1LJLA

Wild type pi258 s. aureus arsenate reductase
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
130
structure length
130
Chain Sequence
DKKTIYFICTGNSCRSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDADNNCPILPPNVKKEHWGFDDPAGKEWSEFQRVRDEIKLAIEKFKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords arsenate reductase
publication title All intermediates of the arsenate reductase mechanism, including an intramolecular dynamic disulfide cascade.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
total genus 48
structure length 130
sequence length 130
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2002-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ljlA00
4WXEA 3T38A 3HJFA 2N9UA 1JFSA 5FWYA 5EWLB 3JS5A 4F06A 5CHYA 3QEKA 4KK3A 1CEYA 2CHEA 2IKSA 1U0SY 3LUCA 4LE1A 4DN6A 4RDCA 2PUBA 1GCGA 3EQ2A 2FLWA 4FB4A 5JNWA 3HVRA 4HNRA 5CNMA 1GLGA 3HUTA 4LE2A 2AYXA 5HQJA 4MR7B 1QKKA 1GUDA 3O2QB 2GX6A 3O75A 4Y9TA 2VYCA 3H5VA 3D02A 5IBQA 3BREA 4W5NA 1KRWA 3OLWA 5EWMB 5TPZD 3SM9A 4MRMB 7ABPA 2VUIB 1QQBA 3OQNA 3CFYA 2R4QA 3H5OA 2IPLA 1TLFA 3SQNA 2L2QA 3OM1A 4B09A 1U8TA 4UHKA 3F73A 4MQFB 5KQLA 4H60A 1NXVA 4O1HA 1XWWA 1ZGZA 1JX6A 2RDMA 3H5LA 4ML3A 3TMYA 5FWXB 1USGA 1D2AA 3H1FA 3JPYA 3K4HA 1JHZA 5IUNC 1PNTA 3L49A 4RXTA 4KFCA 3S99A 2J48A 1Z16A 2RGYA 1P6QA 4NV3A 2F8TA 4KMRA 2BGGA 3IP7A 4IILA 4N03A 3Q41A 4WT7A 4KQCA 3GV0A 4L85A 4YGXB 2IPNA 3NBMA 4D6XA 1Z18A 4EY3A 3NHMA 4Z9AA 3QX8A 1ISRA 4HNSA 3MMNA 3C3MA 1K68A 2NT4A 3CTPA 3T6KA 1BDIA 4NCBA 3JVDA 5EWJB 5KQGA 1FFGA 3QLUC 4F3TA 5GOTA 4RWEA 3DGFC 3KKEA 2JVIA 3GL9A 3CKMA 4G0OA 4G97A 3BRQA 1JFTA 1DZ3A 4WXMA 1A04A 2OENG 4LDAA 2KYRA 1D4ZA 2L19A 2YHBA 4RZSA 1YVUA 5TQ0A 1DCMA 3E61A 1EWTA 1C4WA 9ABPA 2E4UA 1Z2EA 2FN9A 2FQWA 3E3MA 2MSKA 4OTZA 3IP9A 3FGZA 3EAFA 3EDCA 4Z0NA 5JS2A 5TQ0B 1U2QA 1QPZA 3LOPA 2PUDA 4KZKA 2NT3A 4MR8A 2PUAA 4W5QA 3KLNA 1D1QA 3H6GA 1M2FA 2VUHB 3ROFA 2PAFA 1XHEA 1PHRA 2WMYA 3LUJA 3RH0A 1RNLA 1EFAA 2LP4Y 3HS3A 4MS4B 3LUGA 2JCGA 5DTEA 1E6KA 2AYZA 3NHZA 2HJ9A 1EWVA 2RJNA 2PKXA 3I45A 1TVMA 1QNLA 1JBEA 3EQZA 3O1IC 3H5WA 1BA2A 1TM2A 1YIOA 4D74A 1YK0A 2A9OA 3EODA 5BRJA 3TX6A 3GA5A 4MAAA 4MPTA 4H3KB 1T34A 2P4UA 4RY0A 4H3HB 1QO0D 3Q7SA 1NATA 2YHAA 1RZRD 3OQMA 4PZ0A 2JK1A 3HSYA 4NCAA 1MIHA 1S8NA 1Z25A 2JVJA 1XHFA 3GWGA 5JNVA 3IP5A 4M88A 1B00A 3M6MD 4YP9A 4MS3A 2QU7A 3UUGA 1QO0A 3EGCA 3ILHA 3OLVA 5DCLA 4W5TA 5EWLA 5T7BA 3MYYA 4N0PA 2H0AA 4WUTA 4S05A 4MLCA 2QVGA 3C6QA 2JBAB 3IPCA 2WY2D 4KNYA 1CHNA 3MA0A 3MIZA 4RKRA 3EULA 4N41A 1AB6A 3C97A 3LKVA 4MR7A 4G0PA 4WZZA 3RVOA 1DBWA 2FMHA 3QEMB 4D6YA 4Q7EA 2WJWA 1D1PA 5EWMA 4MRMA 4S04A 2HQOA 3LFTA 2IPMA 4RK4A 3TB6A 3I42A 1WETA 4G0ZA 1DCKA 3QELB 1JF8A 4MQFA 3NNSA 4XLTA 2IDMA 1LK0A 4EVRA 4GPAA 1QP4A 1QQAA 5FWXA 2LBPA 5F64A 4ZMRA 5KWSA 1I3CA 3CZCA 5JNRA 2FQXA 5B3JC 3OO0A 1ZVVA 2NUBA 4LE0A 2PLNA 4MR9B 3H6HA 4OATA 1GUBA 2IYNA 3KHTA 1Z13A 1Z2DA 2X7XA 2E4XA 3SAJA 2L18A 2MYPA 4RK0A 4TMYA 1JH9A 2Q5CA 3RVMA 4ZPJA 1VRVA 4Q6WA 3N0WA 1P8AA 5TPZA 4QYMA 3Q15C 3JY6A 4G0MA 3RVLA 4RKQA 4JOQA 1Z17A 5PNTA 5TPWB 1A0OA 1DRKA 3CLKA 3JPWA 5EWJA 3TO5A 1ZESA 1MVOA 3GRCA 3HUUA 3N8IA 4JAVC 2LIVA 1JFVA 1LBIA 4UHJA 3M9XA 5CNIA 3VNBA 3OLZA 4ZMSA 2RJOA 3HV2A 3F7NA 3IDOA 2FN8A 2OQRA 2PJUA 1PEAA 4YWHA 2GBPA 3LKBA 4G0YA 5JS1A 2R25B 2A9RA 5FBKA 2ID7A 3A0RB 1C0EA 2FKAA 3QK7A 5JNSA 3HEBA 4EUKA 4HNQA 3HDGA 5TQ2B 5BQ3A 4W5RA 5BRAA 5C5EA 3DBIA 1NXPA 3FMVA 1W9HA 1W25A 2L17A 4IGAA 4YV7A 2I6FA 2FW0A 1SD5A 3SNKA 1K66A 3GYBA 2ID9A 3KJXA 3I09A 4LRQA 1JYEA 3N6VA 2WRZA 3OO1A 4OLAA 3GT7A 3IP6A 3HCWA 1FFSA 4O5AA 4IRXA 1ZITA 3N75A 5B3JA 3W9SA 2FEWB 2FSPA 1ZHHA 3HM9A 2E4YA 3A3KA 3KYJB 5FBHA 1NXOA 2CHFA 4MS4A 5CNJA 6CHYA 1ZH2A 5IUKC 1JDPA 5IUJC 3N0RA 1YMVA 4TN5A 1FSPA 1P6UA 2IPAB 3H1GA 1VKRA 5ABPA 1L5YA 3N0XA 2FXIA 4EYKA 4G0XA 4MQEB 1JDNA 5E3JA 1BDHA 3Q7RA 1KRXA 4LDZA 1JYFA 1NXXA 2HPHA 4NICA 1J56A 4KPYA 1YS7A 2CD7A 4IMJB 4Z9BA 2PUGA 1DCFA 4Z4HA 4YR7A 5IEBA 2ZAYA 3UKJA 4LX8A 1NXWA 1KMIY 1AB5A 1SXHA 2HQRA 2MYUA 3HDVA 1MB0A 3KCNA 3RVNA 4E7OA 2O20A 5DGCA 1BVHA 1USKA 2E4VA 4MS1B 4YCSA 1R8JA 2V0NA 2E4WA 4YO7A 2CWDA 4OG2A 4Z4CA 1DRJA 1M2EA 4Z99A 1ZY2A 4RY9A 3F6CA 3LUAA 3QX9A 3OQOA 4KVFA 3HZHA 5D2CA 3BBLA 1DBQA 1SRRA 2FMIA 3CG4A 3EJWA 2QV0A 1MB3A 1RZRA 1ISSA 1E2BA 2JBAA 3SG0A 5HKOA 1DP4A 4N47A 1DC8A 3MF4A 1ZDMA 3GBPA 4PICA 2MYNA 3LMKA 3FFWA 4GNRA 2MSWA 4MYRA 1LJUA 1DG9A 3BILA 3QEMA 4EYQA 1EWKA 3JVIA 4JB2A 4JP1A 4RY8A 2JRLA 1PEYA 2QZJA 1MAVA 5TQJA 3H5IA 3O1HB 3O2JA 3OLYA 4XARA 3QELA 3R0JA 3SY8A 1H9CA 3OM0A 1JWLA 2QVCA 4DQDA 5DKFA 4FE4A 3LUKA 4EGSA 1E6LA 2WWVD 3O21A 2QW1A 3GBVA 1NXTA 4MR9A 4EYGA 3DLHA 4F12A 1TJYA 5KQPA 4N0QA 3LTEA 3RVRA 2M98A 3DZDA 2B1JA 4KK4A 5T3YA 2QR3A 3Q7TA 3P9YA 1YS6A 4G86A 2PL1A 4N76A 1A2OA 1Z15A 1SXIA 6ABPA 5TPWA 2H3HA 2GKGA 5FWYB 1NTRA 3RVJA 1URPA 1VPWA 3HXMA 3CNBA 2PUFA 3QLTA 2F8SA 4OBBA 4CBVA 4ZJPA 5HM6A 3NNNA 2W42A 1USIA 5KQMA 4RK7A 2E4ZA 2PMCA 4NQRA 3H1EA 4Q6BA 1RXIA 3KS9A 1Y1LA 4L4UA 4RU1A 2LUOA 4LZLA 4ETNA 3FFXA 1DBPA 3ILYA 3D8UA 4RSMA 1ABFA 3DLBA 5TQ2A 1NXSA 2FVYA 1QMPA 4KRFA 1NY5A 1JL3A 4PYRA 4RS3A 3MQ4A 1VLZA 3RVKA 2FQYA 1M5TA 1QP7A 3KSMA 1ZH4A 3BRSA 4XASA 4WWHA 1CYEA 3KYIB 3OLXA 1IIBA 4IMIB 1ZAYA 3M9WA 4ZYLA 1OXKB 1EAYA 8ABPA 2TMYA 2WJAA 3Q9SA 4RK6A 5GQSA 3O1JC 3ROTA 2FLKA 2LPMA 3B2NA 3G85A 2QXYA 1P2FA 5ED4A 3LUHA 1OXBB 1LJLA 2R47A 4HYEA 3OMWA 3H75A 3HK2A 1EHCA 2XDYA 2FTKE 1E6MA 4ETIA 3CS3A 5JNTA 5IEJA 2A9QA 2PL9A 4MQEA 4IF4A 4JASB 5IULC 4ETMA 4KREA 4E7PA 2ZWMA 5I4CA 4KQ9A 3TD9A 5KC8A 3KG2A 2QSJA 2VK2A 3QLVC 4XAQA 1DJMA 3RVPA 1PUXA 4G0QA 1FFWA 3T95A 3DGEC 4DADA 3A10A 2PE5A 3N53A 3I5AA 1U2PA 2GWRA 3MM4A 4MLDA 2P9HA 3C3KA 4P98A 3LUDA 4Z4IA 2DRIA 4P1ZA 3H5TA 2JB9A 1DC7A 4PEVA 4RXMA 1BAPA 3F6PA 3O74A 4MS1A 3C3WA 1APBA 4Z4FA 2FMFA 5C5CA 4EVQA 4O1IA 5IX8A 1F4VA 4JA2A 2FEKA 3FDFA 4MR8B 2M1ZA 1ABEA 3CZ5A 4RXUA 3CG0A 4W5OA 2PUCA 1GCAA 2GI4A 4F8JA 3CRNA 1ZGGA 2HQBA 4QYWA 1F51E 1FQWA 4YLEA 5TE9A 3T8YA 2IOYA 2R48A 4EYOA 4RK5A 5CNKA 1D5WA 3IPAA 2NZVG 2MSLA 4PE5B 1SXGA 1YTUA 2NZUG 4QICA 1TMYA 4TLLB 4YS6A 4RK1A 5DLEA 5KI6A 4QPJC 1M5UA 1RPJA 4XFKA 3URMA 4OLBA 1RXEA 3KTOA 1JLKA 3QLUA 5BR1A 1PNRA 1Z12A 3RVSA 2FEPA 4JB0A 1L5ZA 1HEYA 4Z4EA 3G1WA 3UK0A 3L6UA 4F11A 5JNUA 3O2SB 2B4AA 2JVKA 1BDJA 1Z26A 2MYTA 1YMUA 1U04A 3FFTA 3KLOA 1QP0A 3CHYA 5IC5A 1KGSA 2WB4A 4KV7A 4YRZA 3HO1A 4EVSA 3A0UA 4Z4GA 2A9PA 3QLVA 2FMKA 1LBHA 3VNAA 4MGEA 3K9CA 2PUEA 3RVQA 4RV5A 3OMXA 4MS3B 5KC9A 1UDRA 3LUFA 3CU5A 3JTEA 4FE7A 4TLMB 5HSGA 1YK1A 1ZN2A 3NNDA 2HSGA 3RQIA 4XXHA
chains in the Genus database with same CATH superfamily
4GVPA 3SXUB 3O4VA 2DPGA 2A57A 1GAEO 1KVSA 3UT6A 3FZNA 4JZYA 4P4SA 5CU7A 1B0ZA 1YDWA 2Q9CA 1O6ZA 2QN7A 2ZR9A 1I3MA 4EHIA 2Y4NA 1XNHA 1SU4A 1JJAA 2WTXA 1UFVA 5I8WA 4Q9AA 2QTWB 4FHCA 3WGKA 2VPYA 3COPA 3EBLA 3DWGA 3B6IA 3TFQA 4IKEA 1TD9A 4WZBE 2ZRJA 1QHYA 5AUNB 2XR1A 1UMBA 1W75A 2C2BA 1JLMA 1B76A 4RVCA 1ESNA 3A37A 4YJFB 3FFAA 1ZUHA 3OLWA 2Z8XA 3M3DA 1A9OA 1SVWA 1ZM2A 5K0NA 2XB2A 1MAAA 2JGAA 1MRZA 3ZVMA 5DHSA 3E03A 3PEEA 2B7CA 3I9V1 2R1TB 4LV6A 4MQFB 4YHHB 3PHLA 2O2DA 4O1HA 3OQJA 5DK6A 1X9GA 1SKQA 3MGCA 2C82A 1G3RA 1J6UA 2IY8A 1XQVA 2LDBA 3R2JA 1MW8X 2A4MA 5FDFA 5KU7A 5JG7A 2IZZA 1E1QA 3T1OA 3S99A 2HGZA 3NHRA 2UUPA 4TKVB 4US1R 1Z6PA 3NC1C 4UUBA 3MD0A 1I7DA 2GZ2A 2VLIA 4NPAA 3EXFB 1VL1A 2V6GA 3MJFA 2P2LA 2PPVA 3KRTA 3X1ZA 2PU5A 1Z0SA 1KBOA 3W2IA 4LJ8A 1Z6ZA 3DR5A 4RVSA 3WHIA 4BQRA 5JH7A 3KQNA 4ZCIA 1FFAA 1X1CA 3EXEB 5KBYA 1QHXA 2J32A 2XYGA 5L7TA 2C4KA 2R5WA 4UNSA 4A8JC 5DM1A 1D9XA 3KZXA 1YCDA 1SUSA 3GL9A 4ZI5A 1NOIA 3WIEA 3PQ5A 2CKMA 4KBYA 4F3NA 2D7DA 1R4AA 1A04A 2BR5A 1BQ3A 1L8QA 2FOXA 2JA1A 4OM7A 1UXHA 9ABPA 4MO2A 1PCXA 1J06A 1OYOA 1VDZA 2AFVA 1JG6A 3E3MA 4WV3A 4Y6QA 5LMNB 1HL3A 1MU0A 3FGZA 2JJ8A 3IUQA 4A5OA 1YGPA 3L0BA 2Q1TA 2K87A 1R1DA 2V5UA 3K0KA 4DL9A 2ZIFA 4X6XA 4KZKA 1UPCA 5LSAA 1QHGA 3WYAA 1UKBA 2P3OA 5HIJA 2GZAA 2VRNA 1V71A 4O4JB 3TDNA 5K6TA 3M0EA 1I7NA 3KZVA 4TKVA 1KAEA 1N6LA 2E9SA 1A77A 1LUAA 3HU2A 3G9XA 2PLAA 3PJFA 4XWAA 1TC1A 3GVXA 1B23P 1FY2A 5FX2A 2LP4Y 1X1EA 3K15A 1CX9B 1FDSA 1LBQA 3LUGA 4LJAA 5FP0A 5BQPA 3I2FA 2AUNA 4WZBA 1RAIA 3G2HA 5HBGA 4YAGA 3TH5A 1D2RA 4UASA 3ZW7A 3IPYA 2PSJA 2VYND 4PLZA 1JBEA 1VIAA 2XOXA 1YZUA 1NKTA 3EQ6A 1FUEA 1VYTA 4Y2TA 2XV1A 2YWJA 1KORA 3H87A 4OL0A 2PMKA 4EW2A 3K9GA 4UARA 3KWMA 3RLIA 1QFJA 3O8QA 4X1YB 5IDXA 2O0JA 2O3QA 5D85A 2XKBA 3NGLA 4TL8A 4R7TA 3RIMA 4OI0A 1O7JA 2O2HA 3PNBA 1M67A 2IGTA 3GMIA 2B69A 5LLTA 3Q7IA 3G02A 3D43A 2VYFA 1J97A 5BSRA 3DHWC 2GNPA 1H9BA 1MO3A 1TO6A 2R4TA 3QUAA 2F9LA 2O2IA 4Q15A 3X1JA 4DJAA 5C1OA 3AUTA 2IP4A 4N5HX 4L8LA 1DX4A 4WFJA 5LWHA 3A2KA 1UWCA 3X1KA 5BVGB 2C2HA 3I6BA 2W2VA 4AP6A 1HTWA 2JIQA 2XEDA 2ZJFA 3OLVA 1IN5A 3ESQA 4MA0A 4WCDA 1WBDA 3NYIA 1WZ2A 1TF5A 3EMVA 2XTNA 3DP9A 2RKOA 2A67A 2CXNA 4HAWA 3RSOA 4FGSA 3OX2A 4WUTA 3OECA 3RR2A 2H2WA 3HU5A 3NH6A 5JADA 3I92A 3PIDA 4FN5A 2JBAB 1Q5PA 3LY9A 2NTVA 3IAXA 3EPLA 1Z0JA 1KPGA 1FF9A 2NQ8A 2C94A 4MR7A 1U6KA 1RAFA 2I1QA 4FT2A 3PR3A 5JNLA 2F6RA 2D62A 3HB9A 4M76B 4BO9A 3R7SA 2Z1NA 3OQPA 3BL8A 4EPYA 2H3EA 2QAGA 3X2SA 4MUAA 2EHJA 5B1DA 1ZWLA 2E1RA 1PFVA 1K8XB 1QH8A 1E0DA 2GZHA 1OTHA 4ER5A 2A2ZA 1I9GA 1QIIA 3PLRA 4AF6A 3CVWA 4JLKA 3CE6A 4ZVOA 3D3WB 1QP4A 3IQGX 1JKXA 1RW4A 4MRRA 2WT8A 1PL6A 3QLJA 5IFLA 5KSWB 3U1BA 4DB2A 4F4JA 2NUBA 4FFRA 3A4VA 1PWYE 2PGAA 3KUXA 3L40A 2B34A 4Y9DA 3BF7A 4LF4B 4C4TA 3HB1A 3GGGA 4B34A 4EZEA 2V6FA 1GSIA 3OPYI 4NJMA 3RYTC 1WZIA 1P81A 1OYVA 1WW8A 1DAOA 1TQ8A 2YTZA 1X80A 2Z58A 4TVOA 4DCJA 1POXA 4EB6B 3VKUA 3EY9A 5T64A 3D1VA 1MA0A 3Q15C 4G0MA 4B32A 4IAOA 5FWAA 1E2MA 2W48A 5HZMA 1YACA 4GGOA 3BH0A 1KETA 2D2EA 3D31A 3FBTA 3OZAA 3FBWA 5A5GA 4QT4A 4UHJA 5IF3A 2XYHA 4YFYA 1PWXA 4JCCA 5AK4A 3DONA 3IOCA 3AGQA 3IULA 4P2GA 2OP1A 2HM7A 4C7XA 5G1NA 5HQTA 4E30A 1O6GA 2CUZA 2RGBA 3TN7A 2CDBA 1L5NA 5JJLA 1AJEA 3B1ZA 1E5TA 1JLHA 1I3OA 3ILVA 2CXRA 4KUHA 2PVSA 4W8GA 2R8EA 1KJZA 1C0EA 2IYFA 4GOMD 4ZCPA 3FW1A 4N18A 5BSGA 4M1SA 4R0MA 3HFGA 4HNQA 3KKMA 2IITA 3DVQX 4TYQA 3WIUA 2OGTA 1KYXA 3HBLA 1R12A 1W9HA 3MLAA 4IHAA 3FMOB 1BYIA 4M2LA 1OI7A 4C30A 2ECFA 1OGJA 2ZG6A 3KJXA 4JLJA 3AEXA 4LWQA 3OPNA 3ZE2B 4A16A 4B5KA 1PEDA 2OHFA 4KRXA 1V43A 2PWPA 2JFOA 5A4DA 2Q3CA 3E8SA 3EVTA 4ITRC 4O2AB 4Q3OA 3CZPA 4JUAA 3NP7A 1RJEA 2XVMA 5AKXA 1H2XA 3TK1A 2LNDA 3O7WA 5KTTA 2IK8A 1PLLA 2JGKA 1H2RS 2AZDA 1T35A 4CW7A 3C7AA 2BEWA 2P9BA 2CHFA 3MTQA 4DV1B 1I5OA 4G0NA 3C39A 1E1CA 3DMTC 3GQVA 4H6PA 3G6KA 4JKIA 4K6CA 4KXQA 3GG9A 2CW5A 4J3NA 3K0CA 3GEIA 1QRUA 4B46A 1XFDA 2IRWA 4OOFA 5JWRA 3PXGA 1CIPA 4HP8A 2X1MA 4AYXA 3ZXYA 3ZHXA 4EO9A 1NLYA 3TIXB 3STHA 1U7DA 1GPUA 2BUBA 3DDHA 1TPZA 5FTLA 3BGWA 1BFDA 2PKCA 3H8WA 3RODA 5KMGA 4P0QB 3JASA 3JVUA 5AVOA 2NTEA 4JEMA 2PTGA 4OX9Y 2BGWA 1RCUA 4IDCA 2X5OA 1HDRA 1XTZA 1E7YA 2CVZA 3HDVA 4E1AA 2V6MA 1DAEA 3UK1A 2QD2A 1OIVA 4I4IA 3TXYA 6YASA 3GNQA 1M2JA 1USKA 6PFKA 4HDMB 1AE1A 3FNGA 1Y7HA 2QTBA 3FCAA 2HHCA 1ADJA 4IO1A 3RU7A 3VGJA 5F7JA 2JI7A 4MPJA 2CFIA 4C0KA 4FZJA 1HG0A 4CF5A 3ELWA 3GRKA 1TA4A 1COWD 1LTHR 1N5JA 1E61A 2JFGA 1G1MA 4P3YA 4DWWA 3OPYA 3BMOA 3LF1A 1T9KA 3H1PA 3VYSB 3CLUD 5G0VA 1RBYA 4DBLE 1WCYA 1ADCA 1KAOA 1NVUQ 2ZJYA 4U9IS 4ZQGA 1RZRA 3LTNC 4EPTA 1N75A 1HSZA 2VHJA 2YFQA 4GBMA 5M34A 1GL6A 4N8DA 3ZZMA 3LQ4A 4JI0B 3GEEA 3RRMA 2PSFA 16PKA 3P2MA 1OE0A 1ZOSA 1QVVA 3LPNA 3OIFA 4MVJD 4EYQA 4L57A 1S1CA 5TR9A 4TRRA 3AUJB 4ENUA 3QITA 1A9XB 4G8DA 1XVIA 1YBFA 4BQEA 1E9VA 4Y9UA 1JHYA 4ER3A 3ZWCA 4DMCA 3WQQA 1RHJA 3AO0B 4KNVA 3WDLA 1FLVA 5C80A 2GN4A 1HMYA 4PXAA 4E51A 3G0HA 1SBZA 2CE7A 1JQ3A 3C45A 5DNWA 4BNUA 1EDEA 1CRQA 3D2CA 1H2WA 1ZGAA 3IDFA 4Q7LA 4IJUA 3GBVA 2FSIA 1IHYA 4N9QA 1JA0A 2R8RA 4LVOA 2VA9A 2VDWB 1N2SA 5DN6D 4IIXA 4QELA 4QGSA 4K9MA 2CZQA 2CHQA 4C4ZA 4OBXA 4UU0A 2G40A 1KR2A 1E69A 4JKOA 3WLTA 5BN1A 4PAWA 5JC1A 2ZXFA 3OFSA 3UAVA 2IFTA 1X1SA 4KO4S 3ZTTA 4BNKA 1ENZA 3IXLA 4JUDX 1XU4A 1M6VB 1Y6JA 2EX0A 2ODPA 4H77A 4M1TA 4X1IB 1RI5A 3K9BA 4B3GA 4ZJPA 1OAOA 4HSGA 3NNNA 2RHHA 3PA6A 1PS0A 4RK7A 5F9FA 1ECJA 2ZT5A 4BZWA 1E1QD 1W0JA 2VSQA 3L8FA 5DO9A 2Z95A 3H4VA 4TLCA 3HV0A 5HNKA 2OXEA 3D6VA 1N2CB 2CYAA 3L0SA 4X92A 3V7YA 1CUVA 1U2ZA 4M98A 3TNDA 1YB4A 4RD6A 1Z2CA 3OCYA 2ZRMA 3IUNA 1DU4A 2XZTA 5DDIP 2PRYA 3HMKA 2J46A 1NXSA 3UHOA 5IASA 3SEFA 4NULA 3DFZA 2FE4A 4RZXA 4U7FA 1FSSA 1U1CA 3TOSA 4BO1A 3OX1A 1E4YA 3HACA 1BTOA 1RKQA 4I9FA 4X6LA 1U3CA 5AM3A 1EVKA 1RVV1 3EA4A 1JAXA 1UBEA 2AXNA 1EDDA 4ZYLA 1TYAE 3EF1A 3OCWA 2IE8A 3ENWA 4MARA 4WK6A 5TC4A 3S8EA 5AK6A 1ZOOA 3GI1A 5A4KA 1U4SA 4DV5B 1KYQA 1RE1A 2WTUA 3H8SA 1LVUA 4JI6B 1FLNA 3AERA 3T5TA 3B2NA 4IIUA 3EYAA 1XHLA 1XZMA 3WLMA 5KPDA 2VP9A 4O63O 3U09A 1BA3A 2J0UB 1JHRA 2FTKE 2VWPA 1MO2A 3U7IA 3ND8A 1DKLA 3QOFA 1WXQA 4HN9A 1XDWA 3NIGB 3LP8A 2CK3A 4G2NA 1KS9A 1H3FA 2P91A 2VDKB 5EEHA 5IDVA 4KREA 2UKDA 1SJ9A 3K0AA 3KSDO 3I9OA 3MWFA 3U2QA 4B6SA 1GGMA 5IKPA 4QXOA 4ODIA 3RASA 4EB0A 4AZ3A 3QLVC 2EU8A 1SQFA 1GCUA 1FFWA 2I2FA 1R7RA 3NWEA 5CA1F 5CG1A 1U5AA 2ZJ6A 2Z0MA 3F90A 1HDIA 4QNNA 3TMAA 4ALIA 2XCTB 2Q4OA 4QU5A 4AKSA 4B2YA 1O94D 1LPNA 4FS8A 2I5PO 1BAPA 3F6PA 4FZRA 4RHYA 5SICE 4JT4A 3VNSA 2C7VA 2EL9A 3STWA 4YT8A 3N2ZB 3NHUA 4ZVSA 2FP4B 5CFRA 1HYQA 3PS9A 2H51A 3HBAA 3FUUA 2M1ZA 3PLNA 4ENWA 1FVXA 1I33A 2VDRB 3IOEA 4OXRA 1AU9A 5KYWB 1DX6A 1T29A 1C1HA 1MTZA 2WZCA 3CRNA 3O8RA 4JBHA 4EOGA 5HE8A 1V11B 2ZQZA 2ZSBA 2GDZA 2J3LA 3BOSA 3UV6A 4CLXA 3P2EA 5CNKA 5CB6A 3IPAA 2PM8A 2J7PA 1GRRA 1FTGA 1PJAA 1SXGA 4QICA 1BVYF 1O95D 2ZSIA 3B1WA 5JBQA 4XFKA 1JQAA 1RPJA 1UKZA 2PX8A 3FZQA 1YFJA 1ZX1A 2P69A 2YIMA 3C8MA 2R2AA 5J3JA 4OV6B 4TRNA 4X97A 3QWAA 2GEFA 2O3UA 3HCAA 1VKNA 4FX5A 2VAWA 3SR0A 2EX4A 1T1EA 1HGXA 2H4JA 1UKEA 4ACBA 2EEPA 1IQRA 3DKRA 1UT5A 3GQBA 4R1PA 3T3EA 4DLSA 5IBCA 4BPBA 1XXHB 1ZBDA 5KWEA 4R3UC 5DP2A 4WVLA 5JJCA 3E2IA 1QH0A 4FR0A 2PS3A 1ZM4A 1QDLB 3PC6A 3SOPA 4EEKA 5K8TA 2BSQA 5EP2A 5TS3A 4TTSA 2W2PA 1L5KA 3U3DA 4EX6A 1SCQA 3BGIA 3ZZ0A 2AW5A 1C41A 1VOTA 1YAHA 2NX2A 5SY9A 4YRTA 2QRJA 2XUAA 4RIIA 5IULC 3ZD7A 1NJGA 3K0HA 1LBEA 3W1EA 4Z6KA 5EQDA 1K5GA 4FYYA 1FP4A 5LPNA 4IJQA 1NHGA 2HZBA 4MLPA 2VOEA 1S02A 2YFYA 4BNFA 1A9PA 3SFZA 1W48A 5E6UB 3W3ZB 1ZHOA 3BDVA 1XA0A 3OKCA 4M1MA 5AKJA 5FKJA 1ESEA 1UDBA 1SK9A 1AY0A 1PQWA 1X1TA 2ORIA 1W4AA 4W5WA 4JJZA 2CHEA 3CVOA 3Q6NA 2IYXA 1GNVA 1T8YA 2XKJE 3L0PA 5DE3A 3GA0A 1SKMA 2V7EA 2C4MA 3VH3A 1T36B 3T9DA 3HVIA 1U7TA 3DV9A 1A4XA 3VR3D 1Q77A 1JZTA 1UBLS 3PDUA 4C4AA 5IAAA 3UOGA 3ZZNA 1FS6A 2C1ZA 4L9WA 4NU5A 3ECCA 5ICEA 4OL9A 2EGUA 1L8XA 4HHEA 4HSEA 4ZFNA 3V3TA 3P8ZA 3VBEA 4MGZR 2IF0A 2R00C 2R4QA 4BV2A 5ILQA 3JATB 2VBIA 5TMDA 4ZO7A 3C3AA 4MVXA 5FO0A 3ZV3A 3B6KA 2I1WA 2OCDA 1TEZA 2ZRDA 4LHVA 3OEEA 5AYVA 4GLLA 1M1NB 3B6ZA 3HY6A 5TMEA 4K5QA 1EVLA 1LLQA 1RS0A 2Z8YA 2B5OA 2BBSA 1JDZA 3LQFA 5ED0A 4C4RA 5AD1A 2ZCJA 5J2UA 4NMLA 3PPXA 3KVOA 4FXPA 1YRBA 4AQYB 1PNTA 3L49A 4PVCA 1RMTA 1UBOS 3AW9A 2PKQO 2J48A 3OEWA 4MIYA 4BPRA 3IR7A 3K0SA 1RC8A 3ZGZA 4Y6RA 5EIOA 2C31A 2WW8A 4NR0A 4PSAA 1W0CA 4KRGA 2OYSA 4MP6A 3OZBA 3RIEA 3F5DA 1NC3A 2XT0A 4TZKA 1V1JA 4POAA 2D7CA 1CQJA 3ZQ6A 3JXEA 1Z22A 4EUEA 3V2IA 3T6KA 1B1AA 2IKQA 3JQRA 3TTXA 4A10A 1O0CA 3U3JA 2DETA 1TT7A 1Y5RA 1RIFA 1D6MA 5F4BA 3ZK8A 1FYEA 3QBEA 4OO3A 4R1UA 3K92A 3IAFA 5AOAA 1DZ3A 4L78A 1J22A 1VKJA 2WP0A 3RJTA 2FZVA 1KI3A 1NKSA 3S27A 1B7GO 3E5MA 3SCZA 4QKQA 1YJXA 2GTPA 1CBUA 3R6TA 1QYIA 5EUMA 4PNHA 1Q7RA 3USCS 3FTQA 4DEXA 3LDUA 3SBXA 4DXDA 5LYJB 4UBKA 5TMBA 1N77A 2BWJA 2PX0A 4KO3S 5CP8A 5EHQA 5TVKA 2FN9A 2FN7A 4RUKA 1KIAA 2HRQA 3O0TA 4P3KA 1CY7A 1RP7A 2VFAA 3FWYA 2ZB3A 3EPRA 5KEIA 4NXNB 1ZKMA 1X6VA 1M8PA 1Y3HA 2H2AA 3RCBA 1XRJA 3A6EA 4UTZA 2PUDA 4OBEA 3MRXA 4W6QA 2UZAA 3ITKA 1N1MA 2AZ4A 3L0OA 3HGMA 3QV2A 4KMSA 4H0CA 4KZPA 4P92A 1EM6A 5C3MA 2ZE5A 4P5EA 4KVAA 1F8XA 4OHWA 5DXJA 4HDNB 5T4FA 3S40A 3FTPA 3V9AA 5K3FB 4Z1OA 1FNNA 1XEAA 2VF5X 1G8HA 3GNSA 3O4IA 4AG6A 2PGNA 4HGRA 3WNCA 2HDWA 3CLTD 1CQXA 2C5HA 5ALWA 1UPUA 1XU7A 5EERA 3ZEAA 1C7ZA 5DK4A 4ASUD 1VKHA 4B76A 1VI2A 3WYEA 4M9CA 3V32A 3L9XA 2CFTA 4NV1A 4WBNB 4M89A 1E8MA 1ULUA 2QSZA 1VCOA 2G63A 3E05A 2GH1A 1CHDA 3KC2A 3VBCA 1YOBA 4ZHQB 1BA2A 2IS2A 4HD8A 2W9XA 2C3PA 1STOA 2P9EA 2HPZA 3TZKA 1HNZB 1P7PA 1WB4A 3JRWA 2XVYA 5JVDF 4ZVUA 3NHJA 1QHFA 3WE7A 4FGUA 1E79A 3BK7A 3R3UA 2CF5A 3GNLA 2OORA 2COEA 3A1SA 3E6AA 3IC5A 2C04A 3KWFA 5TT0A 1QP8A 1NVTA 1H5QA 1RZRD 1G6OA 2QRPA 2YH2A 5KDLA 2C78A 2KQUA 1ODFA 1TLTA 4LRSB 4MB2A 3PUKA 3GJ5A 5JNVA 3A7EA 2N42A 4ROTA 1H23A 3FOEC 1HFEL 1GP2A 2ZIEA 2RCNA 4IOKA 1YJ8A 4N9WA 3RYIB 1UQTA 4CLDA 1B3BA 2HT6A 3JWHA 4GWKA 2H31A 1U4NA 4WOBA 4YP1A 5TV2A 4GDFA 5JJIA 3KSBC 1W1IA 1QRAA 1DBRA 1WVGA 4UTOA 2RHWA 3KZNA 3G2JA 2VJCA 1G3UA 2X8BA 2X8JB 3W6OA 3MTBA 5CFOA 2JLXA 2EW8A 1Y4DE 1G17A 3JRNA 3GEBA 1ZD2P 3H3FA 3LRXA 3OLCX 3CH7A 3AUKA 3QXCA 4LJ7A 4P31A 4S05A 3O95A 3LKZA 4FCCA 5HOEA 4N7JA 2ZR7A 1PJ8A 3MBKA 1D6NA 1O5OA 4RVDA 4W6ZA 4BNIA 5A4AA 1WVIA 2B9EA 5DYYA 2CGEA 4HMOA 2A0YA 4NG4A 5K3SA 3GFSA 4YA6A 5DOVA 4RKWA 5DWQA 1JAHA 4G07A 2BTEA 1W2HA 4ITUA 5E4FA 3FHLA 3RRFA 4WOCA 4B7XA 5KUTA 3LDFA 3UH0A 3OC0A 5AVZA 4TSRA 4S04A 4BLPA 5I47A 1GPDG 1V26A 4U6SA 5JYEA 4B6QA 4EHKA 4IH9A 5H16A 3W8DA 3VU9A 1FMTA 1QKIA 3WY9A 2ODWA 4F96A 2ZYGA 4U0KA 4OXYA 2IDMA 2YICA 4QQFA 1L5GB 5JISA 4Z3OA 1T0UA 1DINA 2VF2A 3IOYA 3OWOA 2ONKA 3OJFA 3F74A 2LBPA 1SIWA 2CHVA 4W5HA 1ZH6A 3A9CA 5B3JC 1W0JD 2VXOA 1OI3A 2PANA 4GX2A 5REQB 3FROA 4ZAZA 3OD5A 3W7VA 3GMDA 2NO6A 1BEUB 4LGVA 3LH5A 4CM7A 2R1ZA 5EMMA 3P5BA 5JEDA 1YZYA 3BMCA 3DT8A 2VP6A 4HWRA 2AJ8A 4MSUA 4ARZA 4IDDA 2DFPA 2I4NA 2R7NA 4KHZA 4PS0A 3WNVA 2QTRA 2Q2WA 2Q5IA 2QORA 5IFKA 4C78A 3CUSA 1VG8A 1R9GA 2QNIA 4GDMA 4ID9A 4RD3A 2C4HA 3HLYA 3PRKE 5HUQA 1F48A 1LY1A 2GK3A 2AC2A 2GO1A 3I9KA 4JVOA 5CNIA 1KHTA 1E6CA 3NM6B 5HFNA 3VU0A 5DEOA 3Q2KA 2BFWA 4NU0A 3OT1B 4WRRA 3ABZA 2CNKA 2HLHA 4P86A 3FM9A 4D8UA 1L7XA 1J1UA 2NUAA 2FEMA 3ET4A 2W2QA 3Q1LA 1FFXA 1W36D 3KR9A 1ZJ5A 2RGUA 1MG5A 3HEAA 1WSBA 2FKAA 5DNYB 3I4CA 2NYRA 4PCLA 3HPRA 1JW9B 1M2VB 2YJGA 4OBWA 4WH0A 3TRHA 4U6NA 4WE3A 2A5DA 4GZLA 4N3NA 4NEQA 2P68A 2CK3D 3FNRA 1EFLA 2IEYA 3IBCA 2D3WA 3PF8A 4LF9B 1I4WA 2BOVA 1NHWA 2DJIA 1OYWA 2CJFA 1Z9BA 3GLSA 3EA0A 1V5IA 1OH6A 5D5PA 3IVGA 2PYZA 4C4XA 1U7UA 4BLQA 1KVRA 4IRXA 3N75A 3SHQA 3ILXA 5HM8A 1G21B 4O4HA 3V8QA 3L43A 3HQ4O 3I1FA 1QJCA 3LLCA 4BGDA 1HNXB 2QI9F 3FXAA 2VTKA 3H9UA 4DQKA 2UVPA 3LUPA 2CLEB 5ES3A 4X7PA 3VYUB 4ENRA 1J24A 1CJKC 1LXCA 1HZZC 5TQVA 2GJ4A 2JFQA 4TXHA 3T5MA 4XGIA 5IXJA 3O9ZA 2ZTMA 4TTTS 5ABPA 2BBWA 1ZCZA 2I1LA 4G0XA 1JJIA 5EJ6A 10MHA 1RJGA 3AHEA 3EPPA 4PPFA 4UVDA 1KZ9A 2C88A 2REOA 4YMUA 2OILA 1DEAA 1JEAA 2J0EA 4WLOA 1W4ZA 1TA0A 1DIRA 2FA9A 4YP6A 4TTIA 3V9PA 1OX4A 1UKYA 3FFBA 3IHTA 4CMCA 5ES4B 5KX5B 3W1VA 4E46A 2UZ4A 3B7GA 2WU8A 1IQPA 4BP8A 2BI8A 1CUZA 5FPTA 1Y9EA 1YWGO 2ZPUA 1JR3A 2E4VA 2H17A 3WYDA 1BOFA 1Z38A 2GK7A 3KEFA 3NPAA 4MUGA 3UG6A 2QN3A 1Y1RA 3UXEA 3L6BA 4B3RB 1YDEA 1KY2A 1VLLA 4DCSA 1JVBA 2IW1A 2VCYA 4AJ4A 3C6YA 1X8JA 2NSHA 2IEZA 3HYRA 1JEJA 4REMA 1KK3A 2IYPA 3KEOA 3L84A 3TQQA 3F96A 1PSZA 1A7UA 1O4VA 4B3HA 1DP4A 1HETA 2BGTA 4RMHA 1Y1KE 1I3LA 4FD2A 3GUYA 2R96A 4E32A 1W34A 1VP9A 3AFOA 5FA5A 2G5PA 1KEEB 4ZEWA 1KZ1A 3I73A 3DLAA 3NCTA 1FLAA 2ZJBA 4OH7A 1EWKA 1Y8ZA 1R4NB 2HSDA 3GUHA 2H00A 3FPGA 5A0FA 3BPSA 4QGGA 3OIDA 1GGEA 1SBTA 1XZHA 2X1HA 4EI7A 4HNGA 2BE9A 5FOUA 2AI3A 3DDOA 3DFMA 2P4SA 3D7RA 2WJPA 2J3DA 1CY8A 1ZZGA 2C5GA 2WEKA 3FRJA 2IZ1A 4HYYA 1P7WA 4XDGA 1T9BA 2QVCA 2UZ3A 2VUSA 1FYXA 1K6JA 1SIUA 3EWSA 4M9ZA 3DPSA 5LP6A 1RSZA 5EYPA 3C43A 2A1UB 2I6UA 1H2AS 2ISCA 4GMHA 3VI4B 1DTSA 5IJ0B 4K86A 3UBMA 2V7PA 4CU2A 1UQUA 2F2TA 1NLUA 2O6LA 4LY6A 1CR0A 1OBHA 4DA7A 3KQYA 3RHTA 4BTLA 1HLDA 1D2MA 3HXMA 1WNTA 4G1EB 1H4VB 4LFBB 4ZRNA 2HA0A 1TZJA 3KQMA 1T2EA 3R3YA 3T7JA 2VT3A 2XOKD 3RBXA 4NBKA 4B9EA 5JSZA 1MENA 4NEGA 2ZT7A 4GIBA 1PJRA 4OFBA 3WLSA 4C6SA 2DM6A 1HQKA 3KB6A 4Q6BA 3C48A 1B41A 1Y6ZA 1UMDB 3PDIA 3KS9A 4WN9B 3IODA 1MRNA 1E9AA 3E4DA 4KWCA 5IP5A 5KNCH 2Z4SA 1VMKA 4NF2A 4FUTA 1AKRA 4J0HA 2DEUA 1ABFA 4BBZA 5FI5A 4WDQA 1Z35A 5KNBA 3DXZA 3IUPA 4ZO8A 2VZEA 2WJGA 3SN6A 1GRQA 1CEQA 2O05A 3BRSA 6NULA 2SECE 4M1ZA 3JWIA 2F64A 3SDBA 2JJ1D 2W8BA 5GTDA 1IIBA 1M6EX 5ELMA 1JFLA 3OF2A 3WGNA 4F2WA 1QQ6A 1UDWA 3D59A 1XZGA 4RJ2A 5TS2A 2AKEA 4UM9D 2Q4DA 1FFBA 3GT3A 2P4EA 3JQ7A 1V6CA 3QUSA 3SKVA 1PGQA 4IJ6A 1YVRA 4KQFA 4ZGGA 1JLRA 1T2FA 2PZBA 4Z0HO 2JGDA 5C4IA 4AJNA 4R3WA 5JPCA 2XQVA 4I50B 1QTNA 3SXJA 1TO2E 4GVLA 5J1SB 2GCPA 4RF5A 2D7JA 1OFGA 5DNDA 4ZU3A 3BFKA 2GCNA 3CSUA 3N39C 4PPYA 1HMPA 3JAKA 1L4HA 3RVBA 1US8B 1PR3A 1HE5A 2X13A 2NACA 3ZZTA 4IJWA 3BCHA 1MOPA 1P1IA 1OB2A 1WD7A 1XCPA 2ODQA 3N2IA 3NANA 3P94A 3QU4A 3PUWA 4KX3A 4S1NA 4C5BA 1FJGB 5FNVA 1WULS 1IZYA 4FFDA 4EFNA 3T7SA 2YBEA 5FT9A 1ZO8A 3ES9A 1BFKA 2ZWMA 4FGLA 2PCLA 4IIFA 5SV2A 3F0TA 3MJEA 4BO5A 5TARA 3U4QA 1DJMA 1K8YB 3T95A 3L1JA 3S7ZA 3B9QA 2PTHA 3TVDA 4BKQA 4CTKA 5EHXA 3ZLUA 5IJZA 2XCOA 3WGZA 4IGEA 3BEOA 3O4GA 4P98A 1E98A 4ZAFA 4ANFA 3KKKA 4FYXA 2WFLA 2B4KA 2DBYA 2G1UA 2XWQA 3R5SA 5BWNA 3OQIA 3N05A 4JJEA 3P9XA 1JG3A 1ZCAA 2FMFA 3QSGA 4UPEA 2GCEA 2VHUA 3R6LA 1SB9A 4PGFA 2RCYA 5AXAA 4M9UA 2FR1A 5BOVA 3D1JA 3QE3A 2AOTB 1ABEA 1H1LA 4MR8B 3VR5A 1YQXA 3UJCA 3L4BC 4C1NA 1E79D 3L5OA 1WCV1 1CQIA 2OHHA 3WLLA 1BYUA 3CMCO 4BVFA 3O1LA 2BGUA 2HQBA 3PEFA 1AZTA 1UANA 4L4XA 1U5CA 1JBQA 2BN4A 4HS9A 4IXNA 4F9TA 1A9RA 3OHPA 2LRHA 3F4LA 3EISA 3HR8A 1G20B 2B2CA 1ISFA 2C96A 2HLDD 1VE1A 2FX5A 3BMNA 4PC1A 3THYA 1Y8QB 2KPOA 1L0BA 3HY3A 4IZIA 4KXVA 3SE0A 3I04A 2IZ5A 5CVVA 4DEYA 2AJCA 1NVWQ 2IZOA 3BTUA 3I64A 3OU7A 3WL7A 4DG5A 4UFPA 3K71B 4BUZA 1OUMA 2IHBA 2C2ZA 4CIWA 4CQLB 2AN1A 3DDZX 3H3JA 4R84A 4YI5A 3N7AA 3OY7A 5BNTA 3ICCA 3VJRA 4N40A 4DLPA 2HFJA 3KLOA 2P27A 1NLMA 1QG0A 2FK8A 2RGDA 5IANA 4OLFA 2OCIA 1SQ5A 5JQGA 2WICA 1QLWA 5TDHA 1AXGA 1NX6A 4H0NA 3NDBB 3DZBA 2PPLA 3NYWA 2C8LA 3K1AB 2AOUA 5GIPE 2HX1A 4TWZA 1LQTA 5D3KA 4L5YA 5JD5A 3C1TA 3OMXA 5T41A 4DSNA 3G2MA 3SHOA 1WCXA 3HXKA 4DT1B 3FNBA 3KVRA 4QREA 2DLCX 4DIOA 1AV6A 1L8AA 1MC1A 1RQLA 1YE5A 2PQ0A 1UFRA 3HWRA 4OHKA 4YJ2B 3ISVA 3RUPA 3SD7A 5CM9C 3MMXA 1S3FA 2DWQA 4JSYA 1X38A 4JB3A 3Q8XB 2EFEB 2OEPA 2UDPA 2ZRLA 3OQBA 4QFDA 1FS5A 3T5BA 3ITNA 3WL5A 3IESA 4C7KA 3SZGA 3TZHA 4U5QA 3DD1A 3F49S 4B0PA 3I6YA 1SAYA 3V33A 1GCGA 5CFQA 1IM8A 4CR6A 3NIBA 1L5QA 1PQYA 2GAIA 2PS1A 3G9TA 4GSLA 1YBHA 2BZ0A 1HRKA 4QOEA 3RRBA 4JYAB 1DKNA 3QE4A 3O2QB 2GX6A 1SCKA 3DYVA 4ZVLA 4DVJA 3UQZA 5IBQA 2MDTA 4BJ6A 1M2WA 4E70A 4QASA 3R3HA 2BFMA 1QQBA 3IRVA 2YWEA 4G8JA 4M22A 1PJLA 3PSHA 2P30A 2WWHA 3VZPA 4CQJA 5K0FA 2WWYA 3VPCA 2HF8A 4UHKA 2EC5A 1TMOA 4DPLA 3F73A 2ECPA 1JV2B 2MWMA 3LY8A 5KKCA 4M0EA 5ADUS 4ISBA 1C3EA 1GPKA 3FPHA 1RXSA 1WF6A 1NR5A 1VLVA 1JHZA 1LS1A 2XAUA 3K0BA 2XMGA 2Z1DA 3HCCA 3X1XA 1MC4A 2I9KA 3FR7A 1Z29A 2G25A 1FU7A 4E4RA 4WT7A 3AL2A 4M87A 3TS1A 4M7WA 6ADHA 4TTAA 3LLMA 2FPRA 1OLSA 3LO8A 1XKLA 5AXCA 2IHTA 3CCCA 1KZ6A 3DO8A 4Z0PA 1YFKA 5IRCD 2JFXA 3E70C 3PKZA 1CE8B 4NZNA 4WEOA 5DEIA 3INNA 1Z4LA 1N2JA 1QJ4A 2B30A 1TM1E 2Y66A 4BNHA 3CZRA 3KKZA 5KQGA 5GONA 1FFGA 5ILOA 1YQQA 4ND2A 2NU9A 2VDPB 5EJGA 4B82A 2XDQA 3DFIA 1OIWA 4TTRA 3VZCA 5J43A 4PAOA 2J85A 3UMJA 4WXMA 5B6PA 2IYUA 1NA5A 1KWGA 1USVA 1ZOPA 3CSSA 2ZI3A 4RZSA 1YVUA 3ZBUA 2XMBA 1K7FB 4XUEA 5M7EA 3BA1A 4IJMA 5BQOA 1TEXA 3EFHA 4Q1BA 1N2CE 1KZYC 1QHIA 2C4UA 5L3ZA 2DHCA 5CB4A 4Z0NA 1CR2A 1EHYA 2WIDA 4NX2A 1AS0A 1U2QA 1OXVA 1U7XA 4C4OA 1J0CA 1DDIA 2IDZA 3DUWA 1YQ9A 3QYPA 3F5FA 1JHXA 4WDRA 3CH6A 4MMXB 1AGPA 4L4RA 4OSPA 1WCIA 4J0EA 4HBZA 1VIYA 1SD1A 3TBFA 3JQAD 3RS5A 1GZVA 3W5CA 1RHKA 3ROFA 4EMSA 4QD3A 3KP1A 4CI0B 3RROA 3F3MA 4UNQA 1JIVA 4PNZA 3IUMA 4OJMX 4XPIB 1V25A 4MS4B 1PFQA 3BDIA 4NARA 4U3JB 3SIXA 2IT1A 4G1MB 1NVMB 5EHGA 1GDTA 3GG2A 3T3IA 1GVHA 4EIWA 5JEEA 1TVMA 1BD3A 1U28A 1EA5A 1Z88A 2ZANA 3Q2OA 4K7JA 3SMQA 1YIOA 4GKKB 4F1KA 4GVXA 4NJOA 4A2PA 5BRJA 3QYAA 2DC1A 4G1BA 4ZC1A 4BAZA 1G38A 3D4LA 1X0XA 2FSVA 5K4HA 1YHYA 3S28A 1MKYA 2ZETA 4Q9DA 1H3EA 2B6HA 4E5NA 3IUEA 1ZXXA 3TKAA 4DVGA 5JCPA 3VR5H 1OU0A 3F1LA 3AVVA 1AG9A 1GGJA 3S2UA 3SYRA 2FZCA 6Q21A 2ZRFA 5BMVB 4R2KA 2OVBA 5CTAA 3QBDA 1C5KA 2JVJA 1WXDA 2DWPA 3KR2A 2GETA 5HILA 3JD0A 2ZJ1A 2W98A 3C15C 3A6JA 1QK3A 1X7WA 4QTTB 4YP7A 4J7XA 2VL7A 3MOSA 4IJ5A 1NMYA 3I3SR 4O2RA 4ZQIA 4IV5A 1O4WA 2APJA 5A7GA 4BRUA 1CPYA 5KSZA 3UUWA 3S7TA 5EKUA 3ZV4A 2OZPA 5JH7F 4W5TA 1RLTA 4RPCA 3SC2B 4TKLA 1YS4A 4PAMA 5J9FA 3U19A 1G8MA 4EX7A 4G09A 4KN9S 1ZH8A 1TM7E 3K05A 4LVUA 5EVJA 2YYAA 3S2ZA 1WSWA 3Q3GE 1T2DA 1Z5PA 3TOCA 4KNYA 1Z0DA 2WY2D 4D8XA 2F59A 4MWOA 4PBTA 2XGGA 3MIZA 2JFHA 3WTBA 1XPRA 1YE3A 2JRCA 3R44A 2BAGA 2NUPA 3TD6A 3TCXB 1NJ1A 3PENA 2LD4A 4QFCA 4F2DA 4RA6A 3PQ3A 1GU0A 4MINA 4MRMA 1N6OA 4ND4A 3WZ2A 3U17A 3VR6H 1P17A 3THXB 2WF9A 3G9UA 3I42A 3GCWA 3OCJA 3GH3A 3SS8A 2CC2A 5FBVB 1RE0A 3PL5A 2J6BA 2HK7A 1NQ5A 4FYHA 4XYGA 5HWSA 4GLFA 1X19A 2Q2OA 3WKCA 3TR6A 4B7AA 4B75A 1ZVVA 1X92A 1XXHE 1ZRHA 3CEPB 4KWIA 1N0WA 1KH1A 2IYNA 2YCLA 1E89A 1ORTA 3GLHB 1E1NA 3E84A 1XTUA 4KQXA 2L18A 1IM2A 3E3LA 3GDHA 4IH4A 4P0TA 3ZDZB 2NU6B 4DV3B 4FWTA 1EK5A 4WOJA 3RV3A 1MUUA 3AEUA 5BWBA 2ONYA 5TPZA 3IERA 3IRUA 1YZLA 5IC4A 1R3DA 1CS4C 1KZGB 3HY4A 4G0VA 5AESA 3K4PA 4WGFA 5TPWB 1U0JA 1RJFA 3TLXA 4WCVA 5CJPA 1LDGA 2NVBA 3FZEA 2PQ6A 1RXWA 4FOPA 3EN0A 1C9YA 1WDTA 4N49A 1MVOA 3GN2A 5JHHB 3IAS6 1C0PA 1RLJA 2O57A 2Z5VA 3V1LA 4B3IA 3C5WP 5F7XA 3VNBA 5K6RA 2ZK7A 1UBSB 1IUKA 2QPLA 1MCZA 3P9SA 4YRNA 2NLOA 5K8IA 2YWDA 4PFKA 3FCSB 4CDNA 2FW7A 2HIAA 1H0KA 2ZDQA 5IVHA 2IDKA 5GV7A 3COYA 2JFNA 3HEBA 5FUXA 4XJSA 1D4OA 3PR2B 1C0KA 1JG7A 2WLTA 4R8MA 5HF9A 3DBIA 4A3SA 4Q4LA 2Q5EA 1TQDA 4L0MA 4BYMA 1Z45A 2ZSDA 3IV6A 3OT5A 5AH0A 2K2WA 2JFYA 4IIGA 5GGXA 2QP3A 3EVBA 4YCJA 4TVBA 3UJ3X 5B2FA 1PQPA 2W2LA 3LQ1A 4UREA 1LPAB 1I0ZA 3O9MA 1J7JA 2J5RA 4DY4A 3QHAA 5KYKA 1NG9A 5EKTA 3Q85A 3N8DA 5FUYA 5ER6A 3T7CA 4FZ5A 4FUQA 4QAQA 4DLRA 1DAHA 2DH6A 2BGIA 4HEHA 2AKAB 4GR4A 1N1GA 4R01A 2HKIA 4NAUA 4II2A 4BCDA 2WK1A 2BDEA 1PJ4A 1JKMA 1P4JA 1OT5A 3DMNA 3LL7A 3PGVA 3PVZA 4R51A 4XB1A 5KOIA 9MHTA 3KL4A 5L3RA 1MP0A 4BFSA 4E5PA 1YJQA 3ONWA 2C2KA 2Y1GA 5FJIA 3WLJA 1C0IA 2WSYB 1H6DA 3AB8A 4L07A 3KVVA 4CM9D 3MPUA 4ITVA 1GGNA 1BS9A 3OHSX 4U63A 4BFWA 5KTRA 1K1EA 1ODLA 2H54A 4MV7A 5AI8A 2NUTB 1AMUA 2C7RA 1B0PA 2P40A 3CRZA 2ZIZA 4KXWA 5CLLA 4N7BA 4RTMA 4NFLA 2PMWB 2WYHA 3FCUB 4Z9BA 1JEYA 3TNFA 2VKQA 3U7RA 5KU1A 1CZOA 2CUKA 1DKQA 2XW6A 4RYLA 4E21A 4WCFA 1RLMA 3TBHA 2NVWA 2ZLBA 3IQDB 1H1DA 1KEVA 3QJYA 4QUEA 2H1WA 2W6JA 2X0NA 2QAJA 3GU3A 3WQHA 3QKIA 2HHJA 7MDHA 1ZIXA 5IVPA 3HKEA 3HSKA 1XMIA 1DRJA 4N4AA 2X0EA 2CXTA 1WB5A 1XTKA 4UXJA 3BQNB 1UXIA 2YV3A 1ZGBA 1ZY2A 5IN5A 3WMEA 2K7FA 2PZFA 3O8OB 4G0UA 3ET5A 1MEOA 1UEJA 3MD9A 2PMBA 1XZCA 4MQ4A 5SZHB 2IHVA 4KQ6A 2AFIA 4G4SP 1BXGA 2VSYA 3SBEA 3S81A 1K98A 1J8VA 4FHEA 5LQAA 3SPXA 1K0FA 3LHSA 1PKXA 1I8TA 3AILA 4LC9A 1NBHA 2VAXA 4FNMA 1QQTA 2CNWA 3OJ0A 4TQ9A 1ZDMA 3C1OA 1OAAA 1M10A 3PC8A 5DOZA 4E5DA 4JH0A 4DMHA 4HT3B 5HRCA 4DDTA 1YQWA 3T52A 1RP1A 2GM3A 5F1KA 2SKEA 2VQDA 4LXUA 4MJ7A 4YYEA 2XYPA 3TTYA 4ZTUB 2AN4A 1AVTA 2JRLA 1KY4A 2Q4TA 1OA1A 4D3FA 3PYXA 2IOHA 4PZUA 1T6NA 1F38A 1UT8A 2OV1A 1FDOA 1OWNA 2PYDA 3K9WA 3ZWAA 3QELA 3N8HA 3OQ1A 4KSBA 2IS1A 3CZAA 2DY0A 1V1MA 1SGWA 2Z2IA 2PXHA 2H5LA 3ADPA 1T8TA 4NL4H 1I1NA 3ME5A 3N8KA 3EX7C 1JVNA 1LV8A 2BM0A 2X86A 4V2IA 3UGTA 7MHTA 2FSHA 3FKQA 2IOQA 2R62A 4GLBA 4DZRA 4F12A 4LTNA 5AQEA 1FDIA 4TLDA 5E7JA 2JJMA 3QPAA 1UZAA 2OPHA 4CKXA 2BRUC 2JATA 3RVDA 1UADA 4U1RA 1R8QA 1TF7A 2BELA 3U44A 4AJLA 4EPWA 5I8ZA 4OQQA 4XKJA 5FWYB 1M34B 2FUCA 1I9CA 2B83A 2Y1KA 5C32A 3WIDA 4L4SA 5AVVA 1RYHA 1TM4E 3L06A 1FDUA 3L7DA 1PR6A 3ZXXA 2J3IA 2XCUA 1Q0QA 5ITSA 3PUZA 4QGBA 2HA2A 2ECOA 2YQ4A 2C4NA 3O84A 4LXQA 4OMFG 3QHQA 4JP2A 4OHFA 4PPGA 3RNOA 2WAAA 3ZWXA 5KX5F 1Q74A 4I99A 3ZWBA 3B9BA 1T9GS 1PU2A 1SHTX 5LQRA 1U7OA 4N0DA 2QPTA 3U26A 3ILYA 1Q83A 5SY6A 1MR3F 5DGHA 3WKBA 4A6DA 2VF4X 3CBQA 3GDGA 1NY5A 3L0IB 1ZJZA 4KDCA 1CUYA 2YN0A 1M5TA 2GN2A 4CE6A 3SKYA 2OCGA 4OQMA 4M83A 3ZD6A 1R5JA 1U0LA 3VH1A 4B8ZA 3W79A 3I0NA 3PWSA 5DW0A 3AW8A 1Q95A 3G5UA 4IQFA 4RK6A 4OHUA 2INGX 3T9BA 4B74A 3O1JC 1QHEA 2AZMA 4RTJA 4AM8A 4LBZA 4X64B 2H5IA 2O7NA 1RPAA 4GKBA 1BHO1 4KV9A 1WDWB 3D1LA 3ZCUA 2R47A 3HJGA 4HYEA 3UJ7A 3OWXA 2QROA 1RCTE 2A8YA 4X8MA 5T6MA 1YA6A 1YV9A 4QBKA 2PL9A 1JAYA 5JT1A 4HADA 1XZJA 4IF4A 1R0ZA 3RS2A 5HIAA 3QJGA 1IBLB 4E7PA 1CNMA 3QU2A 5HKAA 1CCWA 1AZLA 1WKCA 3AUSA 4NOKA 4LJRA 4GGPA 1NRXA 1O1YA 1P60A 1OC4A 4G0QA 5FNVB 5JCOA 3QLEA 4KR2A 4IG4A 3H5AA 1C50A 4D56A 3LUDA 2PFKA 2Q2NA 3RK1A 1VIDA 1DC7A 1TYDE 4F72A 1VL8A 4IIVA 1YOVB 1XB2A 3QIAA 4FEAA 4RADA 4JBYA 4XIYA 5KTYA 3FTDA 4RD4A 5IX8A 3MB5A 2Y1OA 2JD1A 4QPCA 2J09A 3WO0A 3T12A 3K8OE 3O90A 2HDHA 3RF6A 5DSZA 3JD2A 2AN9A 3LCRA 5KDDA 2OCYC 5BNFA 3IUSA 3RSQA 4CVNA 2BIFA 1R66A 2QA5A 3DAOA 4GP6A 5KYXB 1UBMS 3K70B 1DPGA 1G3MA 2O5RA 4G5OA 1CEXA 3V55A 3AHCA 4B2IA 1HYGA 4N5DA 2IXAA 2NVOA 1DIBA 1W8IA 3N76A 1E3WA 3OMLA 2PGIA 1YTUA 2XITA 3OOYA 1AF7A 3T7EA 2G70A 1U8XX 3FOFC 3QE9Y 4JOSA 1BFUA 2OC9A 2Q29A 4WLFA 2BI7A 2Q99A 3CW9A 1T5BA 5FYQA 3VHQA 4JBGA 3JQ8A 1X9HA 3PUYA 4Q1DA 4RTOA 1ACLA 2L0XA 1FUUA 4DJFC 1UJBA 2JLVA 4GZ6A 5KOHB 4P38A 1M0WA 1Z26A 3TECE 1ARZA 1GCOA 1UOPA 3WLFA 4P53A 1E64A 1UZNA 2H07A 2NVUA 3EVDA 4HVTA 4M9XA 3SR3A 1U98A 2O7QA 4WI1A 1IEWA 3LLSA 1J49A 5DNAA 3NLLA 1TYCA 5KTNA 2BCJQ 1ZXBA 5TLSA 1E2UA 5EZ6B 2V8OA 3T41A 4JP3A 3PKIA 4Q16A 2BR3A 2WWFA 4XM1A 3GJ8A 5I9MA 1XA3A 4PG5A 4HGZA 4RFSB 2GK4A 3ZJYA 5HSGA 2BFFA 1JXAA 3IDQA 4TYPA 3WWYA 3ZNPA 2WZBA 3NV9A 1QB8A 1NN5A 2AQKA 1WUHS 2P6UA 5EWLB 4KDFA 4B87A 4BTEA 5CITA 4LIPD 1BZYA 2D4AA 5D8DA 4EJFA 2C3OA 3ZXUB 2FKNA 3NTQA 2JZOA 3OZSA 4DN6A 1L7OA 1RXVA 1PVVA 4Q7KA 4LSWA 5TY0A 4JELA 1JILA 2G72A 2Q3FA 1K7EB 4FYMA 2AMFA 2CDNA 3COZA 5CNMA 1GLGA 2EFGA 4M60A 1NNUA 1E9EA 4JJAA 1UBGA 2QBYB 4BWVA 2D1YA 5K4AA 3Q9NA 4BCCA 1ST3A 4P4NA 2PGLA 3ZLVA 3Q40A 1K8ZB 1W6UA 1BXZA 2PU7A 2WC1A 5EWMB 5TPZD 2RG7A 2RHOA 1ONPA 1X7HA 2HBYA 1N5KA 3IVMA 4B83A 1P1KA 4Q3AA 1MHPA 1UBRS 3E4CA 4OHOA 4H1TA 1Q11A 1OXSC 4OLHA 4YX9A 1F7VA 4CM8A 4ML3A 2UV8A 5DTJA 4I3HA 1RQ2A 3KLPX 2IHKA 3SF8A 2BD0A 2QIOA 2Y0EA 3CE9A 2QE7D 4JEUA 4MCIA 3RRJA 3T1HB 1Z16A 1PYGA 4MWBA 1QH1A 4TMTA 4C2UA 1M1ZA 1TVKA 2D1SA 2QNRA 4WK2B 1RBMA 1N2BA 1UP4A 3LGXA 4CQMB 2HRDA 4X60A 2FFQA 2Q1SA 2XYQA 1AUPA 1KKMA 2FZGA 1MFZA 1Z18A 2ERCA 5DBOA 3UXHA 3B3GA 2O6HA 1V2HE 4RZQA 4Z9AA 4DLVA 3LYUA 4FCWA 5FTWA 2J4CA 2RI0A 3MMNA 1ZSNA 1EK6A 3WB9A 4Q1VA 1Y6GA 3JVDA 3IEIA 3OJEA 2XNSA 3Q0IA 4JMLA 4WXPA 4DLUA 4XUCA 3Q8LA 1D2HA 3RUAA 3AI7A 1YQUA 1EMDA 1Z8FA 3IVCA 1DXYA 3LU1A 3KU4A 3ESZA 3WGLA 1EK1A 2QMYA 3DEIA 4CF3A 2VDUE 2GSDA 1F8FA 1UINA 1WE2A 1C4WA 2QN2A 3H9EO 4XE5A 3T7DA 3UWSA 3ER6A 3G9QA 5DMHA 1RAGA 2HXYA 5BW8A 3EDOA 2VATA 3GLKA 4B47A 5IWAB 3K0EA 2OWDA 3N8NA 4ZQCB 1FXWA 1NU8A 2GBIA 1VHJA 3MGGA 4PBSA 4PS1A 4RHEA 2NXWA 3V7WA 1MRSA 1EE2A 4UTPA 1PLJA 1K4YA 3PGLA 4MPPA 4OUDA 3GB9A 2QRKA 4W5QA 5IAGA 3TCKA 3AV0B 4PG6A 3D3NA 3PA8A 4R9UC 1CW2B 3RG2A 1TIBA 4C08A 2QRVA 3RS3A 1EAMA 2IUSA 4MJLA 4JV5B 3NKLA 2HY7A 1SMKA 1ZISA 1ZH0A 2WMYA 1YZVA 5JAIA 4TLAA 3EZLA 1RZVA 2W6JD 2BMAA 5DTEA 4BQPA 2YJ4A 5AW2A 2M2IA 4RESA 3W5BA 4A0FA 4JUBA 1JXOA 4V1CB 1DUSA 3ZGVA 4YK7A 1DEKA 4E1VA 1EIZA 1YK0A 1Q1EA 1XCLA 2A9OA 1VPEA 3LPLA 5FB3A 2XUZA 4L8VA 2ALJA 2XGJA 1MNAA 4HUQA 2HZ7A 4YAKA 4FKBA 3NIWA 2B37A 5G0WA 4RZUA 1X0VA 5AIAA 3WGYA 4PZYA 1G7CA 1M2HA 2EYQA 3FZYA 4IVPA 4IX1A 4KGDA 4RY0A 2JH8A 3Q7SA 3VPDA 4B3TB 2YFHA 3SWWA 2YJ3A 1WW3A 3W2FA 2CNWD 2HMAA 3CUVA 4C0JA 5J2UF 4X65B 4KHPB 1EGQA 1I2BA 1QLHA 3KQSA 1A4RA 1GAQA 1NM5A 3NYQA 4Q12A 5I7VA 5T8KA 3WFJA 5KB3A 1XVUA 1JDSA 4LGMA 1D0IA 1YC5A 2F1JA 4NJEA 4AK9A 3GGCA 1KQ3A 2QLTA 3KOXA 3D7LA 4HQ0A 3PC4A 1I5EA 3G2PA 3LCUA 3DMYA 3D6AA 2WFAA 4JLMA 3O8BA 3MRVA 3VRHA 1Z6XA 4A6EA 2WNIA 3LZDA 1HDXA 5K8VA 2QTAA 3AB7A 3TOVA 5BY2A 2OB2A 1R9NA 4C04A 2IYSA 4AWXA 4EI2A 1YI0A 2G0NA 2ZYVX 3A1UA 3DBHB 4IPTA 3RS0A 1Y4AE 3WISA 4EBBA 2PL5A 5HQ3B 4BNDA 3KZOA 3EXIB 2GM4A 1AB6A 4LF7B 3KKLA 4OQNA 2W2KB 5CA0B 2QT9A 1DT3A 1JDBB 1Z6QA 3ZX4A 4AMGA 5B5SA 5MGBA 3GLFA 2CYBA 1XMVA 2GJKA 4BASA 1EFPA 1NDUA 1NWCA 1U11A 4RGYA 3SI7A 2CZGA 2DSNA 3WNBA 2NG1A 1EI9A 1G20E 1PR2A 2YZGA 3IBTA 4X6YA 3T9EA 3VHXA 2PGJA 4DNPA 3L0YA 3JARA 4QOHA 3SJAA 1E2HA 1PJTA 1PWEA 3HKCB 2D3TA 3P27A 4G0ZA 4YC7A 3ZVRA 4EY5A 1HYHA 4LHWA 3JD3A 4JI7B 4AUMA 1AKQA 5HCNA 2G1PA 4RL4A 3LQYA 3KU1A 1C3VA 4B44A 1U2GA 2FMXA 5KJEA 4UVIA 2CNLA 2FQXA 4WZAE 1JSZA 4ZYVA 5KHOC 1N6KA 5KQSA 4IQ4A 2Y3IA 3B8HA 1HG1A 1MJGM 2ZI9A 4FT4A 1PG0A 2QX4A 2ACVA 4K6GA 2HCJB 5CCXA 5G4KA 2GF0A 1DCTA 2Y67A 2CEKA 1JH9A 5FTMA 1VRVA 3WHLA 4HRYA 1B8VA 4Y2PA 4A8HA 4YECA 3JZDA 1J8QA 1VPTA 1YNSA 3RVLA 4ILEA 1PGNA 4LHEA 3BC1A 4J4TA 4CKCA 3OD1A 3RC8A 2OHOA 3ZJTA 2G4CA 2IEGA 4KRYA 1SR8A 1OTXA 3VHRA 3MOGA 2FDCA 2CXXA 4R8SA 3N70A 3CUTA 3HCFA 4YRLA 3HUUA 4DNXA 1KOFA 1T3SA 3GRUA 5JD3A 2BDTA 4J2TA 1T6YA 3K0FA 3V4OA 4ZMSA 5AK5A 1XALA 1EE1A 1ZJJA 4P7GA 5BMVF 1IWBB 3H99A 4AAYA 3W5IA 3RAEC 2GBPA 4G0YA 1JGTA 3BD8A 1L5LA 5HKBA 2XNHA 4S3MA 1N9ZA 4HUJA 2O8DA 5MDHA 3AVXA 2JLAA 2GVNA 4L0CA 2XLCA 4EUKA 3V6MA 5TQ2B 3NJ8A 5BRAA 1QHSA 3QVLA 3LBYA 4QDUA 3PE6A 3MQ2A 4AMYA 4IIHA 1KAGA 4PFJA 4PLFA 4YEDA 4IGAA 3RC3A 4YV7A 4IEEA 1C8VB 4P22A 1AKYA 4QFMA 3UAYA 2VBCA 2BF4A 2ACWA 3V1MA 2WF6A 4O4LA 1YL5A 2H9AA 3BL5A 3KD2A 4RH0A 4WMLA 4ALNA 1WWKA 4EW1A 4KU4A 4RVGA 4IF6A 3TR5A 2WOOA 3RSGA 1K9SA 2Z98A 4PCAA 2VTDA 3GFQA 4IS3A 2PV0A 2XUFA 3F9RA 4LYJA 4YJHB 1PS8A 5DYNA 3U5ZB 2QI9C 3A4MA 3BYZA 5C46F 2WJ6A 1IIRA 3UA4A 5D1HA 1GQOA 1UR5A 2DWOA 4KVGA 5G1OA 2C9CA 5DB4A 1R0SA 1QSGA 4CCAA 2XUQA 3RSZA 3N3AC 4GBGA 3GRPA 3SZOA 1XLTC 1DC4A 1D4FA 1R6TA 2ZJ3A 3O4RA 1KJJA 3O4FA 2P3SA 1P2TA 2ORVA 4E2ZA 1P2BA 3U1TA 1EVJA 3HEMA 4YRCA 1UKCA 2UYGA 2BH9A 3E1KA 3DYIA 1WUIS 4NS1A 3HKBA 4A5SA 2NU7B 2OKGA 2I66A 2GXQA 2MR5A 2GYVA 3DZKA 4INAA 4IEIA 5AJYA 5J1TB 5K0EA 5IEBA 1FBNA 2X58A 3IEUA 1NXWA 3JYOA 4RGQA 5GJWC 1JNXX 1MVNA 4WZAA 3RBVA 4P7KA 1SEVA 1MB0A 3AQ4A 4U2FA 5GJCA 2GTIA 3C4VA 3I6IA 3GUVA 4N0EA 4TV9A 1MZPA 1AUOA 2AMYA 5J2TA 4IRUB 3M5WA 1EVYA 4YO7A 3GP3A 3BWYA 3KXKA 5GIOE 5JU6A 2ZWOA 4INZA 4WCFB 2QGNA 1DLJA 4UNNA 3IDSA 3M6FA 4JEIA 5JSQA 5KVVA 1QGED 1AT1A 2YHSA 4WINA 2AYYA 4FSXA 1LV7A 3KJFA 4L50A 1QIJA 4KVFA 1P4RA 1Q0SA 1C9NA 2N47A 5CH5A 4HDAA 1XZAA 3OIVA 4OAPA 3LT0A 4NU8X 4NCIA 5B4TA 2X4LA 4F9EA 3OE7D 2C5LA 4GRIA 3E7FA 1P5ZB 2AR0A 2JKYA 4MWEA 3MF4A 3COSA 3L7LA 1OH8A 1B6TA 2AFIB 1X39A 1Z0FA 1T1IA 4BS9A 4P35A 1LJUA 2WUDA 1JFRA 2FNAA 1B93A 3TMKA 3FRHA 2DB3A 1OHHD 2EJCA 1Q0PA 4UXHA 1IN1A 2QLLA 2RIRA 1YB1A 2AZTA 4EY7A 3RI3A 4XVHA 4F92B 4BNNA 3H5NA 1ZA1A 4P4UA 2C7OA 2EVWX 1AUXA 3NEPX 2Q1WA 3MWKA 1JWLA 2G1JA 4JI4B 2O8VA 4O4IB 1X3SA 1RWQA 2A30A 2CLKB 2OV4A 4JC5A 5B36A 1E5XA 5FA6A 2V7VA 5BUZA 3IA7A 2B3TA 2PVPA 4FWBA 3UV3A 4MR9A 5EZ5A 1EJ2A 3U4GA 4LCBA 4WOKA 2XUHA 4MULA 3VSEA 2GOYA 3TXAA 4DMKA 4O4HF 1V4BA 3DL7A 4PG4A 1YS6A 3CVXA 4G86A 4IHJB 2XTAA 1Z62A 3MAAC 3QF4A 5HDQA 3UPDA 6ABPA 4N76A 1T0JB 2I67A 1Z5NA 3JSXA 4FFSA 5FLEX 2G4VA 4ND3A 4I1RA 1GGHA 1D6JA 4N39A 2WKPA 2BEKA 3A6KA 3EB9A 3BKWA 4K9KA 3MWDA 2M6KA 2FPXA 1ISMA 3F1KA 5BQXA 4R2WA 4TQGA 2YNMD 5CVDA 4DV6B 5EZSA 1E6WA 3WB2A 1DJQA 2ECKA 2G76A 3PD1A 2OM6A 3L0ZA 3I34X 3URKA 2W4MA 4GM4A 4CKZA 4ZCQA 2KM1A 1DC3A 5ALSA 4DZTA 3T1QA 5HKKD 2QUAA 3D8UA 3G0BA 1H85A 1NBOA 1JL3A 2QL6A 4DUZB 2G0TA 5FJJA 2XZLA 2PZGA 3BIXA 4CKWA 4BNXA 1Q1NA 1X74A 4GYKA 1CUUA 4WWHA 4JQSA 1JSLA 1KHHA 2H48A 2X2EA 3OFVA 1CYEA 3HXQA 4DRXB 4PHCA 1PEKE 1OMOA 1R0CA 1SY7A 3OZIA 4A23A 3C5EA 3KAPA 4PYIA 4PY2A 5HJ5A 2ZM6B 2AS0A 3E9DA 3P2YA 3G8AA 4HDSA 2ASEA 1A5ZA 5ESDA 4BMYA 4JI5B 2Q5QA 1VYHA 3H19A 1B43A 3GLHE 2O8BA 4B43A 4MWTA 4B4UA 1GG8A 3B36A 4YRFA 3VPHA 4QDKA 3GA7A 2J4DA 1RFGE 2BI4A 2YZNA 4RFLA 4FIDA 4C43A 3C5CA 2NO7A 3ENVA 3MTIA 2FZEA 4YI3A 3W06A 3DL4A 3GRAA 4WSOA 5TJHA 3VC1A 3A9RA 1PD1A 3CPJB 1SUBA 4E12A 2OCAA 1KL7A 3EMKA 2QUBA 1FRVA 1LF0A 1XDGA 4ETMA 5KIAA 4EY8A 2WHQA 3AI1A 3ZCPA 3WJ2A 3BEDA 4PV7A 3BWMA 4QVKA 3MJSA 1IWPB 1M7HA 5J5AA 2VZ8A 1IONA 2FWJA 4RNDB 1P8JA 4CUJA 4D26A 3H7IA 2NTNA 1QPBA 3U4CA 1VP3A 4GMKA 5LP6F 3CZQA 3NGXA 5JDIA 2CWWA 1RKUA 4RXMA 4EHBA 2ST1A 1G6Q1 1SVLA 2IHUA 3I9MA 4K0KB 1E58A 5KINB 1H2BA 3R75A 2DFLA 2DHRA 5JO9A 1I7PA 2JGLA 3T5DA 4LZPA 4NBLA 2ZTLA 4P82A 3DR3A 5GP1A 2ZIWB 4G26A 1U3GA 1X7XA 1QGUA 3EG9B 4PLHA 4U39A 5KSYA 4PLGA 3QSYA 4ZAVA 5LXTB 4AI6A 1LB1B 4DR4B 3TQIA 3ND9A 2P0AA 4QYWA 4OLJA 4RD1A 3AJAA 2J9YB 4YV0A 3SXPA 2J8ZA 4HDRA 3AF1A 1QX4A 2BUAA 5CEFA 1RLOA 4DYDA 4X91A 4YMLA 2J6HA 3CX7A 5EE9A 3U61B 3B89A 5JXIA 1KA9H 2F4VB 1EZ1A 3URMA 5ELXA 1NQAO 2VK8A 2Z4RA 5I01A 1WTCA 2HF7A 4OCZA 2ONCA 3IFSA 4UJ3A 4E2XA 1B26A 4TTQA 1MJNA 2B92A 4OIMA 3NVDA 2YWGA 4NNOA 4BLSA 3AF6A 1TTPB 4MWGA 3CINA 4JNCA 3UZUA 1UFKA 3L7KA 1DAFA 5AHXA 1P77A 2EGGA 1YMUA 3FSGA 1BCRB 4IDGA 2QMEA 4CN9A 5KHLB 2RGNC 1FYDA 1KGSA 2D2IA 2WB4A 2R66A 3HO1A 1T3TA 4J1TA 2X1VA 3T5GA 3OBIA 3B2QA 3E0QA 5K0JA 4YIKA 4NS4A 2QL5A 5HJ7A 4CIAA 5CEJA 3BCUA 4M6WA 4OKIA 4DR2B 2EKQA 2Z56A 1WDKA 4G37A 2PUEA 2F9FA 3T9AA 1BMFD 4UCFA 1V3VA 5EJ8A 1JKIA 2GPBA 3NS7A 1HQYE 2QZZA 2XCRB 5CDHA 1EBBA 2DWCA 4QSHA 5BNIA 3JW8A 5EG5A 1FRZA 3MT9A 3QF7A 3HKDA 4P32A 1W6RA 3WLAA 3WTCA 4D4IA 5C1DA 2C77A 3DAYA 5I7AA 2BFFB 1GUAA 3HB5X 2GD1O 2A5FA 3WC4A 4UNPA 3U7QB 4RULA 1NR1A 2FZ4A 5SYNA 3VM6A 1PV4A 5BWOA 1UT6A 4GEKA 1W88B 5FNVF 2I4MA 1MA3A 4Z7OB 3IPXA 5TIIA 4WHMA 1K63A 4ZVKA 3OPVA 1Z37A 3IAEA 5CVJA 2P3LA 1CY2A 2WSSA 1YZQA 4YY3B 5A3VA 2HC9A 1QOQB 1JHPA 1N9GB 3CEJA 4YQYA 3FYUC 4UCXA 1ZR4A 5KSOA 1D1SA 1RU3A 4NESA 3WRYA 2EJTA 1QHHA 1DRUA 2QRQA 4MQ6A 5EUBA 4MCJA 3OM1A 1FP6A 2VUTA 2OFWA 4MA5A 4D3XA 5C1BA 3KQVA 1JLSA 4RDHA 2CJWB 4JD5A 3PCRB 3AB3A 3QPBA 3PHBE 5IDWA 3E7PA 3QXJA 3VSAA 2AW3A 2XADA 3UT5B 2DBVO 4KFCA 4DABA 5BN4B 2XODA 2BGGA 1GKLA 4CEIA 1SC3A 4G5GA 1YS2X 3AH8A 1KXJA 1KQOA 4JHLA 3U1VA 4G1UC 3VV2A 3HUEA 5EC8A 2GLUA 2NAPA 1RJDA 2FLVA 3D54D 1QC5A 2ATXA 4H3SA 3ZW9A 2OQIA 1JAIA 1W5SA 4FYPA 5DMXA 3UHJA 3WOHA 2EATA 2X41A 4NCBA 4CT0A 5I5GA 1KDTA 3BSYA 1FW6A 5CHEA 3PZBA 2ZWAA 3QLUC 2WNSA 1CWUA 3DUFA 1QG2A 2FGJA 5HMMA 1M34E 1YMQA 3KQWA 1XVLA 4Q9KA 4HC4A 2OBMA 2FJPA 2WVJA 1YJCA 5DISB 4J1SA 3RU2A 3TLEA 2B8TA 2YUIA 2C59A 1ENOA 2H1VA 4FW9A 2AQ8A 3I2GA 3EOZA 3PWTA 2WMNB 1TJNA 4EFLA 2XJ4A 2DE0X 1YZ3A 3I2JA 3PJEA 5JQGF 4MKXA 4OTZA 4HTAA 4A0SA 4BX0A 5A9SB 1P91A 3GCGA 3B13B 1YZHA 1W87A 2IHZA 3IO3A 3DT9A 3V4LA 2I4TA 2VP4A 3IHWA 1PD0A 2V96A 4U6QA 1KJNA 2C00A 1JA1A 4EW3A 2NPFA 3TPZA 4B73A 4CKEB 5BWLA 1R0YA 2VUUA 3IKTA 1LRLA 2B20A 2ENWA 2YYZA 1AQNA 1C3LA 4WKPA 3UTDA 1HRDA 2QW0X 4ZOLA 2NYVA 5D5QA 3R7WB 4BE4A 4HNTA 1II8B 4F4HA 1IUPA 1DQYA 1V41E 2IH5A 4EB3A 4PU0A 3RWMB 1E9BA 1XTIA 2EP7A 1VBMA 1IK4A 1Q2XA 1C9KA 1JEDA 1JT9A 4GBJA 2ETVA 5DNEA 3RREA 1VIMA 2FW1A 4TMXA 4QNMA 2XUJA 3IQIX 5EKXA 1CY4A 2WE7A 1YR7A 1I6KA 1OASA 2HHAA 2ZJ5A 2PKXA 1V96A 2UZ1A 4O08A 3WRXA 5EXTA 2AMJA 2AEMA 4QC2A 4U5XA 4YCAA 3UMRA 1CZKA 2XCLA 3C6ZA 3FKJA 4U2DA 3UAXA 3D3KA 4FOOA 1CYDA 2OBBA 4G25A 1RWXA 1SM4A 5E0OA 5ICMA 3UN1A 5JFGA 1DO8A 2DUUA 3EGEA 3JZIA 1N6RA 4RANA 3LOUA 1JHVA 3G2KA 1DX9A 3I1JA 4FFPA 3R0QA 1EXVA 1PR4A 1TRKA 4JVNA 5F73A 3S70A 4B6OA 1RWPA 2VDNB 1AQYA 4BO2A 2HNKA 1X7YB 3MGBA 1S3IA 3VNRA 2QU8A 3OA2A 4P34A 1ISPA 1BQEA 1P31A 1PWHA 3EW9A 2O06A 2QVBA 4Q4CA 2WLSA 4DRZA 4E6PA 1B15A 1TCCA 2WHPA 1T9AA 5D1NA 2O7SA 3CCBA 5DCLA 3OJOA 4NH0A 4GI5A 4EJ2A 5H3CA 2FR8A 2O4CA 4JVSB 3L18A 3QEOA 4N5LA 2CFRA 2I54A 1CRPA 1VFPA 3D4BA 3IS3A 1T4DA 2HA3A 3P0EA 5GONF 5LDGA 3FSJX 1NY6A 4W63A 4OHZA 4GOJA 5IT4A 1FRFS 1L4BA 4XSVA 1PDOA 2R6DA 1UAYA 3KQPA 1FXUA 4BQQA 1COZA 2JDIA 5LOVA 5I4IA 1QFXA 4TKUA 1A27A 2NSDA 4H4EA 4K9NA 5ERXA 3SDZA 1QCZA 1SQ0A 1YHNA 5KNDD 1D1PA 1KYWA 1W581 3KYCB 1WRBA 1N36B 3GYGA 4B6FA 2X7HA 4D42A 4DKXA 1Q3TA 5CB4F 5JAOA 2X3UA 1HH4A 3NNSA 4GPD1 2HD4A 4PQEA 4DXHA 1Y1PA 1Y3AA 2FYTA 2HU2A 3KYDB 3DAFA 4GPAA 5M29A 1J4AA 5FWXA 5K03A 3KKQA 5F64A 3LHIA 5JNRA 4I55A 5A5VA 3ANMA 1U65A 4NZPA 5ETJA 4BBAA 3L1VA 5HA5A 5KTPA 4OJYA 4HLUA 4FMBB 1FSZA 1XEXA 2EV9A 2GXUA 4RJTA 1IG3A 2UYOA 4J0JA 1KO1A 3WWPA 3ZY3A 4AZ0B 4RPHA 1VGQA 4ZCRA 4WBXC 2GLTA 4G36A 3UHPA 1R8YA 4PHTA 2E0IA 1TDJA 1Z0ZA 2X6RA 1F8YA 4NH4A 3D8SA 2VRCD 3CLKA 3CVJA 4LPSA 5A4JA 5K8CA 3Q1KA 3I5YA 2BEJA 4N7MA 4G5HA 4F5WA 3RJMA 2I99A 3EFOA 5CEEA 1ZCFA 2P9YA 3I1IA 4IZOA 4QTZA 2G9UA 5LQDA 1YIDA 3RPEA 1GRNA 721PA 1O97C 2PJUA 3M33A 2IP1A 4TYMA 3RUCA 4RIEA 2WWIA 3TQHA 1K08A 1OWOA 1REQB 1ZIYA 3ACBA 1KFJB 3KXPA 4HNUA 2OWEA 2NPIA 3DQQA 5COQA 1FB5A 2X0IA 2PZJA 1SVKA 3SP1A 2AZXA 4G85A 1P1RA 3UJAA 2PIDA 2GEUA 2ATEA 2CL5A 5ALVA 2M32A 3FMVA 4YH1A 1WQ3A 1E5QA 1OXUA 4YV1A 3EEFA 1CEEA 2VHZA 3F9CA 1K66A 1NRWA 2GN8A 2KX7A 4C87A 1JECA 4LMBA 4JJ7A 5THKA 2DULA 4M46A 3WIBA 1SZDA 2V45A 1U31A 5JYBA 3C4JA 2HI0A 4G5YA 4TTVA 2RGWA 3QBVA 2F3SA 2ISQA 1JSRA 3BMQB 2OG1A 5A4FS 4RTRA 1U2TA 4M0MA 2IUEA 2W8ZA 5CW2A 2QX7A 6CHYA 3GOQA 1KERA 5CAEB 2B5VA 4RAOA 2BMWA 3RBZA 3ZU5A 1M0SA 3H1BA 3RTAA 1DPFA 4L9SA 3IPLA 5CXSA 4Z8YA 4BFXA 3AVUA 4AX4A 5GV8A 3AUFA 5HUHA 1I2CA 3WHPA 1NP6A 3O31A 3IL2A 2FPKA 4EL5A