R9CA 3HEIA 2ZGRA 2BU9A 2DUPA 2BDRA 2IFRA 1ODMA 4FOQA 3V0BB 2F17A 5A1LA 5CG9A 3NVCA 3A0KA 4RHV1 4IEWA 1IHMA 5FRAA 3ZFFC 3VBSA 4V2WA 3SH4A 4IE5A 4JRLA 5FLJA 4BMEA 4AEDB 4EWEA 3G6JB 4QXBA 3GBFA 4HT1T 1RXGA 1YI7A 5FY9A 3ZYJB 3MV01 3DL3A 3P1IA 2OZJA 3VHPA 4BIOA 2QQMA 4O65A 4IQPA 5T5JA 4HONA 5IK5A 1MS8A 2A6VA 3ZSMA 1LECA 3LOBA 4HN0A 5EQUA 1LAJA 5FP9A 4LO5B 3KB5A 2YPDA 4JZRA 5FP4A 1W0NA 2JENA 4URTA 2GNTA 4MHRA 5LZ6A 2XJVA 5F8PA 3I4IA 5EWSA 2LW8A 1AF9A 1REEA 4XUOA 3MIEA 5ANQA 5A7QA 4Z92B 2GU9A 3RNSA 4FPCA 3D5OA 3J8F1 4XJ8A 5CKNA 3I3EA 1B35B 4YG0A 4LHKA 1OA4A 1VBA1 2GP5A 4DY5A 4TLGA 1H8TB 1XNDA 2A6YA 2Q8OA 2XUMA 2RG4A 1ZX5A 2WL1A 3AP4A 2NP0A 4Y3OA 1JYXA 2R071 1FMD1 5DMYA 3I2HA 2E6VA 5JMOA 1ZRCA 2DTYA 3GZTB 3KZ4C 3NNFA 2R49A 5HXVA 2R7EB 1JHJA 4DFSA 2YYOA 2ERFA 1YQ5A 4AQ6A 3WQ0A 2D98A 1VBD2 2HWF3 4XFFA 2ZA9A 2H0BA 2VZQA 1JBCA 1XNBA 5LASA 2D7FA 4FPEA 3SCFA 4M0NA 4B29A 4CUCA 5BUVA 1OA2A 4QXKA 3T2PA 1JYIA 4AI8A 1PK6A 1RJ7A 1WBLA 1N1YA 3NV3A 4YFWA 2R0FA 2XMLA 4J6GA 4G9SB 4QGMA 3RWNA 4NMIA 4Q4X2 5JR7B 3I3DA 5IVEA 2CV6A 3EXUA 2D44A 3K77A 5LRSA 1R092 3JD72 2YU2A 3FUQA 2DCKA 2DU0A 4NWWA 4EN7B 3VBRA 5FZCA 1GZ9A 5GZCA 5KHGA 1UY3A 5A3WA 3K4DA 4EWAA 3OPWA 2WABA 1QHDA 4FFHA 2VMFA 2OX0A 3R4SA 4D6RA 5FPXA 4FOWA 1DBNA 1RUJ2 1RVF2 3KT1A 5L7OC 1BK1A 2PHWA 4R4ZA 2WNOA 4FI9A 3HAGA 2K9ZA 4XC9A 5DAXA 3VLBB 3CKHA 2CL2A 1TVGA 2C0ZA 1ULGA 3NKGA 4P9XA 1SQ4A 2UY9A 4KH9A 1ENSA 2XVKA 3QH7A 5JSRA 1EUTA 2JG8C 2QNKA 4XE9A 1R082 1HRV1 1GANA 1QJY3 5EV7A 1SCRA 5FY5A 5AVPA 5CZKA 4BH9A 1W8ZA 2ZXQA 2B8MA 1HRI2 1UKRA 4Y1ZA 1UMZA 2GH8A 3LFIA 2A7AA
chains in the Genus database with same CATH topology
3WXPA 5LK7B 2X29A 1AUYA 3CJIB 3OJBA 4WZFA 3VDDB 1RHI2 1LEMA 1EY2A 4EN9B 1O7FA 3LB9A 2WA3A 4PIXA 5DDJ2 5LEKA 4JTOA 1AYN2 2YPJA 1OQEA 1VJ2A 3HT2A 1RIRA 4RHV3 2X5IC 4E27A 3VZOA 4F83A 5B2GB 1NLSA 3RI8A 3PJQA 3ZSLA 3BTAA 4AVTA 4JGYB 1AYM3 4AEMA 3BIWE 3HT1A 3L9JT 1H8VA 4LBQA 2FBEA 2R6QA 1AZDA 2ZX0A 1OHFA 3H7YA 1W6MA 1LGNA 4YVWB 2H6BA 3WX5A 4LT5A 3WCRA 1JXNA 4IEQA 1ZBE1 3ZFFB 1J1LA 1G6NA 2E7QA 1FOD2 2WLPA 4Q1RA 4ASMB 3ILNA 5FREA 4UW6A 2NMOA 2R073 1FMD3 2DCTA 4FPHA 4H7LA 1AR72 1PGSA 1FNZA 1S0FA 3IBMA 1DYKA 1H2KA 4GKYA 3H0OA 4OI4A 4WZCA 3WZ1A 5KXEA 5I0SA 1Y43B 3OGJA 1BJQA 2BNOA 4GULA 1RITA 3AXEA 1LGBA 2WZR1 3RMYA 1N1TA 3K48A 5K0UA 2RS52 5CFCC 4FXGB 4DXZA 5JVVA 5BNNA 4QGNA 4NN0A 1VB2A 1C5IA 1GYKA 5J3UA 1FAYA 5JZGA 3S7EA 4MXWA 1UAIA 2VVDA 1Q5OA 5FCCA 5H9PA 2ZAHA 4Q4W2 1C3HA 3MDPA 1QJX1 4OHZA 5HI0A 1N3QA 2VMGA 3WHUA 3HN1A 4K1YA 1CGPA 3D82A 1IPKA 1YWKA 1MACA 4DB5A 2HEWF 5CVRA 1HRV3 2XBO3 4N43B 4N90A 4Q2FA 5HCBA 5T5PA 4B4RA 1WW6A 4TZDA 1CAWB 1WLTA 3ZPYA 3CF6E 5BNQA 4YW4A 3DPRB 5JCTA 4D7YA 3WG2A 4WV8A 1BVP1 5L7OB 4QPIC 4XZPA 3QD6A 1QQP1 3WUCA 3NAPC 4XFCA 5K8SA 3MLLA 3SNMA 3R0RA 3WCSA 2DU1A 4Y26A 2LUWA 4LHNA 2JG8B 1LJ7A 4XF3A 1RUG2 4RA0A 1FI2A 1DZQA 1SLIA 1W6PA 5CAZA 3M3QA 4UBGA 1KFXL 3G7DA 1UIKA 4RS5C 1IS3A 3KLSA 1MS3A 4N7IA 1PM7A 3MIGA 4COVA 1V9U1 2E51A 4WM8B 2R1DA 3V0AB 3U4XA 1XE7A 1DGWX 3APBA 3QOPA 1H4GA 2WFF1 2ETEA 5I8YA 2WLQA 3N36A 4N53C 1LOFC 4RR3A 1SBFA 2P17A 2X5IB 4RL7A 3T2TA 3VBHC 1DQ1A 2SBAA 1PIV1 5J96B 3AP6A 4MVTA 2XJQA 1COV1 4Z8BA 4BZ4A 2GC2A 5CFDC 1AX0A 2P34A 2GC1A 4N7UA 1YRZA 4A7KA 1CPNA 4YGCA 3ZXAC 3H1WA 3SHRA 4FPJA 1V6IA 4SBVA 4ZXKA 4AEJA 3I59B 5K9YA 2JKBA 4CTEA 2DURA 1LTEA 3SMHA 1RUD1 1TQ5A 2FMYA 3AM2A 5GLWA 3H1YA 2WZR3 1ND3A 3S6PA 3KCYA 5FPZA 5E1RA 1WCDJ 3DPRA 3ZYIB 4WVZA 1VBD1 3OTFA 4XIKA 5EXOA 4QPGB 4HSLA 1FNYA 1F8VA 1QJX3 4QMAA 5IUQA 5E8AA 2VG9A 4GMP0 3CNAA 2RR11 1W39A 1VAKA 3DN7A 4Y1UA 1XU2A 4S2HA 1GSLA 1UW8A 4YNIA 1EP0A 2XLGA 1F5FA 2ZKNA 4WM8A 3ZMOA 4D7SA 2AR6A 1LR5A 3VBFA 1RUOA 3RJ2X 4MGIE 5GKAC 1VBE1 2P2KA 5CA6A 4QU2A 4Q4Y2 1EAH2 2VQ0A 4AFDA 1QQP3 3MLKA 3H3UA 1RINA 1LU1A 4YVSC 1XXNA 4GKXA 4K20A 2JD4A 3H1MA 4YW3A 1QMJA 1RHI1 1JYCA 2SLIA 2PTMA 1HX6A 4XIOA 3WDVA 1K5MB 2KM2A 4AF9A 4HVQA 1O3SA 1PZ9A 3MPBA 2XHKA 5DDJ1 2YDEA 3WP3A 1AYN1 3AZYA 2C9AA 1Q8PA 4QPIB 1AVBA 1CAXB 1UF2C 1V9U3 3I59A 3NAPB 4XHXA 4R9AA 3O12A 2HWE1 3J8F2 4OI1A 3IDEA 1VBA2 4IXLA 3ZN6B 1JTZX 3GNEA 1S2BA 4YZ5A 2WFF3 3LAGA 2R072 1C1LA 2VOKA 4RS5B 3RQ0A 1FV3A 1PIV3 1ENQA 5EFUA 2ZX2A 4QM9A 1V00A 1COV3 3AKQA 3WR0A 2WT1A 1Z0HA 3ZYRA 2BPA2 2XJPA 4FTEA 5CG8A 3DUIA 2ZGQA 5CU1A 1RUF1 5JSPA 2WT0A 3CL1A 4LA2A 5FMOL 5C9AA 1ZRFA 3N7LA 1OKQA 4XMIA 3BPZA 2IZWA 5A33B 4CEYA 2YUEA 2RM21 2FQPA 2YXSA 1XU1A 1AR71 2R061 4HFSA 2X53S 1YO8A 5C4WC 2UYAA 1VBD3 1LCLA 1NCRA 1FATA 1UD1A 1V6KA 3WW3A 2BVVA 3NL1A 4K9SA 3M3EA 1HQNA 2EIGA 3B01A 1SLLA 1ALYA 5AC91 4FSJA 2N7GA 1HRV2 2WNVC 2ZHKA 4H55A 3T1LA 4Y24A 2GNBA 3ZIXA 5JSOA 2D5HA 2RR13 2DCYA 2ZCWA 4JDMA 4TLFA 1ZREA 1R093 2HWB1 3JCIA 1Q3EA 1K5MA 4X8NA 2QJVA 4OUMA 5JPMB 1V6OA 2GMPA 1QWRA 4QQ2A 4NOTA 4KGGA 4COUA 4R9DA 1GR3A 1MR5A 2VNRA 3POSA 3AP9A 3TN92 5AFBA 1N1SA 2VW0A 2V5YA 1MZ6A 2D6MA 2PHRA 2XJUA 2X8KA 4KBBA 1PGW2 2B7YA 3AMPA 3ZFEA 1WCSA 4IV1C 1QDOA 2ENRA 5EJ3A 1VBE3 5H9RA 1QJU1 1KJLA 1DG6A 2HJIA 4IEPA 4BMBA 4A7YA 5F6KA 2VECA 4LHLA 5ABJA 1RHI3 1GZWA 2CTVA 2I2SA 1HKDA 1CX4A 4WVMA 3AZZA 2R30A 3TNPB 2O1QA 4CDXB 4S2GA 1S0GA 5DDJ3 1DQ6A 1C4RA 1DZTA 3IT8A 1AYN3 1H4HA 1NA1A 2UU8A 4FAHA 3ZYGA 1VIWB 1D0GA 1ZBE2 1HIXA 2PA7A 1F9KA 3ZXLA 4B7KA 4INDA 4CDWC 1MS5A 4ES8A 1Q56A 1XNKA 4M00A 1O91A 2PHTA 3H8UA 4K3UA 4XJ9A 5J36A 5D8AB 1NLRA 2NN8A 1PO21 4IV3A 1YNAA 5L19A 5JPNB 4S2DA 3LCPA 2PN5A 4AFAA 4K21A 1KS5A 3J9SA 1DQ0A 2IXHA 4I2OA 4IERA 1CONA 1UX6A 3IM0A 3U07A 1OFSA 2VMHA 1J3QA 4Q8KA 2WZR2 2ZGTA 4OZXA 1O5UA 1AHSA 1FPN1 2IXKA 2Q30A 5L73A 2NYYA 2YMZA 2VGDA 4S2FA 3LA2A 3OF1A 1I3HA 4JDOA 2VVFA 1D0HA 2RM23 2BTVC 1RUE1 3FLRA 1AR73 2R063 3AJZA 2JICA 1SLBA 1QJX2 2K2SA 5E89A 2V09A 3S30A 2GC3A 2GZWA 3OGGA 1U12A 4WM7A 2EXIA 3E6BA 1VLNA 4ZU4A 2XLAA 1MZFA 3PTYA 5AC93 2RS53 1ZRRA 1WW5A 2ZGLA 4C1XA 1VAMA 4XQDA 1KDMA 4CEWB 4XF4A 4AXOA 3V64A 4DPNA 1F31A 3TOJA 1QXRA 3OYWA 4CDXA 4RQPC 5C4WB 1SFYA 1QQP2 2RMU1 4M3CB 4OI0A 1UZYA 4SLIA 1C1FA 1PVC1 3AMNA 1ND2C 3O0VA 4MGYE 3ZX7A 4CDUA 1J3PA 5BNOA 3DV8A 2WNVB 1ULEA 3O0XA 5LEJA 4LEJA 2BGCA 3FJSA 1LHUA 1RUNA 5JZGC 1LHNA 1JH5A 4GALA 2WSVA 1OSGA 3BALA 4BQ1A 1QJU3 3B00A 4Q26A 1U0AA 4RD7A 3NWKA 3FHIB 1V9U2 2AREA 1PVXA 2D97A 1SFNA 1XNCA 4OULA 2JG9C 2IXJA 3LGRA 2PFWA 4NO4A 4Q4Y1 1EAH1 2BVBA 3MEPA 3RMXA 2WFF2 3L2YA 3QH6A 3AXDA 4IV1B 3RI9A 3VZMA 4LBJA 2D6KA 4H3WA 1RUG3 2Z2SB 5T52A 4YFZA 1PIV2 1PZ8A 5LK5A 4Q0SA 4LO8A 3USSA 1COV2 4HKOA 4IEZA 2ZBJA 4Q0UA 3O7OA 4CZSA 2ZMNA 2HYKA 3J26N 1PO23 2ET7A 4ZU7A 1IPJA 5H9SA 2WWSA 2VH9A 1UPSA 3UK9A 1CAVB 1KRIA 3VBOB 4NVPA 4BHPA 1NZCA 4N9HA 2MNGA 4I3PA 1RUD2 4JAAA 1C28A 1VALA 3OBRA 1OOPB 1AL0G 2GAUA 4CDWB 1GNZA 4CDQB 1FPN3 1GLHA 5JOYA 1FXZA 2HWD2 1U5ZA 2NQYA 2WZPP 4Y1YA 1SBEA 3RSJA 1ENRA 5A32B 1GNHA 3VBUC 4OUSA 5C33A 1RUE3 3RYPA 4Q0PA 4CRQA 2FZ1A 2IWGB 2R16A 1J3RA 3MW2A 1D4M1 4YG3A 5GLVA 4BWOA 1TME1 2RR12 3BCWA 1HXS1 3MF6A 1TMF1 3AKPA 3VV1A 2OYZA 3ZFGC 3B9CA 4E4ZA 1U5IA 1PMIA 3MIFA 4OI2A 1L3JA 1MEC1 5C8CC 4WVVA 3WDWA 5EYXA 1O3TA 4XJWA 4I01A 1AX2A 2VW1A 1KDKA 3V0BA 1LOCA 2PQQA 5T50A 4BYYA 4JGZC 1ZZBA 4EN6B 4D7TA 3KMHA 3AP7A 1VBE2 4AEDA 3SH3A 1PO12 2WNUB 2WJSA 4L97A 4B4QA 2RMU3 1ND3C 1FYUA 4OHYA 3A4UA 3D6EA 4BLJA 1MQTC 4HZFA 3EBRA 5FTTC 4ATFA 2EAAA 3KT7A 3GF6A 1YXWA 1VRH1 4YGDA 4EV0A 1Q8OA 4I09A 4UW4A 2VUAA 1ZBA1 4HBNA 2VQAA 1RUI2 4LBLA 2GMEA 3BB6A 3TN91 4L99A 5F9TA 2A6WA 5JOWA 2WC2A 4RQPB 1B35A 3W58A 3GHNA 1PGW1 5F1RA 1CAVA 5KWRA 1QY4A 1H8TA 5CNAA 2HWE2 2G9FA 2CAUA 1NCQC 4Q4Y3 1EAH3 4YZ3A 3BOPA 2ZMLA 2IFWA 3N35A 1Q8SA 1HQWA 3QLQA 2EF6A 4NHMA 4MYEA 3THTA 3MW4A 4MX3A 3R6SA 1MVQA 2P3IA 2UYBA 1Y9QA 1A78A 1EPZA 3NV1A 4I02A 2JG9B 3FMGA 4XFIA 1DDLA 1PNGA 1AR91 1RUF2 1QU0A 5DZGA 3J8F3 2VULA 1G86A 2BNNA 1DGWA 1VBA3 4G3YC 3TNQA 3OBTA 2OUHA 2DUQA 3POYA 4LBMA 4QD2A 3KCCA 1D4VB 1Q8QA 5JMCA 3OY8B 2RM22 3D0JA 4FP2A 3UKTA 3WV6A 2R062 2DF7A 4AGGA 1S0BA 3ZN4A 1G9CA 3WG1A 4IEXA 3R4UA 4UW5A 3ZSEA 1HV1A 5JWPA 2ARXA 2Y0OA 2WNUA 2JX9A 5KXBA 1WD3A 5AC92 2BFUL 4BA6A 3GBWA 3LKJA 3VL9A 5BV6A 3AYAA 1LEDA 4YZ2A 3CJIA 3VDDA 1J1TA 2F6BA 1TME3 4L92A 1HXS3 5EZWA 5I0UA 1TMF3 2HWB2 1W6OB 3WDTA 1VBB1 2ZACA 1ULCA 3V56A 2BW8A 4PBOA 1YFWA 1ONAA 4K40A 2QZ2A 1MEC3 2RS31 2Y26A 3WDYA 5DUXA 1JHNA 4K8FA 1HDKA 4FPLA 4FAGA 2WS91 4BCUA 3ILFA 4CEYC 3K51A 4JGYA 1QJU2 1NYWA 4QPYA 5L36A 2R1BA 3ZFGB 2Q5TA 4XMAA 4ISRA 2I45A 4YM3A 1UU4A 5TSWA 5FFOC 5EYYA 3V65A 2CWMA 3MIDA 4LR4A 5T5LA 4YVWA 1VRH3 5FO7B 4I3GA 3WW4A 1V6NA 1ZBA3 2LM3A 4L8QA 5E16A 1WW7A 2YV8A 2UWCA 4W6WA 4XXPA 3H50A 3TN93 2XGXA 3ZFFA 5ACA1 2DVBA 2QE3A 3CU7A 5BXXA 3SITA 4BLIA 2CWSA 1CR7A 5BNPC 3VKFC 3UV9A 3E5XA 3M70A 1MQTB 4DNYA 3FFQA 1OFNA 1AR81 2PLV1 4M01A 1BCXA 4QQPA 3ZDSA 3VKMA 1QXJA 1DGLA 3E6DA 1PO22 2PHXA 4AQSA 1RMU1 1TNRA 3ME2A 4YGEA 3ZFEC 1ULFA 1UN1A 1U5YA 3ZXEA 2DCJA 1ZZCA 2ZGKA 3IKWA 4YW1A 1LODA 4EN0A 3GZAA 2R042 3MI8A 4MGZE 1W2UA 4U2AA 1NCQB 4ZKTB 1ZBE3 1LOEA 1AR93 2ATFA 2ZPXA 3ECQA 1FPN2 3S0MA 1NG0A 3FWEA 4AFBA 1A8MA 2BYVE 1KXGA 2EXHA 4XBLA 3AFGA 2YY1A 5GLTA 1RUE2 4XHBA 3AMQA 1MZEA 4QQOA 4Y20B 3WVJA 4FXKB 4H7MA 4E4SA 3ZXGA 1QOSA 4Y5Z0 1WGPA 3B69A 4H14A 1LOGA 4N43A 3MLJA 5GLZA 3TAYA 1JYIA 1MS4A 2XJSA 3WP5A 2HEYF 1CAWA 2MPFA 4IV3C 4AHXA 2K0GA 1C8M1 3NO8A 2HWD1 3ST7A 3THPA 3ZMNA 2CGNA 1RUC1 2RE9A 4EWDA 5L7OA 4I0AA 4PLNA 1WUVA 2AUYA 1VBB3 2ZMKA 4QM8A 4YG6A 4MXVA 1DQ5A 1DLLA 1RJ8A 3HMYA 2RS33 2RMU2 2YGLA 2D6OX 1PVC2 2JG8A 3MF9A 4GH4C 1X82A 1PZ7