1LJLA

Wild type pi258 s. aureus arsenate reductase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
130
structure length
130
Chain Sequence
DKKTIYFICTGNSCRSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDADNNCPILPPNVKKEHWGFDDPAGKEWSEFQRVRDEIKLAIEKFKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title All intermediates of the arsenate reductase mechanism, including an intramolecular dynamic disulfide cascade.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
molecule keywords arsenate reductase
total genus 48
structure length 130
sequence length 130
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2002-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ljlA00
4Q6WA 1GLGA 1DRKA 4MR8B 4PZ0A 5I4CA 1JFTA 3DBIA 5TQJA 1C4WA 4L4UA 1R8JA 4MR7A 2PUBA 1H9CA 4LDAA 5FWXB 2E4ZA 3O75A 3LKBA 1EWKA 2GX6A 5F64A 1F51E 4RWEA 3G85A 1EAYA 3A0UA 4KQ9A 3I09A 1XWWA 4EYKA 1BA2A 4MLCA 1L5ZA 4YWHA 1TJYA 1NY5A 2FW0A 1E2BA 4XLTA 1QO0D 5KWSA 5TQ0A 2MYTA 3KG2A 4O5AA 3HO1A 5TE9A 4OBBA 2QVGA 4S04A 1SXGA 2PUCA 3RVJA 3L6UA 2A9PA 2PAFA 4DADA 1NXXA 2PUAA 3S99A 1ZDMA 3IP5A 4O1HA 4ZPJA 4B09A 4JB0A 3H1EA 2NZUG 3C6QA 3LUKA 3OO0A 1ISRA 4E7OA 1QQAA 2F8TA 1DBPA 3BILA 1BDJA 2QU7A 1JF8A 3N0WA 2LBPA 3DLHA 5IUNC 4HNSA 1ZH4A 4TMYA 1RNLA 4H3KB 2FEKA 3NNSA 1Z25A 1DG9A 5DCLA 1RZRD 3LUHA 3QLVA 3HVRA 2TMYA 3RQIA 1QMPA 3H5LA 1Z12A 3LUFA 4KREA 3K9CA 1TM2A 1NXOA 4Z9AA 6ABPA 1OXKB 2MSWA 3SAJA 3MQ4A 4G0YA 1D5WA 2PL1A 4KV7A 5FWYA 1TLFA 4G0PA 4Q6BA 5DKFA 1LBIA 4XARA 4EVRA 1F4VA 5BQ3A 4WZZA 2E4UA 4RK0A 1E6LA 2A9RA 2JK1A 4TLMB 3RVOA 4MS1B 3EULA 4F06A 4Z99A 7ABPA 4RV5A 2QSJA 5DLEA 1USGA 1I3CA 1QPZA 4E7PA 2JVIA 5CNKA 1SRRA 1C0EA 5CHYA 3I5AA 1YTUA 1P6UA 1DP4A 3KKEA 3QELB 1GCGA 3KTOA 4YRZA 5T3YA 4MPTA 1EFAA 4EGSA 3HSYA 3GBPA 4HNQA 1P2FA 2XDYA 5EWJA 5JNWA 3IP9A 3O74A 3N0RA 4Q7EA 1Z15A 3DGFC 4XFKA 2PUFA 5JNTA 4RXMA 2GWRA 1DBWA 2FEPA 3H5VA 3RVRA 2ID7A 4MS1A 4Z4CA 3CTPA 4JAVC 3UKJA 1EHCA 4F12A 5IC5A 4NV3A 4F3TA 2N9UA 1W9HA 4N76A 2FQYA 3GBVA 3O1HB 3HUTA 3EJWA 4NQRA 3LMKA 3T6KA 3LFTA 3DLBA 2Q5CA 2E4VA 3QLTA 1JFSA 1BAPA 3CS3A 4Z9BA 3JPWA 3BRSA 3H5IA 3FFTA 4G0XA 3A10A 3HDGA 4XAQA 5DTEA 3VNBA 3FDFA 5C5CA 1MVOA 4FE4A 2JRLA 3DZDA 3BBLA 2IKSA 2PLNA 2L2QA 4RSMA 2JVKA 3O21A 2GBPA 4WXEA 4IGAA 5EWLA 1ZN2A 4RK5A 1JYEA 4RK1A 1JLKA 5HKOA 3QEMA 1U0SY 2QW1A 3N6VA 1VKRA 2MSLA 1NXSA 1J56A 1E6KA 3BREA 4G0ZA 2M1ZA 2IOYA 1YVUA 5CNJA 4RK6A 1SXIA 1D1QA 4MR7B 4YP9A 4W5NA 1FSPA 3E3MA 4EVSA 2FTKE 2RDMA 3RVKA 1L5YA 1M5UA 4N0PA 1YMVA 4G0QA 1DJMA 5JNVA 3HJFA 1ABEA 2VUHB 4UHJA 3RVPA 2FSPA 1NXPA 4CBVA 1D2AA 3OLVA 4JA2A 4RY8A 1ISSA 2PE5A 4UHKA 4OLBA 1LJUA 5TPZA 4F11A 3NHZA 3C97A 3OQMA 1YIOA 4WUTA 3QX9A 3ROFA 4MLDA 5EWLB 1D1PA 3CG0A 4MQEA 4ZMRA 3HV2A 5JNRA 4EYGA 3QEMB 2PUGA 5E3JA 1KRWA 4GPAA 2FKAA 2GKGA 4WWHA 2KYRA 1Z18A 3MA0A 2FLKA 4YV7A 3CZCA 3RVSA 2F8SA 3H5TA 1XHFA 5IEBA 5T7BA 1QQBA 3K4HA 4MAAA 1ZHHA 1NTRA 4Z4GA 4L85A 3Q15C 3HCWA 1FQWA 4LRQA 1PNTA 3M9WA 1ABFA 2QV0A 4ETIA 3F7NA 1DRJA 3P9YA 3CRNA 1AB5A 1UDRA 2FQXA 2CHFA 3FMVA 3OLZA 3RH0A 4IILA 4KVFA 3SNKA 2MYPA 1U8TA 1FFGA 4YCSA 1JWLA 1LJLA 4MQEB 2GI4A 3QEKA 1QNLA 1XHEA 3LUDA 3T95A 2W42A 1PEYA 1Z17A 4TN5A 1Z2DA 1PNRA 4OLAA 2IPLA 3N75A 1ZH2A 2PJUA 4OTZA 1GUDA 4TLLB 5C5EA 2WMYA 1RXEA 3OO1A 2QXYA 4YO7A 2FMKA 2WJWA 3RVLA 3T8YA 4EUKA 4MR9B 4YS6A 1GCAA 4YR7A 5CNMA 3JVDA 3Q41A 2FN9A 4QICA 3QELA 1DCMA 1MB0A 3OLXA 5TPZD 2NZVG 2HQRA 1USKA 3M9XA 1M2FA 3O1IC 5HSGA 1JX6A 4MRMB 4PICA 1PUXA 5DGCA 5HQJA 2IPMA 4LZLA 2E4YA 1S8NA 1YK1A 3H1FA 4D6YA 1ZAYA 4KRFA 3OLWA 3TMYA 2FMFA 3KLOA 1U2QA 1TVMA 3SY8A 4FE7A 3QK7A 3GRCA 4LE0A 3JVIA 4ML3A 3FFXA 3QLUC 4ZMSA 2LPMA 5B3JA 2FLWA 1WETA 4JP1A 3RVQA 2M98A 3OM0A 1RPJA 3T38A 1JBEA 3FFWA 3N0XA 4JB2A 4PEVA 1NATA 1DC7A 3LTEA 3LUGA 1A04A 3MIZA 4ETMA 1JYFA 1QKKA 2FVYA 3W9SA 2R25B 3GL9A 4D6XA 3OMWA 2NUBA 4MGEA 3CHYA 1Z2EA 3JPYA 3Q7RA 1URPA 4MR9A 5FBHA 4DQDA 3JY6A 1JDPA 4RXTA 2R48A 4W5QA 5KQPA 4ZJPA 3HS3A 1FFSA 3HEBA 1K68A 3EAFA 2HJ9A 2VK2A 3IP7A 4MRMA 5JNSA 3F73A 1PEAA 2FMIA 4JOQA 3NNDA 3GYBA 2NT3A 2L17A 3EQ2A 1JHZA 3MMNA 3C3WA 3FGZA 5IBQA 4RKRA 4LDZA 3H5WA 1K66A 3I42A 5EWMB 1KRXA 6CHYA 2QVCA 1PHRA 2R47A 3H6HA 2HQOA 2L19A 4RXUA 1DC8A 3DGEC 4F8JA 4KNYA 3NNNA 3EDCA 1NXWA 4KPYA 2OENG 2JBAB 4P1ZA 5B3JC 4G0OA 1T34A 3KSMA 4HYEA 1W25A 4RK7A 2WY2D 3B2NA 5BRAA 2HPHA 3HUUA 4W5TA 4FB4A 1Z26A 4QYMA 4RY9A 2VUIB 3EGCA 4LX8A 2R4QA 3EQZA 1A2OA 2X7XA 3HM9A 5IX8A 4MQFB 4OATA 2OQRA 3LKVA 4GNRA 3QLVC 4IMIB 4OG2A 4G97A 3Q7SA 4Z4EA 1DCFA 2CHEA 4KMRA 5GOTA 3C3KA 4Z4HA 4EY3A 3Q7TA 2E4WA 1KMIY 3CKMA 4PYRA 2DRIA 2ZWMA 3O2QB 5TPWB 4N41A 3MM4A 4WXMA 5TQ2A 4PE5B 4WT7A 5EWMA 2IYNA 1CHNA 4EYOA 1ZGGA 3KJXA 2P4UA 3H1GA 2B4AA 2ID9A 4G86A 4RY0A 5KQMA 3JS5A 2FN8A 2L18A 4QYWA 2JBAA 3C3MA 2JCGA 1HEYA 4RU1A 2AYZA 3RVNA 3ILYA 3A3KA 1A0OA 2FEWB 3E61A 2RJOA 3MF4A 3HK2A 3GWGA 3EODA 4MS3B 1Z13A 3HDVA 4YLEA 2A9OA 3I45A 2JVJA 3G1WA 4Z4IA 3R0JA 1NXVA 3IP6A 3H6GA 1M2EA 1DCKA 3TX6A 1M5TA 5GQSA 4MYRA 5FWXA 2WB4A 5KI6A 1RZRA 3D02A 3BRQA 4NICA 4EVQA 4IRXA 3QLUA 1SXHA 3LUAA 1EWVA 3TD9A 5TQ2B 4IF4A 4O1IA 4D74A 3LOPA 1YS7A 3TO5A 3KHTA 1BVHA 3OLYA 1DZ3A 4KK4A 5TQ0B 4LE1A 4KZKA 1BDHA 2RJNA 1U2PA 2FQWA 5JS2A 2FMHA 3KYIB 4XASA 2JB9A 2B1JA 4MS4B 2PKXA 3UK0A 2LUOA 4RK4A 5IEJA 1GUBA 1AB6A 1ZGZA 1U04A 2J48A 4HNRA 3GA5A 3L49A 3KLNA 4QPJC 5KC9A 3A0RB 4H3HB 4IMJB 1JL3A 2FXIA 3F6PA 2LIVA 1B00A 5JNUA 3H5OA 1APBA 1YK0A 1MB3A 2CWDA 1Z16A 4Y9TA 4XXHA 4DN6A 1ZY2A 4KK3A 3H75A 9ABPA 2MYNA 5BRJA 4JASB 3Q9SA 5PNTA 3ROTA 3VNAA 1USIA 3SM9A 2IPAB 5ED4A 4P98A 4NCBA 1YMUA 1LBHA 3LUJA 1D4ZA 3GV0A 5CNIA 5FWYB 2VYCA 3M6MD 2QR3A 1TMYA 1VLZA 2YHAA 3OQNA 4RDCA 3OMXA 5HM6A 1Y1LA 1MAVA 2P9HA 4MS4A 3UUGA 1QP7A 4Z4FA 4N0QA 2WWVD 3CLKA 2HQBA 1BDIA 2ZAYA 3NHMA 1OXBB 3SG0A 3GT7A 4RS3A 1JH9A 3F6CA 4N03A 1P8AA 2O20A 8ABPA 1IIBA 4S05A 3RVMA 3O2JA 2LP4Y 1KGSA 2YHBA 3JTEA 5ABPA 3OQOA 2BGGA 1ZESA 2MYUA 3NBMA 5JS1A 1ZVVA 1FFWA 1LK0A 2PUEA 5EWJB 2V0NA 2AYXA 4NCAA 3LUCA 3HZHA 1SD5A 2PL9A 4KQCA 5BR1A 2E4XA 4RKQA 1QP0A 4ETNA 3N53A 2I6FA 1QO0A 1JDNA 2IPNA 3D8UA 3O2SB 1QP4A 1CEYA 3IPCA 3KS9A 1E6MA 3SQNA 4M88A 4RZSA 3O1JC 1NXTA 4LE2A 3IDOA 1P6QA 4MR8A 1DBQA 1RXIA 3N8IA 4H60A 4MQFA 5KQLA 4W5OA 4G0MA 1VPWA 3OM1A 5D2CA 5IUKC 3CG4A 2HSGA 5IULC 1CYEA 1EWTA 1VRVA 1YS6A 4YGXB 4N47A 4ZYLA 2CD7A 3ILHA 1JFVA 5TPWA 3KCNA 3TB6A 3URMA 2WJAA 5KC8A 4W5RA 2NT4A 2QZJA 5IUJC 5FBKA 2H0AA 3CU5A 2MSKA 4KFCA 3HXMA 2RGYA 3CNBA 3CFYA 3IPAA 2IDMA 4EYQA 1ZITA 3MYYA 3QX8A 2A9QA 5KQGA 2H3HA 2PMCA 1MIHA 2PUDA 3CZ5A 4MS3A 2WRZA 4Z0NA 3KYJB
chains in the Genus database with same CATH superfamily
1QAQA 2K4MA 1UXHA 1BD4A 1XJWA 2ZYAA 3CBGA 2GILA 3S1AB 1CK4A 1X42A 4ZHQB 3VOTA 4A0FA 1P33A 4AS2A 2GX6A 1Z28A 1JBKA 4K88A 4WNAA 4OQDA 3P94A 1SUCA 4HMOA 2WP0A 1XZKA 1T8UA 1OCEA 1T0UA 4B3CA 1T4DA 3KWLA 1T10A 5DM2A 3HCAA 1OLSB 4TMZA 5EMLA 1U7HA 4HGOA 4WOCA 3DV0A 4AP5A 3THXA 4MO9A 2J67A 5AJZA 1XK7A 4D0GA 1DFHA 1ACJA 3RVJA 1N2SA 2ZIEA 3IRVA 4K9MA 2OHGA 1AKQA 4AZTA 1BJKA 2XHEA 1Z5WA 3BMOB 3A1CA 3M5WA 2PUAA 4A2WA 1VMIA 2AKAB 2RCYA 4BFLA 3EHDA 1T0JB 4N5IX 1RFGE 3S6JA 1SCJA 2FW6A 2PANA 3I9OA 4HDOB 3K20A 5BVGA 2QNRA 4PTZA 2ZIUB 2QU7A 4KDEA 1JF8A 2E9SA 2FZ4A 4NZNA 3KXPA 5CB4A 3AINA 5I45A 3R09A 4MGHA 5LPNA 1RNLA 1Z8FA 3NRBA 4H3KB 2X9QA 1WTCA 4MP3A 5ALEA 3PXDA 2A67A 1YA6A 3B52X 1E60A 4M9QA 1A76A 1L3IA 1LRLA 3DULA 3O95A 5A2GA 1N3IA 5BWLA 2C7OA 4WADA 1VP3A 4G8CA 5FH9A 2QQFA 1PBNA 3MQ4A 2X8JA 1AIPA 2O6LA 4QFBA 2PX5A 1WXFA 2XXBA 4UC0A 4V0ME 3ZVRA 4MAMA 1LPNA 1SHJA 2A9KA 4CQNA 3KYCA 5E8RA 3VNUA 3VR3A 2ZRKA 2Z9CA 3F3KA 1RXUA 4WZZA 4C4AA 4YAUA 4CF5A 1UK9A 2A1TR 1N9GB 2PMDA 3L4BC 1QBKC 1XQYA 1Q44A 5KYTA 2Z6VA 5FA5A 4HUQB 4I6EA 4LSGA 4U7TB 1B3BA 3ELWA 2ZZMA 2JGDB 2FWNA 3K2EA 1LPOA 4WCVA 5BWMA 1DO8A 2VYFA 3RAEC 1IWOA 1P60A 10MHA 2G80A 1Q0RA 2AG5A 2Y4NA 2ZUVA 3BHMA 3CUWA 1E4EB 4D0RA 2SHKA 4RIGA 5BVHB 1SKQA 2C7RA 3B1KA 4PAWA 5EHGA 5FTWA 2FW1A 1AS2A 2ZJYA 1W49A 3CEJA 4EEZA 3AL0C 2YZNA 4TS1A 1X7WB 1F14A 1IQ0A 1NZFA 4O3MA 1ZK1A 4H16A 1ONPA 4RPKA 2JFBA 4U7JA 5JNWA 1PTJA 2PKRA 2PN1A 4FNGA 4H0FA 2Q3LA 3O74A 3U81A 3KXLA 5I4IA 3BE8A 3DF9A 1H9BA 2P40A 4U8GA 4K9LA 3DGFC 4KIWA 1HNWB 3GGGA 1X8KA 3CZQA 5BUQA 3SI7A 3JW8A 5DU2A 1A9RA 2FU5C 1DBWA 2X3YA 3CRRA 2ZI4A 5FNVF 1IXYA 1ECCA 1NNSA 5EXEA 4MS1A 2WIJA 2DBVO 3CTPA 5FI0B 1MKYA 4K6HA 1NSFA 2GCEA 5LZ8A 4G1UC 5A3JA 3GJSA 3ZWXA 1WLSA 2C2ZA 1EVLA 3S7TA 1AMOA 3GBVA 4OK3A 3C1TA 3KPYA 5CGZA 4YC7A 2YJTD 1ID1A 3DLBA 4Q15A 3CUEF 4DR5B 1HO3A 3CS3A 4ZQFA 5EIEA 2BEWA 2IYQA 3FFTA 4G1EB 4D80A 1BS9A 5ARBA 5CB0A 1NVBA 1YBHA 2NV0A 4WASA 3A4VA 4D8UA 4A15A 1N8KA 2HYDA 3WLPA 2P6OA 1IEWA 4IX1A 5LZ5A 1VB3A 2CZGA 1HRKA 1WXGA 2QZSA 1N7JA 2WSSD 3ROEA 1XLVA 1E3WA 1JLKA 2TMGA 4QPDA 2GAAA 3W5JA 1OILA 1JV2B 1RJFA 3ABRB 3L4BA 2PTGA 4XUCA 1KEZA 4RVHA 2W6QA 4OHYA 2V6IA 3UAXA 3MFQA 3MWGA 4PQYA 4UFNA 1LX6A 1JI3A 3OWXA 2JKYA 2VSXA 3TLGB 4ESHA 3QMPA 1QU2A 3SC2B 1RM5A 2IXAA 3D8NA 4NYIQ 4LMPA 4C0WA 5C4MA 7AT1A 4GKKB 3BJIC 1RJDA 4UHJA 5H16A 3WWEA 4MV5A 4XDHA 3LSTA 4JJFA 1G42A 1FRZA 3P2EA 4K28A 4UM5A 1Y42X 2X19A 4YAWA 2WHRA 3DDNA 1DKPA 2BFAA 4MRNA 5FOTA 2GAOA 1VBMA 3IBCA 3D43A 1IN5A 3H9UA 4KACA 3NU1A 1VLQA 4Q9NA 2YCBA 2AOUB 2FG6C 2JI4A 4YMHA 3HV2A 5F52A 4ACAA 4EYGA 4HVAA 3TMKA 4QULA 4OX9B 5EZ5A 5M34A 2BSAA 2SKEA 2Z8ZA 2ZJOA 4Y2HA 3OCVA 1E9DA 3MA0A 2AHOA 2FLKA 2P3OA 1RRPA 3PA8A 2ZWOA 4MAAA 1ZHHA 1I6LA 2AG1A 1EK6A 3Q2IA 3MTQA 2VFAA 4IIVA 1TZJA 3G5AA 5DM0A 2Q1XA 3UNXA 1ZH8A 2QLBA 1FJXA 3T3EA 3ET4A 3WGUA 3S28A 2Q3BA 1ZVJA 2XA9A 3K53A 3CRNA 1UDRA 1FYFA 1RYBA 4OP3A 4K3VA 4XLLA 3GT0A 3ZWAA 5BV2P 2CHFA 4J0CA 1M1YA 5A3QA 4LF7B 3H84A 1GQ2A 5KYYB 2B8JA 2IPXA 3DCYA 4RGBA 4RHYA 5C5DA 3TEMA 4BX8A 5CRIA 2W22A 1XTZA 3DNFA 1HLFA 4PPFA 1LDMA 1Z2DA 3PWKA 1MN6A 3EISA 1SBCA 4P82A 1B0ZA 5E0OA 4ZIRB 2BF4A 1J0DA 1ENPA 1QH8B 1F17A 3T9EA 3OZIA 1SQ5A 2XAAA 4RULA 4FGLA 2NTJA 1R0YA 1YZUA 1NNLA 2IS6A 2XMRA 3LRXA 1EQ2A 4U39A 1K88A 3TTWA 3RJ5A 4WN9A 1E3EA 3QU9A 1T9GS 1W36D 2FHPA 5EXTA 5BQFA 1JMKC 2DGDA 2DBYA 2QN9A 4UBMA 2Q5LA 2PEZA 4ISBA 4WOBA 4MEAA 1EDDA 3MELA 2W9XA 3GQBB 5TC4A 1J2TA 1IN1A 1U0LA 5IDWA 1WEHA 3OIWA 1UZUA 4A36A 1ZCFA 2IPMA 3ANYB 3ZHUA 1D0VA 3UXMA 1YK1A 2WSMA 5HCNA 1NZDA 1OXMA 1YKSA 3AHJA 2WFLA 2VHJA 3KLMX 1OA0A 2O2DA 4CI0B 3VJMA 3U60B 5GADl 1YBAA 8ADHA 3WLLA 3PTLA 5HMLA 1JDBC 3PD0A 3DV9A 4UUBA 4Y2PA 2FLWA 4HNHA 5DN6A 3VSBA 2OBYA 4NBRA 1A82A 1QYCA 1DT3A 1KR2A 2ET6A 2RC5A 4IHJA 4QA9A 1Y3FE 4EGQA 2WVHA 1LBQA 2QD1A 5AM3A 3NBYC 1NATA 3B60A 4RO0A 3FG9A 5TSDA 5KX5F 4M86A 3RAJA 3WLIA 4EECA 2VNKA 5IAAA 1MCZA 4MEBA 5FT9A 4BB5A 3ZCRA 4DPMA 4B3JA 4LOLA 5TT1A 3E8MA 1TZMA 1DMSA 1BN7A 5JE8A 1N2GA 5HE8A 2B2XA 5JS6A 3GVCA 3E15A 2YHIA 3NRCA 4U7DA 3LDUA 4GQIA 1FFSA 1SC1A 1ZN8A 2BJHA 4WXRA 4ISCA 4YP6A 5FOSA 5A6SB 2WDZA 1WX1A 3TSWA 2R4UA 4JOQA 3C5WP 3H2GA 3LP8A 5CFQA 1P19A 2QW0X 2DKOA 3ORRA 3QNUA 1K86A 4CIWA 1NW7A 4EGFA 3T9FA 2B25A 1H1LA 2VDUE 4Q7LA 5JDCC 4BRSA 2LV8A 1KJWA 3CH4B 1SG9A 3ZDYB 4ITVA 4LDZA 3BIWA 5E4TA 4C4YA 4IJWA 4H59A 4M7PA 2WIBA 2I8CA 3NI2A 3PEVA 4Q03A 1KRXA 4MW1A 2BMAA 4PTYA 4KO3S 4OQMA 3PQ8A 1T0PA 3FB1A 1WCIA 3G3EA 4KPYA 2P8SA 3KOZA 2OENG 2Y1XA 2JBAB 3UFXA 1DEKA 3MQFA 1EG2A 1NJ6A 1RKQA 2VPIA 4FNAA 3AX6A 4G0OA 1TC1A 5EKDA 4HMPA 1CDZA 1Z39A 3ONVA 2H08A 4ZDWA 3S2IA 1HYGA 1GCUA 3WAKA 1B8NA 4BGVA 1H3NA 4QBTA 2B0CA 1YXMA 2RBEA 2WU3A 2HQ1A 4D43A 2DTDA 4C0QC 1KNXA 3OEEA 4TYNA 4ESVA 3F7TA 3TIGA 1FSGA 3L7BA 1TQ4A 2BBWA 2CHEA 2G71A 1VI6A 2IF2A 3PQCA 2VLBA 3I6MA 2DF8A 3PRYA 3I9NA 5JDIA 4ZAVA 3I5MA 5REQA 3L8FA 2B82A 3O2QB 3X1JA 2WPNA 1VYVA 1A9QA 4J0IA 2AEMA 1N5RA 5CT4A 4DUYB 2GKSA 4ZO4A 3HJRA 2EV9A 1Q2UA 4MVXA 3KJXA 3WRXA 1JQ5A 4WBSA 4X66B 2IHZA 1E1QA 4C7XA 2YV4A 3UOGA 2B99A 3WL4A 5KQMA 4YA6A 3EH1A 4HMQA 1PLLA 1T8RA 2WUWE 4QYWA 2VT3A 2FA9A 1L4KA 2Z4TA 3AV3A 3NEPX 2NX2A 1E0JA 2BGLA 3T5GA 1KKMA 4QDTA 4BMYA 2YNMA 3PJGA 3GWGA 2APJA 4HXEB 5B7NA 2PX2A 2VDVE 3HL4A 5I8ZA 2ZIGA 4JP5A 3BSSA 3TR5A 4POOA 4O4HB 1GV1A 4QUIA 4ZQEA 5JCJA 1F0PA 2IKQA 1ZQ9A 4Z4IA 3K72B 4MKFA 4ENPA 4TRJA 3Q98A 4X1KA 2P9GA 4Q1BA 5IFLA 3QIAA 1NI3A 4C89A 4EHBA 2PGOA 3JQFC 2YIMA 5U4XA 3KVNA 1T8YA 5B7PA 1POXA 1BMFD 4HAVA 2BONA 3OFND 4UBIA 3UMYA 1FXUA 3BXGA 1OAOA 2I6XA 3LECA 4WNYA 1EWVA 3TI7A 2IXFA 4D74A 4HWGA 4O1IA 1DTEA 1E2HA 5AKLA 4CMCA 5BN4A 2JARA 3TO5A 2JJQA 3FE2A 1MQ8B 3ASUA 4KZKA 3WGQA 1CT9A 1RRFA 2XNDA 4RW0A 2XF2A 1N2IA 1B43A 3RYFA 4BP1A 5H0IA 1O5TA 4XJSA 3ZD7A 1R7RA 2G82A 1XA3A 3VGJA 2FSHA 3E81A 2ECFA 1VSQA 4I4TB 1J9EA 2BGMA 1NC3A 1S8AA 2I54A 3AERB 1AT1A 3EZNA 3N28A 3VR2D 1I5OA 1K98A 1ZGZA 3WMGA 1KE2A 3L49A 1UEXC 4Y8VA 5LJLA 3ZDQA 4MUKA 5B2EA 1U0GA 2JGRA 2FN4A 5SZIA 5TLSA 3R6TA 4CYMA 1J70A 3GJRA 1F8GA 1O95A 3T3OA 4Z7OB 5IK2D 4XXHA 1JHXA 3PDHA 3R6GA 2ONJA 1UZAA 1JG4A 1KJ8A 4UTPA 3CW9A 5HUQA 2Q2VA 4ER0A 3Q9SA 2EBHX 2QN8A 3H13A 3V9PA 2Y8EA 3MAJA 3BULA 1YF3A 4D3DA 3DQQA 2XNJA 3E9RA 3DXZA 3EVBA 3GV0A 2OBXA 2FXVA 1QFXA 2VYCA 3NHAA 5AK6A 3QU5A 3TN7A 2HMUA 4BNUA 4JGBA 1EESA 4D79A 5HM6A 1N34B 3PRKE 2C2HA 1A4RA 1E20A 2IHUA 1XFAA 3PEFA 3CPEA 4L95C 4QYSA 3KQYA 1N6HA 2F4VB 4C6TB 1SU8A 4GWLA 1REQB 1YB2A 1IHDA 4TSFA 3WWZA 1BEUB 3PF9A 3DUFB 1QSGA 1D0SA 2XGGA 3QVTA 3ZCUA 1AG9A 1KL7A 3EEYA 4EF4A 1E4EA 3FDZB 3H3FA 1OX4B 4OCZA 4WZAA 1P5ZB 1BCRB 2CBXA 1X6VA 4E3WA 2JRCA 4TVBA 4IUCS 4A27A 4QU5A 2A59A 3AJRA 3QWFA 4O4JA 2HIAA 4B6EA 3GFOA 5KZMB 3OQOA 4MQ6A 2HHHB 1QQTA 1YOVA 2MYUA 1OYWA 4U7PB 1ZVVA 1FFWA 1LK0A 5C4GB 4A73A 4EEXA 1GLVA 1QOPB 2V0NA 4F4IA 2VTKA 3Q8MA 2JA1A 5DSXA 4KQEA 3KM0A 1USWA 3EOZA 1GGHA 2HBRA 3IBYA 3OJEA 2WICA 4QKQA 1C81A 1U3WA 2O0KA 3ICCA 2OAGA 4FZ3A 4I9HA 4TLDA 5EUBA 3ZU6A 3ZV5A 1T1IA 3CO5A 4J4TA 3ZD8A 3TJZA 1G8FA 2G28A 2VRCD 3KZXA 4DY6A 1QFSA 2P9FA 1PD1A 4P3YA 4U2BA 5JD5A 2WAMA 1Y6FA 3GT3A 3Q3HA 5K03A 1ZGBA 1SMKA 3ILVA 3X1DA 1TT7A 3BA1A 3GFGA 2I7XA 3EH2A 4TXNA 2Q1UA 3K35A 2Y66A 4ASUA 3QPWA 3ZX5A 2VF5X 2VDKB 1O95C 3AVOA 5CP8A 4BO8A 2Y0BA 2H5LA 4EY5A 3MT9A 1PHPA 3KCNA 4M7WA 4PIMA 4Q82A 3URMA 1ETHA 3WZMA 4YRQA 2DQSA 3H8WA 4R9UC 4RKYA 4R84A 4TMXA 5MN4A 2C7PA 2JA2A 2J45A 3I58A 1QYDA 3RRZA 3L9XA 2A30A 3DL2A 3AEYA 1ECLA 3K4QA 4KRYA 4LK3A 5H9WA 2IV2X 1NV9A 3ZDDA 3ITKA 3KDSE 4NBVA 4DLKA 4FKMA 1T15A 4LY3A 1OBCA 3ZCSA 3JQ9C 3UKOA 4M2LA 5CD9A 4OFZA 1TK9A 2HKIA 5JU6A 4MVYA 3INTA 3PR3A 1L7NA 2QF7A 3NRJA 3JWEA 4PO9A 1Y7IA 4XQCA 5AK4A 4C3UA 5CCEA 2WRZA 3OURA 5B4TA 3I92A 2P11A 5CG2A 1X15A 5IAEA 4HDQB 1UOOA 1ZM4A 2PJZA 4QGAA 2C1XA 3ZU4A 4F5DA 2HEGA 1R8JA 1PJ3A 3IJEB 1MRNA 3ROQA 1SIBE 3W2EA 1KZGB 3P0JA 3CUYA 3BDAA 4TRMA 2PBLA 1DC5A 1V41E 3FNRA 5EFZA 2A1TS 3QXJA 3ZXXA 1EKXA 1V5GA 1Z82A 1PJLA 4N82A 1A69A 1BW9A 2FW0A 4P33A 2ZI3A 4JK3A 1U1IA 3FWYA 3KWMA 1OWPA 3NW9A 4RLFA 1ILEA 4XFDA 3K9FC 4OBBA 2BM9A 2CNOA 3A3PA 4G36A 1KY3A 2R87A 3EIUA 4P2GA 3WBBA 4AF8A 4W82A 3MCTA 3HNPA 2AFHB 4GSLA 4O1HA 3AEZA 1TT5A 2ZVDA 1FJ2A 3E9MA 4BMPB 2BFWA 5KJEA 1LNZA 4HFNA 2C9CA 3OOJA 3SYTA 3GVIA 4C29A 4DCVA 1IJKA 3VHXB 1X1TA 2P0YA 2V7XA 1H22A 4R5MA 3DWFA 1XD8A 2V9PA 4EY7A 4XLZA 4FDLA 4LIPD 3R9WA 1GNVA 5DCLA 4GBED 4JJZA 3WK9A 3WKEA 2TMYA 2A0YA 4J76A 4GLLA 3WP1B 1CUIA 1YDEA 3DBHB 1VLVA 3EXIA 3LUFA 2W93A 4CLEA 3AM5A 3NXKA 4DJAA 4FNOA 1NOJA 4HYYA 2PL1A 4YVFA 3WQQA 3KOWA 4Q6BA 4V02A 4J49A 1RFLA 5BN1A 1P5JA 3AY3A 3VUFA 2PUHA 2E4UA 2XRFA 3KLBA 3GAAA 3NIGB 5B37A 3VTKA 2JK1A 4PHTA 4ID3A 2EG5A 3L0OA 4RGVA 4AO7A 1X8JA 2ODTX 3GRZA 3NEJA 4W6QA 4EUNA 3TSZA 3ZHCA 1LEHA 2I0FA 3LDHA 4OHBA 2PJDA 2YN4A 1G4AE 2ZT6A 3FNFA 1JG6A 4OYLA 5F12A 1DAIA 3GJXC 4WE3A 4BNHA 4D02A 3EIHA 1Y4SA 3TNJA 2I33A 2R9VA 3TNFA 4MDYA 1VZ2A 3GUUA 2FI1A 5IAJA 3NIWA 2P62A 4CCWA 3KOMA 1I1QB 3Q6NA 3WO1A 1YJBA 2XQGA 4YRDA 5IM4F 3GMIA 4CG0A 5JEEA 4BP3A 1HH4A 4E21A 4GZLA 3FYUB 1P2FA 3ZWNA 2L0XA 1DRUA 3B85A 3MLEA 3PUKA 5DDIP 3JATB 4JUIA 3AF3A 3MS7A 1MNAA 2VK1A 3KAKA 2X5NA 1XZPA 3MJEA 3QKSB 1R15A 2PUFA 1Y63A 2OCKA 1GQYA 2V7QA 3QYPA 4KZPA 5CURA 2BTQA 5IXSA 2EFGA 2VHXA 1VP9A 3GDHA 1T5HX 3NP7A 3UKJA 1X39A 3KQMA 1RHMA 2O7SA 2O54A 4PNZA 4P58A 3VVBA 4F3TA 4NCNA 4OQLA 4BLTA 4YT8A 3GMSA 2OHHA 4LZAA 3CEHA 4D1YA 4URVR 3LXUX 3AOEC 5JS7A 4PZ9A 4MV9A 1GTZA 2C42A 4PONA 4Q9JA 1GQFA 1IHYA 2XDWA 2YWRA 5E7MA 3SXJA 3ZIAA 3TFQA 4OYHA 5BSHA 5F7JA 4EITA 2OAEA 1OPXA 5FFFA 1YZVA 4GOXA 3GLVA 4R1PA 2YYSA 3IHWA 1U5AA 5I7AA 5BRNA 4F21A 2NU7A 1W5TA 1ZX1A 3E27A 1MAUA 2CFCA 2C31A 3UC9A 3X3HA 4ZC1A 1ZH0A 4F3KA 4EKGA 3FI0A 2XXAA 1YMQA 1E6EA 1MJNA 2PUVA 3GD7A 5DNEA 2CT8A 3A31A 1GRQA 3R3JA 1JYEA 1TL7C 2NVOA 3BIJA 1NBWB 5AJVB 5FV7A 1IRIA 1IZ7A 1CR6A 1FDTA 2R7KA 3WLOA 4BO1A 5K01A 3RKUA 5BQ5A 1H5NA 1OZFA 4C43A 2EWWA 5CMLA 3TECE 1W8DA 3O6VA 2V1XA 5CHEA 2X41A 3ZHXA 3A6DA 3UFXB 4XFJA 5YASA 1PWZA 3F1LA 2WZCA 3NAMA 3U2QA 1DKQA 2V4UA 4YAGA 1HMYA 4E4YA 4N0PA 4URZR 4CQLA 3D7KA 2YVQA 5DHPA 5GJVC 5JNVA 3MMZA 3REGA 1T6ZA 3SIWA 4AMUA 2TECE 4BEWA 3HB7A 1D2AA 3C0KA 3PU6A 3ZQ6A 1RM3A 3ZLVA 4OQQA 1X1RA 4AUMA 3CLSC 1H2YA 1FUIA 1XN1A 3WGYA 2GK3A 1OD6A 5REQB 4U3JB 4BQPA 4LPKA 4WIAA 4D8VA 4L5CA 4BUCA 4R0VA 1RQRA 3QJYA 1L5RA 1KDTA 2EFCB 2YRFA 4KX3A 4WZBE 4X5OA 5JZ9A 2RHOA 2A1UB 5L4LA 2MR6A 4OQNA 2MINB 4B45A 3NBXX 3U4MA 5KWVA 1P8JA 2GKGA 3PC3A 3GK3A 3TI9A 5TMDA 2FUKA 3AF6A 4GX5A 1XXLA 2QRNA 5CPFA 1V35A 5CITA 5ERXA 4FFLA 4JROA 5BOVA 2DLDA 5BMOA 4QJIA 2IK8A 2VYNA 4B6FA 5EIBC 5BSMA 3ZV7A 3CH7A 5JMWA 1ANKA 1TU0A 2VH2A 1DTWB 3RRYA 3DDCA 2ZCUA 2XAUA 3N0VA 1QJ4A 5F1KA 5KNLA 2D59A 2P2NA 2OHFA 2VJCA 4GE0A 3RRJA 3SLRA 1J33A 3NUGA 4OEHA 3S2SA 1KZ4A 5FADA 2H5JA 3MINA 4IIEA 2VYND 3C16C 2CJXA 3JX9A 2I2WA 1FS6A 4PZPA 1GHTA 1EA5A 4WA7A 3R8FA 1KZ1A 2ZOSA 5EMHA 3VDQA 5E3HA 4FYHA 3G17A 1FLAA 1IL0A 2I2AA 3JASB 1Z17A 3RAFC 4N54A 4LJKA 2Q6IA 1P74A 1UJ6A 3NBFA 2IPLA 3UMJA 1ZW6A 2OGWA 2NSYA 3PE6A 1GYQA 1U0TA 1NT2A 1QIKA 3PI7A 3Q2OA 2QT1A 2Q2NA 1H2BA 2VHVA 1YS9A 5L95A 4LF9B 4RM2A 1I0ZA 3AETB 4ZCPA 5HA5A 3ROPA 5KSYA 3E9QA 1RXEA 3OO1A 2FMKA 3FOEC 2YASA 3WRVA 1XVVA 1O54A 2DPLA 3CEAA 3CR8A 3IQHX 2RG1A 4P38A 1Q16A 3WOVA 2FN9A 4GLOA 4MVJE 1CUGA 1HG0A 2CC2A 3HSKA 2G5CA 2O50A 1LRJA 1CS4C 3VGPA 3ELBA 1EE2A 2ORYA 4N49A 3ZUPA 1ZR4A 4NMLA 1GFIA 2E4YA 3EDRA 4FINA 1TJ3A 1GR1A 2LZ0A 4NJMA 4C4TA 4EL5A 3ZY3A 1RLJA 2ZSHA 2YXPX 5AFSA 2VBFA 2ZAMA 4TS9A 1FTGA 5T4EA 3PE4A 1JFLA 1HYEA 4XJTA 1PFQA 4Q4LA 1SO8A 1JVSA 3T1VA 2QTHA 3JU3A 4CL3A 1JSCA 1NDQA 1TLLA 2HF8A 2HXSA 1ZVQA 1EVQA 4XD7D 5CIWA 3PGMA 2NXWA 1JYFA 1KEEB 1ENYA 1QKKA 1RJ9B 2F1HA 2JD0A 1YULA 1WPRA 2OCGA 3C5HA 2A5LA 4EW1A 1JDPA 1T9HA 2PFKA 2ZRNA 5AOBA 3CW8X 1ZK3A 2R6JA 4PLGA 3RPEA 1JR4A 2X2OA 1RR6A 3C8UA 4G41A 4HH3C 1KDYA 1TF7A 3AXSA 2QTNA 1P4GA 5G41A 4EX6A 1K68A 1VHWA 2HJ9A 4MPRA 3BGIA 1LBTA 3ESYA 5E1MA 3U7GA 4FU0A 3NNDA 5DM4A 3COPA 1KF0A 3NDRA 2ECQA 2JHPA 3V1KA 1JAZA 1HDGO 4NENA 4BBPA 1T1JA 3CONA 3B1JA 1PAUA 2OBBA 4UM9D 4L7VA 1NAIA 1ZW1A 2W6CX 3E9DA 5KREA 3L7YA 5JVDF 2CJWB 4B4KA 2YWXA 4R8SA 4X61A 5FAXA 1RWVA 3H6HA 3RUDA 2H2AA 1SOWA 1DC8A 1H2XA 2DT5A 4F6RA 5K0TA 1WB9A 4TYYA 1E66A 2IZZA 3EDCA 4AJKA 1KH2A 3AIIA 1WHSB 4K9KA 5EJFA 3WQBA 2XMPA 3ODGA 4DQLA 3SHTA 1S9DA 2CVZA 2O4UX 5HILA 1DADA 4RK7A 1W25A 2GEJA 1VGRA 8MHTA 1ZPDA 2XB4A 3V4RA 2C4VA 2G0AA 4NCBA 3GJ6A 3K6SA 1YS1X 2R4QA 1RP7A 3KYDB 4XGIA 2IUEA 4ZOLB 3RYIA 1DARA 3AV0B 3SU8A 2XWQA 1IAVA 5GOZA 1TEVA 2FGJA 2JLQA 3SFTA 4W1PA 4P86A 3ZDEA 4RZHA 3LIIA 3ON5A 5F9FA 2DWQA 2FRXA 4WNIA 3SPXA 3ZOZA 2XW6A 4CDRA 2QMUA 3C7CB 1U3UA 2B9VA 3FRIA 3ZW8A 1M74A 3BSWA 5MFPA 2W2KB 1S8OA 4R05A 5TQ2A 2AOTA 2ZI5A 1TKCA 2NU6A 2IYNA 2CCGA 4MVJA 2NZ8A 1ZGGA 3DHNA 3IJRA 2B4AA 4WGGA 1HKUA 3KZNA 2VT7A 3WGTA 4BQEA 2F1IA 2OK7A 2FN8A 3L8YA 4QYXA 5K9ZA 1WJGA 1A4IA 1Y1SA 4UHDA 3GX1A 4JLBA 5ALUA 2PV0A 1M34B 4ZVPA 3E61A 5A7GA 2IDKA 3W77A 1OB5A 3T9BA 3HDVA 3UBMA 1AX9A 2PH3A 4LFBB 3KQOA 1Y9DA 3ZE1B 1NRJB 1R88A 3SMVA 1SCKA 2POQX 2XJ9A 4J43A 4RABA 4ZCQA 3TCXB 4XI9A 2EW2A 3V4FA 1ZAKA 2QVBA 3AW9A 5I9TA 1DCKA 5DP2A 2HHAA 3ND8A 1DI0A 3IEMA 2QRJA 1IN6A 4B7UA 2ZJFA 4HAUA 4HNTA 4TKMA 1AHNA 1CRLA 1T8WA 3RADC 2F1OA 5A3RA 3O3NB 1FIUA 2NU9B 4LZJA 4IF4A 4EHLA 1YQQA 1L7QA 1E98A 1MQSA 3VPAA 1QOZA 1P9OA 3AVTA 1RT9A 1Q0ZA 1A27A 2ZRDA 3E2MA 4LE1A 3RU7A 1R16A 3AM3A 2Q9CA 4DAOA 2X4LA 1RJWA 2W4QA 5H7XA 3U5ZB 2MMCA 1BKDR 2AJCA 3LA6A 4Y2XA 3VVLA 3ZZTA 3E0XA 4CMAA 4IH4A 4MJXA 4XASA 1BMTA 4MA4A 4WI1A 3W8FA 6ADHA 2CBZA 3UK0A 1Z6YA 3AY6A 2JFOA 4DV4B 2JAPA 3UO8B 3U37A 2GBGA 3VVMA 4NMMA 3QXHA 2QNIA 2X42A 1PT7A 1HOXA 4QRIA 4R1MA 4ENSA 4NK5A 3MJHA 3ZTYA 4MYDA 1CIPA 1NUTA 3RS8A 2ZRMA 4ZOEA 2J6IA 1ZD4A 2ANBA 1NU8A 2CWWA 4RFSB 1HDXA 4IJMA 3BKWA 3H5OA 5G0WA 1MB3A 3KXIA 3EN0A 2BRUA 2Q2WA 1PL0A 1BX3A 4B7CA 4E4TA 1WZ2A 5HGJA 3S2YA 3WLFA 6NULA 2AW5A 2VPTA 4MW9A 5GONB 3E5RA 5THXA 1QUEA 1UWVA 1D2NA 2JAHA 2G8NA 3NBQA 3SJCA 1DIBA 1GADO 2FUNB 2HLPA 2JBWA 3EVGA 1PK9A 3PPWA 1H2RS 2WWFA 4FONA 4PC3A 3LT1A 4UDNA 3X1XA 1V7QA 1V3TA 2XX3A 2OFFA 1MHTA 4DCCA 4V38A 3G13A 4OHOA 1UKEA 1R4NB 3PHLA 5DYYA 1FBTA 2QV7A 2X2FA 3OEHA 4ZQBA 4IP0A 4MS4A 3UUGA 1IFXA 4I2VA 4IIBA 3ZZ0A 1HE4A 2Q3DA 1R5NA 3WWCA 4LISA 2PWAA 3C6BA 1AGXA 1IAQA 4HNAB 3KQTA 4RANA 1NNUA 1DAMA 2HI0A 3FROA 4DLXA 1L7OA 3I3SR 1OXBB 3JAKB 3SSOA 4DCUA 5KYUB 5DPMA 3DOFA 5FPKA 3WB2A 1HT2E 1Y8QA 2J9XB 3L0PA 5ER9A 1HETA 3BWVA 5EP2A 2HXGA 4CW7A 4NJEB 4N03A 4Q12A 3Q7EA 1IIBA 5H59A 1BXKA 2M1XA 2AR7A 4UU1A 3ZY6A 3T5DA 1HOTA 3BF7A 3IAHA 4JMPA 1OH6A 3ENQA 5E9WA 1LFAA 1M72A 3VYWA 4ZK6A 3UMMA 1ZK4A 2PUEA 3THSA 4Y2SA 2DY1A 2AYXA 1RAIA 1RKXA 2XKAA 4OHCA 3WNVA 3Q10A 3X1ZA 4AMZA 2CDAA 1H6DA 1EK1A 3OD1A 1ZOLA 2BBTA 1GQOA 2OKCA 4HYQA 4ETNA 4N3NA 6REQA 2OBNA 4UEKA 5AJTA 4L4YA 1QO0A 6AT1A 2YRWA 5ALXA 2WIFA 1MW8X 2G9VA 2PPVA 3ADCA 2EHDA 2B37A 3OQPA 2NSLA 4ZARA 3E6AA 3H97A 2W2QA 1NN1A 3F6YA 1YACA 1CFJA 1YJ5A 1N5JA 2XKJE 2FHSA 4TKVA 1Y6JA 3E9EA 4XGNA 1BKSB 1VPWA 3TR0A 1XMVA 3X2FA 1IQUA 1U11A 2CNKA 3PNMA 4N39A 4EKIA 2ZJ8A 2GBCA 2QR2A 2QYHA 2AHRA 4I3HA 1NVXQ 1SKYB 4E08A 3EQ7A 4RYLA 3PIDA 2DPMA 2EZTA 2ENUA 2NT4A 3EGDA 3NH9A 3MYRA 4KQKA 5KNBD 2OV6A 1SULA 2O2JA 1TCUA 4FFRA 1M8GA 2XGSA 3RJTA 4HGYA 4JBLA 2BKXA 4QOGA 5T4BA 1MA3A 2XA1A 3PNKA 1E89A 2FOLA 4LC9A 3D9QX 5CX1A 3EZYA 2JFFA 1VBFA 3QX8A 5IVDA 3AEKB 3VDXA 2CL5A 5JZMA 5KQGA 3MWLA 1UBUS 4IDNA 2GTPA 1GSIA 4S04A 1JQKA 2VTBA 4Q6WA 2GJKA 4PSAA 3OWOA 1DIGA 2ATVA 2GN9A 3P9XA 4JYCA 3HMQA 4RKWA 3N70A 4ZVKA 4AS1A 2PUBA 1KIMA 2QU8A 4NFHA 1QIIA 2A88A 4JBHA 4MITA 3WMFA 3GCWA 1UBNA 2XTZA 1KOFA 3I09A 3KKLA 1THZA 1Q3TA 3EUEA 4LVCA 1INLA 2PEYA 3DNMA 1R0XA 2XVYA 5AMXA 4BVAA 3MD0A 3A1SA 4MX8A 2OVFA 4Y6LA 2I4IA 1I8TA 3EGXA 4AG6A 2OFPA 2QTLA 3FCOA 1T36B 1XMXA 2A5DA 4NAVA 2ODBA 4RJJA 3WV5A 2J3EA 1HSZA 2Q8NA 3RRXA 3W04A 3A3NA 5C3UA 5FJIA 3DWEX 1PIWA 3DR3A 3JQAA 4WFIA 1WIWA 3LUKA 2O1SA 3GB9A 3IKMB 1UPCA 4M38A 3QFTA 3IQXA 4WMLA 5CM9C 5J4KA 3BH6A 2HRQA 1BDJA 4ANFA 5J2TB 1QCYA 1WRBA 3CISA 4PRZA 2GEKA 3V46A 4X7RA 1TJPB 5IUNC 1CY6A 4K9RA 4YP7A 4ZYWA 3DLHA 4JX8A 4OQPA 5JSZA 1Z25A 3GNSA 1YCGA 3DT6A 1DTWA 4ID9A 3H5LA 2JLSA 1VHLA 3HH8A 1TYEB 1C3EA 1JB1A 3GZNB 2RFLA 5LP6C 5IJWA 4Z5XA 1U02A 1SXJC 3PRJA 2LXNA 1T6XA 1QGOA 1U7XA 3AIMA 1E2LA 3IL2A 4R01A 1F2UA 3LNTA 3HWSA 2E6UX 2Z5GA 1SCIA 2DE0X 3GLGA 3I05A 5EP1A 3ECCA 4KJZA 2EW8A 3QVLA 3N2KA 4C7KA 2A9RA 4Y2JA 1T1GA 3JASA 2FAXA 3M5PA 3P26A 4MEJA 4WEOA 2A9FA 1QLWA 3CVXA 4L5IA 4BWVA 1T2NA 4GR9A 2HADA 3MLBA 1K75A 4YECA 1EGMB 3AETA 5AYVA 2CJYA 1VL0A 4BNIA 3WMWA 3AEUB 1DV2A 3C1OA 4P4UA 2DPHA 1Q11A 1E0SA 2VQ6A 3EPRA 1XVIA 2FWBA 4XSVA 3GJTA 3CRQA 1R6XA 5E6SA 2XMZA 3E7DA 3RTCA 2ZYVX 2Z57A 3LA8A 4W7IA 1G60A 1WUYA 1YVDA 1H93A 4INJA 4LKRA 5ALQA 2I4NA 3LPDA 2BI7A 2PSDA 4RC9A 5L53A 4KR9A 4YAKA 4DM7A 4G5SA 3H5AA 4CXMA 5JCOA 1EFKA 1SXJB 4PC6A 1MABA 2P75A 1N3LA 5E6RB 4JQCA 4DLAA 2VNJA 1XROA 5AVVA 3AESA 5ALTA 4PGAA 5G0SA 1JKJA 1G6OA 4RXMA 2I71A 2QEQA 1K3UB 3HU5A 4NMWA 5EXDA 5B6JA 3SR4A 3OF2A 1JIQA 2O8CA 4MQMA 3TM4A 3K0FA 1IBKB 4MWBA 4NV3A 5AM2A 2F1RA 1XNQB 1YCDA 3G8YA 2XITA 3FVWA 3N2NA 1H8ED 2X7JA 3G59A 1E3MA 1NQ5A 1BE0A 2CFSA 1I3MA 2GM4A 5JSUA 4E12A 4K40A 1CUEA 5K7SA 3T5AA 1MO4A 2HK6A 2IPOA 2FWPA 2E37A 1OBOA 4HTFA 1TGYA 5LVAA 1HDEA 1DDIA 4GOJA 5EXSA 3A10A 3DBRA 1U4OA 3ZLJA 1V3QE 3VNBA 1PNQA 2WU0A 1WOMA 4ZD6A 4CTOA 4V0QA 1MD9A 3PPIA 2GR9A 2ZR9A 3EMBA 2A0XA 1EFHA 1JHRA 4YV0A 3ZWQA 5CYOA 3DPSA 1H6CA 2NPFA 4M1EA 3ASYA 1UOEA 4A7PA 3HA7A 3A05A 1ADGA 1T5DX 1I4EB 2WHEA 2X5OA 4GZ3A 1U0JA 3FOCA 1U0SY 3HKBB 4V0SA 1VKRA 1JWBB 1N2ZA 1YR1A 2AXQA 2MSLA 3ETHA 2B1QA 3OCJA 3BREA 2YXNA 4G0ZA 1OREA 5KHOC 1G4UR 1GZ5A 3CBQA 3OHSX 1YVUA 2ZBDA 1V26A 3FY4A 5EIBD 1J25A 4PAOA 1LDGA 1V6CA 1Z5OA 4NATA 2CE7A 1WW8A 3VNRA 4LTDA 3E3MA 2HO4A 3ZTWA 2AQHA 4KQGA 4QEZA 1UBEA 3MBIA 5L6LB 1PZXA 4JOBA 4WNAB 5KWEA 1ABEA 2QIPA 3PNSA 4F46A 3AZOA 1P3DA 2XKBA 2JGMA 2V7QD 3AKYA 2Q4RA 3OLVA 4INOA 4XWKA 1ZGJA 3KSDO 2ZIWB 4F4CA 5CDTA 3T7JA 1PKEA 1P9LA 3MTBA 1LJUA 2XJ4A 1TMOA 1MTOA 5GM1A 4CF7A 3THXB 1II8A 4OLBA 1VJ5A 1XZBA 2I3GA 3C97A 4MVJH 4TMKA 1T8PA 3QX9A 1JRLA 1UQRA 5JQWA 1LW7A 1LZLA 2W2KA 2BP7A 3DNPA 4C03A 4KE9A 4OO3A 4Y2RA 2PUGA 4RF3A 3FHOA 5FORA 4ODIA 4DBLE 1CVLA 4M1SA 5THKA 1HBJA 2H6EA 2JJ2A 2WYIA 3O38A 2JHAA 3K1YA 1A9YA 2PD6A 3MZ0A 5DMHA 3D0OA 3VZRA 3UB3A 5FUMA 2IW3A 5J4HA 5CIYA 4XIFA 3FCCA 1CD5A 1ZUIA 2PGDA 2QDKA 2JIPA 1TIPA 1W46A 1XAHA 3QOWA 4U00A 5GGYA 5CDUA 4JI3B 2RMKA 3HDQA 1YZQA 1FLVA 1O94C 2VH5R 3E7XA 1LQ2A 3KKMA 4H6WA 4KAFA 3SJBA 3TZQA 4EZIA 2C7BA 4GYYA 4CEJA 4DB2A 3MCWA 4MUMA 2GDZA 1PQPA 2W00A 4NS4A 4GYJA 5FOXA 1XI2A 2LKCA 1X3SA 4JKOA 3ZE2B 3IJPA 4F6LA 1P0MA 4Q9LA 3SNKA 3MBKA 2IXTA 1NR5A 1KJJA 2ID4A 4FILA 4FYIA 5AK3A 2JZCA 5EHNA 5LBTA 3UANA 4Q93A 3ZWMA 3VMFA 4TTVA 1SB9A 3DZCA 3EXAA 2R5WA 1SGWA 3LXXA 4LA4A 5CDYA 5AW3A 1B14A 1PDWA 3N75A 2VP2A 1E2EA 3WK5A 1L8LA 1B93A 1AMNA 5KPJA 1NFQA 2JFYA 4FGSA 4K6MA 5CVDA 5GJBA 3HUEA 2ETVA 1E18A 2OY0A 4A0QA 1WG8A 2BMJA 4GAEA 3AO0B 2SCUB 3PCRB 2GPTA 3RNOA 2FP3A 5JXWA 4DR3B 5BVHA 3WWYA 4UVDA 3HPRA 1O1YA 2ZDQA 2EERA 3EC1A 4BO5A 2AQ8A 3EG9A 3F98A 4MRMB 3GCXA 5DHUA 1YCHA 5JMOA 4FEYA 1ESDA 3KEQA 1ZUHA 4A6XA 3L8ZA 4DPLA 5KNBH 1YO6A 5DV9A 2FV8A 2OPHA 1ISMA 1B1CA 2CNNA 3GEPA 3R6DA 4CDNA 1NDUA 5LMNB 3IUSA 2BH2A 1EYZA 2AUMA 5AJWA 1BIFA 2XD4A 4H15A 4BO4A 3FKSA 2BE7A 3QLUC 2F9MA 4GX0A 4QQKA 2IV7A 4C4PA 3ZKWB 4QBGB 5EPEA 3OX1A 2R7LA 1B0PA 5HS4A 1YJCA 2M6SA 4J0HA 2C4TA 3O73A 1MO3A 3IX7A 1LX7A 2BY4A 3D4NA 1FNCA 4ETMA 4LRUA 2VXOA 4N7RA 1VCNA 4PIPA 4MUIA 2GKOA 2VDOB 3BD6A 4P7JA 1KDRA 2AKYA 5BV8A 1XCPA 1RAEA 2GYWA 4BPRA 1YRBA 1CNFA 4WV3A 5G0TA 3J7TA 5IAKA 3EAFA 2CXUA 4NOKA 1VG0B 2YHSA 2X3UA 1JALA 1ZNZA 3JQ7A 4H4DA 4NJEA 3KVOA 5KJ1A 3LLVA 3CLUD 1F5SA 1JE0A 5FNVA 3GFQA 1TJ4A 2Q3EA 2JG3A 1CZNA 4RKRA 1I3OA 1ND6A 2CMFA 2E3JA 1ADFA 2X6TA 4CDGA 1L6IA 3DZHA 2PSFA 3PNOA 4HK4A 4ND8A 4QLAA 3ECSA 2OP1A 3LC7O 2ZR8A 1JA9A 1PGNA 1LC3A 3DEKA 3PUWA 1S2GA 2QUBA 1OIVA 1KOJA 1I94B 2FPGA 1TQHA 4HDKB 3TZ6A 3ZQ4A 3HU3A 3PEUA 2XCQA 2A7QA 3OTHA 4RV9A 1RP1A 2Y2UA 3HMKA 3KAPA 3NOVA 1GA4A 5KSWB 5ECGC 4NFYA 3CZMA 2X5XA 1BGVA 3NJRA 3HWWA 1AURA 1B76A 4XR9A 4JP8A 3S55A 4RKFA 1OKKD 3GG2A 4NOJA 3QF4A 1RRKA 3QUCA 4FP9A 2HLNA 2WDPA 2ZI9A 3CF2A 4GKVA 1YONA 4OK6A 2IEAA 2NWQA 2X5KO 3FOWA 3D64A 3BIXA 4LY9A 5KJ6A 2PIAA 1KGDA 5TGDA 2E4WA 1YUBA 4UCFA 3RFXA 1HDOA 2DRIA 4GVPA 4P9NA 1O08A 1MOZA 1YZYA 1EX6A 2AOUA 1TTTA 2KX7A 2AW3A 1WUJS 3PTAA 4C14A 4WDQA 4QOIA 3H1GA 3PL5A 2FJPA 5CJPA 1HNZB 2IZ1A 1F3LA 4LYGA 3JS5A 2FH5B 2PSSA 3VSEA 2Q0XA 4MI1A 1CB7A 3DMGA 2G83A 4JEHA 1QQ5A 1KTIA 3STVA 2Z1DA 1XCLA 4IIUA 4HTAA 5EUQB 4KPUA 4BNTA 2F43A 1F8FA 2HJWA 4R3NA 1RLUA 4JOSA 1Z4LA 2BH9A 4H1UA 3SC6A 4YFYA 3CVWA 5CDFE 4B74A 3FVQA 2PLWA 4U9HS 4BLPA 2RGNA 2C3OA 2FSFA 1Y82A 3A4LA 1AGNA 2R6ZA 3P45A 1N6NA 3U4GA 2O0HA 4A2QA 1G0OA 3S3TA 2QDXA 1T24A 3BRQA 4NICA 1KHHA 1MGOA 3CM0A 3R3ZA 4R1TA 5J5CA 4WJLA 2OV3A 5KYYA 3QMWA 2IQ5A 4IDBA 1B16A 4JIMA 4IO1A 1WMBA 4DWOA 3KHTA 4Q18A 3GEDA 1O0BA 5J1TB 4PX5A 5TXGA 1Q95A 2WJZB 4EI2A 1JU3A 4JHLA 4HPJB 1PF7E 2AD1A 3BE6A 3Q6IA 1V1MB 3EQ9A 4JBIA 4NMXB 2CVFA 4KLZA 4ZIRA 3ZJUA 2XGJA 3BDIA 2B20A 1U2SA 3AF2A 4G63A 4NZOA 2RKBA 4O8ZA 4S1OA 1I3NA 2LUOA 1Z68A 4G1CA 4JH0A 4NE2A 4RTOA 4MHTA 2D0PB 1ZRNA 4EMUA 4BOYA 1JSZA 3JZDA 4YBRA 2VSQA 5ILQA 1GPYA 4TT3D 2FXIA 4MZXA 3OUTA 4M0DA 3RRNA 4N5DA 2GF2A 1KZ9A 1JXMA 3AL2A 5BN3A 1AGPA 4B31A 4EKEA 4YYEA 1RYHA 2FW7A 2EKDA 3IHKA 1F4PA 2C07A 2ATXA 2PRIA 2RHGB 2ZTLA 5F9HA 5AH0A 2KHZA 4CKEB 1LBHA 4DRZA 2YC4C 2QBYB 1Y0BA 3K92A 2C4UA 3OT4A 3TNYA 5C7LO 4RJTA 2FK8A 2QL9A 4FWIB 4DF3A 3N2KB 1SELA 1PJSA 3IERA 3ZWCA 3ZNQA 1MAVA 2CFRA 3GMTA 3I1FA 3IR6A 2PGXA 3N6RA 4KLAA 2MTBA 3I1JA 4C0JA 2YW9A 3ZXIA 5P21A 3TGWA 5I7FA 3NGLA 1HRDA 3D4BA 5FXMA 1UWLA 1XDBA 4F8EA 3SYKA 4NL4H 1YIDA 2VO1A 2CVHA 4XD2A 1MP0A 3U3RA 4ZEVA 4I6JA 1WQ1R 1JH9A 4G24A 1OLOA 1QGUB 1JHDA 4I8DA 2H48A 1QFJA 2JI7A 1JB9A 2GPNA 2VG8A 3D2BA 3FYCA 4HDSA 4X8LA 3VNSA 1TQ6A 5LOVF 4S05A 2BTEA 1E4VA 3NM5A 4AX8A 4BMDA 1JMYA 1J2RA 1VG9B 1CJVC 2JGEA 2OT3B 1E9VA 1V6SA 3UZUA 5ABPA 2BGGA 3JAMA 3R7WB 3I04M 1EAMA 1JEJA 5EWJB 4JHXA 1DRVA 2UZ0A 1SD5A 3MNFA 4TTPA 1DX4A 4BO6A 1Q0TA 4YMLA 2NACA 3M0EA 4RGQA 4FDVA 4ZREA 2G9UA 4ZVNA 3K0AA 2J0UB 4WOJA 1DKOA 5JNLA 3NMUF 2QI9C 1SK9A 4E1AA 3G9TA 2O3TA 1JSXA 1ADJA 2FPSA 4KDCA 1QP4A 2YIVX 3HKCA 3M6WA 3DE6X 1DXHA 3BFVA 1B8PA 1P6QA 1EGHA 3WIOA 3WLAA 4EJMA 1FW6A 4H60A 1JPJA 1NHWA 4FLFA 3RSQA 3H4MA 2PXAA 4DANA 1DUIA 1T5IA 3AH8A 3D6UA 1W5FA 1KC1A 2XYHA 1KQPA 1MAWA 1PGQA 3ZV6A 4QM7A 3WLRA 4D4HA 4PGHA 3QXGA 3KFLA 3I2FA 5FTJA 1IY1A 2WJAA 1I2AA 1P72A 3WE7A 2YY7A 2BMFA 5K0LA 2Z2IA 3W1WA 5IS2A 2WVGA 1TECE 3U7QB 2ZRGA 2FR8C 1E59A 2ZIZA 5A1JA 2QM0A 1H2WA 2GRJA 4RHCA 5ALVA 3H2IA 1J8QA 1PNOA 4MW6A 2J7KA 5DGXA 4ZT2A 4BUZA 5I3CA 2J85A 3MYYA 3P9PA 1VL2A 2H4ZA 2VDWA 3N7UA 1AXRA 3KV1A 3M33A 4AWBA 1XU4A 2ILTA 4F92B 2GPSA 4PU0A 3LVQE 5ENDA 1FLNA 1OY1A 3IUEA 3E58A 4CMGA 4K05A 3CZ4A 2AXNA 3PD1A 4H7PA 2GTHA 3LDFA 3SX2A 1O97C 4E11A 2BLNA 4QXAA 1J00A 1FDWA 1KJIA 1UBHS 5AXDA 4L4UA 3SOPA 2Q4BA 4OGFA 1U2TA 4FYMA 4V0MA 2XUAA 3S81A 3PX7A 2QN1A 3AP1A 1F51E 4MGIR 4RWEA 5EVCA 2XQIA 4YV2A 2BOVA 3LHKA 3LS2A 2WIKA 2EJUA 2PWYA 3CRW1 1IG0A 1ZHOA 2VWQA 1QO0D 3CSUA 2X8JB 3BTOA 1VHJA 3R4CA 3I5XA 3FMOB 3TLKA 2G07A 1AKYA 1PYOA 2QP4A 3QRWA 4Y1EA 2JLVA 3RJZA 4MDHA 1Y7PA 5CAEB 4AJ9A 3OEED 3S99A 1VGVA 1VIYA 1AGRA 3LBHA 2P3QA 4PZEA 4RQTA 4BFSA 1GSHA 2EBUA 4B09A 4JB0A 4OQYA 3HL0A 1ISRA 2Z95A 3Q3CA 4E7OA 2WNSA 3L0SA 5J23A 2AKEA 4Q1DA 3S5UA 1T3HA 2GNOA 6Q21A 3UOWA 4BFZA 3R7FA 4HNSA 4AKTA 3W05A 3P9CA 1G3IA 4NCXA 3BJRA 1HQCA 1OI2A 4LY6A 1TCVA 5AKHA 3FUVA 3ENZA 3RQIA 4HVCA 4XIIA 3GLFE 1O57A 3WLMA 4G4SO 2OD9A 1JKIA 1SQFA 4DLPA 1Z6TA 5A4FS 3I2HA 1JQEA 5DSTA 4D9IA 1P2SA 1UP6A 1X3LA 5HFJA 3U4IA 4PGFA 5DN6D 1RRGA 2H1VA 2Y99A 4EVRA 1F4VA 3PGXA 4QD3A 1DV1A 3JVUA 4C7JA 1FMCA 4PNHA 3QVGA 5HJ7A 4HAOA 1EJ0A 3CEPB 3GFVA 2XODA 5JH7A 1SN7A 1O7JA 2Q62A 2P8JA 3TVTA 2W6JD 2ZTMA 1J06A 1P1RA 1M2VB 3EULA 3ZG6A 5IZ4A 1M5RA 1WUIS 4D6PA 2BKUA 1RAHA 1VLJA 3H1BA 1GPAA 1PR3A 2WAAA 5CM8B 4ALMA 3R9IA 3WIVA 2BEVA 2JVIA 3GNLA 5E4JA 3ZCQA 2GWHA 1KQFA 3LM8A 4WZAB 1ENOA 1GY8A 4ND5A 3BMQB 4JUFA 4OQFA 4QPCA 5DTIA 1KAGA 1KIAA 1YDMA 2BCEA 5HBRA 5I7WA 1M0EA 3R9XB 3BRWA 1EHYA 1M10A 1XLUA 3ZI0A 3EF1A 4P0TA 2BFEA 4HH4A 5F78A 2AWNA 3NTUA 1PVVA 3UMVA 1WB6A 4W5JA 3ONDA 1S4QA 2HB6A 3PFNA 4FCWA 4K1LA 3MMSA 5ALWA 2FUG1 3N8NA 4KNWA 4LNUB 1JJ7A 2J3DA 3HNOA 1EVZA 3IPRA 1E1NA 2H0RA 1WB5A 1X7DA 3PHBE 5T6MA 4DILA 5JUWA 1SQSA 3GUVA 4B1FA 1ZRMA 4L07A 4OF4A 2WD9A 4YLYA 4F12A 3B3QA 1CUJA 2IU4A 5JZBA 1M6NA 5DBGA 2YXBA 2YXLA 2D0OB 1CG6A 3CKLA 3Q5DA 2HMAA 4RCVA 5D1NA 4LJ9A 2MOKA 3FNEA 2IHTA 3GJ7A 2YV2A 3O1HB 3WGZA 2GZ1A 4BDTA 1GGJA 3KDPA 4HB3A 4LG1A 2HN9A 3R0VA 3BRSA 5I7EA 1R5BA 2QSZA 2W6ID 3N87A 3PFGA 2IEIA 2VF4X 3PS9A 1MB9A 3I8OA 4UFPA 1GPMA 1AZSC 3KXDA 4QL3A 5DYTA 1LS6A 1SKUA 1O8CA 3Q7IA 4YI3A 5F21A 3TW6A 2FPWA 4ZU3A 5HK9A 2WUEA 3IV6A 4NEHB 4QFMA 5EWLA 4ZGGA 1QF7A 3EIQA 1AK2A 3N9IA 1L5QA 2KBFA 4BO2A 4AP9A 4LRWA 2HLDA 1Q77A 3UATA 1OTYA 4BP9A 4BV9A 4AJLA 3HABA 3UUWA 1E6KA 1AKMA 1JU9A 2CLDX 3ITNA 4AT1A 2ZVJA 4LGYA 3R8XA 4M0MA 4UUQA 1JVNA 4NU5A 5IBPA 5IABA 4FC7A 1NN3A 2FPGB 3HLKA 2XUPA 4N18A 5EKXA 3WKBA 1BWSA 1R3UA 3B2QA 3OCCA 3ZJ4A 4WKNA 5BWNA 1TW2A 3DZKA 3LPLA 4RNCA 4G0UA 3A7DA 1YMVA 2HNAA 4Z9FA 4A8PA 2BL4A 4ZTUB 5MF6A 5CFMA 3R3UA 4FD2A 4Y6RA 3OIYA 4P3OA 4B4WA 3GEEA 3OHPA 4CI9A 3A2MA 1RE0A 3QOFA 1GKLA 4PANA 2WAXA 3SFVA 2OUKA 2QRQA 2PH7A 2HRRA 4MQBA 5JARA 2B5WA 2HK7A 3KB6A 5AOVA 3CLTD 5IJAA 1OF1A 2EYQA 1V11B 1IOVA 1PTJC 2SICE 3NT4A 2O5RA 4MQEA 2J6HA 1EDOA 4NESA 1KFBB 1DUVG 2PS0A 3FI9A 5E3JA 3ESZA 4QXOA 3UPUA 2J5XA 1BKYA 4N0DA 4KR0A 1HI9A 3G68A 1GL6A 1FDSA 3UT5A 3DZJA 2P35A 3GZ4A 1W73A 2I4OA 1ECJA 1FRVA 5LQUA 1E6WA 4KR3A 1EXMA 4Y98A 4MYUA 2C61A 4HWTA 1YWGO 4Y1RB 5HWSA 2I9PA 4I36A 3VH2A 2J9FB 3KQSA 2CYBA 1B26A 3GGDA 3DBHA 3LXRA 4JODA 5F3WB 2EJTA 1N6RA 2QVXX 3INNA 3L0CA 3QW2A 2ZRIA 5C53B 1KVSA 2KPOA 2AJ8A 5KPDA 1ITZA 1V16B 3SZMA 1FYVA 1KI2A 2EIXA 2QXUA 4EMSA 1FFGA 1NI4B 2CKDA 2RAFA 2V3WA 3IBFA 1VECA 3HR8A 3QKUA 3SSAA 4ZMBA 4CR7A 3LCJA 3T95A 3TNLA 3CMMA 4K2AA 3VHQA 1LC0A 3V34A 1S3SA 1VKOA 4GGMX 3KAQA 3LO8A 5L3VA 3WAGA 5C8DA 2C04A 3CUSA 4TYWA 4B73A 4JEUA 1XU7A 3PDJA 4GMDA 4G1BA 4J0EA 5C8VA 1G20A 4XWGA 3QKTA 3I37X 4UZFA 1GILA 1PJAA 4MW7A 1DAPA 4YT5A 2AQKA 4YS6A 2HU7A 5FYQA 4HDCA 2WOOA 3BWBA 4QFCA 4L27A 3ZZUA 5IARA 5JATA 3UWDA 4U7GA 4ZKDA 2FGKA 3Q1KA 4KWCA 1D03A 1XLWA 2Y1WA 3W2IA 4LEIA 3KQKA 2XI4A 1FXWF 3GNQA 2H4XA 5IC4A 4PICA 5JAQA 1BXRB 2V6BA 1WXHA 2B8EA 1VPDA 5HFAA 3ZC3A 4GQAA 3KB1A 4AXBA 4B7ZA 1NDHA 2LR0A 3D6AA 2EDCA 1NYTA 3G1TA 4LGCA 4KOAA 4LCJA 4MK4A 3V7WA 4FE7A 3KWFA 4IM7A 1KDZA 3JVIA 3HN6A 3L02A 3BRCA 3GRRA 5AVXA 1QF6A 1F38A 5A4KA 4TUYF 2OGTA 2X6QA 3BMNA 2EGUA 4OBEA 3TRHA 2IA5A 1OFUA 3L1VA 4FQ5A 1JBEA 3CMCO 4JENA 3ZHQA 5T67A 1H2EA 2VWGA 2ZI6A 5ALHA 1AA9A 3AJAA 3QBJA 1U31A 4JOCA 2W98A 4II3A 4OMUA 4Y9SA 3QYAA 1ST2A 3H2BA 2X9VA 4L51A 3RO7A 1PFKA 4RY2A 3G88A 1ATZA 4Q05A 4ENTA 1UM8A 2NQTA 1H9AA 4TM8A 2OILA 1V7ZA 2B6HA 4ZJPA 5AW7A 2C2KA 4L5BA 1QIDA 2BEWB 4UKDA 1MVNA 3HEBA 4BPBA 3SD7A 4JT8A 2OG2A 3P20A 3PB3A 4B84A 4JUCA 4HEQA 4BNKA 4EOGA 4TTIA 3FHTA 4BCBA 4BXOA 1LSSA 2WSBA 2G4VA 2AB0A 2PKQP 3LQ2A 1RYEA 1E2MA 3CQ9A 1BH6A 4MVJF 2XXAB 3PHCA 4EG8A 1YFLA 3LF1A 4UNSA 4Y6SA 3S40A 2OYRA 2X15A 5K3FB 2P27A 2PU7A 4BMOB 2Q2OA 2PGAA 2DWOA 4YRTA 1FF9A 5F35A 1AKUA 2XRMA 1JG3A 2YQ5A 1VRWA 1ISPA 3V8RA 5B3JC 1J0BA 1WULS 4YJ2B 4PN3A 3KSMA 1WBBA 3CZ9A 1UPXA 3FSJX 3HSSA 3JQDA 4QYMA 5CU7A 2VSFA 3WI7A 4QO7A 5L8VA 1J9GA 1A2OA 2RGDA 3ABZA 3E23A 4K46A 4EAAA 1GTVA 4F4JA 2REOA 1P44A 3DEFA 3DQPA 3IUQA 5EQTA 1PBTA 3DE2X 3WLTA 1YS2X 2ZDGA 3M8KA 1QYIA 4FFSA 1F1BA 4OH1A 4INZA 4WLUA 1ZI9A 4Z4EA 2G77B 3AEQB 1DHTA 3K0CC 1R3DA 2J4CA 4GOMD 1MVLA 2O0LA 1KYTA 5K3EA 2HMWA 2CNBA 1I4LD 3DHVA 4C4ZA 3U4DA 1BHQ1 3VDMA 3CVOA 1N33B 3L3BA 5KVCA 1XRMA 2P4UA 4MO2A 2PIDA 2R8OA 5EC8A 4B4UA 3FZEA 4RA9A 4EJ2A 3HVUA 1YNSA 3KFVA 3WDMA 1JLLB 5B6PA 1PL7A 3ANTA 2EQBA 2EX1A 5MGBA 3RUCA 5G3YA 2SKDA 4DYDA 4AY3A 3IMCA 5CB4F 4NTZA 3GNTA 2W7TA 4D99A 2YFQA 4JL8A 2CK3D 1N7GA 2Y68A 4G9BA 1DAHA 5DVZA 2XBUA 1N5OX 1KI6A 4KV9A 1Z2NX 3HGMA 5LU9A 3BK2A 2GRAA 1K0UA 4GI7A 5ECDA 1P1CA 1EH5A 2ZSAA 4WDRA 3GP8A 1U0OC 1IXKA 3TL3A 2RI6A 4D9GA 3TD9A 4F56A 4ZI5A 4RMNA 3OD5A 2OD2A 4S1NA 4Y2GA 3JAWB 5CVEA 1RI3A 1BVHA 1S2MA 1ZK2A 2J59A 3GUZA 2K2WA 5J9FA 4P5PA 2RJNA 3M2TA 4LZPA 4XYLA 3MTDA 4AIRA 2Q0SA 1OKKA 1TK3A 4BAGA 3LBYA 4CR6A 3A11A 2BEKA 3QVWA 3U49A 5CH5A 1DFGA 3D3QA 4XDZA 1WUHS 3MJVA 2XD9A 2IFTA 3LHSA 4JKYA 4U9IS 5KVQA 4XDYA 4C6RA 2J3MA 4WJZA 2Q5QA 4AJEA 4AQDA 1FJGB 1QF9A 4KPGA 2P69A 1ZCBA 2HK9A 3AR7A 1NMQA 5KYNA 3EPJA 5IT0A 2HTEA 3CF4G 3ZBUA 5JNUA 2CWDA 1SC6A 1AUVA 2MR5A 1TIKA 4F4DA 4WBNF 1ZMBA 1VI5A 1O4VA 2FPKA 3H75A 5GP1A 3OQ6A 4MVJI 1PJBA 3JRXA 3U7JA 2PCJA 4LHZA 4TWJA 5JJCA 1AH2A 1ZZGA 2AN1A 3KT3A 2X86A 4CKWB 3K2BA 4BC0A 3CIOA 1QG0A 5IT5A 4K2HA 2AVDA 2QRUA 1TYZA 5AHWA 3AVUA 5LQRA 3VYRB 2WC1A 4LBVA 4RJ2A 2J9ZB 2FZVA 1NJ1A 3ZVLA 3QIVA 5B55A 4NBWA 2O8NA 4HZUB 3GZTB 3KJGA 3T94A 3OE4A 4HG2A 1ZXBA 3CLKA 4EZBA 3IT3A 1R74A 2A0KA 4LTMA 5AM5A 3V1NA 4DQKA 1GGVA 4ME6A 1QS0B 3F46A 5C7IO 9GPBA 3I30X 3K0CA 3AVQA 3CLSD 4K6OA 3ZIAD 3BQMB 3DMRA 3IA7A 4H6XA 1YB5A 1X1AA 2Z3WA 3THRA 3K4PA 1J21A 4ZRNA 4DV7B 1EK5A 4TTSA 1G8JA 2BZGA 5D3KA 1PR5A 2YHBA 5J2UA 1EZ1A 5CLLA 3WTCA 4KBYA 1RYYA 3H1TA 2JLXA 3K0SA 4U2GA 1Y8RA 1FLDA 1WSDA 3S2EA 2VA9A 4LXGA 2VJOA 3O7MA 5GIOE 3AM1A 1G6Q1 5K0NA 3AUXA 1H23A 5LXTA 3GLIB 1Y4AE 4OHPA 2P2DA 2JFQA 1OI4A 2EGGA 2CLOB 4IXMA 4YACA 3COJA 3I9KA 4IFTA 4KTVE 1OX5A 3VO8A 4OKIA 3D6TB 1ECPA 3L84A 5AJXA 5F7OA 2I62A 3QTTA 4G4JA 3KYDA 4DSZA 2B21A 2O3UA 1NUSA 3KUUA 3ZDFA 5LP6F 3SC4A 1KK1A 2VHYA 4E5UA 3OPMA 1THGA 2X0EA 3RBXA 1P9WA 5HF6A 3JD3A 3EY9A 1XKLA 3MUNA 4F7WA 1L5KA 5BW5A 5IULC 1RAFA 3GP5A 1Y3DE 1VRVA 421PA 1ZXXA 5I9SA 2D8AA 1UQTA 1RXVA 3RWMB 3TB6A 3RRFA 1EX9A 1TJNA 1QNFA 1S1CA 2CDBA 1U7TA 3LCRA 4MIYA 4EPVA 5KNDD 4ZEXA 5T41A 4H1VA 2EQAA 4Q4JA 2OMEA 3OSZA 1YZ3A 2IP4A 3NHBA 1E1CB 1VSBA 1R0WA 3G2QA 3IPAA 2QUHA 1KNQA 4E5VA 3FVVA 1NNI1 3NQ41 4LOKA 3IOCA 4LFCB 1CR1A 2Q28A 3UJ7A 3QV1A 3UWKA 1KE1A 4G65A 5IZCC 4KPFC 2V6MA 2PMCA 1I7SB 4C0AC 3CZ5A 1ZG3A 3JZAA 2B5OA 4NRDA 1TM7E 3B3AA 5MDHA 4OHWA 4GPTA 1R4ZA 3AFHA 3G89A 1T1RA 1QHXA 3GGSA 3VH1A 3MFYA 3RC2A 4DQXA 1SRQA 3K9BA 1V37A 3B6KA 2W58A 1L7AA 3WLNA 1RBZA 4PZCA 2JPDA 5F64A 3L18A 1RWPA 1BJRE 3G85A 4AZ3B 1NVWQ 1T4BA 1L4GA 3JVVA 1YQUA 5AW6A 5KSZA 1C7JA 2OHOA 1DTSA 1TPYA 3DD1A 4MWOA 4QSMA 1VE5A 4QXQA 3F49S 3ND9A 2FPMA 3CVVA 3KG2A 2GJ9A 4IVPA 5TE9A 1KMCA 4CU2A 2PUCA 1UXIA 2X1HA 2PAFA 2Q5HA 3J81A 4GKBA 2GVDC 1X7GA 2Y27A 4IINA 5LA6F 4MROA 3RT9A 2Z6UA 4WCDA 4EFDA 1L4YA 1U90A 4U6SA 4L9WA 5AW5A 3H1EA 3RV4A 4RF4A 4I4TF 3ZUGA 2B8NA 2B69A 2WF6A 3CPHA 4LHVA 1V95A 4DUGD 1Z8HA 3M4YA 1VG8A 2RBKA 5EOVA 3ZK9A 1G21B 2FFAA 4UM7A 3M82A 5KWIA 3IVCA 4LC0A 5DNAA 2QTFA 3U39A 1ZJ5A 1XPOA 3LYHA 1N2JA 1HE1C 4YMVA 1BEZA 3GOQA 3VR4A 3M3PA 3QFCA 1GD1O 5EJ4A 5KJFA 2FPIA 2O8DA 2W2LD 4MW2A 5GONA 6ABPA 1PWXA 3FFBA 2Y77A 3ZCPA 1QP8A 3BQ9A 1G6HA 2ZE8A 4G0PA 1AQLA 2YWCA 4TQUS 5DZSA 4YRJA 5CFOA 2PWZA 3H9CA 2R0QC 2QOEA 3A3OA 4JBWA 3CN9A 3DLAA 3Q5GA 4PSVA 3KPWA 1F60A 3KEGA 1EFUA 1XZEA 5JYBA 2IVZA 4W4TA 4CM1A 3JQ9A 3V3TA 4KR2A 4R6WA 4C6TA 2M6RA 2ZRPA 1J5EB 3ZGXA 1YVPA 3R3SA 3HV0A 2CL7X 4DKXA 1WZIA 4RV5A 1REQA 3IP8A 2QSJA 3VPCA 4C0SA 1LWNA 1TZ2A 3PKIA 1MNQA 4O4HF 3RUAA 1SRRA 1GJRA 2GM9A 3NKLA 4PGGA 1KPGA 1NVVQ 5HUJA 4BMZA 4LRXA 3N5KA 2VCEA 2VXCA 2NSHA 1T3SA 2X13A 3U3ZA 1B4DA 2J32A 1CUWA 4V1CI 3FNBA 1RBMA 3MOGA 3ROZA 2G6TA 4O4JB 2O3JA 1P6XA 4RVCA 5G4KA 3IR5A 7GPBA 3D2CA 1XR3A 3NVMB 2EFJA 3O82A 3GBPA 1Z0KA 4HZGA 4RPGA 4TKUB 3O03A 4TUYB 2CLFB 1NY6A 1T2EA 2I87A 2QMQA 4EY8A 1NF3A 3V33A 4P54A 2P9EA 4XFKA 1WXXA 4UU8A 2UXDB 4B79A 3PQFA 1ZVKA 5FEUA 4ZO9A 1W8IA 2IWRA 3PXGA 2ID7A 1YL6A 4XQGA 4AWXA 4UUAA 1T13A 5B3AA 5IH7A 1K8RA 1U9IC 2QLLA 4IW3B 5IC5A 3SZ3A 4DNQA 4JLWA 3BBPA 4XOIA 2WQ7A 121PA 4WKBA 1FQOA 4IV0A 2HF9A 1XDSA 1I6KA 2CZQA 3VR0A 3WFIA 3AILA 1QGED 3DS8A 4CMHA 1TYAE 3T1TA 2HEIA 4NQRA 2W83A 3HXTA 3QVUA 4RJIA 1ZJ6A 2DKNA 4Z7NB 5D6OA 3ADOA 1E1QD 1E1MA 1MC8A 2P9BA 3SMQA 2R00A 2HRZA 1SOAA 4HS4A 3EIEA 4G3XA 5JWHA 4BGIA 1UT6A 3DCJA 2JFZA 3ENVA 3I8SA 2RG7A 4AO6A 4BXOB 4C0HA 1UJ4A 1K8YB 4QARA 2IYXA 3LK7A 4ZAXA 4TTTS 4EB8A 1CUZA 5BQXA 1O89A 5C0OE 1XO1A 3QA9A 2B35A 3NAZA 5DT2A 3KJZA 1AMUA 2XF8A 1QH0A 3GDGA 5E1DA 3ONEA 3VKGA 4DFDA 4YXWA 3PSAA 2VK4A 5AM4A 3AUKA 1QB7A 2FCAA 4MW0A 3UH0A 5ICCA 2ONKA 3ZQUA 3ZW9A 1MXFA 4YJ2A 2H65A 2PQ6A 4CTNA 2F3SA 2ISCA 4M8NE 3W6NA 1G8MA 3FW1A 1DWOA 4YT4A 4JL5A 1KZ6A 2Z4SA 4YXWD 5LR6A 3EOBI 2UYYA 3JZIA 5JRZA 3DCNA 2C0PA 5HDBB 3SQDA 3KKKA 4F5EA 1O58A 2BFMA 1K5GA 3AR8A 4QRHA 5DBIA 3DDWA 1Z74A 1C1HA 3ESDA 4UHKA 2GASA 4G5XA 2H1HA 1OI3A 2L69A 4AY2A 3DDUA 3EGXB 3OFJA 5TPZA 3UHOA 4F86A 2JH8A 3OQMA 1GG9A 1U2DC 1YIOA 5FQNA 4TV8F 3ZHRA 4M87A 4EDFA 2P4HX 3RHFA 2H92A 2CXQA 3LGXA 2V7VA 1SCUA 1JECA 3FLEA 3QITA 1Q92A 1TD1A 3U7IA 2JFXA 3JQGA 3RUEA 3UVEA 3MBOA 4DMLA 2CCKA 1KI8A 1Y5NA 4RPJA 3QUQA 2ADOA 3CUKA 3GRUA 3FRJA 4LCEA 4M76B 3L7DA 3ND7A 4AROA 1Q1AA 5IEBA 3EDYA 4YQEA 1YRHA 3V48A 4DARA 4JS0A 4MI9A 1SU7A 3AGQA 4O4LA 5KYXA 3NM6B 5D5QA 5K99A 3KD2A 4Z4GA 4Q01A 1JLSA 2JANA 3UJDA 3IVRA 4OB6A 1J2EA 4H7EA 4I9UA 3SJZA 5C7OO 3M9WA 3O8QA 4KTTE 4W99A 4CMEA 1P4RA 2DFDA 5GIPE 1KY4A 1VE9A 3H9JA 4YRGA 2AIRA 2F00A 3WBKA 5L6MB 4RDXA 1Y6GA 2XMBA 4MUNA 4WESB 3FMIA 4NOMA 1W0KA 2MYPA 4R2MA 4HGNA 5DRYA 4YCSA 1LJ8A 3KC2A 4QDOA 4WZAE 5TY0A 1ZH6A 3SKXA 3RC8A 1XHEA 3PEEA 4M1ZA 2UUPA 3AUFA 1PEYA 3NDJA 4C4XA 3V8BA 1W96A 4OLAA 4QJ4A 1PI3A 3ZHYA 1ZH2A 4FZ5A 4G37A 5BV0A 2IUSA 4OTZA 4RM3A 2OLEA 3GY0A 3MHTA 2ZBRA 5CIQA 4S0XA 5HE9A 5BMVB 1W6RA 2IUUA 4IICA 1RJ9A 2WJWA 1NUQA 2P1ZA 4LECA 3WC4A 2B61A 3T52A 3OIDA 5I4KA 1WCV1 1ZD2P 1T9ZA 2X22A 3K09C 3QELA 3N3BC 4IIJB 4AP6A 3R5KA 4EH1A 2ZDHA 2X1LA 2X8LA 2CD9A 4UE6A 1R8XA 1JHPA 1NV8A 1BHO1 1SVOA 1LPBB 1VJTA 2BI8A 2ERCA 3JD1A 5KNDH 1KP2A 1E94E 3NORA 2BMWA 1ZAYA 4H27A 2UZ1A 3JATA 1C3OB 1QHFA 1RKVA 3S2GA 5LXTF 4R41A 1X14A 1R0SA 1ONNA 2YHUA 3ISTA 4ERXA 5J58A 2WD7B 1KVRA 4EP1A 1IEVA 3ESXA 1KSGA 2GAJA 3BMCB 4J4BA 2JLZA 3EMKA 2VHEA 1ES9A 3CY6A 4X6XA 3LUGA 3RS5A 1PWHA 5EQJB 2CLHB 4PG8A 2FVYA