1LHPA

Crystal structure of pyridoxal kinase from sheep brain
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
309
structure length
306
Chain Sequence
ECRVLSIQSHVVRGYVGNRAATFPLQVLGFEVDAVNSVQFSNHTGYSHWKGQVLNSDELQELYDGLKLNHVNQYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVMGDQRNGEGAMYVPDDLLPVYREKVVPVADIITPNQFEAELLTGRKIHSQEEALEVMDMLHSMGPDTVVITSSNLLSPRGSDYLMALGSQRTRGSVVTQRIRMEMHKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSAMHHVLQRTIKCAKAKSGEGVKPSPAQLELRMVQSKKDIESPEIVVQATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of brain pyridoxal kinase, a novel member of the ribokinase superfamily
pubmed doi rcsb
molecule tags Transferase
molecule keywords Pyridoxal kinase
total genus 95
structure length 306
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.1.35: Pyridoxal kinase.
pdb deposition date 2002-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 1lhpA00
4E8WA 4EOHA 2A9YA 1V1SA 4UBEA 3UQ6A 1U2XA 3RRJA 2QHPA 1UB0A 3IN1A 3EWMA 3OTXA 4N08A 3RT9A 4KADA 4K9IA 2HW1A 3RT7A 3RSGA 3QAIA 4LBXA 5BYCA 2XTBA 2Q5RA 2JGVA 2JG5A 2I6AA 3HPDA 3JULA 1RKDA 4O1GA 1VI9A 4U7XA 3K5WA 3RTDA 1DGMA 4XCKA 3NL6A 4XF6A 3VASA 4K8CA 1GQTA 3B3LA 1GC5A 3UMPA 4DU5A 3UQ9A 3RU2A 2QCVA 3KTNA 4O1LA 3RQHA 5C3ZA 1LIIA 2YXUA 4XDAA 3KZHA 4JKUA 3H74A 2C49A 4B8RA 2R3EA 4EUMA 5BYFA 2PKKA 1LIKA 1YGKA 4S1IA 1YHJA 4DC3A 3NL2A 3NC9A 3RO4A 3B1RA 5COJA 5CM5A 3RPHA 2AJPA 3RPZA 1UA4A 1LIJA 1YGJA 3GBUA 3IKHA 3NBVA 2AWDA 4E8ZA 4EBUA 4PVVA 3VAQA 3NC2A 1WYEA 4KALA 4S1MA 4C5MA 3RQ8A 3RSFA 1TZ3A 2C4EA 3GO6A 3RQ2A 4K8TA 1V19A 1EKQA 3LJSA 3UBOA 4C5NA 4E3AA 3UQDA 3RS9A 5F11A 1RFTA 3RTGA 4KAHA 3IBQA 1RFUA 3QA2A 2I6BA 1LHRA 2AFBA 3BF5A 4K9CA 4KBEA 3RRBA 3RQ5A 3MBJA 3RY7A 2HQQA 4C5JA 5C41A 2AX3A 1RK2A 3Q92A 2DCNA 1RKSA 3RSQA 2DDWA 3RU3A 5EY7A 4WJMA 1RFVA 4E84A 3IQ0A 3RSSA 2RBCA 5CGEA 2AJRA 1RKAA 5TRWA 2PKNA 4KANA 3I3YA 2V78A 4S1HA 2HLZA 2ABQA 4K8PA 4JJPA 2JG1A 4S1IB 4YWRA 4E69A 3IH0A 4N09A 3B1NA 3UMOA 3RS8A 1LIOA 3MBHA 1JXIA 2FV7A 5BYEA 3RM5A 3NM3A 3NM1A 3Q1YA 2DDMA 3KD6A 3CQDA 3RQXA 2AB8A 3B1OA 3RTEA 5C3YA 5B6AA 2I5BA 1V1AA 1KYHA 3B1QA 3FHXA 4LBGA 4EN4A 2F7KA 4YL5A 3RTAA 2VARA 1LHPA 1TYYA 3HICA 3NCAA 2AA0A 1TD2A 2PKMA 2YXTA 3N1CA 3RTCA 5TQIA 3FHYA 3H49A 2PKFA 4K93A 3NL5A 4K8KA 4JKSA 1TZ6A 3BGKA 1EKKA 4XF7A 3DZVA 4LCAA 1VK4A 3LOOA 2DDOA 3B1PA 3RQQA 3RREA 1ESJA 3KEUA 3LKIA 3W4SA 4C5LA 3NBWA 5CGAA 3IE7A 4LC4A 5BYDA 1BX4A 1JXHA 1V1BA 3HYOA 3LHXA 2NWHA 5EYNA 3PZSA 1L2LA 3ZS7A 4GM6A 1VM7A 3PL2A 3RTBA 3K9EA 3UQEA 2A9ZA 5C40A 1ESQA 3GO7A 2ABSA 1C3QA 2R3BA 3RRFA 4E8YA 3NL3A 4X8FA 4B8SA 5F0ZA 4C5KA 2F02A 3RQ6A 3DRWA
chains in the Genus database with same CATH superfamily
4E8WA 4EOHA 2A9YA 1V1SA 4UBEA 3UQ6A 1U2XA 3RRJA 2QHPA 3HJ6A 1UB0A 3IN1A 3EWMA 2VORA 3OTXA 4N08A 3RT9A 4KADA 4K9IA 2HW1A 3RT7A 3RSGA 3QAIA 4HV4A 2WJPA 4LBXA 5BYCA 2XTBA 2JFGA 2Q5RA 2JGVA 4BUBA 2JG5A 2I6AA 3HPDA 1EEHA 1E0DA 3JULA 1RKDA 4O1GA 2Y66A 1VI9A 4U7XA 3K5WA 3RTDA 1DGMA 4XCKA 3NL6A 4XF6A 3VASA 4K8CA 1GQTA 3B3LA 1GC5A 3UMPA 4DU5A 3UQ9A 3RU2A 2QCVA 3KTNA 4O1LA 3RQHA 5C3ZA 1LIIA 2YXUA 4C13A 4XDAA 3KZHA 4JKUA 1JBVA 3H74A 2C49A 4B8RA 2R3EA 1FGSA 4EUMA 5A5FA 5BYFA 2PKKA 1LIKA 2VTDA 1YGKA 4S1IA 1YHJA 4DC3A 3NL2A 3NC9A 3RO4A 1GG4A 3B1RA 4C12A 5COJA 3ZM6A 5CM5A 3RPHA 2AJPA 3RPZA 1W7KA 1UA4A 1LIJA 1YGJA 3GBUA 3IKHA 3LK7A 2AWDA 3NBVA 3ZL8A 4QDIA 4E8ZA 2VOSA 4EBUA 4C5MA 4PVVA 3VAQA 3UAGA 3NC2A 1WYEA 4KALA 4S1MA 3PYZA 2Y68A 3RQ8A 3RSFA 1GQQA 1TZ3A 2C4EA 3GO6A 4K8TA 1V19A 1EKQA 3LJSA 3RQ2A 1W78A 3UBOA 4C5NA 3RS9A 4E3AA 5F11A 1RFTA 2AM2A 3RTGA 4KAHA 3IBQA 1RFUA 3QA2A 2I6BA 1LHRA 2AFBA 3BF5A 4K9CA 4KBEA 3RRBA 4QF5A 3RQ5A 3MBJA 5BYEA 3RY7A 2HQQA 4C5JA 5C41A 2AX3A 1RK2A 3Q92A 1UAGA 2DCNA 1GQYA 1RKSA 3RSQA 2DDWA 3RU3A 4CVLA 5EY7A 4WJMA 1RFVA 4E84A 1P3DA 3IQ0A 3RSSA 2RBCA 2WTZA 4ZIYA 2JFHA 2AJRA 5CGEA 2AM1A 1RKAA 5TRWA 2PKNA 4KANA 3I3YA 2V78A 4S1HA 2HLZA 2ABQA 4K8PA 4JJPA 2JG1A 4S1IB 1J6UA 2UUOA 2Y1OA 3IH0A 4N09A 3B1NA 4YWRA 3UMOA 4E69A 3EAGA 3RS8A 5A5EA 1LIOA 3MBHA 1JXIA 2FV7A 2VTEA 4UAGA 3NM3A 3NM1A 3Q1YA 3RM5A 4BUCA 2DDMA 3KD6A 3CQDA 3RQXA 2AB8A 2UUPA 3B1OA 3RTEA 5C3YA 5B6AA 2GCBA 2I5BA 1V1AA 1KYHA 3QCZA 3B1QA 3FHXA 4LBGA 4EN4A 2F00A 2F7KA 2Y67A 4YL5A 1P31A 2VARA 1LHPA 1TYYA 2GCAA 3HICA 3NCAA 3RTAA 2X5OA 2AA0A 1TD2A 2PKMA 2YXTA 3N1CA 3RTCA 5TQIA 3FHYA 3H49A 2PKFA 4K93A 4CVMA 3NL5A 3UQDA 2GC6A 4K8KA 4JKSA 1TZ6A 3BGKA 1EKKA 4XF7A 3ZM5A 3DZVA 4LCAA 1VK4A 3LOOA 2DDOA 1E8CA 2XPCA 3B1PA 1ESJA 1O5ZA 3KEUA 3LKIA 3RQQA 3RREA 2JFFA 3NBWA 3IE7A 4LC4A 3W4SA 4C5LA 1BX4A 1JXHA 5BYDA 5CGAA 1V1BA 3HYOA 3HN7A 2NWHA 3LHXA 5EYNA 2XJAA 3PZSA 3N2AA 4CVKA 1L2LA 3ZS7A 4GM6A 1VM7A 3PL2A 3RTBA 3K9EA 3UQEA 2A9ZA 5C40A 1JBWA 1ESQA 2UAGA 3GO7A 2ABSA 1C3QA 2R3BA 3NRSA 3RRFA 3NL3A 4X8FA 4B8SA 2GC5A 4C5KA 4E8YA 2F02A 3RQ6A 5F0ZA 3DRWA
chains in the Genus database with same CATH topology
4E8WA 4EOHA 2A9YA 1V1SA 4UBEA 3UQ6A 1U2XA 3RRJA 2QHPA 3HJ6A 1UB0A 3IN1A 3EWMA 3OTXA 4N08A 3RT9A 4KADA 4K9IA 2HW1A 3RT7A 3RSGA 3QAIA 4LBXA 5BYCA 2XTBA 2Q5RA 2JGVA 2JG5A 2I6AA 3HPDA 3JULA 1RKDA 4O1GA 1VI9A 4U7XA 3K5WA 3RTDA 1DGMA 4XCKA 3NL6A 4XF6A 3VASA 4K8CA 1GQTA 3B3LA 1GC5A 3UMPA 4DU5A 3UQ9A 3RU2A 2QCVA 3KTNA 4O1LA 3RQHA 5C3ZA 1LIIA 2YXUA 4XDAA 3KZHA 4JKUA 3H74A 2C49A 4B8RA 2R3EA 4EUMA 5BYFA 2PKKA 1LIKA 1YGKA 4S1IA 1YHJA 4DC3A 3NL2A 3NC9A 3RO4A 3B1RA 5COJA 5CM5A 3RPHA 2AJPA 3RPZA 1UA4A 1LIJA 1YGJA 3GBUA 3IKHA 3NBVA 2AWDA 4E8ZA 4EBUA 4PVVA 3VAQA 3NC2A 1WYEA 4KALA 4S1MA 4C5MA 3RQ8A 3RSFA 1TZ3A 2C4EA 3GO6A 3RQ2A 4K8TA 1V19A 1EKQA 3LJSA 3UBOA 4C5NA 4E3AA 3UQDA 3RS9A 5F11A 1RFTA 3RTGA 4KAHA 3IBQA 1RFUA 3QA2A 2I6BA 1LHRA 2AFBA 3BF5A 4K9CA 4KBEA 3RRBA 3RQ5A 3MBJA 3RY7A 2HQQA 4C5JA 5C41A 2AX3A 1RK2A 3Q92A 2DCNA 1RKSA 3RSQA 2DDWA 3RU3A 5EY7A 4WJMA 1RFVA 4E84A 3IQ0A 3RSSA 2RBCA 5CGEA 2AJRA 1RKAA 5TRWA 2PKNA 4KANA 3I3YA 2V78A 4S1HA 2HLZA 2ABQA 4K8PA 4JJPA 2JG1A 4S1IB 4YWRA 4E69A 3IH0A 4N09A 3B1NA 3UMOA 3RS8A 1LIOA 3MBHA 1JXIA 2FV7A 5BYEA 3RM5A 3NM3A 3NM1A 3Q1YA 2DDMA 3KD6A 3CQDA 3RQXA 2AB8A 3B1OA 3RTEA 5C3YA 5B6AA 2I5BA 1V1AA 1KYHA 3B1QA 3FHXA 4LBGA 4EN4A 2F7KA 4YL5A 3RTAA 2VARA 1LHPA 1TYYA 3HICA 3NCAA 2AA0A 1TD2A 2PKMA 2YXTA 3N1CA 3RTCA 5TQIA 3FHYA 3H49A 2PKFA 4K93A 3NL5A 4K8KA 4JKSA 1TZ6A 3BGKA 1EKKA 4XF7A 3DZVA 4LCAA 1VK4A 3LOOA 2DDOA 3B1PA 3RQQA 3RREA 1ESJA 3KEUA 3LKIA 3W4SA 4C5LA 3NBWA 5CGAA 3IE7A 4LC4A 5BYDA 1BX4A 1JXHA 1V1BA 3HYOA 3LHXA 2NWHA 5EYNA 3PZSA 1L2LA 3ZS7A 4GM6A 1VM7A 3PL2A 3RTBA 3K9EA 3UQEA 2A9ZA 5C40A 1ESQA 3GO7A 2ABSA 1C3QA 2R3BA 3RRFA 4E8YA 3NL3A 4X8FA 4B8SA 5F0ZA 4C5KA 2F02A 3RQ6A 3DRWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E8W A;  4EOH A;  2A9Y A;  1V1S A;  4UBE A;  3UQ6 A;  1U2X A;  3RRJ A;  2QHP A;  1UB0 A;  3IN1 A;  3EWM A;  3OTX A;  4N08 A;  3RT9 A;  4KAD A;  4K9I A;  2HW1 A;  3RT7 A;  3RSG A;  3QAI A;  4LBX A;  5BYC A;  2XTB A;  2Q5R A;  2JGV A;  2JG5 A;  2I6A A;  3HPD A;  3JUL A;  1RKD A;  4O1G A;  1VI9 A;  4U7X A;  3K5W A;  3RTD A;  1DGM A;  4XCK A;  3NL6 A;  4XF6 A;  3VAS A;  4K8C A;  1GQT A;  3B3L A;  1GC5 A;  3UMP A;  4DU5 A;  3UQ9 A;  3RU2 A;  2QCV A;  3KTN A;  4O1L A;  3RQH A;  5C3Z A;  1LII A;  2YXU A;  4XDA A;  3KZH A;  4JKU A;  3H74 A;  2C49 A;  4B8R A;  2R3E A;  4EUM A;  5BYF A;  2PKK A;  1LIK A;  1YGK A;  4S1I A;  1YHJ A;  4DC3 A;  3NL2 A;  3NC9 A;  3RO4 A;  3B1R A;  5COJ A;  5CM5 A;  3RPH A;  2AJP A;  3RPZ A;  1UA4 A;  1LIJ A;  1YGJ A;  3GBU A;  3IKH A;  3NBV A;  2AWD A;  4E8Z A;  4EBU A;  4PVV A;  3VAQ A;  3NC2 A;  1WYE A;  4KAL A;  4S1M A;  4C5M A;  3RQ8 A;  3RSF A;  1TZ3 A;  2C4E A;  3GO6 A;  3RQ2 A;  4K8T A;  1V19 A;  1EKQ A;  3LJS A;  3UBO A;  4C5N A;  4E3A A;  3UQD A;  3RS9 A;  5F11 A;  1RFT A;  3RTG A;  4KAH A;  3IBQ A;  1RFU A;  3QA2 A;  2I6B A;  1LHR A;  2AFB A;  3BF5 A;  4K9C A;  4KBE A;  3RRB A;  3RQ5 A;  3MBJ A;  3RY7 A;  2HQQ A;  4C5J A;  5C41 A;  2AX3 A;  1RK2 A;  3Q92 A;  2DCN A;  1RKS A;  3RSQ A;  2DDW A;  3RU3 A;  5EY7 A;  4WJM A;  1RFV A;  4E84 A;  3IQ0 A;  3RSS A;  2RBC A;  5CGE A;  2AJR A;  1RKA A;  5TRW A;  2PKN A;  4KAN A;  3I3Y A;  2V78 A;  4S1H A;  2HLZ A;  2ABQ A;  4K8P A;  4JJP A;  2JG1 A;  4S1I B;  4YWR A;  4E69 A;  3IH0 A;  4N09 A;  3B1N A;  3UMO A;  3RS8 A;  1LIO A;  3MBH A;  1JXI A;  2FV7 A;  5BYE A;  3RM5 A;  3NM3 A;  3NM1 A;  3Q1Y A;  2DDM A;  3KD6 A;  3CQD A;  3RQX A;  2AB8 A;  3B1O A;  3RTE A;  5C3Y A;  5B6A A;  2I5B A;  1V1A A;  1KYH A;  3B1Q A;  3FHX A;  4LBG A;  4EN4 A;  2F7K A;  4YL5 A;  3RTA A;  2VAR A;  1LHP A;  1TYY A;  3HIC A;  3NCA A;  2AA0 A;  1TD2 A;  2PKM A;  2YXT A;  3N1C A;  3RTC A;  5TQI A;  3FHY A;  3H49 A;  2PKF A;  4K93 A;  3NL5 A;  4K8K A;  4JKS A;  1TZ6 A;  3BGK A;  1EKK A;  4XF7 A;  3DZV A;  4LCA A;  1VK4 A;  3LOO A;  2DDO A;  3B1P A;  3RQQ A;  3RRE A;  1ESJ A;  3KEU A;  3LKI A;  3W4S A;  4C5L A;  3NBW A;  5CGA A;  3IE7 A;  4LC4 A;  5BYD A;  1BX4 A;  1JXH A;  1V1B A;  3HYO A;  3LHX A;  2NWH A;  5EYN A;  3PZS A;  1L2L A;  3ZS7 A;  4GM6 A;  1VM7 A;  3PL2 A;  3RTB A;  3K9E A;  3UQE A;  2A9Z A;  5C40 A;  1ESQ A;  3GO7 A;  2ABS A;  1C3Q A;  2R3B A;  3RRF A;  4E8Y A;  3NL3 A;  4X8F A;  4B8S A;  5F0Z A;  4C5K A;  2F02 A;  3RQ6 A;  3DRW A; 
#chains in the Genus database with same CATH topology
 4E8W A;  4EOH A;  2A9Y A;  1V1S A;  4UBE A;  3UQ6 A;  1U2X A;  3RRJ A;  2QHP A;  3HJ6 A;  1UB0 A;  3IN1 A;  3EWM A;  2VOR A;  3OTX A;  4N08 A;  3RT9 A;  4KAD A;  4K9I A;  2HW1 A;  3RT7 A;  3RSG A;  3QAI A;  4HV4 A;  2WJP A;  4LBX A;  5BYC A;  2XTB A;  2JFG A;  2Q5R A;  2JGV A;  4BUB A;  2JG5 A;  2I6A A;  3HPD A;  1EEH A;  1E0D A;  3JUL A;  1RKD A;  4O1G A;  2Y66 A;  1VI9 A;  4U7X A;  3K5W A;  3RTD A;  1DGM A;  4XCK A;  3NL6 A;  4XF6 A;  3VAS A;  4K8C A;  1GQT A;  3B3L A;  1GC5 A;  3UMP A;  4DU5 A;  3UQ9 A;  3RU2 A;  2QCV A;  3KTN A;  4O1L A;  3RQH A;  5C3Z A;  1LII A;  2YXU A;  4C13 A;  4XDA A;  3KZH A;  4JKU A;  1JBV A;  3H74 A;  2C49 A;  4B8R A;  2R3E A;  1FGS A;  4EUM A;  5A5F A;  5BYF A;  2PKK A;  1LIK A;  2VTD A;  1YGK A;  4S1I A;  1YHJ A;  4DC3 A;  3NL2 A;  3NC9 A;  3RO4 A;  1GG4 A;  3B1R A;  4C12 A;  5COJ A;  3ZM6 A;  5CM5 A;  3RPH A;  2AJP A;  3RPZ A;  1W7K A;  1UA4 A;  1LIJ A;  1YGJ A;  3GBU A;  3IKH A;  3LK7 A;  2AWD A;  3NBV A;  3ZL8 A;  4QDI A;  4E8Z A;  2VOS A;  4EBU A;  4C5M A;  4PVV A;  3VAQ A;  3UAG A;  3NC2 A;  1WYE A;  4KAL A;  4S1M A;  3PYZ A;  2Y68 A;  3RQ8 A;  3RSF A;  1GQQ A;  1TZ3 A;  2C4E A;  3GO6 A;  4K8T A;  1V19 A;  1EKQ A;  3LJS A;  3RQ2 A;  1W78 A;  3UBO A;  4C5N A;  3RS9 A;  4E3A A;  5F11 A;  1RFT A;  2AM2 A;  3RTG A;  4KAH A;  3IBQ A;  1RFU A;  3QA2 A;  2I6B A;  1LHR A;  2AFB A;  3BF5 A;  4K9C A;  4KBE A;  3RRB A;  4QF5 A;  3RQ5 A;  3MBJ A;  5BYE A;  3RY7 A;  2HQQ A;  4C5J A;  5C41 A;  2AX3 A;  1RK2 A;  3Q92 A;  1UAG A;  2DCN A;  1GQY A;  1RKS A;  3RSQ A;  2DDW A;  3RU3 A;  4CVL A;  5EY7 A;  4WJM A;  1RFV A;  4E84 A;  1P3D A;  3IQ0 A;  3RSS A;  2RBC A;  2WTZ A;  4ZIY A;  2JFH A;  2AJR A;  5CGE A;  2AM1 A;  1RKA A;  5TRW A;  2PKN A;  4KAN A;  3I3Y A;  2V78 A;  4S1H A;  2HLZ A;  2ABQ A;  4K8P A;  4JJP A;  2JG1 A;  4S1I B;  1J6U A;  2UUO A;  2Y1O A;  3IH0 A;  4N09 A;  3B1N A;  4YWR A;  3UMO A;  4E69 A;  3EAG A;  3RS8 A;  5A5E A;  1LIO A;  3MBH A;  1JXI A;  2FV7 A;  2VTE A;  4UAG A;  3NM3 A;  3NM1 A;  3Q1Y A;  3RM5 A;  4BUC A;  2DDM A;  3KD6 A;  3CQD A;  3RQX A;  2AB8 A;  2UUP A;  3B1O A;  3RTE A;  5C3Y A;  5B6A A;  2GCB A;  2I5B A;  1V1A A;  1KYH A;  3QCZ A;  3B1Q A;  3FHX A;  4LBG A;  4EN4 A;  2F00 A;  2F7K A;  2Y67 A;  4YL5 A;  1P31 A;  2VAR A;  1LHP A;  1TYY A;  2GCA A;  3HIC A;  3NCA A;  3RTA A;  2X5O A;  2AA0 A;  1TD2 A;  2PKM A;  2YXT A;  3N1C A;  3RTC A;  5TQI A;  3FHY A;  3H49 A;  2PKF A;  4K93 A;  4CVM A;  3NL5 A;  3UQD A;  2GC6 A;  4K8K A;  4JKS A;  1TZ6 A;  3BGK A;  1EKK A;  4XF7 A;  3ZM5 A;  3DZV A;  4LCA A;  1VK4 A;  3LOO A;  2DDO A;  1E8C A;  2XPC A;  3B1P A;  1ESJ A;  1O5Z A;  3KEU A;  3LKI A;  3RQQ A;  3RRE A;  2JFF A;  3NBW A;  3IE7 A;  4LC4 A;  3W4S A;  4C5L A;  1BX4 A;  1JXH A;  5BYD A;  5CGA A;  1V1B A;  3HYO A;  3HN7 A;  2NWH A;  3LHX A;  5EYN A;  2XJA A;  3PZS A;  3N2A A;  4CVK A;  1L2L A;  3ZS7 A;  4GM6 A;  1VM7 A;  3PL2 A;  3RTB A;  3K9E A;  3UQE A;  2A9Z A;  5C40 A;  1JBW A;  1ESQ A;  2UAG A;  3GO7 A;  2ABS A;  1C3Q A;  2R3B A;  3NRS A;  3RRF A;  3NL3 A;  4X8F A;  4B8S A;  2GC5 A;  4C5K A;  4E8Y A;  2F02 A;  3RQ6 A;  5F0Z A;  3DRW A; 
#chains in the Genus database with same CATH homology
 4E8W A;  4EOH A;  2A9Y A;  1V1S A;  4UBE A;  3UQ6 A;  1U2X A;  3RRJ A;  2QHP A;  3HJ6 A;  1UB0 A;  3IN1 A;  3EWM A;  3OTX A;  4N08 A;  3RT9 A;  4KAD A;  4K9I A;  2HW1 A;  3RT7 A;  3RSG A;  3QAI A;  4LBX A;  5BYC A;  2XTB A;  2Q5R A;  2JGV A;  2JG5 A;  2I6A A;  3HPD A;  3JUL A;  1RKD A;  4O1G A;  1VI9 A;  4U7X A;  3K5W A;  3RTD A;  1DGM A;  4XCK A;  3NL6 A;  4XF6 A;  3VAS A;  4K8C A;  1GQT A;  3B3L A;  1GC5 A;  3UMP A;  4DU5 A;  3UQ9 A;  3RU2 A;  2QCV A;  3KTN A;  4O1L A;  3RQH A;  5C3Z A;  1LII A;  2YXU A;  4XDA A;  3KZH A;  4JKU A;  3H74 A;  2C49 A;  4B8R A;  2R3E A;  4EUM A;  5BYF A;  2PKK A;  1LIK A;  1YGK A;  4S1I A;  1YHJ A;  4DC3 A;  3NL2 A;  3NC9 A;  3RO4 A;  3B1R A;  5COJ A;  5CM5 A;  3RPH A;  2AJP A;  3RPZ A;  1UA4 A;  1LIJ A;  1YGJ A;  3GBU A;  3IKH A;  3NBV A;  2AWD A;  4E8Z A;  4EBU A;  4PVV A;  3VAQ A;  3NC2 A;  1WYE A;  4KAL A;  4S1M A;  4C5M A;  3RQ8 A;  3RSF A;  1TZ3 A;  2C4E A;  3GO6 A;  3RQ2 A;  4K8T A;  1V19 A;  1EKQ A;  3LJS A;  3UBO A;  4C5N A;  4E3A A;  3UQD A;  3RS9 A;  5F11 A;  1RFT A;  3RTG A;  4KAH A;  3IBQ A;  1RFU A;  3QA2 A;  2I6B A;  1LHR A;  2AFB A;  3BF5 A;  4K9C A;  4KBE A;  3RRB A;  3RQ5 A;  3MBJ A;  3RY7 A;  2HQQ A;  4C5J A;  5C41 A;  2AX3 A;  1RK2 A;  3Q92 A;  2DCN A;  1RKS A;  3RSQ A;  2DDW A;  3RU3 A;  5EY7 A;  4WJM A;  1RFV A;  4E84 A;  3IQ0 A;  3RSS A;  2RBC A;  5CGE A;  2AJR A;  1RKA A;  5TRW A;  2PKN A;  4KAN A;  3I3Y A;  2V78 A;  4S1H A;  2HLZ A;  2ABQ A;  4K8P A;  4JJP A;  2JG1 A;  4S1I B;  4YWR A;  4E69 A;  3IH0 A;  4N09 A;  3B1N A;  3UMO A;  3RS8 A;  1LIO A;  3MBH A;  1JXI A;  2FV7 A;  5BYE A;  3RM5 A;  3NM3 A;  3NM1 A;  3Q1Y A;  2DDM A;  3KD6 A;  3CQD A;  3RQX A;  2AB8 A;  3B1O A;  3RTE A;  5C3Y A;  5B6A A;  2I5B A;  1V1A A;  1KYH A;  3B1Q A;  3FHX A;  4LBG A;  4EN4 A;  2F7K A;  4YL5 A;  3RTA A;  2VAR A;  1LHP A;  1TYY A;  3HIC A;  3NCA A;  2AA0 A;  1TD2 A;  2PKM A;  2YXT A;  3N1C A;  3RTC A;  5TQI A;  3FHY A;  3H49 A;  2PKF A;  4K93 A;  3NL5 A;  4K8K A;  4JKS A;  1TZ6 A;  3BGK A;  1EKK A;  4XF7 A;  3DZV A;  4LCA A;  1VK4 A;  3LOO A;  2DDO A;  3B1P A;  3RQQ A;  3RRE A;  1ESJ A;  3KEU A;  3LKI A;  3W4S A;  4C5L A;  3NBW A;  5CGA A;  3IE7 A;  4LC4 A;  5BYD A;  1BX4 A;  1JXH A;  1V1B A;  3HYO A;  3LHX A;  2NWH A;  5EYN A;  3PZS A;  1L2L A;  3ZS7 A;  4GM6 A;  1VM7 A;  3PL2 A;  3RTB A;  3K9E A;  3UQE A;  2A9Z A;  5C40 A;  1ESQ A;  3GO7 A;  2ABS A;  1C3Q A;  2R3B A;  3RRF A;  4E8Y A;  3NL3 A;  4X8F A;  4B8S A;  5F0Z A;  4C5K A;  2F02 A;  3RQ6 A;  3DRW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...