1LJUA

X-ray structure of c15a arsenate reductase from pi258 complexed with arsenite
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
131
structure length
130
Chain Sequence
MDKKTIYFITGNSARSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDADNNCPILPPNVKKEHWGFDDPAGKEWSEFQRVRDEIKLAIEKFKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title All intermediates of the arsenate reductase mechanism, including an intramolecular dynamic disulfide cascade.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
molecule keywords arsenate reductase
total genus 47
structure length 130
sequence length 131
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2002-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ljuA00
3KKEA 4MPTA 3OLXA 4OTZA 1U0SY 3HDGA 4GPAA 4XXHA 3KS9A 3Q7TA 3DLHA 3KLOA 5GOTA 1Z17A 4MQEB 1TJYA 3I5AA 1FSPA 4KMRA 3HEBA 4LX8A 3C6QA 3BBLA 1XHFA 4MR8A 4L85A 5BQ3A 5FWYA 1JH9A 4NCAA 5TQJA 1OXKB 3E3MA 4RXTA 3SQNA 1QP0A 3EQ2A 3CTPA 2FEPA 4B09A 1AB5A 1W9HA 1E6LA 1KRWA 2FLWA 2VK2A 1FQWA 3G85A 2M98A 3KYJB 3N0XA 4LE1A 4Z4CA 3P9YA 2FN9A 1CHNA 5TPZA 1E6KA 3JVIA 3BREA 3FFTA 4IGAA 2RJNA 4EUKA 1L5ZA 5T3YA 4KPYA 1JL3A 3KTOA 1QP4A 5IUKC 2A9QA 4QYWA 2JCGA 4MS1B 3ROTA 1BDHA 4CBVA 3UK0A 3HCWA 4HYEA 4FE7A 4JAVC 4O5AA 4EGSA 4IMJB 1KMIY 4YGXB 3LUCA 3DLBA 2MYNA 2FMHA 2ID9A 1QO0D 4Q6BA 4L4UA 4MRMB 5HQJA 2IPLA 2F8TA 4GNRA 1QKKA 2FMFA 3N0RA 5FWYB 4W5OA 4MS3B 1GCGA 4IMIB 4KQCA 2PKXA 1NXSA 3JY6A 5TPWB 1JFVA 4JOQA 2JVJA 3CRNA 4LDAA 4RWEA 4KV7A 3HK2A 2OENG 4DN6A 5EWMA 1DZ3A 4DADA 2FQYA 4RK1A 5I4CA 3NHMA 2PE5A 3O2QB 1R8JA 4MQEA 4QPJC 3KHTA 1EWTA 4YWHA 4F11A 4ZPJA 1U04A 3QK7A 1A0OA 2FN8A 3CG4A 4W5QA 1ISRA 3NBMA 3OQOA 2QW1A 4W5TA 1BA2A 1M5UA 1QNLA 1YVUA 1VKRA 2FMIA 2RDMA 2RJOA 1JF8A 2WWVD 1DBWA 3N0WA 4W5NA 1SXGA 1C0EA 1XWWA 1D2AA 3HZHA 3JPWA 3OLWA 1MAVA 2QVGA 4UHJA 3BRQA 5TPWA 2NZUG 5JNRA 5CNKA 2I6FA 5PNTA 1CYEA 4IRXA 4D74A 2DRIA 3LTEA 4HNRA 4G0PA 3RVPA 3M6MD 1DC7A 3O21A 3OLZA 4RDCA 5KQPA 4OBBA 1DP4A 1MIHA 3CZ5A 2JBAB 4Z4EA 3SG0A 1Z12A 4S05A 4JA2A 4MR9A 4ZMSA 3RVLA 4EYQA 3EQZA 1KRXA 2MYPA 5T7BA 3O2SB 5FBHA 5TQ2B 4RU1A 1Z15A 3L6UA 2JVKA 3IP7A 2ZAYA 3B2NA 4JASB 5JNSA 3EODA 3I42A 3A3KA 4Z4GA 2LBPA 1NXWA 1E6MA 1QMPA 3OQNA 1P8AA 3A0RB 2GX6A 4RK4A 2BGGA 2J48A 1GCAA 2E4ZA 3Q15C 4RKRA 4P98A 5JNTA 1TLFA 1ZN2A 3EJWA 1BVHA 3LUAA 3C3WA 2XDYA 3FMVA 1QQBA 1JBEA 4UHKA 4WXMA 2MSKA 2FEKA 4H3HB 2QV0A 1FFWA 3DGFC 3LUKA 4M88A 5KQLA 3OM0A 4KFCA 1U8TA 5TPZD 2PMCA 2PAFA 3F6CA 3IP9A 2WJAA 4JB0A 1YIOA 3SAJA 3C97A 4RK0A 3RVJA 2PLNA 3W9SA 4F3TA 3KG2A 1JX6A 4E7PA 1M2FA 8ABPA 1HEYA 4S04A 3LOPA 2HQOA 1T34A 4XAQA 3HJFA 3RVNA 1YK0A 4WUTA 2FQWA 1Z18A 4RKQA 5IX8A 3M9XA 5CHYA 2FMKA 5FWXA 3CHYA 2LIVA 4G0XA 1BAPA 1PUXA 4RV5A 1NXXA 1YMUA 2E4UA 3URMA 4ZMRA 3C3KA 1U2PA 3SY8A 3OO0A 2R25B 2FVYA 3H6HA 5ED4A 1DCKA 1UDRA 4KQ9A 5D2CA 1ZH2A 1KGSA 1Z16A 2KYRA 1RXIA 4RXUA 4XFKA 4WXEA 2PUDA 2R48A 1GLGA 1RNLA 4IILA 4MR8B 3K4HA 1W25A 2X7XA 4PZ0A 5TQ2A 1NXVA 1PNTA 1YS6A 3O1HB 5JNWA 1DCMA 3JS5A 2FW0A 3NHZA 1YTUA 5CNMA 1ZVVA 4MR7A 1FFGA 3GL9A 2PJUA 3F7NA 4XARA 4G97A 4P1ZA 3IPAA 1S8NA 2FSPA 3MM4A 3EGCA 3LUJA 1A2OA 4Z4FA 3SM9A 1SXHA 2B1JA 1JHZA 2WY2D 1TM2A 4OATA 4G0ZA 5HM6A 4RS3A 3T8YA 1JYFA 1SRRA 3KYIB 3MQ4A 5KC8A 3HDVA 3QEKA 2NT4A 6ABPA 1DCFA 4YCSA 4F06A 4N0QA 3N75A 3UKJA 2GBPA 1I3CA 4Z4IA 2CHEA 2B4AA 1MB0A 1YS7A 2A9OA 4MRMA 4G0MA 2CWDA 3LKVA 2WB4A 2A9RA 5IULC 2MYTA 3HXMA 2PUEA 1PEAA 1Z26A 4KRFA 3EDCA 2QSJA 4RK7A 5KWSA 1A04A 4DQDA 1DRKA 2VYCA 3GWGA 4HNSA 1Z13A 4YP9A 1PEYA 3GBVA 1NXPA 3O75A 5KI6A 1ZITA 4LZLA 1M2EA 2N9UA 2IPNA 4Z9AA 1C4WA 1ABEA 4NICA 1RZRD 4YS6A 1EAYA 1ZESA 2LPMA 2TMYA 4F12A 1D1PA 3CG0A 3RVSA 2WJWA 5JS2A 3TD9A 3A10A 3HVRA 2IPMA 2OQRA 4YRZA 2H3HA 1DC8A 2NZVG 9ABPA 3I09A 2HSGA 5E3JA 1D4ZA 5JNVA 4LE0A 2PUBA 3RQIA 1F51E 4MLCA 1MVOA 4D6XA 4G0YA 2WRZA 1TVMA 2HPHA 1D1QA 4O1HA 3HV2A 3Q7RA 4ML3A 5EWMB 2QZJA 3HUUA 1CEYA 2FEWB 4KK3A 2PL9A 2MYUA 1USIA 3QLTA 4H60A 5EWLB 1OXBB 1BDIA 2PUGA 1E2BA 3T6KA 5BRAA 5ABPA 1AB6A 4MGEA 2H0AA 2YHAA 2IDMA 3GA5A 2F8SA 1Y1LA 4MQFA 3KSMA 3RVQA 4ETNA 4Z9BA 3QX9A 3QEMA 5IUNC 3TX6A 5IBQA 4EVSA 4OG2A 1DBPA 3D02A 3LKBA 3BRSA 3GV0A 4FE4A 5BRJA 5TQ0B 1DG9A 3H5LA 3N53A 1J56A 2HJ9A 1APBA 3OO1A 4N76A 2LUOA 3MMNA 5IEJA 3QX8A 4YO7A 4Q6WA 6CHYA 1ZY2A 4LE2A 1USGA 1VPWA 1TMYA 3EULA 3EAFA 4EYKA 1BDJA 2FLKA 3TO5A 1RXEA 4RY8A 5JS1A 3O74A 3GYBA 4Z4HA 3OMWA 1LBIA 1ZH4A 1M5TA 4G0QA 5B3JC 5DCLA 5CNIA 1ZAYA 1RZRA 1P2FA 2JRLA 3L49A 3CLKA 1JLKA 3LMKA 2VUIB 4WT7A 3QLVA 2AYXA 2WMYA 2E4WA 3LUHA 3H75A 2QR3A 3NNDA 4NV3A 2JK1A 3A0UA 4G0OA 3KCNA 1ABFA 2NT3A 4PICA 3H1GA 5TQ0A 1JDPA 3H5TA 1EWKA 4RY0A 4ZJPA 3HM9A 4RSMA 1DRJA 4FB4A 4MS4B 2IOYA 2QU7A 4JP1A 1QPZA 1YK1A 5IEBA 1JDNA 3HS3A 3I45A 3ILHA 4N47A 3VNBA 4MYRA 1Z2EA 3QLUC 1QQAA 4YR7A 2L18A 2L17A 3BILA 1P6QA 2JB9A 1NY5A 4TMYA 4YLEA 2HQBA 4N0PA 3SNKA 2E4XA 1YMVA 3H5IA 3FFWA 3H5OA 2P9HA 3O2JA 1VRVA 4D6YA 1PNRA 1SD5A 1H9CA 4IF4A 2FKAA 4OLBA 3LUFA 3S99A 4W5RA 3OMXA 3CZCA 4N41A 1D5WA 3H6GA 5DGCA 3MYYA 4E7OA 2GKGA 2Q5CA 3DGEC 4PEVA 5DTEA 3GRCA 2VUHB 3CNBA 3HUTA 3H1FA 4MS3A 4F8JA 1L5YA 1PHRA 4KK4A 1K68A 3TMYA 4Y9TA 2AYZA 4HNQA 4MAAA 4RXMA 4Z99A 3H1EA 2ID7A 3VNAA 1FFSA 4MS4A 4MLDA 5IC5A 4XLTA 3JTEA 4KREA 5FBKA 2GWRA 3Q7SA 4QICA 1JFSA 1DJMA 3GT7A 4EYOA 1Z25A 1EWVA 3T38A 4RK6A 3LUDA 3DBIA 3O1IC 4Q7EA 3RVOA 4LRQA 4QYMA 1IIBA 3OLVA 2P4UA 3JPYA 2IKSA 2HQRA 4TLLB 2CD7A 2FTKE 1F4VA 3CU5A 1LJUA 1JFTA 1EHCA 1U2QA 2R47A 3IP5A 3RH0A 3Q41A 2QXYA 3FGZA 4YV7A 3QLUA 1K66A 1NATA 2A9PA 4MR7B 1RPJA 1GUDA 2JVIA 3H5VA 2YHBA 4KVFA 2PUFA 3N8IA 3KLNA 4PYRA 2JBAA 3K9CA 4NQRA 4LDZA 5F64A 4KNYA 1ZDMA 1USKA 1NXTA 2V0NA 2ZWMA 5CNJA 2PUCA 3TB6A 2QVCA 3FFXA 1QO0A 4RZSA 3M9WA 3CKMA 3GBPA 3HO1A 3QELB 5HKOA 1URPA 3NNSA 4N03A 3OQMA 4NCBA 4EVQA 5HSGA 4JB2A 3DZDA 3D8UA 4EYGA 5KQMA 1ZHHA 2E4YA 1LK0A 4Z0NA 5GQSA 4OLAA 4WZZA 3MF4A 4EVRA 3C3MA 2PUAA 2FXIA 1LJLA 1DBQA 4ZYLA 3RVKA 2FQXA 3O1JC 2M1ZA 3LFTA 4RY9A 4TLMB 1SXIA 1P6UA 4MR9B 5EWJA 1B00A 4WWHA 2MSLA 3ROFA 2MSWA 1QP7A 1MB3A 3OM1A 1Z2DA 4EY3A 3RVMA 4ETIA 3Q9SA 4ETMA 7ABPA 5DLEA 3NNNA 1WETA 1ISSA 1LBHA 1XHEA 3H5WA 3R0JA 3E61A 5TE9A 2NUBA 3ILYA 2PL1A 3G1WA 1VLZA 3UUGA 5KC9A 1ZGGA 3F73A 3IPCA 4H3KB 2GI4A 1NXOA 2O20A 1ZGZA 3QELA 3QEMB 5FWXB 3HSYA 1GUBA 2LP4Y 4PE5B 3IP6A 3MA0A 2R4QA 1EFAA 3OLYA 4G86A 4XASA 3FDFA 5BR1A 3MIZA 5EWLA 5JNUA 5B3JA 3IDOA 4RK5A 5C5CA 2IYNA 2L2QA 3F6PA 5EWJB 3T95A 3LUGA 4MQFB 3RVRA 3CS3A 3KJXA 4O1IA 5C5EA 3CFYA 5IUJC 2L19A 2E4VA 1JYEA 2IPAB 4TN5A 2W42A 3QLVC 1NTRA 2CHFA 4KZKA 4MS1A 1JWLA 3N6VA 5KQGA 3JVDA 2RGYA 5DKFA
chains in the Genus database with same CATH superfamily
1CWUA 4I4TB 3SSMA 1JFLA 3Q9UA 5CIYA 3LNCA 2H08A 3FETA 3ZDXB 3GLGE 4LOAA 3NUQA 3U9SA 3DE1X 3I2IA 4FOOA 3CKKA 3UPDA 1Y63A 2QPAA 5BQ3A 3D8TA 1JIKA 3C1TA 1M34A 2G25A 3CNHA 2HA5A 4NCAA 3K1YA 1R7RA 2BTOA 1FDTA 4HMPA 2BEVB 1KAHA 3CXUA 4NOLA 5LWQA 4BX0A 1L8OA 4QYSA 2QRPA 2SCUB 2CDRA 4KR0A 3PQEA 4ZTUB 4CKYA 4HLDA 2FP4A 1O6CA 1USVA 4B09A 1NBME 3T3NA 2PT9A 1F14A 1E6LA 1SCJA 3BL8A 1WNFA 2WTXA 3R09A 4HYTA 4Z4CA 1BD4A 2EFDB 1S8AA 4GYWA 3OPYA 3NCTA 3JVIA 3BREA 3PDIA 2LNDA 2V3VA 3W5CA 2RARA 2ATIA 2VF4X 3A14A 1T5TA 3U44B 3DLCA 1DX9A 3P9SA 4LCJA 3E8SA 3W2GA 4BS9A 2CMHA 5KVCA 5EMMA 4L08A 5F23A 5CPFA 2FWRA 1C9NA 1U8CB 2R8YA 3EDOA 1SVNA 2JI7A 4O5AA 2X1LA 2DPYA 1R9NA 1E4EB 2XSZA 4HRAA 1PJCA 2WF6A 4U39A 4Q6BA 1SHLA 3LI2A 2C96A 1B74A 2YHUA 3GXBA 3KTFA 4AO7A 2P9BA 1SQ5A 4XOIA 1E5XA 1CQXA 2C7VA 3ERCA 4Q48A 4C6TA 2BFEA 3B13B 3BWEA 4ZQIA 4ARZA 4UNSA 3U3DA 5C8VA 4J7AA 4CKXA 3GR6A 3PPYA 4FHGA 1RHKA 2J9ZB 2O0HA 3BX1A 1DT3A 3WRXA 3T7TA 1YDHA 2CVHA 2QRNA 3A58B 3E5HA 3O6VA 3PJGA 4P5PA 1RVDA 5DISB 4GOLD 2HJGA 1I1HA 1E2GA 1ZVMA 1RKBA 2GCOB 4FOSA 2Y2VA 4ZOAA 2NW6A 1HG0A 1HYGA 1NUSA 1AOXA 1QJ4A 3WRVA 2XNSA 5K09A 4ZC8A 4MAFA 1EGQA 1S2OA 1ORTA 3U7FB 1Z37A 2AS0A 2Y0EA 1O8BA 3AZQA 4QQKA 4OXIA 1V1RB 2QRUA 4OUDA 1M5UA 2BR4A 3I2HA 1E94E 1VLJA 1QNLA 1YVUA 3L8YA 1DPGA 3R6GA 3DDNA 2G67A 3UH0A 4YUZA 2HBYA 3X2FA 1DBWA 5FDFA 2XTAA 4KBGA 3RU9A 4C0QC 1DFGA 2Z5FA 5EOVA 1ZWLA 4GHWA 1JSRA 4EG4A 4C07A 2ID4A 3S8MA 1G3QA 1FVXA 3FPEA 4BAZA 3A6DA 3LH5A 2GJ9A 4KNVA 3WG9A 1S2IA 3NTQA 3UK2A 1KAMA 3OJWA 5JNRA 2XZOA 2M6KA 2MOKA 2VCEA 1DE0A 2VJDA 1J8YF 1HI9A 4FTWA 3V8QA 5K3EA 2WIBA 3HVKA 3U19A 3LK7A 2C2KA 1O94C 1DWQA 3TSYA 1AMNA 3G2JA 4RDCA 3ZY3A 2ECFA 4YRFA 3A6PC 1DP4A 3O4JA 2GUGA 1LVHA 4YVFA 3JQ6A 5FV7A 5FFMA 3VNVA 1YE3A 5IKEA 3CY6A 1NT2A 1G1AA 4R51A 4Y8VA 4YH1A 5D5PA 4BJ1A 1R0CA 1VBFA 2P6MA 1IQPA 1RDFA 1GSIA 1XTIA 1JLMA 1SIBE 3V4PB 3WC4A 3S1SA 3HDTA 4M1ZA 2YJTD 4YHBA 1F6DA 4OXXA 3M7IA 4Q1DA 4TROA 2ZATA 2FWAA 3GCGA 3PICA 3BIXA 2J9GA 4G36A 4GWLA 1Z8DA 4JR0A 3VBCA 5HFNA 4B73A 2EIHA 3KOZA 4MUAA 4L6CA 2GK6A 4EG6A 3OCUA 2BFFB 1T3ZA 1G5FA 2G83A 2Y92A 3SBEA 1IJFA 5KYTA 2EG9A 1J7KA 2ZYIA 1QV6A 3OE5A 1HNZB 4LDPA 4FGSA 2IS2A 4DA0A 2FW1A 4X64B 2QP9X 3T3OA 3D6AA 4Z3DA 3TFOA 1HNWB 3H3JA 4J0DA 1XRSB 1YUBA 2Q4BA 3LUKA 4KFCA 2Y1GA 4B2LA 2I4OA 5KNCD 3ZZ1A 3WADA 4XUGB 4P2GA 5AO9A 1X42A 10MHA 3HU3A 1JA9A 1JX6A 1KO7A 3F3KA 4NJEB 5FKJA 2IU4A 3LOPA 2HQOA 3QEJA 4ZQCB 2OAQ1 4Z3OA 4DCNA 2PYDA 4NNOA 3PFWO 1X7XA 4F1JA 3W6UA 1FYFA 5FA6A 3VPDA 3ITNA 1VGRA 3KQYA 4YAOA 1Z0SA 4G0XA 4RZXA 1GPUA 1U4SA 2B0CA 1L4YA 1ZUNB 3PEUA 1TVCA 5H3HA 3CF6R 2AXQA 5I9NA 5K5EA 2AFVA 3PT9A 1T2NA 4RFSB 4DNOA 2PVPA 2KYRA 1B7GO 2WJ4A 3IUYA 4UBJA 2HR1A 2D54A 1SB9A 1RNLA 4JI3B 1JDJA 1YR6A 3HWSA 5BVHA 3KSBC 2AFIB 3MQ2A 2AD1A 3AEQB 2QNIA 1ZK0A 2PX6A 4ND5A 1Z4OA 4UW9A 2ACKA 1IOZA 1PLJA 3FAKA 4DIDA 2CXRA 4FJ0A 1YTUA 5DV9A 2B4TO 3QKSA 4P33A 3SJZA 1PJ4A 1RLOA 1XAJA 2B21A 4C3OB 2OXRA 3KSAC 3D6FA 3PHIA 4OHBA 3ZDQA 1W76A 4JI8B 4WLEA 1T8TA 4DYDA 3DMPA 3DULA 1QGUA 4FZJA 4OHFA 1KAQA 3B1FA 4Y2XA 2FFHA 4BJ3A 2O1SA 4K0KB 2M32A 4PR3A 2DFPA 4RD3A 1BS1A 4IDEA 2R0QC 2FETA 2YJNA 4WMLA 1FJHA 1JSLA 2BM8A 3CJQA 4GLBA 3LT4A 2PX3A 1WHSA 2O2DA 3BQNB 5EYPB 4ALJA 1ZG3A 3HHEA 2GS9A 2PWYA 4ZD6A 4D9HA 5I8PA 1C9KA 2R65A 4MKHA 1LDEA 1RMYA 1WDKA 3UKJA 2ZKLA 4JY7A 5FLEX 4Z4IA 1NW4A 3I58A 1XDWA 1UM9A 3ZGYA 4P7GA 3PG5A 2A9OA 1WKBA 1KFCB 2ZUFA 3R76A 5JMPA 2EGHA 3TQRA 1WW3A 2ZKIA 3WK8A 3WRXC 4A0QA 4DMCA 5BXYA 5IXJA 1P5HA 4RTKA 4NMXB 1Q7BA 3R7FA 3EDCA 4BMVA 4PLWA 5AESA 1E32A 1K2WA 3C8DA 3JU3A 3OUZA 2H06A 1DC4A 2EBWA 3KJIA 4H6XA 3O75A 4JOCA 1FW6A 5JJKA 5C80A 1F1BA 2P2ZA 4QOHA 4F7DA 3TLXA 1M2EA 2Q4RA 4LJAA 4DIOA 3RJ9A 1UAAA 2YRWA 4V3CA 3OZGA 5ECGC 1IZ0A 4JBNA 1BCRB 4I99A 5JWRA 1QIMA 2EAUA 4IEFB 1IE3A 4FOLA 5DSZA 5EZ5A 1KP9A 3T1HB 3EGXB 1KVUA 1QH0A 2CLMB 5KDDA 3HJRA 4TRJA 2V0CA 3OHSX 3OMLA 4UUBA 1NW9B 5FQOA 5C31A 4F6CA 3OY2A 4YRAA 2CZQA 3ZVMA 2CJWA 3AWDA 1ZIPA 3KC2A 3V6MA 2W98A 4DWWA 4BNNA 5EYPA 3A2KA 3BWCA 4ENTA 2VP3A 5JNVA 2IS4A 4N4AA 5JTTA 3AR3A 4D5EA 2CDNA 1VMDA 4UAVA 1D1QA 2X9GA 3HV2A 1UODA 3RGWS 1SVIA 2QDXA 3CKLA 3E9QA 3Q3GE 3QFRA 5JWHA 1ZXLA 3TVYA 4L5CA 3ZCSA 2XTNA 4EWLA 1C29B 1IQUA 1NQXA 2H4HA 3DOUA 4V39A 1N2HA 4QPNA 3JZFA 3U3OA 3AMVA 4UZFA 3LUPA 1XOIA 4G8JA 3OCXA 4N8DA 1W87A 2JZNA 5HF9A 4PYMA 5LNK1 1EFDN 3CTMA 2QUZA 3D02A 4OG2A 5CX1B 1XK7A 1X1BA 1U5BB 1DUSA 1X80B 4EO9A 4OL0A 2ZB4A 5LQDA 1G9XA 4YP0A 5AD1A 3RADC 1K5HA 3UTDA 5LOVA 3Q8MA 5GZ3A 2FUKA 2XBLA 4AMGA 4DC1A 3ZNQA 1NUAA 3OTHA 4HZUA 4WLUA 2DPHA 3Q8XB 1TQDA 2JI4A 3EULA 4DLBA 1PKXA 1UINA 2WABA 2OAEA 2R751 2JD0A 1ZVJA 3DTNA 4OHUA 5BWBA 3TO5A 1E9AA 1U9YA 1I0LA 5A4KA 5ITZA 2QLJA 3PUVA 4H4EA 3LSYA 2NVBA 4YJGA 4B17A 1GR1A 1P5JA 2XLCA 3DBHB 1I2AA 5JJCA 1ICEA 3RRYA 4ON9A 4EECA 1VJTA 2OGSA 1QHHA 2Q5OA 1ZIYA 2YWHA 3CLKA 4L8FA 2XD9A 3K3PA 3K7EA 2X4IA 2XGOA 3QLVA 3G9ZA 3PFKA 3IHWA 1O95C 1HDYA 1PU2A 1WMSA 2IBMA 3EZYA 2AB0A 3FX2A 4PC2A 1DHRA 1XALA 2E4WA 3WFJA 3VKUA 1BD3A 2AEFA 3HBMA 4LXGA 1UEIA 2QR3A 5JY1A 4UDYX 4CMHA 3G0DA 2QR5A 3OM9A 4MROA 3G2OA 2G8LA 2H1WA 4PICA 5KYNA 5K3DA 1G21A 3T9FA 4LF9B 2HHHB 5A0VA 1L3BA 4QTTB 5AKIA 2VHTA 5MHTA 2KMLA 5C5IA 2Q46A 3JQ9A 4UMFA 3TTXA 1LU9A 4XCVA 1JHRA 4JP1A 2GH1A 3V4OA 2EZ8A 4BFCA 1GTJ1 1L4GA 1FVHA 1TT5A 4WFKA 4YUXA 4M8SA 3ETGA 1GDDA 1QQAA 3ZW7A 3A1CA 4POAA 3V7YA 1DKRA 3KALA 3G17A 5FPHA 1EESA 4YLYA 3N6XA 3K9WA 4LTMA 1P4RA 4N0PA 5BN4B 2N1BA 2WG0A 3PSAA 3QY0A 2A8YA 3LY8A 4YRQA 2VHQA 3HR8A 4LI0A 4UZEA 1BHQ1 1C7QA 5HS6A 4GGOA 3P5BA 4AN1A 4DDKA 4F6RA 1LRLA 1LTHR 4AKSA 1COWA 2GPNA 2XB4A 3IX7A 4OQLA 3PQ7A 3SZMA 3WAKA 3FUWA 3MERA 4UPEA 1NJ8A 2WFZA 3GOQA 2OGTA 3MLBA 5CYOA 3G1TA 3WIDA 4H1UA 3BZUA 4KTVE 3FR7A 1RIFA 3VR4H 3P19A 1H4SA 1N5KA 1E7RA 1A8PA 3FVRA 1K68A 1N2ZA 1HE3A 5GTDA 4HS9A 4IOKA 1X7GA 1HZJA 2LVBA 4GWKA 3DZ8A 1K89A 2ID7A 2P2CA 3KKLA 3DF7A 5H80A 4OD0A 1XMSA 2JGDB 4M9RA 7AT1A 3KP1A 1VL8A 2AEEA 2AC7A 4K9SA 3VPAA 4QT4A 3RGGA 4IIJF 4XVQA 1XTKA 2HHCA 4YCMA 1QOZA 3DOOA 2F00A 1CY7A 1TVKB 4DUZB 3G49A 3TUZC 3KD2A 3ZI4A 3L8ZA 3RYHA 1U1IA 1YCGA 3KQMA 4EG7A 2QVBA 3GNQA 1LNQA 3O8NA 3ZD9A 4DLRA 3NBZC 3F1LA 4TSFA 3FCXA 3WGLA 2OXTA 1S9DA 3DMYA 1E4VA 3ND6A 3F5FA 3WLOA 4EPYA 1NMSA 2PY6A 3OTOB 2WU8A 4K2HA 5A7GA 1C0IA 3GP5A 4LS3A 3H13A 2NQTA 3F67A 4C6HA 1A69A 2HDOA 3KWMA 1F4LA 3RUDA 2O2IA 3Q3VA 1VE7A 2H51A 4N9WA 4U2FA 4UHEA 1VA4A 3G2IA 5KOHA 2V0NA 3DE5X 5KVQA 2VQ3A 3ZHVA 1ZD4A 4ZU3A 2OWEA 1FP2A 1C3XA 3NNSA 2BGNA 3WJ2A 3OICA 3D1LA 3L77A 1CR4A 4RQAA 3WK9A 4HDRA 3K9GA 3DAGA 4UE3S 2WQ7A 2PQ6A 4WA8A 3FGNA 4ZOLF 3WFIA 3RS4A 2QX8A 3E5MA 3IEIA 4AFNA 3R2JA 5LD2B 4G89A 1TYZA 3HG7A 1XZ8A 1SBQA 1YACA 4LTNA 2W2OA 2UAGA 3GDOA 1JVNA 3HYSA 5CJJA 1ONSA 4RPJA 4D81A 4E4RA 3OPNA 1J8FA 3C6XA 3FZGA 3G59A 5AK3A 4UUOA 5KTMA 1EVZA 2M2IA 2EJTA 2LE0A 1B76A 1EA7A 2MSWA 1NG9A 1YVDA 3QU7A 1WE2A 1V8OA 4WNYA 5THKA 3Q3IA 1QP7A 3OM1A 5REQA 3SZGA 4GZLA 5BUZA 3DE0X 3OJFA 1L5LA 2QM0A 1SCQA 2PUJA 2DFDA 2Y0PA 1IQRA 1E63A 2C5SA 3AJ8A 5E6SA 4C4XA 3B1YA 3E8XA 5CCBA 3KK0A 2UVDA 3JVVA 2XKAA 3WYEA 4IIGA 1X8JA 2ALJA 3UAZA 4BLQA 1YB1A 2WAXA 5C7LO 1YDGA 2UYHA 4R9SA 2UZAA 1RM4A 1MN6A 4UTXA 4V0MA 5ILQA 2A94A 2JI8A 2XUJA 1GKLA 4K0RA 2FDCA 1MG0A 2XA9A 2J0QA 2VPIA 4DG9A 4DV4B 3MA0A 4MZDA 4Q1FA 4D3SA 1W36C 3TLGA 4E5DA 2PR2A 5DHPA 2X8JB 3C0KA 2I4MA 2I2WA 3O0TA 5BUSA 2XBUA 2QUKA 1BH2A 4AURA 1RJGA 4DR4B 4IGEA 1SHJA 3UPUA 1GWNA 2Z30A 5GONB 1ETUA 2JZCA 4PN7A 5A3QA 4B3SB 4MQFB 3M4JA 4FBGA 3KJXA 2W58A 4WI1A 1XD2A 3ZWPA 1VIYA 4GXRA 4R9NA 1PP4A 3ICVA 4O2LA 2XT9A 1NVXQ 1PWXA 1L7VC 4UU1A 2OXIA 5REQB 2PRYA 3P0EA 4PHTA 4TMKA 3B1XA 4M7PA 3RAGA 4OH7A 1E3LA 1NAHA 2PWZA 2YYAA 3KKEA 5C0OE 3FYHA 2EW1A 3PB3A 3R5FA 3TTSA 1C7EA 2PSSA 2VDJA 2JZOA 5E6SB 5FI5A 2NTJA 3DLHA 1QCYA 4YPFA 2FYTA 4RFSA 3VI3B 1SWVA 2AQ8A 3EUAA 3IEPA 4F84A 2EKDA 4KRYA 5E6UA 4O8ZA 2GEFA 2UDPA 2ZYWX 4R01A 3WLEA 1U0HC 1B8VA 2KW5A 2W6JA 5DWQA 4ZT4A 2OBNA 3PA8A 2ZQZA 1KJIA 3LGXA 4FCWA 4B2PA 2K6GA 2NG1A 4YBZA 5FLYA 3PQ8A 5IAGA 1I2BA 2DWCA 3RBAA 3ZHRA 3AHIA 2ZIZA 2AG8A 1EUCA 3EQ2A 2D59A 3OFND 2X8JA 2AI2A 3BG5A 3EXG2 3WYCA 3QE9Y 3E53A 4FT2A 1D6SA 5ICEA 1AB5A 5CXSA 1R9MA 2P6PA 3DOHA 4MCAA 4EY7A 2YR0A 1W7AA 4H0CA 3BJEA 5ICSA 3PFBA 5SZKB 1J0XO 4EABA 2ZVDA 1G18A 2CD9A 4AJHA 2C59A 3KHSA 1BGXT 4LNHA 4MO2A 2XUZA 3DBLB 1N8KA 3JD4A 1L6RA 2JJ2D 4W5HA 1ORRA 5TSDA 1MA3A 4MUGA 3E3NA 5CLQA 4OOFA 4N9QA 3LCJA 3CUVA 3T34A 2BZGA 1DB3A 1XPJA 1Z4LA 4JAVC 2B4RO 4IMJB 2FMTA 5ADUS 2D0PB 3AL2A 2JFHA 3VVCA 1PR1A 1YOBA 4KVZA 4OXKA 5CYGA 2X6TA 1XJWA 2R1ZA 1IJEA 2D00A 4R83A 2AMLA 4Z2YA 4G5FA 1SK9A 3G13A 4CKZA 3VA7A 1C4OA 1NBWB 3D2BA 3FPJA 3CEPB 3PV0A 3PX2A 1CVIA 3AHHA 4K05A 3LOUA 5AI8A 4AUNA 4M1MA 3H9BA 4JN6B 1YFJA 2HJWA 3U17A 1SCKA 1BCRA 3LC7O 5EJMA 1UPUA 4DUPA 2NPOA 3E70C 4IEIA 4BXOA 4TRRA 3K0AA 2PZ8A 2PE5A 1HKHA 4I55F 1WDMA 1ID8A 2BMJA 3LHKA 2B1QA 4RQUA 2FEOA 5LP6C 4CLRB 2V8OA 1TQ4A 2BHTA 3EGEA 1FFBA 1EX6A 1L5MA 3DOJA 2V7VA 1BE0A 2WBLC 4JD5A 4W5QA 4U2CA 4GZMA 3STVA 4F1KA 1U90A 1N5OX 1O77A 1P0PA 1R4MA 1DAMA 2HF9A 2ATCA 2JGEA 2GZ2A 3I6ZA 4LRXA 3W6OA 3EXIA 3T9EA 4RJIA 2ETXA 3COPA 3IMCA 4O4JF 2PGIA 2W83A 2Z2XA 4F2WA 4I50F 5AW5A 2FCRA 1UOEA 3HFSA 4V0QA 3BEOA 4NBLA 1PZNA 4OIMA 5DNEA 4Y6OA 2FEMA 2COKA 3EBPA 4MVJD 3NM6B 4H77A 4BQQA 3VGPA 4C4AA 4EUEA 1D2AA 4JYPA 3P26A 3R5XA 4IHKA 4XEHA 3FRJA 3OAAD 1MAVA 2Y2UA 5FOVA 1FJGB 2GNPA 1H42A 2YDYA 2ZDGA 5C5DA 3I53A 3O8OB 1P75A 5C1OA 3JZMA 3UMFA 2CL7X 2AOXA 1ZJJA 1ULSA 4IBOA 3UJNA 1E3JA 3OLZA 3O8CA 4BKOA 1DSSG 3ORSA 2H7YA 1ZS9A 2RC5A 3IQHX 2QB5A 3V80A 4B6EA 1T1GA 2AL7A 2QRGA 3OBIA 1JQEA 4V0SA 4B47A 1M1UA 4R31A 4ND7A 3W2HA 3UWDA 4RTRA 4LNUA 3TQFA 1AHHA 4INZA 3KELA 3HCCA 3WWYA 5U4QA 2HCTA 3EVBA 3KWFA 3O2SB 3D0OA 8AT1A 3LPNA 4RU1A 1FSSA 1QHSA 1VCMA 2ZAIA 4LJLA 2TMDA 4R2XA 3WK5A 1BE6A 1ORDA 5E1BA 3SMVA 1NGSA 2OD7A 4X24A 2Y05A 4QUKA 1U3UA 4B6QA 3P8ZA 1B4DA 2HPZA 1WP4A 1DKUA 2AN1A 3UNXA 1BWQA 1VLMA 2ZJFA 1IZ7A 3H1TA 4QZVA 3Q87B 3AUSA 5GINE 3LQ4A 5JRJA 3MELA 3CH7A 3T5BA 4L5AA 2F3QA 4MWDA 5FB3A 2V7BA 3NXKA 4MI9A 5BWOA 2Q3BA 4LXQA 5LMZA 1Z5UA 2XF2A 5H3LA 3RSGA 1NXQA 5IVKA 4Z8XA 3ZJ4A 3O8OA 1FFWA 1SK8A 2QQEA 4F86A 2PMCA 1NC3A 3BE6A 3HFGA 1U9IA 5ALYA 4ZOLA 1G3UA 4QLOA 1POXA 2J6IA 1UT6A 1Y3CE 3L18A 4FGUA 4L3VA 3KEFA 3SAJA 3SKYA 1DQYA 1GKKA 4KE6A 3ZK7A 4PNHA 5DSTA 5AJHA 4GPIB 1PYGA 2BCJQ 2RGAA 5EE5B 3LCRA 5TQVA 2VDWB 3WXBA 2XQKA 3BTSA 1NY6A 1E3TA 1JHPA 2IE0A 2ZK7A 1VJ5A 2DE0X 4GI3A 4J43A 1Q57A 1UZAA 1NXXA 2P4QA 4PZ9A 3HB0A 1VM6A 1AT1A 5CB4F 1OTYA 3H6HA 2BC9A 3AHGA 1D4OA 1UDRA 3FFAA 5T4HA 2H7XA 4RTLA 1IY0A 4PPGA 5EXDA 2RHBA 4OJQA 2C31A 2CDBA 2AZDA 3U60B 4G1FA 2P9QA 3H16A 1KEEB 4BMNA 1R15A 2NV2B 2QKYA 1A5BB 1GLGA 4HDOB 4RVCA 1YS9A 1UBSB 3RC7A 4YRIA 1EX7A 3IUEA 1UPTA 2OB1A 3EVEA 3GRFA 4IYJA 5A1JA 2WFAA 3H9UA 2IL1A 2Q5QA 3V8BA 3QU5A 3M4XA 2OG1A 3WE7A 2VRWA 1HZZA 4QBHA 1XWFA 1M1NB 2Q6IA 5FWDA 4XTCS 3ZH9B 4CLXA 2ZM5A 4E1BA 2JBWA 2PJUA 2QLMA 2WE7A 4MW1A 4XYBA 3Q8LA 3FDJA 1NG1A 3P2YA 1IUPA 2IWRA 1DU4A 1PTJA 4MEBA 5DM70 2FEAA 1PV4A 3W2EA 3FA2A 2Q3FA 5LU8A 1C7ZA 1SQ6A 4M0UA 4G0VA 3S3TA 3QXCA 1T2AA 4BLUA 2FUNB 4BMOB 4BCBA 4RMHA 1XZBA 4QFMA 5H9WA 1EFTA 3ZDDA 1VCHA 2GESA 2JANA 2ZUDA 3K9NA 1LPNA 1QO7A 2VSYA 1NR5A 4UC0A 3X1YA 1E0AA 1O97C 5IS2A 2W8ZA 4YJ2A 2JFXA 1F60A 1YJAA 1U1CA 1T6NA 2P7HA 3F6YA 1EQUA 3QEKA 2VYVD 5GGXA 2VZ0A 3VNUA 2POCA 2K7ZA 1LQUA 3MILA 3R7WB 1V48A 4ZDJA 3KR2A 2C2WA 4Y6LA 2CWDA 4IIDA 4KR6A 5IJ9A 1J5PA 3FSGD 2MYTA 2VWPA 4TUYB 4BPRA 5LQJA 1QHYA 3BE8A 3VKFA 3M0EA 2QSJA 5LJIA 3A4MA 3O93A 3WFZA 1YZNA 4MUFA 1ZK3A 5KI6A 3RIEA 4DCGA 3WQBA 1B26A 3NDPA 4Z9AA 2H65A 3K6RA 4IIBA 2VI5A 4AY5A 3D7KA 3MPOA 3F5QA 3M4ZA 2DFTA 3MGKA 5KWEA 1JECA 4Y2HA 5AVWA 3ONEA 4AY3A 3SBXA 2IYUA 1YIDA 4GO1A 2D2FA 2V6MA 3WWOA 1T5SA 3IR7A 2XMBA 5EKSA 3RVSA 1KAEA 3HCOA 1TZJA 3A10A 3OCWA 5DF1A 2NYRA 1RWOA 1RBMA 1DC8A 3K0FA 3BTOA 1F12A 3T3GA 2A7XA 3GLHB 3FCCA 4MI6A 4FOPA 4YONB 2VDUE 2QG4A 1JEEA 1KK3A 3HO6A 3N3AC 3P9ZA 4FHFA 3P0RA 4Q4HB 4DIUA 5KNBD 4BRWA 3GEBA 1DO8A 2QYTA 3JATB 1C30B 2QZJA 4QOJA 4KK3A 1OLUA 5JSHA 3CH4B 1NQVA 1I33A 4HGQA 5EWLB 1BS2A 1VCNA 3C6KA 3UK7A 2ODWA 1WY5A 3GFTA 3NVMB 1TC1A 3FPKA 3BMNB 1AQYA 2VPPA 3KSDO 1P2SA 1XMXA 3PZBA 2WJVA 3RVQA 4IV8A 5C4MA 2HI0A 2R7LA 1CZHA 4RZQA 4BWFB 4NMWA 3DBRB 1KXJA 5J9FA 5BN4A 4EVSA 3OA0A 1E9SA 1U3TA 3LQFA 1Y8AA 2C97A 3O2NA 4Q1BA 4MW7A 4PO8A 4HXYA 4OM7A 3T06B 5TQ0B 2JASA 2XCTB 3I3SR 4QLBA 1UF9A 3TLGB 1J56A 4EG8A 1RTTA 4PSCA 3L92A 2H1VA 3NBQA 2RH4A 1ESZA 5TF0A 1NBIA 3ZZ0A 1T8RA 1OH5A 2BL4A 1TMYA 2XTJA 4C2TA 3X1DA 1DAEA 5P21A 3LJKA 5EESA 2WWIA 4YT2A 5JS1A 2EGGA 1GNQA 4J94A 4RLSA 5C7IO 2IS1A 1J2EA 3U3XA 4IY1A 1Y1SA 2Q28A 2BFNA 2GYWA 5F1YA 4M8NE 3EUWA 4UEOA 5EERA 1V6AA 3Q2KA 4O1MA 2IGTA 3SC3A 1L5HB 2B30A 3UB4A 3LLVA 5G53C 3VVBA 1ISJA 4PZCA 3R9WA 1FOEB 1QKIA 2ZVJA 3GRAA 3FD8A 4NDNE 5LDGA 5HMMA 3ZQJA 2DFVA 2FWBA 3OHMA 2VKQA 4KUGA 5H5JA 4L9RA 4J2TA 2P40A 3AJ9A 2IEBA 3TW8B 5IM4A 2XIQA 2LKCA 4GMHA 4DQLA 4NV3A 5L4SA 1RWMA 1RFGE 4FFBB 4KI7A 1PEKE 2AG6A 2G6TA 1ZN7A 2CL6X 4ZZ3A 1KEPA 1EWKA 3VU0A 1HPLA 1NJ2A 3PDHA 5EKUA 1E5TA 1DRJA 1DJLA 1V7QA 4LF6B 4YB8A 3DMTC 3SQDA 4BLPA 1Z4QA 4EMSA 5BNTA 3IHLA 4FC7A 3MMSA 1T3HA 4LYEA 5KOHB 4M9UA 1C2TA 1OKKD 4R54A 5GP1A 2YWFA 4A0FA 1RHUA 5BSGA 3DMHA 3MQFA 4UDOA 4XLLA 5HA5A 4B35A 1H0HA 3W5DA 5HG0A 3HMKA 2UYCA 1ZQ1A 3OC6A 3OEYA 3FFWA 5ALSA 4YP5A 3H5OA 3BCUA 2ZYHA 5HKKD 1F6BA 4IF4A 1CQJB 1O94A 1P3Y1 4NCXA 4A6DA 4J91A 3NHFA 1LC3A 4HO1X 4QPPA 4RTJA 1VE5A 3A9SA 5GV7A 4KGVA 1V26A 1JWAB 3FF1A 1THTA 3HZZA 1KOLA 4E7OA 2OM2A 1N5LA 5KNBH 3OP1A 1SFRA 4GW3A 1WP9A 3GRCA 4GVPA 3TW8A 3MAJA 1HQYE 2V4UA 3ZJ5A 1SVUA 2PGXA 3H7IA 3P52A 4O63O 4A03A 2H9IA 3TMYA 1M3SA 2Z04A 3ZNOA 3NO4A 3LOQA 3DT8A 2FKNA 2BM0A 1E9BA 3AFGA 2XNDD 5BN3B 2FPGA 2WM8A 1O7JA 1T5IA 4OVKA 2YNMD 5G1NA 4L02A 2JAQA 3I83A 4D4GA 3JARA 4Y2QA 5K8LA 4CVNA 1WAMA 1LFDB 5LYYA 4M0KA 1W8DA 4YN3A 2W5UA 1NF8A 4TYYA 5K0SA 4B48A 5HHTA 1U8FO 2GPTA 4EHFA 1AIPA 3ECCA 2A5FA 3EASA 4JI2B 1AHNA 1UBHS 2A0XA 4TT8A 1W4BA 2W6CX 4LZAA 2P0EA 5YASA 4QSHA 3USZA 2B92A 4HFMA 4OH1A 3QLUA 4ENVA 4ARUA 1CUVA 1CB7A 4K86A 5NULA 4KOAA 3RU2A 3U3KA 3K6SA 4FU0A 3UXMA 1TCBA 4P32A 4LDZA 2D5CA 2RBGA 1QGUB 5AUNB 3PTAA 3A2LA 5HIKA 4G63A 4AMYA 2I4NA 2NSLA 1YH3A 2FOIA 4X7MA 4B85A 4X63A 2EJUA 3M9WA 1VG1A 3HO1A 4MP8A 4QJ5A 5A4JA 2HSWA 4MWBA 1IZ8A 3SU8A 1Y33E 3GH1A 4BRZA 2HW8A 2C5EA 4E07A 4R7ZA 2Q6LA 3O1LA 3OZXA 4D8WA 1YQ9A 3THOA 1GT6A 1VHLA 3BPSA 4ZI2A 3DLPX 2VHJA 4QGSA 1GPAA 4FFSA 4L95C 2FXIA 1PJAA 4YAJA 4LVOA 2QUJA 1KHHA 3OOEA 4PLPA 2O2GA 3E15A 4GPBA 4UBNA 4JT2A 4DEVA 2ON6A 4OQDA 3HPQA 1WD5A 3JQPA 2WLTA 5T8KA 4EY3A 1XI2A 4CCSA 5JMTA 1EGVB 4KPUA 1K6XA 3HB5X 1FBNA 1E58A 1BMTA 3G2MA 4F93B 3UGQA 3GZ4A 5HKLA 3HXPA 5KUTA 2Q99A 3LYHA 4YJDA 2CBZA 1A3CA 4JYMA 4B3CA 5LIPA 4LJ5A 5TMEA 4Q66C 2MR6A 4AT1A 2ZPAA 3PUHA 3W7BA 4QBGB 1NULA 3OWHA 3IPCA 3PNMA 4YJHB 1BQ3A 3E18A 4DPMA 3I6BA 5IT0A 2O20A 1IB6A 1JG3A 1GEGA 2RBEA 2RGNA 3QEMB 5F1KA 1ADFA 3SHOA 3H2YA 3U4CA 5EJ2A 2QTVA 4U02A 2CJFA 5EJGA 5FHQA 1XMJA 4BL5A 4YP1A 2V5UA 5JNUA 1FRFS 2VRCA 4E70A 3N2GB 1JA0A 4BQFA 3NPAA 3HGTA 1OFTA 5TY0A 2BD0A 4WGFA 2BUBA 3SLRA 4DC0A 4KG7A 1IZYA 2OCLA 4B3IA 2I4TA 3HDQA 5MN5A 2RGDA 4DABA 5IK2D 2MSCB 1NZFA 2B83A 3N6VA 1EFKA 2ZOSA 4RCYA 3OA2A 4G26A 3LDHA 2Z5VA 3HDGA 3ILVA 2XRZA 3QEBZ 3A1UA 2RHJA 1O3YA 2CLEB 3ZXXA 3STWA 2Q3LA 2X8LA 1NONA 5CDFE 5HJ5A 4LQLA 1FSPA 2C2YA 2AVDA 4INAA 3C6QA 2NSDA 4CV0A 1DFIA 1B14A 2BFDB 3TNJA 3PR2B 1KE2A 4LVUA 3O8RA 3DFFA 3I6IA 5EJ7A 3S5UA 5EIBD 2Z95A 2F3UA 4ESVA 6PFKA 4JLVA 3ZLBA 1HL3A 2GZ1A 1I1NA 4PRKA 1NNSA 4C0HA 1FDSA 2GFIA 3UENA 1UC4B 1P72A 1ENZA 1YE5A 3ICPA 4TXMA 5LQNA 3K0SA 1W9HA 2WTAA 1G66A 2OV4A 4W5JA 4I3HA 5JRZA 2IXDA 4S0XA 3VPFA 4AMVA 3IAUA 1L5ZA 1G64A 3AIMA 3KTOA 3QWFA 3H04A 2VTBB 3B20A 2VDOB 4CN9A 4YJ2B 4KODA 4L50A 1V3TA 2DCUA 4IDCA 1BCSB 3FOAA 5ED0A 5EJIA 4KR9A 1J0BA 4DWJA 1P39A 2UUCB 1Q44A 2A2ZA 4D9NA 2WT9A 2Q5IA 3WQRA 4DYVA 2DTXA 3LUCA 1YXMA 2CLKB 2MYNA 4U7GA 1HTTA 3N6RA 1WDLA 1QB7A 1NVKA 2O23A 4CM5A 2NXWA 3ES9A 2PQ2A 4KH1A 3BA1A 1I1OA 3R5SA 1IUOA 3CR8A 4R41A 4FGJA 4NY1A 1Q0QA 1ZMTA 1WVIA 2E7ZA 2OO5C 1UFRA 4J0JA 2C84A 3EAQA 3RRBA 4RWEA 4WW0A 5DXJA 5D3MA 5K3CA 5C3UA 2P0AA 5LZ5A 4DGQA 5J43A 2P5UA 3MRSA 5H1YA 5LP1A 4OAQA 1NVWQ 3OEED 3B6KA 4CCAA 2VPYA 1J24A 1YFKA 3TCXB 1KO5A 3CLSC 3W6NA 3UUEA 3F90A 2F1HA 1EFRA 2GLXA 3BGOS 4FEYA 3S29A 3ADDA 3W3AA 2FHSA 1NVVR 1XZPA 4RDHA 4JYAB 1EE9A 2LR0A 1XKLA 3BSFA 5E4FA 2XODA 2OPBA 1VKJA 2ODAA 3A7DA 1DJPA 3DD5A 3PVZA 2HLDD 2WHEA 2KBEA 4V03A 3DDUA 2R8PA 3ACDA 2RHOA 2XYQA 3WQQA 4DGSA 3L84A 3DV0A 3JYOA 5I45A 2HA2A 3UT5A 1CFJA 1ESCA 2GLUA 1W2HA 2IW3A 3B9RA 4TS3A 5M7EA 2P6RA 4HQFA 2GBLA 1VP3A 3BMXA 2X0FA 2XBMA 3HNOA 4BUZA 4ZVNA 2F64A 3ZD8A 4LUCA 1Q50A 4GOMD 3UO8B 1YZYA 3PEEA 2ZS7A 3PRYA 5C8DA 4K3UA 5AW0A 4OK6A 1WRBA 3OZDA 1E2FA 1H6AA 1UKEA 1XCLA 9ATCA 1O5OA 3OT1A 5AW4A 1B43A 1NMXA 5D3MB 1GKYA 3KZXA 4UUPA 3BC1A 1Z6ZA 4BNYA 3VSCA 1L4BA 1VLQA 4G5HA 3QTTA 1S2MA 2NPFA 2AEMA 4YRTA 3PVCA 3SSAA 2Y0DA 1MOQA 4G1UC 2QMUA 1RVV1 4QBIA 3I4LA 2J3KA 4IF6A 5A3SA 1MDFA 2OXEA 2O8EB 5IWAB 3CC8A 4IX9A 3RYCA 3MHTA 2ICAA 1Q2XA 1Z15A 2GD6A 5TJHA 2WZCA 4L9SA 3QFHA 3KJGA 4HCJA 1M2JA 3FPSA 2YWDA 2YS7A 3U81A 3UMSA 1GT91 5D85A 4M86A 3BXEA 3O5AA 4M54A 3HM2A 4HRXA 4DNPA 1MW9X 2Q6KA 3IQEA 4P98A 1O6ZA 2W0MA 3ZV6A 3FZEA 2IEAA 3IA7A 1CUUA 4IVPA 3T35A 2GO7A 4D02A 4ER6A 5D1NA 1Z28A 2OHJA 3JQAA 3VTKA 4WCFA 1W48A 1LD3A 3P97A 3DE7X 3AJAA 1W36B 4GH5A 1QR2A 1QUFA 2A58A 1BDMA 3DGFC 4OU4A 3QMMA 4RE6A 1S96A 1U8TA 4B4WA 4DY6A 2C7PA 4LF4B 3IP9A 2X2OA 1QLHA 1ONNA 1QFSA 2VT2A 2WJAA 2BHLA 2ODBA 2XNHA 1M6VA 2Q1TA 1JMVA 4FCVA 3ONDA 4R7TA 4XRRA 1Q16A 1JRLA 1G2PA 2I1WA 4OFBA 5ITWA 3LL7A 1Z63A 1M2FA 2R6R1 3M6XA 4O2RA 1LI4A 3MOGA 2GBIA 4YRBA 4DR3B 2GJSA 2YWJA 3LT1A 4RKQA 1XZIA 3M9XA 4UVHA 2CF5A 5ALPA 1WHTA 5ESDA 3DQZA 1AH2A 1T2EA 3D2AA 5KJ1A 4ASUD 1VC2A 1T4DA 2CNOA 3LX8A 2GQ0A 5CK4A 1R0RE 4ESEA 4YCLA 2HUNA 1WSDA 3HA7A 2GHTA 2XVZA 3FYUB 4WIAA 4CEJA 1SZCA 1YQWA 1GG9A 2R1TA 4CKCB 3O03A 1ZH2A 2REXB 2TYSB 3GMTA 5K0TA 4RXUA 5IFKA 1Y81A 2B6HA 1ADYA 2VSNA 3OFVA 4HQOA 4IYRA 2AKYA 2JI9A 3QA3E 1J4AA 1DAGA 3TRDA 2ZRHA 3PUXA 5DH9A 1EK5A 3BIFA 1EUDB 1KH3A 2PDAA 5DGDA 3FXAA 4L73A 4YFYA 1WB6A 4XVCA 1QIFA 4P7KA 1JU9A 2SNIE 2IIBA 2NZYA 1G7RA 1Z4IA 3WGVA 4JI0B 4GSYA 3BK7A 3RC8A 1KK2A 2H17A 2K4MA 3IPAA 1IBLB 4XW2A 4DR1B 1J33A 3MM4A 3AJDA 2O2HA 3PQ2A 4GQAA 1DFHA 1IHXA 1PSZA 2XUFA 3BMNA 4MJ7A 1V5FA 3AK4A 1R0KA 4NK4A 3H1BA 1PDVA 1HLDA 2FG6C 1XDUA 1SZJG 2G9VA 2YCLA 4X94A 1N25A 3SE0A 5BP7A 1M0TA 1PFKA 2J5KA 5HGXA 5JPCA 4TTRA 5AXBA 3N2IA 5B2ZA 5IZCC 3DPIA 1R8QA 3CSUA 3CE9A 5CYPA 1C5KA 2Y1OA 3S2EA 3GP8A 2WJGA 4M8LA 2FUG1 4M7WA 3WK7A 3I62A 1EA5A 3O95A 1K3UB 4MQ4A 1JHQA 5CAEA 3ZDBA 4Z53A 5I4IA 2C83A 3BIJA 5JZBA 2Z5GA 3E7PA 3F3SA 3I6YA 2Z3VA 3AY7A 2PWAA 1U02A 1G6HA 3N70A 3NC4A 4FFNA 4IKPA 3WLJA 3V4RA 4PLTA 2ZB8A 3HXMA 5HF6A 1Q7GA 4DARA 1YJBA 3HE3A 2XEDA 3ZU4A 2P9YA 5A9RA 1XD8A 1V16B 2IK8A 1HE8B 4CCWA 1ZITA 3AY0A 3ESYA 4GZ3A 4EAQA 4GL2A 3A9WA 1TZKA 1RABA 4GMGA 5HZHA 1KGDA 4G5OA 1FZTA 4RMGA 3VO9A 4YS6A 1FDVA 4BPBA 2BMAA 5I7AA 4MDFA 3LGAA 3SK0A 3U3RA 1C8BA 1MFZA 2M1XA 2X8BA 4NYMR 1I9CA 3O91A 4AI6A 1IUKA 2I0FA 3TZBA 2PRJA 3ZPXA 5K3SA 4PBRA 1OXMA 3H83A 1N4AA 4ALKA 4YRZA 3DZCA 4UU8A 1G5QA 1N6LA 1V1RA 2NTEA 3ETLA 3MD0A 2G28A 5E3JA 3T7SA 5I7EA 1GN8A 2PX8A 2ATXA 3GZNB 2ZIUB 3HVIA 4GKVA 2W6QA 4IIYA 3TNFA 4L9AA 1BHO1 2F90A 2Z5LA 5KPJA 4WBSA 5C51B 2I4LA 2Q2WA 3Q4GA 3P9IA 5EKTA 2GM4A 1CEYA 2WM3A 9MHTA 1NSYA 1U6JA 2XCLA 2C7OA 3AI7A 1GCUA 4GRDA 1K06A 2ZI4A 1KZ7B 4MGEA 4OHOA 3GA5A 2QM7A 5AVJA 2HL6A 3RRFA 3KSMA 2GR9A 1S0UA 1VFNA 2AX3A 3BCRA 4Z9BA 2F1JA 1SIWA 1TXGA 1N6RA 1K0FA 4J1SA 4D9GA 1UXJA 3AEKA 1YULA 2B36A 1OTHA 4IPTA 5KVAA 3C4QA 3NTVA 2I9PA 1CQJA 2HJ9A 3FPHA 1NJ6A 4LMAA 4LV6A 4P3PA 4U6SA 3TSOA 4D8UA 5IEJA 3CLRD 3LXUX 4IZHA 5DOVA 1LDGA 4BASA 3UF0A 4EA9A 3B3FA 2NUTB 1TMOA 3C48A 1YVRA 3R41A 1GRQA 3EC1A 1H3FA 5AI5A 1S4QA 3AR5A 4LXIA 3H9CA 4FFRA 3L6BA 2XE4A 2Y4NA 1E6WA 3I9OA 3NBAA 2DCMA 3O74A 4QAJA 3WV4A 3TG2A 1RC0A 2VF8A 3LPMA 3CVYA 2GZ3A 3FMIA 7GPBA 3STUA 4M1WA 2KB0A 5KTSA 2AR7A 1EK6A 4GBGA 5DHAA 1V7PC 2I6GA 3WLPA 2XWPA 4CODB 1C3EA 3ID6C 1BX0A 5HS4A 4JP2A 1ATIA 1WKCA 3UJCA 1AQLA 2H1FA 4XQ0A 1NW8A 2A35A 3B6IA 3K1TA 1IBMB 4WK0B 2I62A 4CM1A 2FZKA 2QP3A 2VAXA 1YR2A 2XOKD 3INRA 1FDOA 2DQYA 3RLIA 1V8PA 4M4SA 3QBVA 4JROA 2P30A 4YCAA 5HBGA 3IBGA 4NBWA 4IP0A 4O08A 1R12A 1T0UA 1E5VA 4MW0A 5IASA 3IDFA 2ZDQA 1Y3FE 2H54A 6GPBA 2O8FA 2BFAA 4MS4B 5G0UA 3WYFA 4ALLA 4CTJA 5D3ZA 1T1IA 2XWBF 3H2KA 3SHVA 1RYHA 3A6ZA 1T91A 2OHVA 4QTYA 5KNBA 1DAFA 1XZHA 4KXWA 2Z6QA 4I8XA 3BWMA 4ZV9A 2JFOA 1J2JA 3QLUC 4E5SA 2X6QA 4NHEA 4XDYA 4IWNA 2AA3A 1M0EA 1C3LA 4QOEA 4J9UE 2QTBA 2IYAA 2OWDA 2R6HA 1TPYA 1VL5A 2I76A 3R4VA 4RLFA 5A62A 2G9NA 1JDUA 1UJ4A 1AK9A 3ORHA 1Z22A 1NVUQ 3CSDA 3FPCA 4UDNA 4XI9A 4JLAA 3S99A 5KYUB 4W5RA 4P08A 1HNNA 1YUMA 4JMLA 1CRZA 4ZOLB 3ELBA 1MJGA 5GY7A 4OXQA 2W71A 5B5SA 1JLLA 3NV7A 3D6HA 3MXTA 3NTRA 5ALUA 4W6QA 1YF3A 4OI2A 3I30X 4TLAA 5KAPA 5BYBA 2PM8A 4K1LA 2ZJ5A 3PGJA 1ILWA 4HNQA 3OIWA 4KYTA 3NWPA 4M1YA 1H4TA 1RJ9A 2XR1A 4FZVA 4JBLA 4E6PA 1Y4UA 2R87A 3CMMA 3UV7A 4WK4B 1E79D 1BJRE 3RUIA 3UMYA 1PR0A 2OFOA 1H0SA 1BVUA 4FWIB 1TQHA 2V58A 4LHEA 1T2UA 4BUCA 2P4UA 3H4IA 2HTEA 3ZJYA 4L5JA 1M6HA 4L4SA 4BBJA 3I1JA 1JKXA 3GAFA 1DGQA 4NARA 5AHWA 1YB4A 2IUUA 2YS6A 3SF8A 1CS0B 1EHCA 1I3LA 3FIJA 3WGYA 5BOVA 1DRUA 1C0PA 4DIEA 2I7DA 3FGZA 3PC7A 2Q9UA 2DPLA 1KQOA 4JLBA 4DHEA 4ARAA 1TUEA 5KTRA 3NS7A 2K2QB 1NBMD 3G88A 4OEHA 5AI6A 2G1UA 5DLDA 1YU6A 2XNJA 2ZTHA 3AIKA 3W05A 3JWHA 4F4JA 5BOSA 5KKAA 2HZ7A 4RULA 3IDSA 1RKQA 2OV2A 2YXEA 3ASUA 2QVCA 3NALA 1CUAA 1JI0A 2PBLA 4RNDB 3TB6A 1SPBS 2YYSA 2CXUA 4AZWA 4QDKA 1FTSA 3OQMA 4LYDA 1UWLA 2C98A 4BEJA 4G6ZA 3MMXA 1BXGB 1XQYA 2B35A 3SFTA 4HLUC 1U3GA 2DYKA 3H2GA 1OWNA 3F5DA 4MUNA 4RPGA 4B6OA 4YCCA 1ZRMA 1Y3DE 1MXHA 2QOEA 4I81A 6ADHA 1H3NA 3FCUB 1ETHA 4YAFA 2B1GA 3RVKA 2C5HA 2O0LA 1U2DC 1SU8A 3OQPA 3VOTA 1DXHA 5B58C 2QAJA 2QRQA 4Q5IA 2IPXA 1T0HB 1TFRA 2Q2OA 1U80A 5I9BA 2G88A 1XXHA 2RAVA 3GMSA 5LB4A 1XA3A 3EWIA 5KTYA 2GKSA 3AW9A 4TTJA 3H18A 3NNNA 4NBNA 2P0YA 2IYXA 2PKWA 4ZODA 1AS2A 2JC3A 1W93A 2X22A 3L8HA 4Y9SA 2EX0A 3RSCA 3QG5A 2D5AA 3WQHA 5H70A 2ECKA 4ZJUA 4OGKA 5LBIA 1OWOA 4BB0A 4AKGA 2B7CA 1DQSA 3QIVA 3D5TA 5CH8A 3SC4A 4HNAA 5ALFA 1T43A 1ZGGA 3AUJB 4EHNA 3VZQA 3AL0C 2J5BA 5FPQA 3W8DA 5JC1A 4H3KB 2GI4A 1EVJA 1OVMA 5B7PA 4RTOA 1W4CA 3L0OA 4W1SA 4QPZA 3CRW1 1GUBA 1F7UA 1Z34A 4KDCA 1KO4A 3EDMA 2IWHA 1E66A 3CT6A 2LCIA 2A3RA 1DS6A 4H7IA 4K1XA 2FFRA 1N77A 4GPD1 4KJXA 1HDEA 1W49A 2HA4A 3AQIA 3QJ5A 5EWLA 5E3IA 1OPRA 5KREA 1KEEA 3E0QA 3GAMA 4HBZA 3V8RA 5L3RA 4YPOA 1E99A 2H1LA 2WTUA 3NDJA 3JAMA 4F3KA 3GT4A 2E4VA 1PZMA 2FPMA 2IPAB 2R7KA 2W6PA 4X5OA 2ZFUA 2ODEA 4ZXFA 4BKRA 5M2QA 3BHNA 3ETEA 1L2TA 1FFCA 1ST3A 4LKRA 4M1KA 3ZWCA 4FEGA 2X15A 1TT7A 4P7JA 1TJNA 1H9AA 4CR8A 4UMEA 3HFRA 2VJNA 2VL7A 1YONA 1TU0A 2PMEA 2CDCA 2A84A 3FOZA 3KEOA 2ZS8A 4UM7A 4JLWA 1KI3A 1KVRA 2PKEA 3OIFA 4NHOA 3E3LA 5KHOC 1XLWA 2VP5A 4URFA 3PLRA 1COZA 1H2BA 3OECA 5FWYA 2GPWA 4CQMA 5DWDA 1YS1X 1KQNA 2BMFA 3CN9A 1A82A 3I9FA 4RXTA 1ODLA 4OX9Y 2I2BA 2NU9A 1JUDA 3KPWA 3MUOA 3W7VA 4BNXA 1WXWA 1XO1A 2Y1DA 4HR7A 4EPXA 2AJDA 2FEPA 1U0RA 4BMZA 4ILEA 5FAKA 2ODPA 2YYZA 1D9XA 1Q1AA 2QMQA 1Q0RA 1UFQA 4ESOA 3G85A 3CRZA 1AZSC 4REQB 1GYPA 4BQOA 1NDHA 1CHNA 1ZI8A 5HCUA 2B7LA 3UATA 3V46A 2GK3A 1DKNA 1M83A 2IZ7A 1N3IA 3GAAA 1YOVA 3C45A 6AT1A 4HDKB 2W22A 4MRSA 3F9RA 2ZT8A 4UFOA 2MMCA 4BX3A 1YZUA 4Y98A 3Q7PA 4BE7B 2OY0A 3RS9A 3DE3X 3WLTA 4XPZA 5JAPA 3M6AA 1T9GS 1RWNA 3C8ZA 1I4DD 3A2MA 4QGHA 4R98A 3VTAA 3EISA 5DHFA 3MK31 3WNZA 1T5BA 2HFJA 4YALA 1OILA 1Q74A 1VKZA 3WBBA 4OF4A 4NI5A 2XKKA 1Y5MA 3NEPX 3DKRA 4W5OA 2AN5A 3DYBA 1KI6B 2G8NA 2HNKA 4J3FA 2OHHA 4O4LB 4Y0NA 4DJEC 1LW6E 1PFYA 4OOEA 3IXQA 2NU9B 4KXQA 2QGFA 3PNQA 3T5AA 1GDTA 3VR5D 4RVGA 3LYLA 2A4KA 5AI0A 4O3MA 4OX9B 3R6TA 2ZBUA 3CRRA 1J1UA 4FJ2A 3I32A 3DC7A 2C88A 2GK4A 3N76A 1J25A 2V7WA 4KWEA 4E51A 5IN5A 2ATVA 2EW8A 1ICIA 4BVGA 3K94A 3WZLA 1IB0A 5AJZA 4CU5A 4U2EA 2B8NA 3KXPA 4F11A 4CIXA 1I7LA 2DWOA 4P4UA 3JQAB 4B3GA 4E21A 1FLDA 1OAOA 2OG2A 3CIFA 3H8JA 2D1SA 1N57A 5LIRA 1XRMA 1S2LA 4AKTA 2FK8A 1PUIA 3ET4A 3QEOA 3GJ8A 3MSXA 1MC4A 1W5BA 1ODFA 4Y9UA 4A91A 1E4EA 3ABQB 3DAOA 4P5DA 1TYCA 2DBQA 3EEIA 4PCLA 2YMPA 4RJJA 4X1KB 3LAWA 2G77B 4REMA 2D0DA 5DT9A 4Y9DA 4QUIA 3BXGA 1WUJS 3QMWA 5K0CA 3HVHA 3DKIA 2YN0A 4KQHA 1RT9A 1VJDA 3A7EA 1G3IA 4WERA 4D0LB 5TPWA 3RJMA 3U1BA 3WTBA 5JXJA 2IE8A 4CEHA 4LJYA 1L5HA 3JAKA 3PDUA 5ALHA 4F97A 3DZIA 1N2CE 1U9JA 1G0NA 5LXTB 3M6MD 2MDTA 3DHEA 3LXMA 3NHWA 4LY9A 4MA5A 3VR6H 4KSYA 2DHCA 3IRUA 4LY3A 3VAAA 4LECA 3U80A 1PJ3A 4K3VA 1PZGA 3L2OB 4HN2A 4ND3A 1SKBA 4JA2A 1X15A 5K0JA 1EHYA 5G4LA 4OK3A 3VR6D 3IBYA 3RVLA 4CM4A 5C52B 1Z6GA 4IDGA 2R6ZA 1AHPA 3UMCA 3ZDEA 1C7RA 3DMDA 5B7QA 2C9DA 2GEBA 4O02B 2QAGB 3EODA 5JZSA 3LQQA 3DDWA 1NXWA 2E1RA 3OQIA 2ENUA 1D2GA 4HDNB 2EGUA 4EBBA 4WBNA 4JI1B 2R4UA 4Y7DA 3AM1A 2J48A 3WB2A 3EN0A 3LWDA 4ALIA 4QUBA 5JJIA 1WCXA 2E4ZA 3EH2A 4NX2A 4QBTA 4Q4AA 4PZAA 2BKVA 4RKRA 1NM5C 1IY2A 2JDID 5L7YA 2RKBA 3JD2A 1U65A 2AFIA 2X0NA 1JHOA 4B3HA 3G23A 2DUJA 3WB1A 2WEKA 2FZWA 2Q6VA 3FLBA 4TL6A 4BBPA 1YDFA 1UFOA 1GPWB 1QIDA 1QZUA 1SUIA 3ND8A 2OOKA 3PF8A 4GIBA 4JL6A 5AHXA 5CIQA 5AM1A 2F17A 1IZ9A 3TUJC 3NYIA 2P9JA 4MWTA 2JNWA 4FHCA 1Z88A 1XLTA 2VDMB 3R0IA 5JLAA 3OT4A 4E7PA 1HDOA 3KWLA 4AECA 1FX0A 1GAXA 3ZQUA 4WUTA 4JDUA 5EMJA 5SZJA 2VP2A 3GO4A 4R8RA 4BRSA 3BXZA 3AV0B 2DBVO 1IY1A 2FMKA 2HO5A 5CHYA 4B5LA 2IY8A 3IVRA 2Q8QA 3CHYA 3EGDA 3KLPX 3ZCXA 1C0LA 4BO4A 4ZMRA 2VWGA 4Y2RA 5KYXA 4ZCTA 4I6EA 4J4HA 1QZXA 1US8B 1YJ5A 4KQKA 4N54A 4X54A 4ZVKA 4BGEA 4LGYA 1XA0A 2CCGA 1Z62A 4GKAA 4EQZA 4J7XA 2J59A 2J3HA 2VTKA 2IZOA 4WXEA 5FYDA 5K0EA 3HBFA 4IIFA 3UW3A 3JVUA 4MR8B 1D0SA 1NMQA 1X94A 4X8MA 2G06A 5IK2A 2QN7A 2E49A 5F2EA 3WDMA 3F4LA 1XNHA 3DWEX 1DWPA 4ZZ2A 1YS6A 3AILA 3PEFA 4QXRA 1ND5A 3PEYA 5IT9A 2ZRIA 3BEDA 4X3OA 1Q22A 1RACA 3YASA 3FE2A 3NVAA 4J07A 3TLAA 1QAMA 1Q7EA 2YV5A 1VG0B 1KIFA 1ZM4A 3H2BA 3P0HA 1IRIA 5AKYA 3EHDA 1KTIA 4JGIA 4JGGA 2BOVA 3L1IA 4OHMA 4M49A 3TVTA 3WOHA 4J1TA 2WY2D 3MTDA 3CF4A 3F96A 1W8IA 4Q3BA 5C7YA 2WDPA 1Y4AE 2PZMA 3OKAA 5C3MA 3ISVA 1X1TA 3AR9A 4DV3B 1E3WB 4CI0B 1AGYA 3CUKA 3EIHA 3ZE2B 1VIAA 3HBJA 3DQPA 1BRMA 2N46A 4CT0A 3G9QA 3NXSA 4MNTA 5CYFA 4DIMA 5CDTA 4NZOA 1IN4A 1ISMA 2YVUA 1SBHA 3R24A 2X0IA 1E0DA 1IAQA 3VV2A 1MB0A 5E8JA 1TD9A 3WYGA 4UNIA 4JLJA 3BDIA 5JH7F 4ZYXA 2VHXA 3LKVA 5TNXA 3I73A 5DMHA 2Y76A 4EHKA 5JVDB 3TPZA 3BWXA 2BEWB 2WAMA 4NZNA 4O4LF 1G8SA 3W2TA 4E4YA 1ANKA 5CX1A 4AMZA 3N8HA 1KR5A 5H68A 5LJLA 1FP4A 3I9KA 3NKFA 3P2EA 1NX9A 2ZT7A 4YT8A 1G4UR 1N5JA 4E2ZA 2ADOA 3VR2A 2QR2A 3GLUA 5BV8A 7YASA 3AV3A 1OAOC 5GMOA 1X7WB 1AUVA 3QVMA 1N6NA 5C1IA 5J40A 1UDXA 4H7EA 2QEQA 5ALWA 3A8TA 1NFRA 5G02A 1THMA 2AG0A 4EB8A 3H2SA 4H7JA 4JI4B 3DT6A 5A4AA 4DLLA 3RHTA 2PUBA 1T9ZA 2QUAA 4R0NA 4A8JB 1F51E 5FEUA 5J4HA 3M6IA 3TLBA 3LYAA 1W4RA 3EXIB 1YR9A 4NCJA 5E9AA 3EPJA 5H8WA 2O5RA 1RM3A 1USIA 3RS5A 1PGJA 4Q9LA 3B6JA 5ABPA 1OYYA 4TV9B 4YREA 1ZUWA 2O9JA 5CU7A 4ZVRA 4EF6A 4YAKA 4G5YA 1WQ4A 1NVEA 2VDNB 2ZIFA 2BVNA 3LX5A 4I8DA 4XWWA 1DADA 2IEZA 3FHCB 1YZVA 1EJBA 2F4VB 3OTIA 4OFZA 4YXFA 5K9ZA 1FU4A 5AUQA 2RK6A 1GU0A 1AA9A 3TAUA 621PA 3ELYA 4EHAA 4BQNA 5KYKA 4I9UA 4RA9A 5DTQA 1MEJA 4L4ZA 1U7OA 5HIJA 5DNUA 3RYIB 2IEDA 2QK4A 4LX0A 3JQ7A 4XUDA 1NJ1A 1SCAA 3V8PA 5DASA 3GMIA 3TLKA 2BE7A 1ODTC 2VNKA 4N8EA 1L7EA 1Y3HA 4TLCA 3GYBA 2F48A 2O3QA 4BAGA 3UUWA 1OHHA 8ADHA 1H1DA 5HFAA 1A72A 1QRTA 3L6DA 1P80A 3ETJA 1I4OA 3HP1A 2IP2A 1WV0A 1ZAYA 1DQPA 1G42A 1XEXB 1JLKA 3VPGA 5IYZF 1Q1NA 3FAZA 2ECPA 3UWMA 1ZCBA 4UATA 2Y99A 5CW1A 4OBXA 1GOTA 1M7HA 4GEKA 2PUHA 3GRZA 4QTUB 5HKKA 4G5RA 3BFKA 4XX0B 3SZ3A 4CMJA 2JK1A 1LS6A 4EEKA 3HR4A 1YA8A 2G4VA 2HA6A 2HSZA 4XJXA 1ABFA 2XITA 1FPMA 2C2HA 5DHSA 3HM9A 4KHZA 3FM9A 4XM0A 3WGNA 3SI7A 3T1NA 1PL0A 4ZAGA 2YV1A 3A1NA 3WLRA 2JAXA 4E5VA 2WYHA 4TLBA 4NJOA 2PH3A 3AY3A 5BOSB 3VNBA 1Z56C 5BN1A 4DCPA 3MJRA 1NZDA 4WGGA 3BILA 1Q95A 4BWVA 1MEEA 1MO3A 2O06A 2OPHA 1XK6A 2KPOA 2W11A 1HWYA 3L8GA 4I1SA 1TM4E 1UDCA 3VZSA 4O4JA 3OZSA 3FLEA 1SEPA 2PD3A 2ZRFA 3K0KA 3V4FA 5FL7D 4MIYA 1TCUA 5DWVA 2ZBEA 4NYMQ 2XI4A 3MWDB 3EIOA 2LKDA 5C34B 2FDXA 2ACVA 5C35A 1QH1B 2GKGA 2YICA 3DGEC 3VHXB 4LGMA 4B9AA 2PH7A 1HXHA 2VUHB 2EBHX 4F4IA 2EFCB 3WLAA 4KK4A 5BSUA 3FN4A 3RB8A 1CR0A 1G21B 2FZ5A 2AYZA 3OURA 4W5WA 1L5VA 1KAGA 1GPJA 3GLQA 3T52A 4LF8B 1CVLA 1RXCA 4HKTA 5A9TA 5LQKA 4RV9A 3TDNA 3DKVA 5CBKA 2VPWA 3G8YA 3A1FA 1JFSA 1BEEA 3AI1A 3MRVA 3IJPA 2GM3A 1XPRA 1ES9A 3GPDG 4FGKA 1WOYA 2OZVA 4K6FA 5BRNA 3CR7A 4LRQA 4QYMA 3WKBA 3CX3A 4NOKA 2CD7A 4KQIA 3JQ9C 1WMAA 3TG8A 2DT5A 3AFIA 5AXDA 2GZDA 3QJYA 3V6LA 1SA0B 1X19A 4DBLC 4IFEA 5I7RA 4PLFA 4R05A 3SFZA 1TYEB 3WDKA 1J0EA 2HBQA 1QHFA 2V6BA 1EEHA 2X58A 3KZMA 5E9JA 3TB4A 1RJDA 1OBHA 2PUFA 3EXHA 2HU2A 3IAHA 3LLCA 4L2IA 3OCYA 5I51A 1B42A 1EP9A 1K6MA 1A2BA 4U2DA 2PUCA 1WPQA 5A9SA 4QFDA 1E9VA 4QXAA 4RABA 4OQYA 2P11A 5E1DA 2G04A 1SQGA 2OOSA 1OH6A 4I1PA 1LZKA 2BGIA 1GZDA 3TOSA 1P5FA 4QDZA 5HSGA 5K99A 2XB2A 1I7NA 4YQEA 1M0WA 3DWGA 3DMRA 1B8PA 3B7PA 1IXSB 1PQWA 3PPWA 1Y3AA 3BH7A 4D9EA 1UPFA 2QRHA 4EMBA 1JILA 3MF4A 2V6FA 4XWGA 1ECPA 1YFZA 4BDTA 4RH0A 2VBFA 4TLMB 1I94B 1ZGCA 3LO8A 3G5TA 3H0EA 1V5GA 1KARA 4NCKA 1XC7A 3UYKA 4DKJA 1L8AA 3X1JA 2FI1A 4YFVA 1ODJA 3NW9A 4N6OA 2QY9A 3E58A 1LUAA 3K92A 4TVSA 4G81A 3L4SO 1U0BB 1H4VB 2ZBVA 3GJXC 5H16A 4QIHA 2WHQA 1ESDA 4KR7A 3O9VA 2BLNA 5TE9A 2JLQA 3HN6A 2XAUA 4EKNB 1A9OA 4UMVA 3EC2A 2NU7B 4IWXA 1PDOA 2HEGA 5P8WA 3PE4A 1RZ3A 1P7CA 2QYSA 4AUEA 3PNLA 4KE8A 1NLUA 3KZVA 4D26A 2YASA 4RKWA 3IBSA 2ZZMA 1IN7A 4X6XA 3KYDB 3ZWWA 4DJDC 1FMJA 2ORYA 2WHYA 4M53A 1Q6YA 5C8XA 2C99A 5AKKA 1RHRA 2QX9A 4L7QA 3RG8A 3ZHQA 4EH1A 1TYDE 4NBVA 4XM2A 1F3LA 4RGBA 3KJEA 2JFBA 1PD1A 4RH3A 4B32A 1VHWA 5LN1A 3NV9A 4QFBA 1ZX1A 2FPPA 2L2QA 3FNIA 3PUKA 2P35A 3WTCA 1D6JA 1S6YA 3MPUA 3UJPA 1L5SA 3HL0A 3UG7A 4NIMA 3UC5A 5C1PA 1P4HA 2L19A 1VE3A 1GAEO 5HX7A 1I6MA 2DLDA 2N47A 4LYYA 4PONA 4EJ0A 4Q3OA 4B3BA 4F5WA 2A0YA 1LLCA 1FBTA 3MWJA 1KIMA 1N0WA 2VBIA 3LRTA 4I5GA 4W8GA 1ODKA 2WD9A 4ZCIA 4QBFA 5K8JB 4BO6A 4JLKA 3OSUA 3Q7TA 4UKDA 5J2TF 3X1XA 2JIOA 2HYDA 3CUYA 4NYIQ 2B2NA 5G41A 2PV7A 3DNFA 1GRCA 3HJNA 4HPJB 4JOBA 2Y1XA 5LBTA 1ZL2A 4UD6A 1NOJA 3HEBA 4MR8A 1FUUA 2FPIB 4OAPA 1D03A 3TZ6A 4NZYA 1OXKB 2PKQO 3OESA 1IY8A 3I01M 2G1PA 3L8EA 2J32A 3UAOA 4J90A 1ZGBA 3ZWAA 4PNPA 3TGPA 1IN5A 5FX2A 2BE9A 1N2JA 4XTRA 3VC3A 1J9EA 3L1VA 3O8LA 4GOJA 4K8OA 4ALNA 4BU0A 3LP6A 2WSLA 2IHKA 4KX5A 3DBOB 3VNSA 3KHKA 3MEQA 1Z7YA 3ZY6A 2W2XA 1QUEA 4IIXA 4CLRA 3WL5A 1FTNA 1O9GA 3DYIA 4GI7A 3KDSE 4O2AB 4P4GA 5BUQA 1P4GA 3G2HA 4DJAA 1OB5A 2NAPA 4IJ5A 4HQNA 4HJXA 5ERGB 2D1TA 5BSMA 5AW3A 2CNKA 3OTWA 4JEMA 3PFIA 5HKAA 4MV8A 2ZR0A 1GCIA 1ODIA 3PD7A 3N28A 5AXCA 1B16A 4BLRA 4EGSA 4KQXA 4ENSA 3EXHC 3IEUA 3IILA 3TLMA 4EI9A 4PAOA 1ZBQA 1T6BY 4HRYA 4JVLA 3GFVA 2IPLA 4OHXA 3L02A 2AOWA 2HXSA 1Y9DA 4PS0A 1XTBA 4N7MA 1NE2A 5JE8A 5KDOA 1A88A 1OROA 4TKMA 3THXB 1BVYF 2WV9A 1IEVA 3OHPA 2ZR7A 4JBHA 4TS4A 3RFUA 3ZDCA 4N48A 5EE3A 1JTFA 1RLTA 3KQVA 3SYMA 1ZZGA 1AKRA 4WINA 2DG2A 4DT1A 2G71A 3GLRA 3DEHA 1HURA 3B53X 3WGKA 4ZAWA 5I4CA 4NBTA 2ZANA 4BNDA 3O83A 3VSAA 2QLFA 4RZHA 2V7XA 2WWXA 4MQEA 4Q4AB 4JX8A 3UHFA 2PBRA 5EP1A 3A36A 5CVJA 1EWTA 1CZNA 2DWQA 3D5QA 3E7FA 3VHLB 4ZPJA 5CM9C 1NOIA 3QBEA 4CM7A 4LZPA 4TS9A 3DMFA 3IEMA 4ZCPA 4ZAZA 4QXPA 2GEJA 2VQDA 4UBIA 3TS1A 4UEJA 1PS8A 1X77A 2G0TA 3G82C 2YZMA 1FX1A 4LKOA 2ZJ4A 4UPDA 3QX3A 4UVIA 3VV3A 5DBFA 1KIAA 2OE2A 1I2CA 1TB4A 3TQCA 4C4YA 5B2EA 3PRHA 1WXEA 1UOPA 1C8VB 4KO3S 2HA0A 3WDSA 3WWDA 1ZUHA 3VR1A 4DIKA 4KWTA 4DG8A 4DCUA 2Z98A 4PXAA 4PR0A 2OR3A 3GFQA 4QPDA 4YAIA 4EELA 4P58A 1MGPA 1T9AA 3WLHA 2I65A 5FL7A 5ADVA 2H8KA 3BB4A 4U2GA 2QVGA 2PTHA 5EAIA 1I24A 3H8WA 3DONA 1SUEA 2OV3A 2GAFA 1R9JA 4MHSA 2X0JA 4DT1B 1QGOA 3CRVA 4O8CA 2JH9A 2Q2QA 3LTEA 2WYUA 4QUAA 2IELA 5ECWA 3UJ9A 4CV2A 1UZNA 4OQEA 1TW3A 2I2CA 3C5WP 3UFXA 1B8OA 3SR0A 1YQXA 1J22A 3F4BA 5JYDA 1J5XA 4ZREA 5BQXA 2P68A 4YRLA 5HVNA 3GJ4A 3T7CA 5CB8A 4HB0A 1TEXA 2ES4A 3NTXA 3R0ZA 4PF1A 2I3DA 1E2MA 1KO8A 3OPMA 3UQZA 3CLSD 4MUHA 1WG8A 3W5UA 5HIIA 1GPYA 1JSZA 3SIWA 1KVQA 2GD1O 2YJ3A 4UOZA 1NPTO 1AN0A 2D3TA 2MR5A 3EZFA 1J1ZA 3KB1A 2R85A 4YCJA 4EDFA 5LZ2A 3K8OE 3OE1A 2IX3A 3NX4A 3Q15C 3KQWA 4LC0A 3G0HA 3EZNA 5FO0A 3RFXA 4BV2A 4H7PA 3UMBA 2OC4A 1U8UA 1WO8A 5L9AA 2D74A 4D9CA 2RBKA 1JBEA 1JVSA 4FMCB 4NAHA 4BKPA 3MWKA 4OKSA 3AHCA 4UTPA 4QRDA 3UGTA 3PHBE 4E88A 4XDZA 2R6FA 1OHHD 4FMDB 1ZI9A 2D4AA 3A4IA 3MJTA 4IUBS 4ZYZA 2QXTA 4WN9A 4P4NA 4F2GA 2GEDA 2IHJA 3C97A 1J97A 4UHCA 5LM3A 4F3TA 2QMYA 1HEYA 3OFNA 3KR1A 3RVNA 1GUYA 1IXYA 1J6UA 4YIHA 3NEJA 2P5SA 3DVSX 2EFJA 1L5NA 2A92A 4C3ZA 3MJHA 3HZOA 3F5MA 2H5LA 2J3EA 3HWX1 2VWHA 1VHJA 1KKMA 4HLNA 4N5DA 5BQPA 3SYRA 3HB7A 1K2VN 2PS1A 3BORA 3MC1A 1SIUA 2NSHA 2PCLA 5TXGA 4EHJA 3NWJA 2I2DA 1BEZA 5G3YA 1T4CA 4TM7A 5IMBA 1GV0A 4XOUA 3B60A 2ZULA 2AVNA 4YMHA 5JJ5A 5DIFA 3RKRA 1JEOA 1TKAA 2W43A 4IWYA 4V38A 1AY0A 2IYPA 1P44A 2XTZA 1M7BA 1XTUA 3DXYA 3MBOA 3S2YA 3WA6A 4DDHA 2D06A 3ER9A 3R9IA 3PRKE 1NXVA 1PLLA 4ZGGA 2DXIA 1RM5A 1VB5A 3W6PA 4YR9A 1JKIA 3GG9A 3ENVA 3JYNA 3PUZA 3ZHYA 4D57A 3VMMA 4D9KA 3ZX5A 1NC1A 1O03A 1CF4A 3OE4A 1M2VB 3TZLA 3EMVA 4S1VA 4YMWA 4XDGA 3L79A 1IZZA 3AONB 1IFXA 3GDHA 1CP3A 4Z4FA 4J7CA 1R0LA 5IRCD 1ZD9A 3DFIA 3NGXA 3ZVLA 1K7CA 3DFMA 1QSGA 3ITDA 1BQ4A 1DMRA 1G5HA 1X39A 5T41A 4NR0A 1MR3F 1PTKA 1Z6TA 4PY2A 4QO7A 2C4VA 1KOGA 3GD5A 6Q21A 4TSRA 5KTKA 4XJVA 2AJ8A 1QGAA 2VH1A 3HJCA 4N3CA 1MMFB 2VK1A 3BSWA 3VM6A 1RQGA 5EPUA 2Z9DA 2EWWA 4LJ8A 3QSGA 1I80A 1VL2A 3F5SA 4BP9A 5KWVA 1TJ4A 4Z3KA 5BORA 5FI0B 1TAUA 3S6JA 2CLIB 5EG5A 3UJ6A 4C7MA 3ORRA 2CUKA 2DUUA 2WFLA 3QVUA 4OFXA 3NYWA 3I9NA 3TSCA 3A1DA 3VJKA 4MQLA 4KFRA 2Q7OE 4KMSA 1G3RA 3BD7A 1XZJA 4HEA1 1IXKA 4RK7A 1C1HA 3EMDA 3HCPA 5UKDA 4DQDA 3EXEB 3HH8A 2QLNA 2VYCA 1BWSA 1YOVB 1Z9BA 2QI9F 2QG9A 1CK4A 4PTYA 1NXPA 3V3TA 3NLLA 8OHMA 4AY6A 1QHHB 3LBYA 2G9RA 2J46A 2MIIA 3QQPA 4V24A 5C8YF 5A7FA 2IKQA 1ZMOA 4FS3A 1DBRA 4LF7B 1FF9A 1KZ6A 3D0KA 4PO1A 1SD2A 2X3YA 1E6EA 3JSXA 3IE2A 2X9NA 4FZ3A 3MJSA 4LSGA 4FONA 1GFSA 4ZKDA 5AM3A 4YQYA 3DAYA 2ZRLA 2ZSFA 3HVRA 2VYFA 2C7BA 1R6DA 1U0OC 2O0JA 4LJKA 4C7KA 3T1VA 5HRAA 4O2BB 3UBMA 2H7CA