1LHPA

Crystal structure of pyridoxal kinase from sheep brain
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
309
structure length
306
Chain Sequence
ECRVLSIQSHVVRGYVGNRAATFPLQVLGFEVDAVNSVQFSNHTGYSHWKGQVLNSDELQELYDGLKLNHVNQYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVMGDQRNGEGAMYVPDDLLPVYREKVVPVADIITPNQFEAELLTGRKIHSQEEALEVMDMLHSMGPDTVVITSSNLLSPRGSDYLMALGSQRTRGSVVTQRIRMEMHKVDAVFVGTGDLFAAMLLAWTHKHPNNLKVACEKTVSAMHHVLQRTIKCAKAKSGEGVKPSPAQLELRMVQSKKDIESPEIVVQATVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of brain pyridoxal kinase, a novel member of the ribokinase superfamily
pubmed doi rcsb
molecule tags Transferase
molecule keywords Pyridoxal kinase
total genus 95
structure length 306
sequence length 309
chains with identical sequence B
ec nomenclature ec 2.7.1.35: Pyridoxal kinase.
pdb deposition date 2002-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08543 Phos_pyr_kin Phosphomethylpyrimidine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1190.20 Alpha Beta 3-Layer(aba) Sandwich UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 1lhpA00
4C5LA 4C5NA 2YXTA 1RFTA 1ESQA 1LIKA 3NM3A 3K9EA 2RBCA 4LCAA 1GC5A 3BGKA 2PKNA 3NL6A 1V1SA 2AFBA 2C4EA 1BX4A 3UBOA 1EKQA 2R3BA 3DZVA 2QCVA 3RS8A 2V78A 1L2LA 1LHPA 3B3LA 3MBJA 3RU3A 3RS9A 3NBWA 4KADA 4B8RA 1UB0A 5EYNA 4E8YA 1WYEA 3EWMA 3RSGA 1RKSA 3IKHA 4S1MA 4C5JA 4LBXA 3RRFA 1LHRA 4JKUA 4N09A 2AA0A 1VM7A 3UQ9A 3GO7A 4E84A 1YGJA 5C3YA 3NCAA 5C41A 3LOOA 2ABSA 2AB8A 3K5WA 3FHYA 3UQ6A 1RKAA 3QAIA 1EKKA 2JG5A 4KANA 4E3AA 3Q1YA 3RSQA 2AJPA 3H49A 4O1GA 5BYEA 4KBEA 4WJMA 4E8ZA 3RQQA 3IN1A 5TRWA 1TZ6A 2AWDA 3RTEA 3RY7A 4X8FA 4N08A 3UQEA 2DCNA 5TQIA 3B1OA 5EY7A 4E69A 3RSFA 3UQDA 5BYFA 3NL2A 1VK4A 3GO6A 3NBVA 5BYCA 1LIJA 4EOHA 3DRWA 4XF7A 2AX3A 1RFUA 2HW1A 3N1CA 4K93A 5CM5A 3RO4A 1YHJA 4DC3A 3KD6A 3NC2A 3RQ5A 4KAHA 4C5MA 3LJSA 3RQ6A 4K8TA 2VARA 5B6AA 2XTBA 1V19A 3RRBA 3RT9A 3RTBA 3RSSA 3RQ2A 4S1IB 4C5KA 2FV7A 4LBGA 3VASA 4YWRA 1LIIA 1JXHA 1V1AA 1UA4A 2Q5RA 3BF5A 4K9CA 3RTCA 2DDMA 1KYHA 3CQDA 3HICA 1U2XA 4JJPA 4K8PA 5F11A 2C49A 3RRJA 3KTNA 3NC9A 3IE7A 3RTAA 3OTXA 1YGKA 4K8CA 2PKMA 3PZSA 3VAQA 3RREA 1JXIA 4EBUA 1V1BA 3W4SA 3RQ8A 3RQHA 1TD2A 3B1RA 3UMOA 2NWHA 1C3QA 3I3YA 4S1IA 3HPDA 4JKSA 4XDAA 2F02A 3RPHA 3RQXA 4B8SA 4UBEA 2JGVA 4EUMA 4O1LA 3FHXA 1TYYA 1GQTA 3JULA 3LKIA 3PL2A 4S1HA 1DGMA 1RFVA 3B1PA 3H74A 3QA2A 1LIOA 2DDOA 4PVVA 3RT7A 2DDWA 2I6BA 2I5BA 3B1QA 3B1NA 5C40A 3UMPA 5F0ZA 3NL3A 3KZHA 2HQQA 4XCKA 3HYOA 4U7XA 4LC4A 3NM1A 4EN4A 5CGEA 3RTGA 4K9IA 4KALA 1RK2A 2PKKA 5BYDA 2F7KA 2JG1A 2AJRA 4DU5A 1ESJA 3RPZA 2YXUA 2QHPA 5CGAA 1VI9A 4GM6A 4E8WA 2A9ZA 3RU2A 1RKDA 4K8KA 3IBQA 3ZS7A 3KEUA 2ABQA 3MBHA 2R3EA 3IH0A 1TZ3A 5C3ZA 2A9YA 5COJA 3NL5A 3Q92A 4XF6A 2I6AA 2HLZA 3GBUA 4YL5A 3RM5A 3IQ0A 3LHXA 3RTDA 2PKFA
chains in the Genus database with same CATH superfamily
4C5LA 4C5NA 2YXTA 1RFTA 1ESQA 1LIKA 3NM3A 4UAGA 3K9EA 2RBCA 3N2AA 4LCAA 2UUOA 2X5OA 1GC5A 3BGKA 2PKNA 3NL6A 1V1SA 2AFBA 2C4EA 1BX4A 4CVKA 3IQ0A 3UBOA 1EKQA 2R3BA 5A5EA 2GC6A 3DZVA 3HJ6A 2QCVA 3RS8A 2V78A 1L2LA 1LHPA 3B3LA 3MBJA 3RU3A 3RS9A 3NBWA 1GQYA 4KADA 1UB0A 5EYNA 2VORA 4B8RA 1WYEA 3EWMA 4E8YA 3RSGA 1RKSA 3IKHA 4S1MA 4C5JA 4LBXA 3RRFA 1LHRA 1W78A 4JKUA 4N09A 2AA0A 1VM7A 3UQ9A 3ZL8A 3GO7A 4E84A 1YGJA 5C3YA 3NCAA 5C41A 2XJAA 3LOOA 1GQQA 2ABSA 1O5ZA 2AB8A 2WTZA 3FHYA 1P31A 3K5WA 1RKAA 5A5FA 1E8CA 3QAIA 1EKKA 3ZM6A 3UQ6A 2JG5A 4KANA 4E3AA 3Q1YA 3RSQA 2AJPA 3H49A 4O1GA 5BYEA 4KBEA 1GG4A 4WJMA 4E8ZA 3RQQA 3IN1A 2GCAA 5TRWA 1TZ6A 2VTEA 2AWDA 2AM1A 2Y1OA 4QF5A 3RTEA 2Y66A 1EEHA 3RY7A 4X8FA 4N08A 3UQEA 5C40A 2DCNA 5TQIA 3B1OA 5EY7A 4E69A 3RSFA 3UQDA 5BYFA 3NL2A 1VK4A 3GO6A 3NBVA 5BYCA 4C12A 1LIJA 3HN7A 4EOHA 3DRWA 4XF7A 2AX3A 2XPCA 1RFUA 2HW1A 3N1CA 4K93A 2JFHA 5CM5A 1YHJA 3RO4A 2VOSA 3KD6A 3NC2A 4DC3A 3RQ5A 4CVLA 3ZM5A 4KAHA 4C5MA 3LJSA 3RQ6A 4K8TA 4HV4A 2VARA 4QDIA 4BUBA 5B6AA 2XTBA 1JBVA 1V19A 3RRBA 3RT9A 3RTBA 3RSSA 4BUCA 3RQ2A 2UAGA 4S1IB 4C5KA 2FV7A 4LBGA 3VASA 4YWRA 1LIIA 4C13A 1JXHA 1V1AA 1UA4A 2JFGA 2Q5RA 3BF5A 3NRSA 2AM2A 4K9CA 5F0ZA 3RTCA 2DDMA 1KYHA 1P3DA 2F00A 1U2XA 3CQDA 3HICA 4JJPA 4K8PA 5F11A 2C49A 3RRJA 3KTNA 3NC9A 3IE7A 3RTAA 3OTXA 1YGKA 4K8CA 2PKMA 3PZSA 3VAQA 3RREA 1JXIA 4EBUA 1V1BA 3W4SA 3RQ8A 3RQHA 1TD2A 4CVMA 3B1RA 3UMOA 2NWHA 2GCBA 1C3QA 3GBUA 3I3YA 3PYZA 4S1IA 3HPDA 4JKSA 4XDAA 2F02A 3RPHA 3RQXA 4B8SA 4UBEA 2JGVA 4EUMA 4O1LA 3FHXA 1TYYA 1GQTA 3JULA 3LKIA 1E0DA 3PL2A 4S1HA 1DGMA 1RFVA 2UUPA 3B1PA 3H74A 1LIOA 1J6UA 2DDOA 3QA2A 2DDWA 2I6BA 2I5BA 3B1QA 3B1NA 4PVVA 3RT7A 3UAGA 3UMPA 4ZIYA 3NL3A 3KZHA 2HQQA 3QCZA 4XCKA 3HYOA 1JBWA 4U7XA 4LC4A 3NM1A 4EN4A 2VTDA 3EAGA 5CGEA 3RTGA 4K9IA 4KALA 1RK2A 2PKKA 5BYDA 2F7KA 2JG1A 2AJRA 2Y68A 1W7KA 1ESJA 4DU5A 3RPZA 2JFFA 2QHPA 1FGSA 1VI9A 1UAGA 2YXUA 5CGAA 4GM6A 4E8WA 2A9ZA 3RU2A 1RKDA 4K8KA 3IBQA 3ZS7A 3KEUA 2ABQA 3MBHA 2R3EA 3IH0A 1TZ3A 5C3ZA 3LK7A 2A9YA 5COJA 3NL5A 3Q92A 4XF6A 2I6AA 2HLZA 2GC5A 4YL5A 3RM5A 2Y67A 3LHXA 3RTDA 2PKFA 2WJPA
chains in the Genus database with same CATH topology
4C5LA 4C5NA 2YXTA 1RFTA 1ESQA 1LIKA 3NM3A 3K9EA 2RBCA 4LCAA 1GC5A 3BGKA 2PKNA 3NL6A 1V1SA 2AFBA 2C4EA 1BX4A 3UBOA 1EKQA 2R3BA 3DZVA 3HJ6A 2QCVA 3RS8A 2V78A 1L2LA 1LHPA 3B3LA 3MBJA 3RU3A 3RS9A 3NBWA 4KADA 4B8RA 1UB0A 5EYNA 4E8YA 1WYEA 3EWMA 3RSGA 1RKSA 3IKHA 4S1MA 4C5JA 4LBXA 3RRFA 1LHRA 4JKUA 4N09A 2AA0A 1VM7A 3UQ9A 3GO7A 4E84A 1YGJA 5C3YA 3NCAA 5C41A 3LOOA 2ABSA 2AB8A 3K5WA 3FHYA 3UQ6A 1RKAA 3QAIA 1EKKA 2JG5A 4KANA 4E3AA 3Q1YA 3RSQA 2AJPA 3H49A 4O1GA 5BYEA 4KBEA 4WJMA 4E8ZA 3RQQA 3IN1A 5TRWA 1TZ6A 2AWDA 3RTEA 3RY7A 4X8FA 4N08A 3UQEA 2DCNA 5TQIA 3B1OA 5EY7A 4E69A 3RSFA 3UQDA 5BYFA 3NL2A 1VK4A 3GO6A 3NBVA 5BYCA 1LIJA 4EOHA 3DRWA 4XF7A 2AX3A 1RFUA 2HW1A 3N1CA 4K93A 5CM5A 3RO4A 1YHJA 4DC3A 3KD6A 3NC2A 3RQ5A 4KAHA 4C5MA 3LJSA 3RQ6A 4K8TA 2VARA 5B6AA 2XTBA 1V19A 3RRBA 3RT9A 3RTBA 3RSSA 3RQ2A 4S1IB 4C5KA 2FV7A 4LBGA 3VASA 4YWRA 1LIIA 1JXHA 1V1AA 1UA4A 2Q5RA 3BF5A 4K9CA 3RTCA 2DDMA 1KYHA 3CQDA 3HICA 1U2XA 4JJPA 4K8PA 5F11A 2C49A 3RRJA 3KTNA 3NC9A 3IE7A 3RTAA 3OTXA 1YGKA 4K8CA 2PKMA 3PZSA 3VAQA 3RREA 1JXIA 4EBUA 1V1BA 3W4SA 3RQ8A 3RQHA 1TD2A 3B1RA 3UMOA 2NWHA 1C3QA 3I3YA 4S1IA 3HPDA 4JKSA 4XDAA 2F02A 3RPHA 3RQXA 4B8SA 4UBEA 2JGVA 4EUMA 4O1LA 3FHXA 1TYYA 1GQTA 3JULA 3LKIA 3PL2A 4S1HA 1DGMA 1RFVA 3B1PA 3H74A 3QA2A 1LIOA 2DDOA 4PVVA 3RT7A 2DDWA 2I6BA 2I5BA 3B1QA 3B1NA 5C40A 3UMPA 5F0ZA 3NL3A 3KZHA 2HQQA 4XCKA 3HYOA 4U7XA 4LC4A 3NM1A 4EN4A 5CGEA 3RTGA 4K9IA 4KALA 1RK2A 2PKKA 5BYDA 2F7KA 2JG1A 2AJRA 4DU5A 1ESJA 3RPZA 2YXUA 2QHPA 5CGAA 1VI9A 4GM6A 4E8WA 2A9ZA 3RU2A 1RKDA 4K8KA 3IBQA 3ZS7A 3KEUA 2ABQA 3MBHA 2R3EA 3IH0A 1TZ3A 5C3ZA 2A9YA 5COJA 3NL5A 3Q92A 4XF6A 2I6AA 2HLZA 3GBUA 4YL5A 3RM5A 3IQ0A 3LHXA 3RTDA 2PKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C5L A;  4C5N A;  2YXT A;  1RFT A;  1ESQ A;  1LIK A;  3NM3 A;  3K9E A;  2RBC A;  4LCA A;  1GC5 A;  3BGK A;  2PKN A;  3NL6 A;  1V1S A;  2AFB A;  2C4E A;  1BX4 A;  3UBO A;  1EKQ A;  2R3B A;  3DZV A;  2QCV A;  3RS8 A;  2V78 A;  1L2L A;  1LHP A;  3B3L A;  3MBJ A;  3RU3 A;  3RS9 A;  3NBW A;  4KAD A;  4B8R A;  1UB0 A;  5EYN A;  4E8Y A;  1WYE A;  3EWM A;  3RSG A;  1RKS A;  3IKH A;  4S1M A;  4C5J A;  4LBX A;  3RRF A;  1LHR A;  4JKU A;  4N09 A;  2AA0 A;  1VM7 A;  3UQ9 A;  3GO7 A;  4E84 A;  1YGJ A;  5C3Y A;  3NCA A;  5C41 A;  3LOO A;  2ABS A;  2AB8 A;  3K5W A;  3FHY A;  3UQ6 A;  1RKA A;  3QAI A;  1EKK A;  2JG5 A;  4KAN A;  4E3A A;  3Q1Y A;  3RSQ A;  2AJP A;  3H49 A;  4O1G A;  5BYE A;  4KBE A;  4WJM A;  4E8Z A;  3RQQ A;  3IN1 A;  5TRW A;  1TZ6 A;  2AWD A;  3RTE A;  3RY7 A;  4X8F A;  4N08 A;  3UQE A;  2DCN A;  5TQI A;  3B1O A;  5EY7 A;  4E69 A;  3RSF A;  3UQD A;  5BYF A;  3NL2 A;  1VK4 A;  3GO6 A;  3NBV A;  5BYC A;  1LIJ A;  4EOH A;  3DRW A;  4XF7 A;  2AX3 A;  1RFU A;  2HW1 A;  3N1C A;  4K93 A;  5CM5 A;  3RO4 A;  1YHJ A;  4DC3 A;  3KD6 A;  3NC2 A;  3RQ5 A;  4KAH A;  4C5M A;  3LJS A;  3RQ6 A;  4K8T A;  2VAR A;  5B6A A;  2XTB A;  1V19 A;  3RRB A;  3RT9 A;  3RTB A;  3RSS A;  3RQ2 A;  4S1I B;  4C5K A;  2FV7 A;  4LBG A;  3VAS A;  4YWR A;  1LII A;  1JXH A;  1V1A A;  1UA4 A;  2Q5R A;  3BF5 A;  4K9C A;  3RTC A;  2DDM A;  1KYH A;  3CQD A;  3HIC A;  1U2X A;  4JJP A;  4K8P A;  5F11 A;  2C49 A;  3RRJ A;  3KTN A;  3NC9 A;  3IE7 A;  3RTA A;  3OTX A;  1YGK A;  4K8C A;  2PKM A;  3PZS A;  3VAQ A;  3RRE A;  1JXI A;  4EBU A;  1V1B A;  3W4S A;  3RQ8 A;  3RQH A;  1TD2 A;  3B1R A;  3UMO A;  2NWH A;  1C3Q A;  3I3Y A;  4S1I A;  3HPD A;  4JKS A;  4XDA A;  2F02 A;  3RPH A;  3RQX A;  4B8S A;  4UBE A;  2JGV A;  4EUM A;  4O1L A;  3FHX A;  1TYY A;  1GQT A;  3JUL A;  3LKI A;  3PL2 A;  4S1H A;  1DGM A;  1RFV A;  3B1P A;  3H74 A;  3QA2 A;  1LIO A;  2DDO A;  4PVV A;  3RT7 A;  2DDW A;  2I6B A;  2I5B A;  3B1Q A;  3B1N A;  5C40 A;  3UMP A;  5F0Z A;  3NL3 A;  3KZH A;  2HQQ A;  4XCK A;  3HYO A;  4U7X A;  4LC4 A;  3NM1 A;  4EN4 A;  5CGE A;  3RTG A;  4K9I A;  4KAL A;  1RK2 A;  2PKK A;  5BYD A;  2F7K A;  2JG1 A;  2AJR A;  4DU5 A;  1ESJ A;  3RPZ A;  2YXU A;  2QHP A;  5CGA A;  1VI9 A;  4GM6 A;  4E8W A;  2A9Z A;  3RU2 A;  1RKD A;  4K8K A;  3IBQ A;  3ZS7 A;  3KEU A;  2ABQ A;  3MBH A;  2R3E A;  3IH0 A;  1TZ3 A;  5C3Z A;  2A9Y A;  5COJ A;  3NL5 A;  3Q92 A;  4XF6 A;  2I6A A;  2HLZ A;  3GBU A;  4YL5 A;  3RM5 A;  3IQ0 A;  3LHX A;  3RTD A;  2PKF A; 
#chains in the Genus database with same CATH topology
 4C5L A;  4C5N A;  2YXT A;  1RFT A;  1ESQ A;  1LIK A;  3NM3 A;  4UAG A;  3K9E A;  2RBC A;  3N2A A;  4LCA A;  2UUO A;  2X5O A;  1GC5 A;  3BGK A;  2PKN A;  3NL6 A;  1V1S A;  2AFB A;  2C4E A;  1BX4 A;  4CVK A;  3IQ0 A;  3UBO A;  1EKQ A;  2R3B A;  5A5E A;  2GC6 A;  3DZV A;  3HJ6 A;  2QCV A;  3RS8 A;  2V78 A;  1L2L A;  1LHP A;  3B3L A;  3MBJ A;  3RU3 A;  3RS9 A;  3NBW A;  1GQY A;  4KAD A;  1UB0 A;  5EYN A;  2VOR A;  4B8R A;  1WYE A;  3EWM A;  4E8Y A;  3RSG A;  1RKS A;  3IKH A;  4S1M A;  4C5J A;  4LBX A;  3RRF A;  1LHR A;  1W78 A;  4JKU A;  4N09 A;  2AA0 A;  1VM7 A;  3UQ9 A;  3ZL8 A;  3GO7 A;  4E84 A;  1YGJ A;  5C3Y A;  3NCA A;  5C41 A;  2XJA A;  3LOO A;  1GQQ A;  2ABS A;  1O5Z A;  2AB8 A;  2WTZ A;  3FHY A;  1P31 A;  3K5W A;  1RKA A;  5A5F A;  1E8C A;  3QAI A;  1EKK A;  3ZM6 A;  3UQ6 A;  2JG5 A;  4KAN A;  4E3A A;  3Q1Y A;  3RSQ A;  2AJP A;  3H49 A;  4O1G A;  5BYE A;  4KBE A;  1GG4 A;  4WJM A;  4E8Z A;  3RQQ A;  3IN1 A;  2GCA A;  5TRW A;  1TZ6 A;  2VTE A;  2AWD A;  2AM1 A;  2Y1O A;  4QF5 A;  3RTE A;  2Y66 A;  1EEH A;  3RY7 A;  4X8F A;  4N08 A;  3UQE A;  5C40 A;  2DCN A;  5TQI A;  3B1O A;  5EY7 A;  4E69 A;  3RSF A;  3UQD A;  5BYF A;  3NL2 A;  1VK4 A;  3GO6 A;  3NBV A;  5BYC A;  4C12 A;  1LIJ A;  3HN7 A;  4EOH A;  3DRW A;  4XF7 A;  2AX3 A;  2XPC A;  1RFU A;  2HW1 A;  3N1C A;  4K93 A;  2JFH A;  5CM5 A;  1YHJ A;  3RO4 A;  2VOS A;  3KD6 A;  3NC2 A;  4DC3 A;  3RQ5 A;  4CVL A;  3ZM5 A;  4KAH A;  4C5M A;  3LJS A;  3RQ6 A;  4K8T A;  4HV4 A;  2VAR A;  4QDI A;  4BUB A;  5B6A A;  2XTB A;  1JBV A;  1V19 A;  3RRB A;  3RT9 A;  3RTB A;  3RSS A;  4BUC A;  3RQ2 A;  2UAG A;  4S1I B;  4C5K A;  2FV7 A;  4LBG A;  3VAS A;  4YWR A;  1LII A;  4C13 A;  1JXH A;  1V1A A;  1UA4 A;  2JFG A;  2Q5R A;  3BF5 A;  3NRS A;  2AM2 A;  4K9C A;  5F0Z A;  3RTC A;  2DDM A;  1KYH A;  1P3D A;  2F00 A;  1U2X A;  3CQD A;  3HIC A;  4JJP A;  4K8P A;  5F11 A;  2C49 A;  3RRJ A;  3KTN A;  3NC9 A;  3IE7 A;  3RTA A;  3OTX A;  1YGK A;  4K8C A;  2PKM A;  3PZS A;  3VAQ A;  3RRE A;  1JXI A;  4EBU A;  1V1B A;  3W4S A;  3RQ8 A;  3RQH A;  1TD2 A;  4CVM A;  3B1R A;  3UMO A;  2NWH A;  2GCB A;  1C3Q A;  3GBU A;  3I3Y A;  3PYZ A;  4S1I A;  3HPD A;  4JKS A;  4XDA A;  2F02 A;  3RPH A;  3RQX A;  4B8S A;  4UBE A;  2JGV A;  4EUM A;  4O1L A;  3FHX A;  1TYY A;  1GQT A;  3JUL A;  3LKI A;  1E0D A;  3PL2 A;  4S1H A;  1DGM A;  1RFV A;  2UUP A;  3B1P A;  3H74 A;  1LIO A;  1J6U A;  2DDO A;  3QA2 A;  2DDW A;  2I6B A;  2I5B A;  3B1Q A;  3B1N A;  4PVV A;  3RT7 A;  3UAG A;  3UMP A;  4ZIY A;  3NL3 A;  3KZH A;  2HQQ A;  3QCZ A;  4XCK A;  3HYO A;  1JBW A;  4U7X A;  4LC4 A;  3NM1 A;  4EN4 A;  2VTD A;  3EAG A;  5CGE A;  3RTG A;  4K9I A;  4KAL A;  1RK2 A;  2PKK A;  5BYD A;  2F7K A;  2JG1 A;  2AJR A;  2Y68 A;  1W7K A;  1ESJ A;  4DU5 A;  3RPZ A;  2JFF A;  2QHP A;  1FGS A;  1VI9 A;  1UAG A;  2YXU A;  5CGA A;  4GM6 A;  4E8W A;  2A9Z A;  3RU2 A;  1RKD A;  4K8K A;  3IBQ A;  3ZS7 A;  3KEU A;  2ABQ A;  3MBH A;  2R3E A;  3IH0 A;  1TZ3 A;  5C3Z A;  3LK7 A;  2A9Y A;  5COJ A;  3NL5 A;  3Q92 A;  4XF6 A;  2I6A A;  2HLZ A;  2GC5 A;  4YL5 A;  3RM5 A;  2Y67 A;  3LHX A;  3RTD A;  2PKF A;  2WJP A; 
#chains in the Genus database with same CATH homology
 4C5L A;  4C5N A;  2YXT A;  1RFT A;  1ESQ A;  1LIK A;  3NM3 A;  3K9E A;  2RBC A;  4LCA A;  1GC5 A;  3BGK A;  2PKN A;  3NL6 A;  1V1S A;  2AFB A;  2C4E A;  1BX4 A;  3UBO A;  1EKQ A;  2R3B A;  3DZV A;  3HJ6 A;  2QCV A;  3RS8 A;  2V78 A;  1L2L A;  1LHP A;  3B3L A;  3MBJ A;  3RU3 A;  3RS9 A;  3NBW A;  4KAD A;  4B8R A;  1UB0 A;  5EYN A;  4E8Y A;  1WYE A;  3EWM A;  3RSG A;  1RKS A;  3IKH A;  4S1M A;  4C5J A;  4LBX A;  3RRF A;  1LHR A;  4JKU A;  4N09 A;  2AA0 A;  1VM7 A;  3UQ9 A;  3GO7 A;  4E84 A;  1YGJ A;  5C3Y A;  3NCA A;  5C41 A;  3LOO A;  2ABS A;  2AB8 A;  3K5W A;  3FHY A;  3UQ6 A;  1RKA A;  3QAI A;  1EKK A;  2JG5 A;  4KAN A;  4E3A A;  3Q1Y A;  3RSQ A;  2AJP A;  3H49 A;  4O1G A;  5BYE A;  4KBE A;  4WJM A;  4E8Z A;  3RQQ A;  3IN1 A;  5TRW A;  1TZ6 A;  2AWD A;  3RTE A;  3RY7 A;  4X8F A;  4N08 A;  3UQE A;  2DCN A;  5TQI A;  3B1O A;  5EY7 A;  4E69 A;  3RSF A;  3UQD A;  5BYF A;  3NL2 A;  1VK4 A;  3GO6 A;  3NBV A;  5BYC A;  1LIJ A;  4EOH A;  3DRW A;  4XF7 A;  2AX3 A;  1RFU A;  2HW1 A;  3N1C A;  4K93 A;  5CM5 A;  3RO4 A;  1YHJ A;  4DC3 A;  3KD6 A;  3NC2 A;  3RQ5 A;  4KAH A;  4C5M A;  3LJS A;  3RQ6 A;  4K8T A;  2VAR A;  5B6A A;  2XTB A;  1V19 A;  3RRB A;  3RT9 A;  3RTB A;  3RSS A;  3RQ2 A;  4S1I B;  4C5K A;  2FV7 A;  4LBG A;  3VAS A;  4YWR A;  1LII A;  1JXH A;  1V1A A;  1UA4 A;  2Q5R A;  3BF5 A;  4K9C A;  3RTC A;  2DDM A;  1KYH A;  3CQD A;  3HIC A;  1U2X A;  4JJP A;  4K8P A;  5F11 A;  2C49 A;  3RRJ A;  3KTN A;  3NC9 A;  3IE7 A;  3RTA A;  3OTX A;  1YGK A;  4K8C A;  2PKM A;  3PZS A;  3VAQ A;  3RRE A;  1JXI A;  4EBU A;  1V1B A;  3W4S A;  3RQ8 A;  3RQH A;  1TD2 A;  3B1R A;  3UMO A;  2NWH A;  1C3Q A;  3I3Y A;  4S1I A;  3HPD A;  4JKS A;  4XDA A;  2F02 A;  3RPH A;  3RQX A;  4B8S A;  4UBE A;  2JGV A;  4EUM A;  4O1L A;  3FHX A;  1TYY A;  1GQT A;  3JUL A;  3LKI A;  3PL2 A;  4S1H A;  1DGM A;  1RFV A;  3B1P A;  3H74 A;  3QA2 A;  1LIO A;  2DDO A;  4PVV A;  3RT7 A;  2DDW A;  2I6B A;  2I5B A;  3B1Q A;  3B1N A;  5C40 A;  3UMP A;  5F0Z A;  3NL3 A;  3KZH A;  2HQQ A;  4XCK A;  3HYO A;  4U7X A;  4LC4 A;  3NM1 A;  4EN4 A;  5CGE A;  3RTG A;  4K9I A;  4KAL A;  1RK2 A;  2PKK A;  5BYD A;  2F7K A;  2JG1 A;  2AJR A;  4DU5 A;  1ESJ A;  3RPZ A;  2YXU A;  2QHP A;  5CGA A;  1VI9 A;  4GM6 A;  4E8W A;  2A9Z A;  3RU2 A;  1RKD A;  4K8K A;  3IBQ A;  3ZS7 A;  3KEU A;  2ABQ A;  3MBH A;  2R3E A;  3IH0 A;  1TZ3 A;  5C3Z A;  2A9Y A;  5COJ A;  3NL5 A;  3Q92 A;  4XF6 A;  2I6A A;  2HLZ A;  3GBU A;  4YL5 A;  3RM5 A;  3IQ0 A;  3LHX A;  3RTD A;  2PKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...