1LJUA

X-ray structure of c15a arsenate reductase from pi258 complexed with arsenite
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
131
structure length
130
Chain Sequence
b'MDKKTIYFITGNSARSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDADNNCPILPPNVKKEHWGFDDPAGKEWSEFQRVRDEIKLAIEKFKLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords arsenate reductase
publication title All intermediates of the arsenate reductase mechanism, including an intramolecular dynamic disulfide cascade.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
total genus 47
structure length 130
sequence length 131
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2002-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ljuA00
4IILA 2JRLA 1MB0A 3HUUA 2IOYA 6ABPA 1PEYA 4MQEA 5E3JA 4RSMA 2FMIA 3N6VA 2MYUA 4N0PA 2WJWA 3MF4A 2FQWA 3JTEA 1LBHA 5B3JC 3OLWA 2YHBA 4RXMA 1WETA 1DCKA 4QICA 1VPWA 1M5UA 3A0UA 3OQNA 8ABPA 2NT3A 3EQ2A 3JVIA 1JLKA 1JDNA 2HQBA 4W5RA 1ZGZA 1P6UA 3CU5A 3I5AA 5KQMA 2Q5CA 2GI4A 3OLYA 1ZN2A 2XDYA 3NNNA 1QQAA 1JX6A 2HPHA 3DLBA 4KQCA 3MM4A 3RVSA 1ISRA 5JNTA 3I09A 3H5WA 4WWHA 3HSYA 1RNLA 2FN8A 3H5OA 3OLXA 3Q41A 4Z4GA 3T8YA 4NQRA 4ZJPA 4MS4A 4MYRA 1T34A 4RS3A 2FSPA 1DP4A 3JS5A 2WWVD 2PUCA 2GKGA 2MSWA 2N9UA 3JY6A 1D4ZA 5ED4A 3CKMA 3LUAA 3SM9A 5KC9A 3BRSA 4LRQA 1PHRA 1USGA 1DCMA 1KGSA 2HSGA 1EAYA 4HNRA 3F7NA 1Z13A 2PUBA 4IF4A 3HZHA 3MMNA 3Q7RA 4DQDA 4RKQA 4RK6A 1KRWA 4F06A 4ZPJA 2P9HA 2F8SA 2WMYA 2IDMA 5BRAA 3G85A 3P9YA 5KC8A 3ILYA 3O2SB 2LP4Y 1BDIA 2L2QA 3KJXA 3H5TA 3HDVA 3K9CA 3KSMA 4W5TA 3CRNA 3DBIA 4D6YA 1DBPA 1F51E 1RPJA 3OM1A 1QP7A 1U8TA 1Y1LA 2IPNA 3HV2A 5FBHA 2QSJA 3T6KA 1MIHA 4UHJA 3Q7TA 4F8JA 1L5ZA 2P4UA 1FQWA 4XASA 2CHEA 2PUEA 7ABPA 3O1JC 3CZ5A 3IP6A 3C3MA 1SXHA 3O75A 5TE9A 1JF8A 4H3KB 1RZRA 1ZAYA 1BVHA 4FE7A 1KMIY 3SNKA 1QMPA 3UKJA 5I4CA 1EWTA 4KRFA 2DRIA 2WJAA 4Q7EA 3DLHA 1YVUA 4RK5A 3RH0A 3Q15C 1F4VA 2H3HA 2VYCA 4MAAA 1QQBA 3QX8A 2FLWA 4RXUA 3OO0A 1C0EA 2JVKA 3RVLA 5IULC 2PUGA 1HEYA 1Z15A 2JK1A 3BILA 2O20A 3D02A 4IGAA 4OTZA 3O74A 1SXIA 2WY2D 1Z2EA 3LTEA 5ABPA 1YTUA 1GUDA 3EJWA 1ZH2A 4EYKA 1VKRA 5JNWA 3F73A 2LUOA 2A9RA 3M9WA 4CBVA 4YO7A 3C97A 5TQ2B 3LUCA 5IX8A 3OQMA 3HDGA 1JL3A 4JP1A 1W25A 1YMVA 1TJYA 3EDCA 1AB5A 4LZLA 1DRKA 5C5CA 4N41A 2JVIA 2FEPA 3QEMB 3KYIB 1QO0D 4UHKA 3KLNA 4OLAA 4NV3A 3TMYA 1NTRA 3LUFA 4RK1A 3GRCA 4EY3A 1DC7A 4XFKA 1USKA 2VK2A 3HJFA 3HUTA 3OLVA 3UUGA 4PICA 3JPYA 4KZKA 3CHYA 4N0QA 3RVNA 1ZY2A 1JFSA 2PUFA 1ZESA 4Z4CA 4Z99A 2NUBA 1NXPA 4MS4B 2FW0A 3LUJA 3QLTA 4EYGA 3O2JA 1BDJA 2QR3A 4YWHA 1CEYA 4PEVA 5IEBA 4TLMB 3A0RB 4G0YA 1U2QA 3KHTA 2GWRA 3N75A 3A10A 1DRJA 3N8IA 3T38A 2R25B 2YHAA 5EWLB 4ETNA 2A9OA 4KMRA 3NNSA 3LMKA 5HKOA 4Z4IA 3I42A 2ID7A 3I45A 3CZCA 4MLDA 3H5IA 4OG2A 1QKKA 1LJLA 1K68A 3FFWA 3M9XA 4M88A 3QLUA 4D74A 2FEKA 3GL9A 3QK7A 4LDZA 4W5NA 2OENG 5TQ2A 1NXVA 1U0SY 1YK0A 1Z16A 1YMUA 1Z26A 3K4HA 1DZ3A 3DGEC 2JB9A 4LX8A 1OXKB 5FBKA 3L49A 3QX9A 2RDMA 1YS6A 2PMCA 1C4WA 4EVQA 3QEMA 5HM6A 2PE5A 4Z4EA 3A3KA 3RVOA 3NBMA 1A0OA 1RXEA 3IDOA 5IEJA 1BDHA 1PNRA 4G97A 4RY0A 4TN5A 1GCGA 3TX6A 1YS7A 3EODA 4JOQA 4S04A 4RXTA 4NCBA 3GYBA 4RWEA 1Z17A 1DBQA 1TMYA 1L5YA 3D8UA 5DCLA 1DJMA 3H6HA 1Z2DA 4MS1B 2A9PA 5EWLA 2M98A 2CWDA 5TPWB 2TMYA 3S99A 3SQNA 3C3WA 3Q9SA 3RVMA 4KVFA 1NATA 1LK0A 2V0NA 3KG2A 2H0AA 4YGXB 2PAFA 3EGCA 2LBPA 1JFVA 1EWKA 5KQLA 4ML3A 2NZVG 4RDCA 1SD5A 3CS3A 3RVJA 1MVOA 3LOPA 3OLZA 4MGEA 4N76A 1NXSA 2CD7A 5TQJA 4EGSA 1DCFA 3O21A 4PE5B 4Z4HA 3GBVA 4KK3A 1ISSA 1M2EA 4YLEA 1JYEA 2FLKA 4H3HB 1APBA 2W42A 4KFCA 3N53A 2I6FA 4GPAA 5D2CA 1QO0A 4Z0NA 1JBEA 4ETMA 1GUBA 4LDAA 1K66A 4L85A 4G0QA 5F64A 2B4AA 1YK1A 3EAFA 4JB2A 1QP4A 2R47A 2OQRA 3MQ4A 3HS3A 4WT7A 6CHYA 5HQJA 3H5VA 3N0RA 3TO5A 1AB6A 1Z18A 2HQOA 1E6KA 2PLNA 3H1EA 2E4ZA 3NNDA 5DTEA 4ZMSA 1LBIA 3IP7A 4MS1A 4RK4A 1J56A 5T7BA 3EQZA 5TPWA 4JAVC 3URMA 3H1GA 2JCGA 1U2PA 1USIA 3HVRA 3QEKA 2FXIA 3FGZA 4EYQA 2ZAYA 1E2BA 4LE1A 5JNRA 4PYRA 5CNJA 2E4UA 3KS9A 2L17A 4TMYA 2MYNA 3Q7SA 3M6MD 1GCAA 3LUDA 4G0XA 3O2QB 4JASB 3CNBA 4G86A 4E7PA 4HNSA 1QNLA 1CYEA 5EWMB 2KYRA 3HXMA 1JYFA 1ZVVA 3ILHA 1FFSA 3E3MA 3GT7A 3NHMA 1M2FA 4WUTA 2RGYA 4OBBA 4ETIA 4Z9BA 1KRXA 4YRZA 2A9QA 2R48A 4MRMB 4OATA 4QYMA 1SXGA 1P8AA 1D1PA 4G0ZA 2HQRA 3GV0A 2IKSA 1NXOA 3DZDA 2R4QA 3MA0A 5EWJA 4GNRA 4ZMRA 1GLGA 2FMHA 3RVPA 1FSPA 3QLUC 4WXMA 5KI6A 4N47A 2AYXA 3BBLA 4MPTA 4LE0A 4P98A 4QPJC 2IPLA 3OO1A 4KNYA 4S05A 1QP0A 1E6LA 1UDRA 4G0PA 5BQ3A 2F8TA 1QPZA 5PNTA 3JVDA 4TLLB 3TB6A 2J48A 2PL1A 5IUJC 2RJNA 3ROTA 4XLTA 2LIVA 4KQ9A 4F12A 2GX6A 1RZRD 4FE4A 3CTPA 3KTOA 3HM9A 3QLVC 1TLFA 1ZHHA 3GA5A 4ZYLA 2QVCA 3FFTA 3LKBA 4W5OA 1FFGA 2PUAA 4IMJB 4MQFB 3EULA 4O1IA 5TPZD 4F11A 4H60A 1VLZA 4YS6A 1PUXA 5EWMA 3C6QA 5IBQA 2PKXA 3OM0A 2WB4A 3HEBA 4WXEA 5HSGA 1CHNA 3QLVA 2PUDA 1OXBB 2FN9A 3HO1A 4MS3B 3T95A 5BR1A 2JBAB 4F3TA 1ZITA 3HK2A 3IP9A 1NXTA 4MR9B 1H9CA 1ZGGA 4MRMA 3OMXA 5DGCA 1JDPA 4JA2A 5FWXA 4D6XA 3FMVA 2MSLA 5B3JA 1I3CA 1W9HA 2RJOA 4QYWA 4XAQA 3IPCA 3ROFA 1JH9A 2FTKE 3N0WA 2VUIB 2FMKA 1EWVA 4RZSA 2X7XA 5KQPA 3NHZA 3RVRA 4LE2A 3N0XA 3CFYA 5DLEA 4Z4FA 2L19A 4E7OA 2QXYA 4G0OA 2BGGA 1NXXA 3H5LA 3LUHA 9ABPA 2QV0A 1PEAA 2NZUG 2ZWMA 1P6QA 1Z25A 1TM2A 2E4WA 3LFTA 4WZZA 4XARA 2WRZA 3CLKA 5CNKA 1PNTA 2E4VA 4RV5A 5FWYB 1S8NA 4MQFA 2IPMA 2E4XA 4HYEA 4MR7B 5KWSA 3QELB 2LPMA 4DN6A 2FQXA 4N03A 1ABFA 3JPWA 5JS2A 3VNBA 3FFXA 4YV7A 4OLBA 4NCAA 5JS1A 3MIZA 4O1HA 4Y9TA 4MS3A 1B00A 2FEWB 3MYYA 2JBAA 3CG4A 3L6UA 3RVKA 2QW1A 4EVRA 4MR9A 4RU1A 3UK0A 3KYJB 1ZDMA 4NICA 1JWLA 4RY9A 4EVSA 5T3YA 4KV7A 4B09A 5EWJB 1Z12A 5TQ0B 1EHCA 4RK7A 1XHFA 1DG9A 3IP5A 1P2FA 3OMWA 3B2NA 4W5QA 2MSKA 5IC5A 5BRJA 1D1QA 1TVMA 3LUGA 3CG0A 5IUNC 1D5WA 2GBPA 4MLCA 3KLOA 1M5TA 3R0JA 2QVGA 2FMFA 2PL9A 3RQIA 4MR8B 1NXWA 5CHYA 4KREA 1U04A 4HNQA 1E6MA 1YIOA 2QZJA 3O1IC 3SAJA 4KPYA 1ABEA 2B1JA 2L18A 4DADA 1D2AA 2VUHB 5FWYA 1SRRA 5DKFA 2PJUA 5C5EA 5TPZA 4MR7A 3G1WA 3VNAA 3F6PA 3QELA 1LJUA 1URPA 3LUKA 5CNMA 4MQEB 5GQSA 4YCSA 4P1ZA 3SG0A 1BAPA 2FKAA 3H1FA 4O5AA 1VRVA 3GWGA 4EYOA 4XXHA 2HJ9A 3KCNA 1BA2A 3SY8A 2IPAB 1EFAA 2E4YA 5JNVA 4Q6WA 5GOTA 4RY8A 3BREA 1NY5A 3BRQA 3IPAA 1JHZA 4Z9AA 3RVQA 2FVYA 5FWXB 4L4UA 4RKRA 1A04A 5KQGA 1RXIA 3HCWA 5TQ0A 1ZH4A 4FB4A 5JNSA 4IMIB 1A2OA 3FDFA 3H75A 3O1HB 1JFTA 1XWWA 4G0MA 3DGFC 4EUKA 3OQOA 1IIBA 2NT4A 4JB0A 3GBPA 3E61A 5CNIA 3TD9A 2QU7A 2ID9A 3F6CA 2IYNA 3LKVA 2FQYA 5JNUA 3KKEA 2AYZA 1R8JA 2MYTA 4Q6BA 4KK4A 4YR7A 4RK0A 4MR8A 2CHFA 2MYPA 1MB3A 4PZ0A 1FFWA 3H6GA 4IRXA 3C3KA 1MAVA 1DBWA 3W9SA 1DC8A 5IUKC 2JVJA 1XHEA 4YP9A 2M1ZA
chains in the Genus database with same CATH superfamily
4C4PA 2VG8A 3URKA 1U3FA 1LSUA 4HG2A 4WXRA 5FUBA 3EIHA 1TVKA 3AHFA 4G41A 4CCWA 2XT6A 4UNQA 1O4VA 3PA6A 4NG5A 5EP1A 2JLVA 2WJWA 1K0UA 1DCKA 1DINA 3HEMA 4POOA 3DAFA 4BGVA 5A9SA 1P9LA 3HYRA 4LTDA 1POXA 4IYRA 5F51A 5LQRA 3EQ2A 4RCVA 1WULS 1ENYA 1CJUC 3O2NA 1JDNA 3BWYA 1CUAA 4J7AA 1GPUA 2Q5CA 2IYFA 3IO5A 5H1YA 3OFVA 2GI4A 2IV3A 4AU1A 3AQ4A 2GEFA 4DHWA 2Q4BA 4UTPA 1Z38A 4DV2B 1SOMA 3G0DA 3L0ZA 3EPLA 3A6GA 3L4BC 1EXMA 3BMOA 2VPZA 1EFHA 2GOYA 1HM5A 1Y6FA 5CVDA 4OXQA 5B30A 3PFKA 1O94D 1E9BA 1ODLA 1FS4A 4MB0A 5DI3A 2YIDA 3ZQUA 4OXKA 4MS4A 5DCUA 2HMAA 4LJAA 4PG6A 2CF5A 2Q4OA 4RS3A 3T7EA 1V8DA 2Q62A 4LJLA 3RRYA 5EQTA 1VKHA 2GLXA 1IM5A 2N9UA 5FEUA 3FPCA 5JLJA 3GFOA 2ZB3A 3DZFA 3RRFA 2XUDA 3UH0A 5KC9A 1XU4A 2HFKA 4JYMA 3KYBA 3V2IA 5FBVB 1N7JA 1O5TA 4LZJA 1HG0A 1B93A 2F7SA 1JALA 2DY1A 4O0MA 5BQOA 3BZWA 3BGIA 1OX4B 3OCUA 4NE9A 1QYIA 4NV0A 3AI1A 4F71A 2A1UB 1U4SA 4QLOA 1SU8A 3NM5A 4OL0A 1O97C 4ZPJA 2XYPA 3ZV6A 1YJCA 2BFWA 2QRGA 3CB4A 4G89A 2BE7A 5AW5A 1FRFS 5FOSA 3O2SB 4NZYA 4ND6A 3PXCX 3MD9A 3GFRA 4RD4A 3DBIA 5LQAA 5J5CA 3WZLA 5KYYA 4H18A 3U3OA 3HV2A 4KZPA 5H8WA 2V7XA 2J9ZB 3PSHA 1GPLA 3D4IA 2M1XA 3MBKA 3E9NA 5ECWA 1CJMA 2FWRA 1TK9A 3IBCA 4FMDB 3IR6A 4N3GA 1YU9A 1QGYA 3LUPA 3SLGA 4JLJA 1DKLA 2R7AA 4MB6A 5B1EA 4XGNA 3A4LA 4BUJA 5KQRA 4EQZA 3KD2A 3A2LA 5ITWA 4CQJA 3IQGX 1ZAKA 1E3TA 1KMIY 1ONNA 3DZCA 3KQQA 4RFLA 5L7YA 7MDHA 2GBIA 3IPYA 3JARB 1QVVA 5AW4A 3IUNA 1M6VA 3TEMA 1X1CA 5IRCD 3RLFA 2OV8A 4P2BA 2RIRA 1UZUA 2VYND 3A36A 1YONA 4RMIA 1QQBA 4QAJA 4AN0A 5BN3B 4I4IA 2QUKA 4DIBA 2XD9A 4KE9A 3S2IA 1OQAA 5G4LA 4RS4A 3LY5A 5HQTA 4ILKA 4DPKA 3D3WB 3LIIA 1IOZA 3LTEA 2WHXA 2B37A 2JHGA 2F9MA 4W99A 4Z1MA 4PIMA 3UT6A 4W9MC 1XF1A 2LUOA 3EC1A 2AE1A 2VDPB 3DMNA 1T4CA 2QLNA 2XQVA 2OQ2A 3M2PA 5D3MB 4FR5A 2ECFA 3K4QA 3P9CA 5DSXA 5LXTF 3M4JA 3ZYZA 4F72A 1B7GO 2LD4A 1Q77A 4JUCA 1G3MA 1HZJA 2H7XA 2WKWA 3K2IA 4I1IA 4A8PA 5I3CA 5IANA 3AVUA 5EUMA 5FB3A 1XEAA 2E3JA 1KZGB 4UFOA 3BK1A 1WBDA 1PNOA 2CLKB 1K63A 1DJQA 2ZB4A 1H2ZA 3WGIA 2QBYA 3CW2A 3JSAA 5DRYA 1WWKA 4UVIA 4NZPA 3TZEA 3IC5A 2BH2A 3IAUA 5M5BA 4QBKA 5BSWA 3HUTA 1BMQA 5ICEA 4N0QA 3QUSA 2AJBA 2AG8A 4KCGA 4AYWA 1THZA 1Z4KA 3QKIA 2QRLA 4M86A 4MVJI 3HXLA 2GN1A 4ZXFA 4KAJA 2I5PO 4EKEA 4KPEC 1Z7GA 1KJNA 2XI4A 4C0LA 5CB8A 1FDSA 2GWRA 1TF5A 1H4VB 4CV0A 5AW6A 4EGQA 1BEZA 4A36A 3TBHA 1E3QA 1ENZA 2FNAA 4A1OA 4HUQB 1V5IA 4WZ6A 2J3LA 4MI9A 4Y6QA 4BP1A 3G2OA 3H0CA 3SBXA 2FW1A 5H9WA 1E79A 3TLBA 1Y0BA 5DTIA 2C3OA 1Y3AA 2ZRIA 1JKXA 3AB3A 1PSWA 2IZZA 3M9XA 1L8QA 3JD0A 4HZUA 4UOQA 3AEXA 4EVIA 2G28A 3TQRA 4WLUA 1QH0A 1M6WA 1K6IA 4N7RA 2BRUC 3BC1A 4V2IA 1BCSB 2VL7A 2AF4C 3D9QX 3FCXA 3V6LA 2OYSA 1AGPA 3AONB 3GZNA 3ZHRA 2VP2A 3KDSE 3LVRE 4UU7A 4Y9DA 5LB4A 3VTAA 4FC7A 1Q17A 1NGSA 1TM7E 2PS1A 4HGRA 2FLVA 1RI4A 1U4OA 4EPTA 3BZUA 3K1AA 1H3EA 1A0OA 5DEIA 4J6EA 4GI1A 5CW2A 1XTJA 3MRXA 3QBTA 5K03A 1FRZA 2HMWA 3KR9A 4G09A 2HF7A 4IOJA 3EODA 2IHJA 4JLUA 2UZ1A 3VHLB 1FPQA 4QDTA 3WB2A 4U8HA 1QUFA 3BIXA 3JQFA 4DPLA 3IUBA 1EP1B 1NC3A 4DLBA 4EF4A 4FX5A 1KKLA 1BMDA 2YYZA 2V7QA 4JB8A 3BEOA 2PRJA 2FE4A 1XD2A 2BHRA 4IIHA 3CB2A 1TI7A 3M6FA 4LPKA 5P21A 3VSEA 3MFYA 3AR4A 1GT91 2BONA 3CLTC 3QXGA 2ZETA 3VU3A 1H22A 3OEYA 4C6RA 2ZR8A 4WI1A 5BV2P 3ZHYA 1Y89A 1TKAA 4CM6A 1Q1QA 5AVRA 1QDUA 2CXQA 1J9EA 1Y9JA 4R8VA 1ID8A 1HBJA 2QSUA 4YJ3F 3GEBA 4KQ6A 2D2VA 3M6XA 3LTNC 2CNKA 4Z4HA 1WHTB 2YY5A 4XD2A 1I36A 4OF4A 4EG0A 1TTPB 5G0TA 4Q4CA 3PDJA 3WMWA 1KO1A 1APBA 1X7XA 4PSKA 4HAOA 4N7JA 1BD3A 3ZUPA 1C50A 1N9GA 1A9OA 3LE8A 1ILEA 1UQUA 1RTTA 2AN5A 4F6RB 3GLGB 1VMKA 2A5FA 2B4AA 1F2TA 2FX5A 1YACA 4JB2A 4RH3A 4EI8A 3OC0A 3MQ4A 3P2IA 4I4NA 2QQ0A 3BN3A 3NEYA 1RAAA 1V3TA 5ELLA 1V2GA 4G56A 4UHHA 4C7OA 1M8JA 3NOQA 5JZSA 1KYXA 1Z0SA 3M4YA 3C85A 1LLDA 5AICA 3TO5A 2Y27A 3FUWA 1HKHA 3B1VA 2O6HA 2W8BB 3L1IA 2MDTA 3R4CA 5ED0A 3W4IA 3U31A 2JLZA 2WJZB 5EUQB 1R9MA 1CUFA 1U0RA 1QU3A 4JAVC 3QEAZ 2XUAA 3FNQA 5IVDA 3GGOA 2FPIA 1SKMA 3DCIA 4HI0E 2IXBA 2ZT6A 1VLMA 2NG1A 3KSDO 4OYRA 4UHCA 1C3EA 1U2GC 3GEEA 3CJRA 5E9JA 3NTXA 3PEYA 1Q1NA 1MB4A 4M0EA 4X3PA 4ONEA 3AZQA 3KKLA 2L17A 3LLUA 2XUFA 1KF0A 2R11A 4RM2A 1T9KA 2YXEA 3ZDQA 1ODFA 5J5AA 5CIYA 1W87A 1FFEA 1TQDA 3C7AA 1FSFA 1CYEA 4G5QA 1KVRA 1TFRA 2ZBQA 4HLUC 1G59A 2ISQA 5JZ9A 1ZKDA 4JYZA 4K26A 4RPKA 1T0BA 1ZJ4A 3DAPA 4CV3A 3GNTA 3KVRA 3UFXB 1Y8ZA 1KS2A 5ECGC 1R4MA 2GXQA 3W5SA 3VSAA 2TMKA 1SAYA 5BSHA 5JRZA 1KAQA 4KN8A 4MI1A 2FF5A 1U7DA 2BMDA 4BLUA 3ZE0B 1RMTA 3TLCA 4ABTA 1MZVA 4G0ZA 4BVGA 2IKSA 1C0IA 4PSDA 4XR9A 4X3CA 1IJKA 1MB2A 2JFBA 3EEIA 2YNMA 4TV9B 3UICA 4H27A 5JSZA 3ECCA 4DUYB 4LFBB 3ZJVA 5AKLA 4JMLA 3DZIA 4I1UA 4KQXA 1IQPA 1LK7A 1Z08A 2EARA 4E21A 4YRBA 1P2TA 3HJBA 4YUXA 3RVPA 2YOHA 3JAKB 2X0NA 1KSGA 1HNWB 2VUSA 2KBFA 4YQEA 3WQHA 3ELDA 4LE0A 2G77B 1UC9A 1WZ2A 2W2KB 4O4IB 2TMGA 4XQGA 4YONB 4ERNA 1KMHB 3OM9A 1VPVA 2P35A 4RTSA 2NYVA 3VNUA 1IXYA 2YN4A 3KJGA 4TKVA 1PK8A 4W7HA 2PMWB 4IHQA 3ROTA 4YAGA 4N5DA 1F8GA 3PXUA 3L40A 5JCJD 1QPZA 1EE2A 1R66A 4MGIR 1NQOA 2P69A 5DHAA 2PUAA 3PFWO 4CR6A 3I83A 4YJHB 4LOAA 1PJTA 1JLRA 4GP9A 3ZTTA 1E3MA 2AUNA 2GXSA 4MARA 2QTMA 3BGSA 2VF8A 3DFFA 3D3KA 5EL0A 4U7FA 3THSA 2PKWA 4B79A 3H7AA 5BW5A 1SNYA 2QE7A 4DREA 5LWQA 1M7HA 4QXPA 1XTBA 3MUNA 2JBAB 1E3JA 4G23A 1GUYA 2NU7A 1EXNA 3L7CA 1Q50A 3EXHC 4MKGA 3EVBA 1Q44A 1W0JA 3KHSA 1LTHR 2J33A 4ZGWA 5L3SA 4ER0A 1PE0A 4IVNA 1FUIA 4O1MA 2FPMA 3GDWA 5HILA 2IV7A 1NSFA 5FOUA 4D6XA 1UWKA 2FOXA 2X2EA 1KEWA 3OU7A 2QUHA 3SEFA 4B3TB 6Q21A 4HEA6 2JGNA 4WOKA 2J3JA 1X80B 1ZM7A 2GDZA 3HNRA 4D4IA 2ZSUA 4JV5B 1CQIA 3N0XA 3S2GA 1KEVA 5EHIA 4CG0A 3FFAA 4Z4FA 1Q16A 3G68A 3OEWA 4N7MA 3THXA 4X1KB 3VYSB 3H2SA 1QJ4A 2ZIWB 3WGZA 2VJNA 1NYQA 3QUQA 1R64A 4IH9A 1MEOA 2GEVA 1WAMA 2Y92A 5CM9C 3V4SA 2WRZA 3CLKA 4IUCS 1JJFA 3E4CA 4PAOA 4HCJA 4RV5A 1X1AA 2RB4A 1EFKA 2GNOA 1WW3A 4EJSB 1FP2A 5AVTA 2XZPA 1N5KA 1SKBA 1TPZA 1YZHA 2C4WA 2Z43A 1Z36A 4OHYA 3RIHA 5DN6D 2N42A 4CW7A 4FSDA 1RTKA 1MAWA 2GF2A 4TQAA 3FTNA 1BVYF 3VNBA 1I13A 2DOKA 3NHRA 2YV1A 1IN8A 2P9QA 4OLBA 4WLNA 4GRDA 4G5XA 3B1YA 4IMRA 3WNCA 3C3AA 5KYTA 5J2UB 2YIVX 1M2HA 2GO1A 3UK0A 3R8FA 1OIVA 1Q1EA 2NZXA 4W1PA 3AFGA 3GCXA 1T0PA 4KSCA 4UUPA 3TIXB 5KNCA 3K94A 4IIYA 4JX8A 2FHPA 1JMVA 3EXFB 3LDUA 4OJQA 3UJHA 2O2SA 4Y9UA 2G1UA 4M76B 4AWBA 1SZCA 3B1KA 1VE1A 4YFYA 1QNFA 4ZYZA 4NRDA 2GBPA 3R74A 1EQAA 2V6JA 2W4QA 1K06A 2CLHB 4Z53A 4R68A 4NYMQ 3WMXA 1VIVA 4IQ4A 5EIBC 4MROA 3WGNA 5BW6B 3GFBA 5LQMA 2XYGA 4KVZA 1FQOA 3P2KA 4P33A 1JDTA 3IOEA 5EE0A 3O1IC 5H3LA 5J9FA 5CDTA 1ABEA 3ND5A 1O77A 3P96A 2ABWA 2XX3A 4YQYA 2VH1A 5DKFA 4I5IA 3BH6A 1EAMA 5E1DA 3LV8A 4MUAA 3L7LA 1I0LA 2VQDA 4TKUA 4K1LA 5IXJA 4Q1FA 1FB5A 4EPYA 3AHHA 1PL0A 1AZLA 3CX8A 3L01A 1RLIA 4JENA 1XQ9A 2A9FA 4KEAA 4B4UA 5K8UA 5KJFA 2E85A 3EZLA 1F6DA 3NUGA 4NFHA 4XB6B 1DL5A 2NUTB 4ASUD 2BOVA 2DHRA 3GFGA 3PC8C 1JHOA 4L08A 1GVHA 4EEZA 2PGNA 4K8RB 5LIPA 1A9SA 3N2GB 5ENZA 4BO8A 5EJ4A 3EF0A 4HN9A 5EYPA 2WZQA 3WP1B 5F2KA 2Q2QA 5KQGA 3PFNA 4L6IA 3USES 3E5MA 5IJ0B 2XAAA 2P4HX 3S6JA 1HUQA 3JQ7B 1G4UR 1RWMA 3QG1A 5CLGA 2Z2YA 4E94A 2ZUDA 4CM8A 2TECE 2JKZA 3E27A 3OQOA 1N5LA 2HWUA 2NV2B 1G7RA 3MINA 4BVKA 5FOQA 1CY6A 4L9RA 2J32A 1RBMA 1OD6A 5AJWA 4BPRA 3WRWA 3D6NB 2IL1A 4MR8A 2JW5A 3EUFA 3FFBA 5FTJA 3ZLVA 2WWWA 4LWOA 3I0ZA 1A69A 3GMDA 3HFRA 3COVA 3RYFB 3D2LA 3LC7O 4L5YA 3HU1A 4DDVA 3WRXA 4AMBA 2AIRA 1V5GA 2JVJA 4MA5A 4YP9A 5BV8A 4G63A 3H3JA 2DKFA 4RE6A 2XDQA 3BUSA 4YDQA 2QTHA 3EQ6A 1P1CA 2AOUA 4RF3A 4MX8A 2A1TS 3NCHA 4GOND 5EIXA 3JTEA 3KV1A 3OZCA 3I76A 2AUMA 4V0RA 1HI9A 1KVUA 1XVTA 2OHGA 2RC5A 3IT0A 2HSJA 1PK9A 3JZFA 5BMOA 2PR7A 3E23A 4TUYB 4BJ1A 5D3ZA 1H5NA 2IXAA 3ICCA 8ABPA 1CUUA 3P9SA 1IDN1 2Q3MA 5HS4A 4QSHA 2X1HA 1I30A 3TTWA 3WBBA 4EZEA 3V4PB 1UJCA 1P6UA 1DX4A 3UBMA 3W5DA 4R1UA 4X24A 3R9WA 3EGEA 2WTMA 3CIFA 3OQ6A 3DTVB 1YCGA 3TPZA 2CCJA 4EBBA 4IZHA 1BGVA 3OHMA 1IN7A 3HP4A 4XJXA 1AD2A 3W5UA 4KMOA 1I1HA 9LDBA 1OSNA 5LLSA 2R6ZA 2FPUA 4JEUA 2EKQA 1OT5A 3KUUA 4OGFA 1T8TA 3PPWA 3PXGA 3OZAA 2DUNA 1LPMA 1P77A 2IZ7A 1WPXA 3LCVB 3FN4A 1KO4A 4EA6A 1KFEB 2R66A 4U2EA 1DE0A 3O6VA 4YQZA 5DO9A 1JHAA 3FR8A 4QQRA 3T9EA 4F3RA 2ZUEA 1MA3A 1IZ9A 3QW4B 4ES6A 5FAKA 4U3JB 3FR7A 4QUBA 1DCMA 1PT5A 1KGSA 3BEDA 3RYTC 2BI4A 4HNRA 5A4AA 3F7NA 4IUYA 4OMFG 2LZ0A 1I5EA 1T8SA 3EMKA 3C98A 3HZHA 5FADA 5A0TA 1FDUA 1PNQA 4KR3A 2EHDA 5JSZB 4KX5A 3WLMA 3WWEA 1F6BA 4I8XA 4UNPA 2VBIA 4C4RA 1BHQ1 3EUAA 1ML3A 1U8EA 4Y3UA 1L7DA 3UHPA 4AZ3A 4EFDA 5JD5A 5LDDC 2M6RA 4JYPA 1WL8A 4IDCA 2UUCB 1DXQA 3KTAB 1D1TA 1NTOA 2NAPA 1EFRD 3VDMA 1RT9A 4AQYB 1NVEA 1XDDA 5AIAA 3EN0A 4WDQA 3JX9A 1TYCA 1HE5A 3KOXA 4YYEA 4BBAA 4C5BA 4PAQA 1U8FO 3MT7A 4HDSA 4MWOA 2JD0A 1E18A 5ER9A 4C2BA 4JU8A 5JALA 4XWWA 1RMYA 1YS1X 3LXMA 2YYAA 3PD7A 4E12A 3VNVA 4QUJA 5E7QA 3DBRB 2GAIA 3CX4A 3I9V6 4KFSA 2Q5QA 4F1JA 1JF8A 4MYDA 4Q19A 3TSAA 1DKPA 1R0CA 3O0TA 5I4CA 3D3NA 1JB9A 1WOMA 2ZSHA 1TAUA 4LMRA 3MWFA 2WTUA 4DDTA 1OLXA 2B8TA 3TKLA 1UM9A 3FMFA 4D4GA 1C7EA 2O5RA 4RSRA 2EBUA 1G6OA 3OE7D 2VYCA 3IKLA 3IAHA 1CUXA 3ESDA 3ZWPA 2Y1OA 2CFIA 1IN6A 2K4MA 1AKMA 2ETVA 4U6NA 5E95A 3DKIA 3T61A 1IM2A 3THYA 1TK2A 4WXYB 2ILVA 1SQ0A 4ZI7A 5A5FA 3LQ2A 2XXAA 1I6LA 3L82B 1VKRA 3N7UA 5HE9A 2AWOA 4NOKA 1UC4B 3KWFA 4MHTA 4M83A 2C88A 3BXHA 3F0TA 3ZDRA 4D3DA 4EW2A 3C97A 1ZOIA 4OB8A 1WMFA 1BHO1 2XTAA 5IH3A 1ESCA 5TQ2B 2QI9C 4C0XA 5EIWA 2AOWA 2P1ZA 1HQKA 1RXSA 4RWZA 2PWPA 5E6RA 3L07A 4E31A 1GTZA 1PQ4A 1W25A 3EDCA 3O4JA 1FIUA 3M82A 4LDPA 1V1RB 5IXYA 1NZJA 3RRMA 2WU3A 3PR3A 4JNKA 3DC2A 1V11B 3EAQA 1ZS9A 3QEMB 3GIWA 2I9KA 1ZZEA 1JYSA 1UDCA 2D1FA 2BBWA 4YH1A 5EIEA 1VCMA 1NMEA 2YWBA 2OT3B 3CLRD 3ETLA 4PU0A 4AS1A 3GI1A 1S3SA 3DE2X 4CEHB 3WGMA 1VBNA 5THKA 3CT6A 2SKCA 4KQJA 4NESA 5JVDA 3L0DA 1XNRB 4QO8A 3WP0A 1P74A 3JQQA 4BDTA 1ADJA 1Y81A 4MS4B 2E5FA 6LDHA 1G6HA 2O0MA 3KXPA 3VYUB 3SIXA 5U9CA 2F3UA 2O7QA 3NT5A 1V7PC 5LZ5A 4FGSA 1FL9A 3JWIA 1C0PA 3WAKA 2NMVA 3KZXA 2JLUA 4KBYA 4OOEA 3C6MA 4A10A 4D8YA 1E7YA 5LD2C 5HNKA 2GCGA 3KKQA 4WHMA 2RAFA 3U9SA 4ETWA 2RGWA 4JJ8A 2V0GA 1X1EA 2EIXA 3ZJYA 3DD1A 4MLDA 1XN4A 1TM1E 1UMBA 4PONA 3WB0A 1WB5A 3T4PA 3B89A 3NH6A 2CUZA 3O4FA 5BOSA 3BMQA 4DB2A 4BAZA 2DU8A 2HHCA 3QUTA 2QRQA 2GD1O 2FETA 3G2JA 1TLTA 1M1NA 2XF8A 4E5YA 1COZA 3EA4A 2ZQYA 3HXOA 3WOHA 5DYWA 2HO4A 1Z16A 3RAFC 1OWMA 3ESRA 1E7SA 2OB1A 1YGYA 2X0JA 5CLHA 3CH4B 1IXRC 1F6WA 1Y8RA 3ZCUA 4Z4EA 3IJRA 3CCBA 4TMKA 4UCWA 4PBSA 5I4IA 2CNNA 1A9TA 1HDZA 3ZK8A 1PL6A 1E3SA 2OHFA 3IDOA 5DBOA 4F4IA 2QW0X 1Y8AA 2AKYA 2EP7A 1QYDA 3WWYA 5FFFA 5L6LB 3FIUA 3MWDA 3UK6A 3AEQA 3S81A 1GV1A 4S1WA 1R6DA 4LDQA 2QAGA 5A6VA 1BKYA 4MKZA 4RXTA 4B2IA 1S1MA 2GPTA 2QD2A 3RYCA 2DGDA 1WQ4A 2VPIA 3DBLA 1LB1B 4GZ5A 4C7JA 4ARSA 5J1SB 1UK7A 3H6HA 3A27A 4QFCA 2V3WA 2XWJI 2WU1A 1IUNA 1K4YA 2ZYDA 4L7QA 5CK4A 1GZ6A 3OY7A 2NO1A 3ZY4A 4YCNA 2QGZA 2VYNA 4A6EA 4IF6A 4EKYA 1IY8A 1EFVB 2GJ8A 1GO2A 4TZKA 3LNTA 1YCFA 1PGJA 5F35A 1E58A 5I01A 1L6RA 3BICA 5DLDA 5ADUS 2ODWA 3QFCA 4COKA 5IDWA 3VR2D 2XITA 2VYQA 2GXUA 4P86A 3IKJA 1A5TA 1UJ6A 2PK3A 4I55B 3GDOA 4GMHA 1WSBA 1TF2A 3U5ZB 3WK9A 3GGSA 4CEIB 1U3CA 3IAAA 3BJZA 5EMNA 5BSTA 4NZOA 4PE5B 4PZ9A 5T67A 3ZU3A 1DFGA 3DWGA 3RJMA 3DT6A 1YDMA 2I1QA 3LVFO 3SWWA 5DM60 3CF4A 2YDXA 4ATNA 2QBYB 3V4ZA 1OFUA 4KFCA 1T10A 1RPNA 4MW2A 3HL0A 1SCUB 2WM9B 3FYHA 4QU9A 3PQ5A 3QSYA 3JWPA 4QEDA 1DJLA 3K0CC 4YK7A 3ITKA 1P17A 3O7MA 5GZ1A 2YW9A 3S27A 4BKPA 3KEQA 1KTIA 2CL7X 1AZWA 4AX4A 2O5VA 3Q5EA 1J20A 1R9GA 4WT7A 1D2CA 1WIWA 1I2BA 1KAEA 1YUBA 1GG2A 3LX5A 3LYAA 4E4TA 2FSSA 1CR0A 4KIJA 1JKMA 1NT2A 1VE5A 2HQOA 1JHDA 1QH9A 2RHBA 3IIKA 4G01B 1ICIA 1WY7A 3R24A 1TMKA 4XQCA 4ZVOA 3ZWDA 4N48A 2QRUA 3F7TA 3W5BA 2HQ1A 2PKQP 3IB3A 2VN8A 5THXA 5B64A 1BYUA 1XTKA 1WXWA 1KQPA 3THRA 4YLGA 4OKSA 4AXXA 1Y3IA 3FGZA 4DZZA 5L3QB 3PKJA 3DCJA 4U4AA 4U7WA 1MO5A 1YR6A 5D3QA 3W05A 5LQNA 1WW2A 4HZUB 5BV1A 1QUEA 3MMXA 5CEEA 1GN8A 5K01A 1EXVA 3ND7A 1VP3A 1N2OA 3ADPA 1GFSA 1NULA 3V1UA 4XEHA 4RVFA 2A0UA 5EXPA 3GMTA 1II0A 4HDNA 1QC5B 3ADCA 3ZNNA 1IQ0A 3VI3B 3V33A 3GZNB 5A4JA 4MOWA 1D6NA 4F93B 2WZDA 8LDHA 1EQ2A 1T2EA 3GD5A 1QSGA 1UDBA 1YF3A 4DMLA 1Z5NA 3K1AB 3Q88A 2DBZA 4LFAB 1N1GA 2H1HA 2ZVJA 3QTTA 2ZZNA 1Z0FA 4OB7A 4XEUA 5JLAA 1VLVA 2PLWA 1UJBA 4R7TA 2R00C 2R8ZA 2J46A 3COSA 3DLCA 3FSEA 3N87A 5DX1A 1PT7A 4UFNA 1RWVA 4IL5A 5JATA 1BH6A 2H59A 3ZJ5A 3WRYA 1YOVB 1FNDA 4MWGA 3PV0A 1BE8A 3ZLBA 3H9GA 2HCJB 2ZWAA 1OA0A 4XM1A 2HK9A 4ZQGA 3TCNA 4N47A 3AFOA 1FU8A 4K6GA 2RAPA 1JTEA 1U3VA 2QN8A 3AF0A 3FI0A 1DWUA 3JQAA 4BO4A 2HPAA 4RVUA 2GJAA 1JXQA 3M4NA 3OJOA 4UDNA 5L45A 5KHOC 1OXUA 3RC2A 3TB6A 2AFHB 4FGUA 1XELA 2IX9A 1AH2A 2F3RA 3TPFA 1AC5A 1E3WB 1TU4A 4L8GA 2GX6A 2SCUB 3IDSA 3CTPA 4PXAA 5DNWA 2BFFB 3OTGA 4BMNA 1A4RA 2CMGA 3PYXA 2G9UA 1JS1X 4B6OA 3DEFA 3AKDA 1MW8X 2CFRA 4C01A 2F3TA 1MX1A 1XTQA 4O63O 3OZIA 2EQAA 3WK4A 2ERYA 4ALKA 5EWMA 3C6QA 2IE0A 4R1OA 5GV7A 3UVEA 3WIVA 3OM0A 2I6QA 2BGMA 3HEBA 2A84A 4MV9A 1L4NA 2WVJA 4ZCRA 2QDXA 1XB2A 3OU2A 4JUDX 3IP9A 1X0XA 2GUGA 1ZGGA 2WSSD 3DMFA 1E0AA 5B1IA 1WF6A 4R31A 4R3NA 1E2UA 4I2VA 3TVTA 4AN4A 1LPPA 4DLZA 3O38A 4KUGA 2O57A 3CUTA 3RS3A 3MCUA 1U65A 1TKRA 5EXTA 2C1XA 2QTRA 3DAGA 4QGSA 2OXCA 2CJYA 2GN6A 2RJOA 2XNDA 1Z34A 3BB4A 4KV9A 2QUAA 2G83A 3FBGA 4XAQA 4R0NA 3UOGA 4Y30A 2WAAA 1M2JA 4UD6A 4AW9A 4EMTA 4F5ZA 3CH7A 2BHTA 4XPZA 5KOHA 2O14A 4JZKA 2GTHA 1U7TA 4U2DA 1P5JA 1KVTA 2WNHA 2HMVA 2COKA 2BZ0A 3QKWA 4B3FX 4DMKA 1JG7A 2OORC 3MCAA 4LWQA 2VSQA 3T1TA 1KIMA 3EEFA 2F8MA 4IG9A 4WCFC 4C21A 5AVYA 1G2OA 4DSTA 4EY5A 3KQKA 3ZHTA 4OOFA 4OLFA 4QT4A 5KJCA 2VHXA 4ZK6A 1ZIOA 2OV1A 2VAPA 3P8ZA 3DDWA 3TVDA 2HRDA 1CZHA 1KH2A 2PS3A 1E5VA 3PVCA 3UJ8A 2O7RA 2Y1DA 3PF9A 2RI1A 4UUAA 4X93A 4ZU3A 1STOA 3G6KA 3R20A 2IY9A 3E1KA 1CFZA 1AQIA 4P4GA 1ESZA 2ZE7A 3SU8A 2D3TA 1HT2E 1G3IA 2UYCA 8MHTA 1W2HA 3HGTA 5KPDA 1P7CA 4OQ4A 4K9OA 2V4UA 3OZ7A 5E8JA 3VDNB 5BWMA 3QRWA 4FS3A 4DV0B 4MO2A 3EFOA 1ZK0A 1T8WA 1HDEA 4Q18A 4X97A 5LU8A 1TO2E 3KTDA 3SDZA 2IXFA 2GFIA 1WRBA 3DG9A 4JYAB 2FPOA 3IP5A 1RZUA 4OGWA 1NVKA 1SA0B 3TUJC 3T7KA 4GC9A 1RHMA 4MW0A 5HF8A 4YX9A 2DB3A 3A2KA 2FA9A 1FU7A 1NLFA 3UMYA 1OILA 3Q3EA 4HLNA 4LMBA 1T1IA 4C7MA 5LP6C 3KL4A 4S1OA 4RIGA 4B6JA 1IBLB 5EQDA 3MQFA 4C7BA 2BMAA 2C59A 3IIIA 2MU1A 4Q93A 1S1CA 2HU2A 2V54A 2Y67A 2WYVA 3GX1A 4K7JA 1JIJA 4ZIRA 4GOLD 4FEAA 5AHOA 3TYXA 4KDRA 3ZGXA 3CLVA 2BEKA 5GJWC 4QX6A 5JJBA 3C3PA 3D64A 3ML1A 1EESA 1A71A 2RHOA 3U80A 1IEWA 4UAJA 4UM9B 2R6DA 3ORHA 3NMUF 1PN3A 4PHHA 1E1RD 1PLJA 3HV0A 4I8DA 3P2OA 3I9JA 5ALHA 1RS0A 3HR8A 4LBZA 4A6PA 4L74A 4ZOCA 5BWOA 2NU7B 1NAIA 1K7EB 4CNBA 1G1AA 1W7AA 1W9MA 4PFKA 2IUUA 1Q0RA 4AKIA 1X7ZB 1GVNB 1JHZA 1YD7A 5GV8A 3QKTA 2QQ5A 3QVKA 5I7UA 1Q3HA 3VZPA 1VE3A 1RXIA 1VP9A 3MSCA 4GUAA 1NMYA 4XSHA 4L0QA 1KARA 3WLPA 2XODA 4QGHA 4MCHA 1EUDA 1XWWA 2PCJA 5CX1B 5FH9A 2J0QA 5H83A 2HMYB 2MMGA 1XXHE 2NQTA 3NDJA 3OKCA 2WE7A 4IIEA 3HFJA 4JZYA 1IY2A 2QU7A 2ZSFA 3FYUB 1XTSA 1KP3A 4Q7MB 5JNUA 2I8AA 4ZEOA 1BX3A 2J59A 2Q7DA 3V00A 4D4HA 3HZZA 4OQXA 2NO5A 2BHSA 3P2MA 4C04A 1G7TA 4KQ1A 3BB3A 3H6GA 2P9BA 3O1LA 5DK6A 1E62A 4L27A 4ZOQI 2TYSB 3SHFA 1KEEB 3AT1A 5EMLA 2GBLA 4HFNA 2C2XA 2KQUA 2FR0A 3ESYA 4M7WA 4U02A 3STVA 4OAPA 1PQYA 3NHAA 4MYHA 4YRRA 4CT0A 4QQFA 3QHAA 2EX0A 3ANSA 3ZY6A 4WZBA 4YAEA 1XFDA 5EC8A 3F47A 2ZWVA 3KQWA 4OGKA 3CLUC 4Q05A 5KAMA 1GTMA 4C9BA 1UKAA 2UVPB 1P5ZB 1E2HA 2ZJBA 3C24A 4G24A 4H59A 5B7GA 1GD1O 3FNEA 2VTVA 3D8NA 3DZBA 3P5SA 4J2TA 2HWWA 4I1YA 1YSCA 3GOQA 5T3UA 4ACAA 4XSGA 2VATA 3DEKA 2YH2A 3NM4A 3OQPA 2VK4A 3IT2A 5BXQC 1KZ4A 2V1XA 3HKEB 4FQ8A 4ZCQA 2ZYUX 5KQMA 2Q2WA 1J8FA 4C6TB 4XYMA 5D8DA 1H2YA 2W11A 1CD5A 1D5CA 4QOJA 4ZD6A 2H5IA 2WBLC 1UPFA 2X4LA 1K8ZB 3MTAA 3PS9A 3NO4A 4P54A 1EFPB 1H1LA 4C5AA 1XDZA 2HNAA 4Q3AA 4XJSA 1SUIA 3ELBA 1M6NA 4AJNA 1LWNA 1I0ZA 1J6UA 1DPFA 1T4MA 3VOAA 4YV2A 1SQSA 2WOJA 2QMQA 1UAGA 3EEOA 1LPNA 1TUGA 4RZUA 5FPTA 5IAJA 2K7FA 2GF0A 2XMGA 1JECA 3LBFA 2O50A 4FBGA 1N0VC 2ST1A 5JT1A 5LXTA 5EZYA 4TKUB 4I4TB 1BWPA 2OG1A 1KJWA 4FGZA 1RRVA 2E7ZA 2Y1GA 1FFAA 5ESWA 4ZT2A 5F9HA 1FBNA 3OUZA 2FPGB 1FMFA 1Z4LA 4JLPA 4QBTA 1YKFA 1UANA 2ZFUA 1C4XA 1RAFA 3F97A 2XTMA 1K7YA 1FTSA 4P8RA 3ZE2B 1ODTC 3BL6A 3QF7A 4JLAA 3P9YA 3A25A 4NENB 2F8SA 1A5BB 1KNXA 2IHBA 2VBFA 1RWKA 2OV2A 3BAFA 1MFZA 5JSQA 3AVXA 4HRVA 1JFLA 2P30A 4Q9JA 4RULA 1W48A 3UAGA 2AOTA 1T26A 4OX9Y 2OLKA 3I4CA 1QP7A 3REFA 2VWPA 1L2TA 5KNBH 1RYZA 3W5HA 4L5BA 3VTKA 4HB0A 1RAEA 1SG6A 2P4UA 3V55A 3CVXA 1FYXA 1HMYA 1SMKA 3PVZA 2PUEA 2IT1A 3I3SR 3N59A 1CE8A 1OBVA 3CW9A 4I4CA 3TLAA 4E5SA 4FDAA 1DLIA 3IP6A 4MIKA 5AKYA 1TM4E 2H00A 2GK6A 5FT9A 3ZWVA 2Z2ZA 1BQ3A 1H69A 3EF3A 3B3QA 1J0BA 4KHPB 1DBIA 3HKBB 1BVHA 3I9KA 1O5IA 5KQSA 4Q7KA 4D9KA 3P20A 4WXPA 5FQOA 1TUIA 1W34A 1XQXA 1X86B 1Z4QA 4QXAA 1P2SA 1A8QA 1RI2A 2J9RA 1MENA 3R7BA 5LPNA 3R77A 2J3KA 4HLCA 3O0DA 3RWMB 3EHEA 1X94A 5ELXA 1GU7A 1M7GA 2HCBA 4UKDA 2LTAA 2Y76A 3H3FA 4U2GA 2JVKA 2PUGA 4DV5B 4JL8A 2JKYA 3BILA 3E1GA 2HRBA 4IGAA 1Y82A 3JQPA 1VZ2A 2AQHA 2SKEA 4BMXA 2J3IA 4M9XA 3G9XA 3E53A 2NO4A 4BUCA 3F98A 4QHYA 5JNWA 5IKEA 1K8YB 2INGX 2NNWB 5JADA 2ZUTA 1PFKA 121PA 1XZDA 3LX4A 1PDOA 2JGKA 1AA6A 2FKNA 2XEDA 1JPNA 1HTWA 2J08A 4G5OA 1QAMA 2EL9A 2VJMB 1T5SA 1FP6A 3AUYA 3M6WA 4OHOA 1JQDA 4U0JA 4BN5A 2XPCA 1ECPA 1YB2A 4FYXA 3HYNA 4H7KA 2QRKA 3DE6X 2AN1A 4P7FA 1AUOA 4WK4B 4RQAA 2JEYA 3PHJA 5T6BA 4XDYA 1WU8A 5L4SA 3GRCA 4QEKA 1R27A 4AUMA 5HKKD 3LYHA 1SQGA 3KKOA 1L4BA 1E4VA 2C2WA 4UBLA 3RS5A 3UUGA 3WLLA 2PUFA 4ZEXA 1ZJ5A 3AR5A 3EVTA 4PLGA 5K8LA 1Q0TA 1K9SA 3B60A 2LV8A 3LNCA 3F6YA 3E3OA 1E5LA 2VEOA 4GC5A 4G0YA 3VPXA 3RC8A 2PD3A 4WY2A 3B82A 3ZW8A 2H08A 1L5VA 4LXUA 2DEUA 1N6LA 4ENSA 2P3LA 1J2TA 2VQ3A 1CU1A 1OI4A 3D7MA 3DL0A 1GSIA 4OQQA 1H9AA 4OUKX 5DZSA 1I7SB 4M98A 1UDAA 1GKKA 3D6JA 5JI3E 4F2GA 2FX3A 2FWBA 1B0AA 4ZI5A 2FZEA 3L2OB 2HK6A 2XT0A 1GNVA 2IS4A 3JWHA 2WIBA 5A4MS 2P2LA 1EJ2A 2JI8A 4KPFC 1NRWA 3VYRB 4D74A 4C7XA 1OLOA 1OR8A 1R9JA 2D5IA 5BOVA 2J8ZA 2MSCB 1YA4A 4MVJG 5CCDA 2XE6A 3SMVA 1USUA 5IW8A 3UWSA 5F21A 3OZRA 1T8YA 4X6UA 2D00A 1AUPA 2YFQA 3GT0A 2VPTA 4IJWA 4BO0A 3QXSA 4J0IA 4MVJP 4MV0A 5TEWA 4JJ4A 5IH7A 4G37A 1SIWA 4HGNA 5HM6A 4EL0A 1PSZA 2ISSD 2PGLA 2PZKA 1I3OA 2V4ZA 4IDHA 3KU1A 4EQ6B 1A9ZA 3A3KA 4K8OA 1N36B 3OCCA 5C7IO 1KI2A 5BV0A 1BDHA 2HTFA 2JGFA 4NVRA 5JAHA 1RWWA 2XADA 1DDOA 3P0IA 4TN5A 4GX1A 4YBZA 5AVJA 4A8JB 1U1IA 4FDTA 5EJ5A 4JGBA 3NETA 3FHJA 2HTEA 2DUJA 2J4FA 4GLBA 3I9FA 2OBNA 4X20A 1N6NA 1C8KA 1TMYA 2KW5A 3FDZB 3FJOA 4GBMA 4RKYA 3D0QA 4FLFA 4WN9A 1L0BA 3X1JA 4B45A 5B36A 2QV7A 3OIDA 3V1KA 4P83A 2WQ7A 1CVIA 1YRAA 4G67A 2M98A 2CWDA 4KQKA 2OCXA 4YUVA 3ZWKA 1ZLXA 1DQPA 4JL5A 1SVOA 4S24A 2I4OA 4D3SA 2H17A 3THYB 3JR7A 4IXWA 2LBPA 4ZI7B 1X7HA 4J3JA 2XXAB 3JQGB 4ML3A 4TT8A 2WUWE 1TCVA 4TROA 3KQTA 1XHLA 2YHIB 4LJSA 1V9SA 2QJRA 3CS3A 2JLCA 2NXCA 3BFJA 2AJCA 5JVDB 2BJWA 1XKLA 3PQ4A 3BE6A 2R96A 3HN7A 3C5HA 2XRYA 3FLBA 3ZU5A 2FZ5A 4NY1A 4UNRA 3TAHA 5JANA 1N3YA 3PFHA 1JMKC 4QDJA 4M0CA 2CVZA 4YLEA 1QWSA 4KUHA 4DFDA 4HDOB 4Z7OB 2YVQA 1R3DA 4IIJF 4NK5A 1U8YA 1Z5OA 3SZUA 3DFMA 1FEZA 1GUBA 2OZLB 4UULA 2O3RA 2E5LB 3AERB 2EFHB 3SJAA 1F1JA 2WZCA 3VA7A 4D5GA 4GLFA 4DA4A 4BLQA 1RYFA 5EJ6A 2J30A 1LC0A 2VZLA 2IIPA 2QP9X 1EVEA 1G4HA 1PWHA 2LKDA 1XMOB 3TW4A 2R68A 2XA2A 1G42A 3A1TA 4ZYUA 1W96A 5EKXA 5GOZA 4AURA 4B44A 5F23A 2E48A 3USCS 4F9GA 4MQ4A 3B7PA 4MPJA 1ZOOA 2FSUA 2O8EA 3WB9A 3U7RA 1RJ9A 4TQ9A 3M6LA 1G20E 1GRRA 2ONYA 4S35A 4Y2JA 2FPWA 4Z0TA 3BMQB 4M46A 1VPEA 2ZJAA 3E5NA 1AXRA 2YXNA 1NI4B 1HV8A 4TMYA 2GEDA 4NABA 5D00A 3NDIA 2MYNA 3ZOZA 4KIWA 2OK8A 1XCPA 3DNPA 4OQMA 4YMLA 3IEVA 1DB3A 4E7PA 1KJ8A 4Q00A 3DMHA 4Y1FA 4YCMA 2WNSA 5AVUA 3PEUA 3ABIA 3OF3A 3PDCA 4EFLA 6AT1A 3H97A 3I01M 2ZE8A 2ZRPA 5ILGA 3PHGA 4AP9A 3PC4A 4WINA 3SS9X 4OBBA 2I65A 4GOXA 5EJ2A 3RIYA 3SNHA 2X0FA 2FRVA 4BNHA 3ESCA 4AMVA 4MRMB 4A0QA 2HDNB 4GBED 2EYQA 3MWDB 4RJLA 2Q0HA 1PL8A 4OFBA 4GDFA 3PBKA 5CH3A 5TGTA 4Z5XA 3OPYA 5DGDA 4EGFA 2QAGB 2L82A 3F5MA 4Z4QA 3FZNA 3TLGA 3VM6A 1HE3A 4JXJA 3MS4A 1NOIA 1R8QA 3BIJA 3GARA 4DXHA 2ALJA 4KR7A 4HTFB 2GO7A 4Z8XA 2F1RA 3HFGA 3TRDA 2CXRA 3SZRA 3UEOA 3QLUC 1XZFA 2QTCA 2XCIA 4B6EA 4DQLA 2OCIA 4I3GA 2PSJA 5MDHA 3LQQA 4LHWA 4PIPA 5KX5B 5HIJA 1JKFA 4NONA 4RTJA 2VXOA 4JBNA 2GZHA 2YMMA 1SZPA 1A8HA 1QR2A 1XXHA 3LF2A 3PWSA 4WESA 1IIRA 1O6FA 2FP4A 3ER9A 1ZD4A 2ZUBA 1FUYB 1K5GA 1ZUNB 4GXNA 2HPVA 2QVCA 3LKBA 4MWEA 5T8KC 3BE8A 2OPHA 1G8PA 4JT8A 1U0LA 3C6ZA 4NCKA 3ZCQA 2N46A 1LSOA 1NSTA 2WINI 1JKIA 4EITA 2B5OA 3GJ4A 4UAUA 2DM6A 3IEUA 5COQA 4XIYA 1CJSA 1NN0A 1UIRA 2VJBA 3AUSA 1NPYA 3U44A 3ZIAA 1OXBB 4YJFB 1T3LA 1LH0A 4Z0HO 4BLPA 1F1BA 4XFDA 3V48A 5LB2A 1E2FA 4DJAA 4B74A 3P1JA 4EGCB 1ISJA 5F7XA 2WV9A 1VMDA 3VDRA 2PGOA 3EZ7A 1KWGA 1LVGA 2WU0A 1MMFB 1QYRA 2FEAA 3JQBA 4P7GA 3PNBA 3WL7A 2AW5A 1TW3A 1QB8A 4H7EA 3ODGA 4MQ5A 5ERGB 5FWXA 1B1AA 5LL6P 1R8YA 3H5RA 4M9RA 1JSLA 1QVRA 1ZK4A 4M22A 5ALYA 5CA0B 5KSWB 5INTA 1ZCBA 4CMBA 4Q4HA 1F5SA 1VSQA 3FG9A 4WY8A 2VHUA 1Q7RA 2Q50A 1JAXA 1D4FA 2I2FA 2Q1XA 2YR0A 3O8QB 4ME6A 2CNDA 1KJQA 2GZAA 4D46A 5MN6A 3RC1A 4G0OA 4TXJA 4O4JF 4OM8A 2GPWA 4URXR 3DKVA 4KJZA 3AHJA 4HPWA 3H1AA 3MB8A 4BX9A 1WHSA 4W6ZA 2P9TA 1Z25A 1N32B 1MOZA 4BZWA 2O1XA 4GPD1 4N5IX 2FVXA 1SO8A 2IU3A 4US0R 1TU3A 3DMTA 5T5QA 1AS2A 3HB0A 2PSFA 4C7KA 5ALMA 2Y9MB 2PKRA 1R6UA 3KZMA 5MHTA 2O1EA 3GT4A 3HM2A 2IOQA 2LPMA 2ATCA 2WUEA 5CVVA 3U4QA 1FMTA 1K89A 2OBFA 2GD2A 5HIIA 1ZD2P 4L9WA 1BRTA 3QY0A 4W8GA 5KYUB 2VJDA 3VVBA 3ZGNA 4AJ4A 3LFUA 2SECE 3IUSA 4AZ0B 1L7BA 5AJTA 1C0KA 4ZV4A 2EFGA 1L4LA 1G5HA 4Q37A 2XE8A 4NHEA 5IYZF 5K20A 2WQ6A 3U7GA 3OF5A 1BWQA 5ELMA 3OTWA 3B1FA 1YQGA 1JWLA 1J90A 3FSGD 4EVSA 4C2UA 1HGXA 3BXEA 3SYMA 3T9AA 4M37A 3DZHA 4K0KB 1JTFA 2PO7A 3DV9A 1OPRA 1BW9A 1XZEA 2A6PA 2CMHA 4F0JA 3I62A 1C41A 1RYBA 2CXXA 4WA7A 1TVMA 4Q7JB 5JAIA 3AKZA 1NOKA 5EXEA 1ODSA 1K27A 1NVDA 3JQ8B 2EXXA 4PX9A 1YB6A 4EJSC 5HE8A 2E89A 1R0KA 1WEHA 2Y2VA 3QVMA 1G8FA 4RZHA 1KE1A 5DTMA 1Y3DE 4PZDA 1U6IA 1U04A 4DARA 3PQEA 1BA3A 4IXNA 3LY7A 2X5OA 2PS0A 3EH2A 5JMPA 4YUAA 2XUGA 1SUBA 4UXHA 2JJMA 3AWDA 4LSMA 2G4VA 5DWVA 4ZO7A 3A3OA 1RW4A 4E14A 1PR0A 2PJUA 1Z6YA 3CA8A 3CRZA 2HLDD 2XV1A 4MR7A 2HA7A 4U7HA 1MAHA 2XB4A 4JR0A 4K6CA 4KMSA 3F6PA 5AYVA 4BNVA 1DOZA 3LUKA 4HRXA 3K1TA 4TT3D 1XE3A 1BHSA 4QVKA 4P1ZA 4AY4A 5DGHA 5EHXA 3LX6A 4R9UC 3WKAA 3WL5A 2NTVA 1XZ8A 1EFUA 1NQVA 2FDXA 4RBNA 3RVDA 2WSSA 5AW7A 5DU2A 4RY8A 3HWRA 2ZIXA 4R51A 1Z7YA 5E9WA 4UQPA 3H6KA 5TT1A 1KQFA 2YUTA 2AG1A 4BUZA 2FR8C 3ONEA 1A2OA 4KSBA 4UEWA 4B4WA 3D7RA 1ID1A 3OPNA 5TJHA 1H4SA 3B48A 3EFEA 1MPTA 4IDGA 4EUKA 4R1NA 3AVVA 3EQ8A 1JDVA 3GDHA 1N2GA 2R62A 4PX5A 1GPAA 1NP7A 4MMYB 3WSTA 2IBTA 1BXZA 1EDBA 1L9XA 5D5PA 4KWHA 3CRVA 4U7JA 5EIOA 3C6KA 3IE2A 4DY4A 5AOCA 1G8HA 4WSOA 1P72A 1M0TA 4PLFA 2WIAA 4OFZA 1RWQA 5C37A 2YJ4A 2UDPA 2B94A 4PZ0A 3F46A 3J81k 2YXDA 3G7NA 1R0RE 3HLKA 2TSYB 1G0NA 2WKSA 4QBFA 2C92A 5DYGA 1OV6A 1NQAO 2JRLA 4FJ0A 2XWQA 3LLCA 4C0KA 3L5KA 4MLZA 4TWZA 1Q0LA 1FNMA 3ENZA 4P5DA 5I9NA 2PZGA 1IAVA 3EDMA 4RKWA 2R6HA 1CEXA 4H35A 3TLMA 1DRWA 1XEXB 1A8PA 1FF9A 1I5OA 1P0QA 1P7WA 4DM7A 1NVTA 2Q3FA 4QICA 3WGJA 1S2GA 3NORA 4UD2A 3MMSA 3B1XA 3NG1A 3W1EA 2V7VA 1KPIA 2VBCA 1OBOA 4M1YA 4OAOA 5BVGA 2NO9A 3ONNA 5ALPA 4XYEA 4NULA 3VISA 1XGKA 2HQBA 3Q2IA 4NIMA 1N7IA 3WC4A 2FWAA 1K8RA 5BQPA 5FLYA 2QVXX 2ZB7A 3IUMA 4IRMA 5JDIA 1TC2A 3K20A 1LLCA 1MFPA 2WJJA 1JX6A 1NR1A 5KMGB 3MM4A 3RVSA 5JS8A 1AZSC 2EKDA 3H5WA 3HSYA 3WL8A 2XMSA 5JU6A 1RRMA 2FN8A 1LC3A 3KNZA 2FG7C 2JHAA 2N0SA 2HGZA 1QANA 3LQ4A 4GPEA 5CVEA 2WPDA 4XGIA 3WYBA 1T24A 1U1EA 3HBJA 3K6KA 2BDEA 2JFUA 3D4OA 4JI0B 4KE7A 3QMVA 3QFFA 1FYEA 1JHRA 1JBKA 4FIDA 2D1QA 3UB3A 1WTCA 5EG5A 1M1YE 3EIXA 3ZPXA 5AUPB 4E2YA 4JI8B 1K3UB 5ADVA 3I9NA 3ENKA 1UKYA 3TTYA 1T8RA 3A6EA 1BWRA 4XZ3A 4Z3KA 3FTPA 2J0VA 1V7QA 2COEA 2HLPA 4D9CA 2D4HA 4ER3A 1EHIA 2IP1A 3WQRA 2NAFA 1ZL2A 2UYYA 3L7JA 3TNJA 1Z6QA 1JHXA 4EABA 1UBGA 3KSMA 2H48A 3F2IA 3LLSA 3RT7A 1G8YA 1F51E 3UJBA 1MABB 1UMCA 3DP7A 5K0TA 1Z5ZA 3PGMA 2C9ZA 3HDHA 3UMJA 3RRZA 1FFYA 2VTKA 4MQLA 3QITA 2GYYA 2ZATA 3ASVA 3QVLA 5BO5A 3PGLA 3HJHA 2NVUA 1EWQA 3ASZA 3MGGA 3QX3A 1E0DA 5A3RA 2GSDA 1Z4JA 3O1JC 1P4JA 2WZBA 1SXHA 4JHXA 5EEGA 2O8FA 1GFZA 4BMPB 2ZW9A 4DUPA 1NIPA 3DD5A 3K71B 5M3BA 3JQEA 3TR5A 1P1KA 1BKDR 4BV2A 4J6FA 3VKWA 4V0OA 1QR6A 3L7IA 5KOIA 2WFMA 4CU2A 2QROA 1RJGA 4DCGA 1IE3A 5KTKA 4ZVQA 2I76A 3ICVA 1BJTA 4RD1A 4WZBB 5IMSA 2OR3A 4FCVA 4EEKA 4IOMA 1Q1ZA 4BN4A 1XPUA 4BN0A 1KI6B 1T4BA 4G9EA 4YRPA 5CR9A 3RNOA 3RYIA 4MW7A 5ERYA 5LWHA 4DUGD 4A6XA 1XJ0A 1O1YA 2Z95A 4OD0A 1QZZA 1O95C 2IYAA 1DI0A 4XM0A 4ZOBA 2YBDA 3T3DA 2X2FA 2YCBA 3AEZA 3TDNA 3DNFA 4AO6A 2CLLB 2GZSA 3ZJUA 2IOFK 1AKTA 2OBMA 4ZXPA 2CK3D 2CW5A 2PX3A 1QX3A 4IOLA 4KDEA 4ND1A 4NNOA 5FBWB 4QTYA 4Q4AA 5AHRA 5F76A 2YTZA 4C0AC 5JBIA 5K09A 1N5JA 3FF4A 2B6NA 4AROA 2I2AA 3QEOA 2W43A 2OP0A 3NWOA 1H0RA 2QP4A 4CODB 1JV2B 4J0KA 5JXIA 4Q7QA 3N2LA 3KLNA 4JITA 1W1UA 4JSTA 1ZONA 4E5NA 4L1KA 2C94A 2VK2A 5SZKB 1TECE 4NWIA 3V6MA 1I14A 4XYBA 4TS4A 2CWWA 3JPYA 2IDJA 5EZ6B 4WKPA 5HCIA 3EUEA 1QH1B 1XLWA 1P7YA 2C9YA 2NUBA 3K73O 4AULA 2YWGA 1NVWQ 2VO1A 4Z51A 1FVFA 1E5XA 1LX7A 5DBFA 2O05A 4GP6A 5BNTA 5JY1A 1GADO 5LXTB 5ALNA 1AKUA 2C7GA 3J7AC 3QENA 2Y1LA 4BCCA 4ZCPA 1ES9A 1P0MA 1TM3E 2R25B 4RD2A 1OT3A 3EPPA 3I72A 5K0FA 1I4TD 1M34E 1WF3A 2ID7A 1QS0A 3WGYA 4MJLA 3HUFA 1A5ZA 1LZKA 2P3SA 5KDLA 1AMNA 2ZSEA 2IHKA 3GUZA 2EJBA 1DIAA 1L7EA 2B7BA 1MX9A 3AP2A 2VAMA 3NYIA 4BVBA 3NBXX 2JFOA 4B3GA 1B2LA 4KWCA 1S6YA 3WGKA 2OHJA 3DE4X 4D81A 4R6XA 3EPJA 1XMQB 5JH7B 3RAPR 4BJ6A 4ZVMA 4K5QA 1SG9A 2Q5OA 2AOTB 1CC1S 3IDFA 4H7PA 3A2MA 3OIFA 2IZ0A 3DGEC 1OGJA 1QMGA 3LP5A 6REQB 1E66A 1V35A 3IPRA 4N7BA 4F38A 2C20A 3H9JA 3SSNA 4EB0A 2P3QA 2X4IA 1XYYA 1P2GA 1Z82A 2A4MA 1ZM4A 3NBMA 1CE8B 4PLYA 1ZG3A 2BEUB 2O1WA 3G9ZA 5IARA 2O3JA 5G1PA 3W3AD 2C97A 5DE3A 1KBOA 2HA6A 3NDRA 5AKJA 3TJZA 4E2ZA 3KAQA 1ZA2A 2WK1A 5CFZA 1SHTX 3DDHA 1DBQA 3ENNA 2XVZA 3JCZA 1BU5A 4O4HA 4WVLA 4RPCA 2C5LA 4GKAA 5FOWA 1KIFA 3II6X 1HFWA 4MS1B 1YDHA 5EWLA 3OLQA 3OCZA 1XNHA 3AHIA 3A1VA 2C4NA 1CUEA 2ZDHA 4MVJD 4NTZA 2DTXA 4UVDA 4PHFA 1VJ0A 4JYBA 1YQQA 1E4EB 1RM4A 4N4AA 4JGIA 4BO2A 1QX4A 1M2NA 5K6AA 5E4JA 2PYZA 4KRGA 2R85A 3CUYA 3WZ2A 5JJ5A 2MSNA 2VI5A 2W93A 1W85A 3BFXA 4DLVA 4FEGA 1EXDA 3RVJA 4MGEA 1TYBE 1EX9A 4P7KA 4V0LA 3E9DA 3HA7A 1WXQA 3SYRA 3OCVA 5SICE 1IATA 2G9NA 4I36A 4DMRA 5AR1A 4MAMA 5FRDA 4ED9A 2O4CA 2FSIA 2BT4A 5EGNA 1NMQA 2QM3A 1YZKA 3JAWB 3MJ4A 4MO9A 5D2CA 3B9QA 5FWAA 2Q8QA 3O3CA 1U5BA 3NONA 4HWRA 4Y7DA 5EA2A 3STYA 5LZ8A 4EG5A 1SBIA 2AX3A 4E15A 2O3TA 2PN1A 3GLKA 3K9HA 3LYLA 4IAOA 2WTBA 5CIQA 2ZAIA 1QGUB 1CBUA 2O52A 3NHBA 4E1AA 3FHOA 3MBOA 4B71A 2RHJA 1Z28A 3H5AA 1X19A 1US8B 1NDHA 4LS3A 2FB9A 4YJ3B 3A4NA 3HCFA 1Z18A 1EA7A 2CMFA 1E6KA 1L4HA 2J7PA 3G13A 3I9V1 3QUAA 3UATA 4ZMSA 5I48A 5P8WA 3GQBA 1VM6A 3O8RA 4LY0A 5FUYA 1C9YA 2Q6TA 4XB1A 4FKBA 5E6RB 3ZGZA 4B32A 4W5WA 1U2PA 1N3LA 3DPIA 3ESZA 1UAAA 4L3WA 3ZWOA 1B1CA 2V7WA 1I32A 3GJ0A 4EF5A 4GECA 2JRCA 2PVPA 4AF7A 5BN4A 4J4TA 3T1YB 2VDJA 3GZTB 1H3FA 5CNJA 5DYYA 2CL5A 4IIBA 3A70A 5KAPA 2AVDA 2OC9A 3WIDA 2A14A 3T0FA 4DDUA 1YKSA 4IGEA 2XVXA 3QP9A 2YV4A 3PJRA 1XZKA 5J4HA 1UOOA 5SZJA 4X0EA 1A9RA 5D51S 4EB6A 1YE5A 3UMSA 2ZR7A 1EE1A 2HBQA 3H8VA 3IUYA 3FCUB 3ZKAA 4DNPA 4ZDJA 1LDNA 2JNWA 3DBHA 3EQ9A 3NHMA 3SBOA 1QGOA 1ZXLA 2PAAA 3N39C 3P0JA 4PGHA 4B40A 4ENWA 1XI2A 2K6GA 2RGGA 2GEUA 2H7YA 4RZ3A 5KKAA 4GQAA 4GE0A 1SQFA 4MA0A 4R16A 4OJMX 3DMRA 4W8OA 5FFMA 1EVZA 1UBHS 3BXGA 1LPAB 3B38A 3FLAA 3MJSA 5K6RA 4X20B 2ZITA 1C7FA 1UT8A 1U2SA 2CEKA 3S1LA 1DWQA 4BEWA 5TGDA 3DV0A 1NU6A 4RD6A 4ZMRA 1OWLA 1U7PA 4D0RA 4DEVA 5LSAA 3I5MA 5C53B 1IXSB 1B41A 1KO5A 2PH7A 3D5QA 4Z0PA 4ZMBA 5KINB 1L8XA 1HETA 3AW8A 2WTEA 2AS0A 3ZZ1A 4J1SA 1C1XA 1NBWB 2QRPA 2C04A 2Q4EA 2XUIA 2YZ7A 5AVVA 3N8KA 1OH8A 1GL3A 3RWBA 1KEUA 1T6ZA 2O19A 2HC9A 3OQVA 3S1AB 2LIVA 1ZWLA 4OUDA 3U4CA 2PT9A 1Q21A 3DXYA 1BJKA 4B73A 3RF7A 4W5OA 2XD4A 1B16A 4B48A 1EM8A 2YN0A 3EZ6A 1Y5RA 3P2YA 4PYKA 3SBDA 2VQFB 4LY3A 3GW8A 1OTYA 1NSYA 2YZMA 4H60A 3GPCA 3QHQA 1M6HA 2ASVA 1ADGA 4PS1A 3LBHA 1G7SA 1YGPA 3I04A 2Q28A 1PFVA 5G3YA 4AWXA 3LFHA 2FN9A 4YJ2F 5J4YA 4ZAWA 4P80A 1N33B 4HDCA 3JQFC 3HU3A 2QPLA 3VO2A 2Z8ZA 1K4KA 1JIXA 3QVJA 4IEEA 4P2GA 4YRTA 1AF7A 5FX2A 2ZJ1A 4G81A 3UW3A 3AEUA 3P97A 1MUUA 2BKEA 2W2OA 3ZBTA 5H4GA 3GH1A 1AKVA 2HDOA 4ZC8A 4QLAA 3UENA 3A6HA 4K9MA 3COZA 5CYFA 1DQRA 2QTLA 1KP2A 5FHRA 4AY3A 3HYTA 3MWEA 4FXOA 1QHGA 2JJ2A 2J6CA 1RXWA 5KWEA 1XZNA 5KTNA 1P62B 4KODA 3A11A 5KU1A 2QXYA 2C0QA 1ZKMA 1T2UA 3VYVA 5EJ8A 3G7SA 4YP6A 1P6QA 2QL9A 1NKVA 1FW8A 1ZIDA 1TM2A 1O2DA 2G1AA 2VF5X 4UTZA 3CQ9A 4WOJA 1HTTA 1JR6A 2HN9A 5JJIA 5C46F 4JOCA 2E4VA 3WR5A 3KJIA 2B4QA 2DVMA 4TLAA 1Z9BA 2O2CA 4YWJA 5HUHA 4B83A 4HYEA 1W73A 3ZWYA 2AZTA 2BR3A 2PTHA 3MJHA 4MWDA 4OK5A 1U8CB 5EJIA 1NRJB 4NFLA 4A27A 1ZJYA 1ATZA 1ABFA 2FV8A 2NV6A 3FKSD 4NXMB 2Z5GA 4UOZA 4NS4A 1VHJA 4OI1A 3LBAA 1K3TA 1Q2XA 4DMUB 3DZ8A 3MIZA 1R7RA 3SIPA 1M5RA 1B00A 1FYWA 2XKJE 3JVEA 4ACBA 5FBLB 5HF9A 4B3MB 1FDIA 1THGA 1Y1RA 2AXEA 1P61B 3B2QA 4WJZA 5A6SA 3EVGA 2VWGA 2YXPX 3SN6A 4F3CA 2IXEA 4HQNA 4KV7A 2ZT7A 1U7WA 2RAVA 5C51B 2WSLA 3GC6A 3ICPA 4A2WA 4JI7B 1EHCA 3FZQA 5C1DA 1JDSA 2X2PA 1QHHA 5T4BA 4D9GA 5DHSA 3IQDB 3B2NA 4Z6KA 3UJNA 3AG6A 5AVXA 1Z6AA 3OZFA 2QKYA 5KJEA 3LSYA 5CLLA 1D5WA 3ZK7A 2QYHA 4M8SA 4MYSA 2QT1A 1RQ7A 4RF4A 1M5TA 5FWDA 1Z74A 1SPXA 5HDQA 4OQZA 3SEZA 3RQIA 1OFIA 3NLLA 1CRZA 3RIMA 3F1KA 5CXXA 1FNNA 2AN9A 2JIZA 1E6MA 1G1MA 3ACCA 2EBFX 1MDFA 3WTCA 2WJ3A 4BVJA 4ENQA 1L5OA 2HU5A 4JJIA 3E7FA 5DOVA 1NAHA 2YJZA 2W2NA 5C1PA 4URZR 3SOZA 1C8VB 5C5EA 4NYMR 5D6NA 4B6PA 3HDJA 3PPVA 5FLXA 1ACMA 1GNSA 4V3CA 3GRZA 2RKBA 4B2YA 1HDIA 1ST3A 4R2LA 4R98A 3ZQ6A 3VQTA 2IJGX 4IJ6A 3KB2A 2YNMC 1S9DA 2HRRA 1DAPA 2XVMA 5HJ5A 1C30A 5DXFA 4XXHA 3DEIA 3FOFC 4KWTA 2IYPA 1DTWA 3Q8MA 4RF2A 1PBTA 5LMZA 3SZLA 4D9NA 2O7SA 2G5GX 1TM5E 5AJYA 1DV2A 4QGFA 3D3JA 4WW0A 2P65A 3KAJA 3O26A 5FWXB 1IH8A 4OA5A 2A59A 4FHCA 4H6XA 3S40A 5TQ0A 3D4LA 4O8ZA 4QPZA 4FB4A 2JCYA 4HGPA 5JQGB 5JSHA 5E1BA 1DAEA 4ZI2A 1EBUA 2IYRA 1GQRA 5ALSA 4BX0A 2R60A 1H1TA 1Q92A 4URWR 4QNNA 3RS8A 3W7VA 1X1RA 2NT4A 2OWDA 2PJDA 2ZKIA 1KDRA 5EWLB 4DDKA 3F6CA 4AN1A 1E1MA 3T1HB 5C1OA 2OWEA 3UAOA 2F43B 1UPCA 2R751 1KZYC 3K35A 4J4HA 4J0GA 4LYHA 3A7EA 4OXXA 1T9BA 5EP3A 3K6SA 5AK0A 1WW8A 4TV8F 2YXLA 4KJXA 3BH0A 3KZVA 1NQUA 4MUHA 3T3MB 1WMAA 2MCFA 4F21A 5JJCA 4CFSA 1W5BA 5DM70 1XCBA 4C0SA 4MICA 3AF1A 1VMAA 1MB0A 2PH1A 3DAHA 4FGKA 2FHSA 4CR7A 2IOYA 1NX9A 4MQEA 1DC6A 1I2ZA 1CRPA 2M32A 2I34A 1BIFA 1H5UA 3RABA 4MWBA 1SUEA 3NC0C 3QOWA 4RXMA 3RREA 2BI7A 5L3ZA 4K03A 3FYSA 4TWRA 4UHEA 1KH3A 4BBPA 4GT1A 3DONA 1M34A 1UBUS 3T4UA 1J8VA 4HAWA 4AT1A 1BD4A 3WTBA 1EGVB 3K9WA 2JIRA 4XIJA 3NU1A 3RBXA 4J07A 2X0EA 1E94E 1BW9B 1ZJWA 1U9ZA 3S28A 1TNDA 2Y1EA 2J5KA 3GVHA 2B3DA 3TZ6A 1C3OA 2X77A 4PNZA 1HLGA 2WTNA 2HK8A 4ALIA 2V59A 1ISRA 3AR9A 4JIMA 4DSUA 5LM3A 1Y9EA 1RNLA 4QBGB 1E8DA 1XT6A 4PIVA 3Q41A 3P0EA 2XT9A 3RJ5A 4S1VA 5CMLA 4D8VA 4QAQA 3R7SA 4E13A 2BCEA 3HVIA 4Y2YA 1SBNE 1RLMA 3IRVA 4MYRA 3BCUA 3TNLA 2X19A 3KQVA 3QXXA 3TMAA 2WWVD 3VJKA 4Q3LA 1KY2A 3F8TA 3JY6A 2GPYA 2C4MA 3NAZA 3PL1A 4Y2UA 5ED4A 4ZVKA 2HLDA 4LV8B 4MP6A 4N5LA 5A5DA 1HORA 2Q29A 1C2YA 3ITEA 3PKZA 3BRSA 5F7OA 4KKVA 4HAUA 4YALA 1EP9A 1NPTO 1FU4A 3DOEA 4PXSA 4TT3A 4DA0A 4HNVA 4DLYA 5CT9A 1R88A 1IVNA 2DYKA 2RCYA 3AUTA 3QPBA 4PXYA 1KXJA 3QYPA 2I3DA 4FYMA 1U98A 3PHLA 3PQ6A 5BV7A 1WUHS 1THMA 3F5FA 3RKUA 3SYLA 5K4HA 1YJXA 3KB6A 2H52A 2JATA 1V1JA 3PJGA 2AZMA 4IVPA 2GVZC 2IS2A 4E1VA 4RPJA 3HDVA 4YUZA 3Q9NA 3RG8A 4QM7A 3UH1A 1LPSA 1PEKE 2EDAA 3SZMA 1WTAA 3C1TA 1XOIA 4UTXA 1MOQA 1JR2A 2AR7A 3RU2A 3UJ7A 4KN6A 1U9YA 4LHEA 2YRWA 4HK4A 3K2QA 1ZBDA 4K6FA 4PCLA 3UG7A 1T0HB 4EJFA 1E20A 1FQWA 2PYIA 3I2IA 1L5HB 2B92A 3P27A 2HBZA 4LNUA 4P3YA 1QK3A 1KU0A 1XWFA 4L15A 4PSAA 2HD4A 3H9QA 4NHOA 1QRSA 2QRZA 4BMDA 4DV3B 3C4JA 3C3MA 1CDZA 3A6JA 3D6MA 3LBYA 1NVGA 2GDJA 4N54A 5DX8A 4UQLA 1X8LA 4GZ6A 1YRYE 3E82A 5E6UA 5EJAA 1TT5A 3X43A 2X1MA 2HXYA 3TF5A 2O8DB 1Z22A 4DEYA 2C2YA 1XZLA 1LA2A 3DLHA 4KLRA 4OJNA 3D4BA 3RH0A 1SXJD 3Q15C 4KI7A 3R5FA 1C3VA 1Z7WA 1DKQA 3ROEA 2ZU0C 3TOSA 1GU1A 3EMBA 5CH8A 1ZR2A 4CV2A 2XA9A 1GFIA 4ZRMA 3L8FA 1IJFA 2GM5A 3T35A 4YRKA 2DCMA 3VPHA 2ON6A 1ORVA 1GTJ1 5FOVA 1MH1A 4DA7A 1ZH0A 4TWBA 1KJIA 1M8FA 1SXIA 3K8QA 3QIAA 5ABPA 1TUBA 1VXRA 1S2IA 2C0CA 2XE7A 4OQYA 4UARA 1NVAA 2A9RA 2B2CA 3HB5X 4BECA 3ILXA 2IEDA 5A3SA 3ZTWA 3A6ZA 2XQFA 4O29A 2ZT5A 1PWZA 4BE7B 3ANNA 1BXKA 3JASA 5I7AA 1YL7A 1ZGCA 4JP1A 3TTXA 4J0EA 2XMPA 2BDTA 3D8RA 2GAAA 4LJ8A 2NXWA 2QMZA 2AT1A 1DWPA 3B3GA 4DCJA 1KI4A 1DJNA 1FXSA 1M1XB 2RHWA 5JIBA 1O87A 1NTRA 1ORWA 2D2FA 3LUFA 4G8DA 3UY4A 3WRXC 1DC7A 4CL3A 1Z2OX 2X5JO 1DARA 3BHMA 2NSYA 3W9YA 1Q74A 4BJHB 3U4MA 2H4ZA 3MS2A 4P35A 1RQLA 4HEQA 4W8HA 3T1OA 3IOCA 2AX4A 2FCRA 4FC6A 2CXNA 3GJ8A 4CG2A 4E2FA 3QLTA 2R6R1 3RSZA 4R41A 1KI3A 3GJRA 2WD9A 4LJ4A 4H08A 1UBFA 1JG1A 3MSXA 5AXDA 1X7GA 2AQ8A 4ZU1X 2XB9A 2P4EA 2OGUA 3IODA 3LPNA 2WMOB 2DWQA 2OD9A 3M1LA 3K72B 3M6VA 4IP0A 5BN5B 1RQXA 2RD2A 1H3NA 3OA0A 3KQNA 3RJZA 3LMKA 5B6PA 2VP3A 1O96A 4NX2A 3Q2OA 4Y2HA 3TTUA 1E9FA 3ZGVA 2WHPA 1ZXXA 1HL3A 1O54A 3UQZA 1JXMA 4MSUA 2RGEA 5CXSA 5AK5A 1E3IA 4BNGA 2H7CA 3FCYA 4EL5A 2PWZA 2UUBB 4RTLA 4HNAB 3I2GA 3FBTA 1JUDA 4G5HA 4YMSA 3L1HA 4HX5A 2OENG 4NU8X 3ZXSA 4CLRA 4LGVA 2PH3A 3KOUA 2YYYA 3LGAA 3NAQA 1DZ3A 3MGKA 3DUFA 3RK0A 4MI3A 3WISA 4CTOA 3SQWA 5BR8B 1AS0A 4COOA 1Y6RA 2JI7A 4B35A 1CCWA 1NQ5A 2Q6IA 3GLHE 2A88A 1C9EA 2CJWB 2W6PA 1SB9A 3K0FA 4EA9A 3RUDA 2O3SA 1XPRA 4FCWA 4UUOA 1WP4A 2AE2A 3TKAA 4P4NA 3PI7A 1KEPA 2QA5A 3HXQA 2GRJA 4HOYA 4WGFA 5HKBA 4TRJA 4JOQA 1RQNA 1TD1A 2DWPA 2VCHA 4DSZA 1P19A 3HC7A 4IJKA 4EPXA 1EUCA 4X94A 2CN1A 2DP4E 4BLTA 4DT1B 2AFVA 4IHJF 3K7EA 4IKEA 1J00A 2YL2A 4LISA 2FDRA 2Y8EA 5FI5A 2OFFA 2QTWB 4Z54A 1F48A 4U1RA 4NU6A 5DDIP 5IJAA 5K4AA 4CF6A 4OYYA 1LK0A 5DMHA 2A0KA 3KG2A 2WWIA 3L8CA 4M1SA 2IX3A 1WXGA 5EQJB 5HRAA 3DQZA 3PNLA 3FVTA 4OHVA 4M0LA 1JQLB 4RA6A 4EKIA 4PX2A 3G2HA 1H6CA 1H8HD 2FSGA 3BTVA 2ZT8A 3CMCO 4LYAA 2DG2A 2BM1A 4N76A 2JHCA 3SYKA 3QKUA 2PFKA 5CBPB 1U6JA 5H81A 4PF1A 1Z8NA 3G17A 4H7DA 4RNDB 5A9TA 4A5OA 4JP3A 1YRHA 3BGDA 2PZJA 5AI9A 4CQMA 4EBFA 4L5CA 4Y2SA 2FLKA 2YWEA 2VH5R 3EXG1 1G21A 5K3BA 1RWPA 3O4RA 2J9GA 4BWFB 2G9RA 2REQA 3A37A 1IL0A 1VBKA 1EVYA 2FSVA 1VE7A 2PV0A 1R6AA 2F67A 2ZYIA 2K2QB 3GCZA 4H4CA 4CHTA 4NMXB 2OLJA 2WJPA 2L0XA 3HA5A 3MD0A 4Z2AA 1QP4A 2LE0A 3H11A 2CBZA 2O1SA 5JFOA 1SHLA