1LJUA

X-ray structure of c15a arsenate reductase from pi258 complexed with arsenite
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
131
structure length
130
Chain Sequence
MDKKTIYFITGNSARSQMAEGWGKEILGEGWNVYSAGIETHGVNPKAIEAMKEVDIDISNHTSDLIDNDILKQSDLVVTLCSDADNNCPILPPNVKKEHWGFDDPAGKEWSEFQRVRDEIKLAIEKFKLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords arsenate reductase
publication title All intermediates of the arsenate reductase mechanism, including an intramolecular dynamic disulfide cascade.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Oxidoreductase
total genus 47
structure length 130
sequence length 131
ec nomenclature ec 1.20.4.4: Arsenate reductase (thioredoxin).
pdb deposition date 2002-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01451 LMWPc Low molecular weight phosphotyrosine protein phosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1ljuA00
3Q9SA 1SRRA 3EGCA 3QELA 5KI6A 4RKRA 2FN9A 1PEAA 4XASA 3CS3A 1P6UA 1YS6A 4JB2A 3EDCA 1JYEA 1QO0A 3N8IA 3RVQA 1D1PA 5F64A 1K68A 4RWEA 2A9PA 1EWVA 1RPJA 3H5OA 3OLZA 2J48A 3IPCA 3JY6A 3O2SB 1RZRA 3CZ5A 6CHYA 1GUBA 2R4QA 1JYFA 3NNNA 2WWVD 2H3HA 3LUAA 1NXOA 2JCGA 4Z4CA 4KREA 1LBHA 3JPWA 3SM9A 4MPTA 1FQWA 1DCFA 1RNLA 2PLNA 3FFWA 4IF4A 3LKBA 2OQRA 1Z2DA 4RZSA 5B3JC 3OO0A 3HCWA 1YS7A 1KRWA 3KSMA 4M88A 2JBAA 4JASB 3TD9A 2F8SA 1BVHA 3RVLA 2E4XA 3HM9A 3OQOA 4G0MA 4RU1A 1Z25A 3MIZA 3LUGA 3N0WA 3UK0A 3LTEA 1NXPA 1NXVA 3C3MA 2L18A 1HEYA 1E2BA 1VRVA 3K4HA 3OQNA 2HQBA 5IUJC 5E3JA 5KQMA 4W5NA 3O75A 1YIOA 3LMKA 2FTKE 1QQBA 4RXUA 3KTOA 3RVKA 4MAAA 3T95A 4HNRA 4IMIB 1MVOA 1PNTA 3EAFA 5KC9A 1A0OA 4RK4A 4NCBA 3LUJA 2JK1A 4OLAA 2QR3A 2WMYA 4PICA 4XFKA 4B09A 1VPWA 2MYUA 2WJWA 1W25A 5IEBA 1DBPA 4PZ0A 5PNTA 5FBHA 2FVYA 3N53A 3VNAA 3CU5A 1NY5A 3C3KA 1ZGGA 4HNQA 3EQZA 3LUCA 3FFTA 3OMWA 4KK4A 4O1HA 2NZVG 3EJWA 1A04A 2ZWMA 3QK7A 4RXMA 4MR8A 5TQ2A 3HVRA 2JB9A 1GCAA 4IILA 3HXMA 1ISRA 3EODA 5HQJA 4KFCA 2F8TA 2IOYA 1FFGA 3LUDA 2IYNA 2NUBA 3HV2A 3QEMA 3KJXA 3JS5A 2CHEA 1GCGA 3G1WA 5FWXB 2B1JA 3SAJA 2P4UA 2RJNA 3GYBA 4KRFA 2JBAB 3I45A 1QPZA 3IP6A 4JB0A 1DBQA 1SXIA 2ID7A 2GKGA 3KLNA 4XARA 1EFAA 1JF8A 2XDYA 3IP7A 4ZMSA 1DCKA 2QU7A 2CHFA 2VUHB 4MLCA 2B4AA 1DC8A 2FMKA 5KWSA 1Z12A 2RDMA 4LE0A 1JFVA 4MGEA 1ZESA 4Z4FA 3OQMA 2RJOA 4YLEA 3N6VA 4FE4A 1ZY2A 2WRZA 3RVOA 3EULA 4D74A 2FN8A 3D8UA 3A3KA 2PJUA 1NXWA 3A10A 1JX6A 3O74A 4YO7A 5TPWB 4DN6A 1Z26A 2A9QA 1Z15A 4HYEA 1H9CA 1TVMA 5FWYA 3T6KA 3KS9A 1W9HA 3QEKA 4RK1A 4F3TA 2ID9A 3HJFA 1ZDMA 1NXTA 1GLGA 5KC8A 4JP1A 2A9RA 3CG4A 4MR7B 2CWDA 3GBPA 3IPAA 2PE5A 4QYWA 2FXIA 4XAQA 5JS2A 4RV5A 2E4VA 3GBVA 3Q7RA 2QZJA 4IGAA 4MR8B 2PUCA 2FEPA 4RK0A 2P9HA 1YK1A 5JNTA 1D1QA 4E7PA 1NXXA 1TMYA 3CTPA 2A9OA 3OM0A 5EWLB 3DLHA 1C4WA 3OO1A 4WXEA 1TJYA 1YMVA 2FQWA 4S04A 3UUGA 2FQXA 7ABPA 1A2OA 4Z4IA 2MSLA 3GWGA 3KHTA 8ABPA 1YVUA 2HQOA 3R0JA 3FFXA 4KQ9A 4PEVA 5CHYA 5IC5A 3K9CA 4W5RA 1F4VA 3NHZA 1ZN2A 2PL9A 5IUKC 2H0AA 5IX8A 4WT7A 1PUXA 3M9WA 1TM2A 4L85A 4QPJC 4NICA 2FMIA 2PAFA 2R47A 3I5AA 2WY2D 3H5VA 1PEYA 4RKQA 4LX8A 3VNBA 5C5EA 4RS3A 4YGXB 1OXKB 5ED4A 1M2EA 4GNRA 4EYGA 2JVKA 4F12A 4YV7A 2GI4A 4MR9B 3LOPA 2QV0A 2HPHA 5DCLA 3Q15C 5FWXA 3O1HB 2PL1A 1J56A 3HEBA 4RY8A 5FWYB 1ZAYA 3NBMA 3CNBA 1JLKA 3GV0A 5D2CA 5CNKA 4EVQA 4EGSA 1KMIY 2IPLA 3RVNA 3DBIA 4MS1B 5DTEA 4OATA 4MLDA 2M98A 3L49A 1L5YA 3QX9A 4Q6BA 1SXHA 3HZHA 5EWJB 3H75A 2IDMA 2MSKA 4S05A 3C3WA 1QNLA 2L2QA 1MAVA 3DGFC 1JHZA 2FEWB 3MA0A 3HO1A 4W5OA 2CD7A 4RY9A 1DCMA 1M5UA 1U2PA 2FKAA 4Q7EA 2JVJA 2DRIA 3KYIB 5TPWA 3KLOA 3MQ4A 1Y1LA 3P9YA 2NT3A 1QP7A 1DG9A 4N47A 4LZLA 3A0RB 1M5TA 2MSWA 1E6LA 1JDNA 1QP0A 4RDCA 3KCNA 2QXYA 2GWRA 2E4ZA 2FW0A 2LBPA 4OLBA 2QW1A 1BDIA 3QLUA 4G0ZA 3CG0A 4P1ZA 3H1GA 3F6PA 1JBEA 4MR7A 3N0RA 4N41A 1PHRA 5EWMA 1P2FA 1Z18A 4ZMRA 1SD5A 3RVSA 1ABEA 5BQ3A 5EWLA 9ABPA 1JWLA 2FLWA 3HSYA 3M6MD 4WXMA 3TB6A 4CBVA 1JFSA 4QYMA 3D02A 4G0OA 3OMXA 1F51E 4QICA 5HM6A 1CHNA 4RK6A 3RVRA 4EYKA 5IULC 1KGSA 3RVJA 2IPAB 5KQPA 3RQIA 1Z17A 2PUBA 3H6GA 4FB4A 1QP4A 2IPMA 4XLTA 2AYZA 4UHKA 3I09A 3LUKA 5T3YA 3H5WA 4H3KB 2E4UA 3BILA 2BGGA 3BRQA 4WZZA 4F06A 2OENG 3IDOA 1KRXA 3C6QA 4KVFA 4Z0NA 3DGEC 3EQ2A 2LPMA 1USKA 4MR9A 1I3CA 1URPA 4G86A 4MS4A 3O1JC 3OLYA 1Z13A 5TQ0B 4IRXA 4ETIA 4MYRA 1U8TA 3F73A 3QLTA 3HDVA 3BBLA 2FMFA 4MS1A 4WWHA 3ILYA 5BRAA 3MF4A 5EWJA 4Z4GA 3RVPA 3CHYA 5JNWA 2O20A 4LRQA 4H3HB 4TLMB 5EWMB 1PNRA 4LE1A 5IEJA 3E61A 4G0PA 2GBPA 3H5TA 1D2AA 5DKFA 1DP4A 3T38A 2HJ9A 4ETMA 1WETA 1ZVVA 3FMVA 4TN5A 4HNSA 4MRMA 1YMUA 2YHAA 4GPAA 3O2QB 4RY0A 4Z99A 5JNRA 1EHCA 3JTEA 4OTZA 4YS6A 1U0SY 1QMPA 3I42A 4Z9AA 2LP4Y 2PUFA 2IKSA 2PUEA 3LFTA 1P6QA 5T7BA 1YK0A 1YTUA 2MYNA 3HDGA 2WJAA 4PYRA 4IMJB 4O5AA 5JNUA 4DQDA 1M2FA 2N9UA 5BR1A 1U04A 2IPNA 2QSJA 4TMYA 1BDJA 3UKJA 4N0QA 1ZHHA 3DLBA 1LJUA 1D5WA 5C5CA 1RXEA 2ZAYA 1ZGZA 4EY3A 1NTRA 3N75A 3FGZA 1BDHA 3MM4A 4WUTA 4Z4HA 3ROTA 1ISSA 1B00A 4L4UA 5DLEA 1DRJA 1DC7A 1MIHA 1E6MA 2I6FA 4E7OA 5JNSA 1GUDA 2X7XA 2M1ZA 4MS4B 1AB6A 4MQFB 4O1IA 4N0PA 2GX6A 1LJLA 3QX8A 5B3JA 2FEKA 2FSPA 1FFWA 2PUDA 2MYTA 4YCSA 3NHMA 2W42A 4JA2A 4EYQA 1Z16A 3TO5A 4ML3A 4KNYA 4KZKA 1ZH2A 3JPYA 1USIA 2PMCA 3F7NA 5GQSA 5IBQA 3HK2A 2VK2A 2QVGA 1U2QA 1TLFA 1DBWA 3HUUA 3S99A 3H5IA 3GL9A 1FSPA 3NNSA 4RXTA 3JVDA 4MRMB 5JS1A 1JFTA 1Z2EA 4ZJPA 5KQGA 1L5ZA 1OXBB 2KYRA 1K66A 2Q5CA 4XXHA 5TQ0A 4EVSA 5KQLA 3A0UA 3IP9A 5TPZD 5ABPA 1QQAA 1XHEA 5CNIA 4RK7A 1D4ZA 1USGA 3HS3A 3CZCA 4MS3B 2NT4A 3CLKA 4G0XA 5DGCA 1C0EA 5HSGA 3L6UA 2MYPA 4G0YA 1APBA 2L19A 4F8JA 4ZYLA 1BAPA 2PUAA 1S8NA 3SQNA 3KYJB 1LK0A 4ETNA 3NNDA 3JVIA 3LUFA 3H5LA 5JNVA 3MYYA 3RVMA 3BRSA 1T34A 4W5QA 3TMYA 3O1IC 4Z9BA 3SNKA 4LDAA 4UHJA 3QLUC 3QELB 5I4CA 1EWTA 3ILHA 1MB0A 3QLVA 1NXSA 4MQEA 1CEYA 1AB5A 2R48A 1XWWA 4YWHA 4NQRA 5TE9A 4PE5B 4TLLB 3H1FA 3Q41A 4KMRA 1NATA 4NV3A 2E4WA 3H6HA 3Q7SA 2JRLA 2LIVA 1JL3A 1QO0D 4G97A 5CNJA 1R8JA 1VKRA 4D6YA 1VLZA 1JH9A 3LUHA 3QLVC 3OLVA 2HQRA 1UDRA 4FE7A 1JDPA 1RZRD 4RK5A 3B2NA 4EVRA 4NCAA 3LKVA 4JAVC 1ZITA 4MQFA 3URMA 2HSGA 2R25B 4LE2A 3TX6A 2FLKA 4F11A 2PUGA 1XHFA 2RGYA 2QVCA 2FMHA 3G85A 2AYXA 1IIBA 2LUOA 4DADA 3FDFA 4Z4EA 1DZ3A 4N76A 4Q6WA 5GOTA 6ABPA 3OLXA 4H60A 1QKKA 4W5TA 1EWKA 5TQJA 4D6XA 4G0QA 4RSMA 4N03A 2L17A 2VYCA 2FQYA 3HUTA 5BRJA 1BA2A 1FFSA 3SY8A 3O2JA 1LBIA 2VUIB 5TPZA 2NZUG 1SXGA 4YP9A 3Q7TA 4YR7A 3O21A 3E3MA 3GRCA 2WB4A 4ZPJA 3N0XA 4OBBA 2E4YA 1ABFA 2YHBA 5FBKA 3BREA 4EYOA 5IUNC 1E6KA 2TMYA 4MS3A 3KG2A 3GA5A 3ROFA 4MQEB 3W9SA 2JVIA 5CNMA 4KV7A 1P8AA 3IP5A 4JOQA 4KK3A 3M9XA 3DZDA 3OLWA 1EAYA 5TQ2B 1ZH4A 3MMNA 4EUKA 4Y9TA 1RXIA 4LDZA 3CRNA 4OG2A 2V0NA 3C97A 2PKXA 1MB3A 3T8YA 1DRKA 3CFYA 1DJMA 4KPYA 3QEMB 4YRZA 3CKMA 3H1EA 3KKEA 3GT7A 3OM1A 4KQCA 4P98A 3SG0A 5HKOA 1CYEA 3RH0A 3F6CA
chains in the Genus database with same CATH superfamily
3E9CA 4B76A 1ZIXA 2GUWA 3TFOA 4XASA 1UJ6A 1YB5A 2PX6A 5ALOA 2VYFA 1R64A 2IPOA 2P4EA 2WSIA 2C98A 1JPVA 1KEPA 2YVQA 4HDKA 4QRHA 1T15A 2WAYA 1S7GA 2RKBA 2HNAA 3QXGA 4HOYA 4MVJE 1H2WA 4PLHA 4RDIA 2XF8A 3DH0A 4LY6A 3FCXA 4KRFA 1RQNA 4NJOA 4O2AB 3QJGA 3BRWD 3PUWA 5F51A 3R7NA 5LQAA 3TI7A 4X6YA 4GLLA 2D2IA 4ND1A 4R1LA 1NP3A 4KBYA 4S0XA 3BUSA 4W1SA 2CYAA 2JHFA 5EMMA 4E5UA 3IAS6 3FTFA 5CLLA 4JY7A 5IM4A 1C9KA 1RNLA 1XHLA 3MMZA 4GVPA 4II2A 1VCOA 3LKBA 2AXPA 3FNFA 3OJLA 1Z2DA 4EL0A 3WLOA 1W4ZA 1GGNA 4PZAA 4Q16A 4QLOA 4UAJA 3KU1A 1KRWA 5EE5B 3RKRA 2P1RA 4DVJA 2O19A 4RFLA 4FKMA 3FCCA 5DSZA 4OAOA 3WO1A 2CUNA 4F4CA 2Z04A 2JJQA 3GVIA 2GARA 4WN9B 1C1DB 3PXUA 2E0IA 2BHSA 2FZCA 4BLVA 4S12A 2OCKA 2RHRA 2Q5LA 1UBSB 3RSOA 5DNUA 3JQRA 2PKQO 3RODA 3J7TA 1VI6A 4JQSA 3QGMA 4PLYA 4BN5A 3PX2A 1AZSC 5B2ZA 3KZMA 3D4BA 3Q40A 3Q12A 3ZHVA 2O2GA 4LV8B 1KR5A 4XB2A 1GHTA 5C8YB 1NP6A 4DBVO 1D2GA 2B4KA 2C3MA 4MICA 5F2EA 4N9QA 3C87A 1DDGA 4RA9B 2IH5A 3A9TA 5TMDA 3HCDA 1DX4A 2H00A 4J16A 2JIBA 2EP5A 1YULA 4D9KA 2AUTA 4HSEA 5IEBA 4ESVA 5G4LA 5DXAA 2ENWA 5PNTA 3M6AA 1W5AA 2W2NA 2J3IA 3BIJA 4A15A 4MUIA 3NMUF 4OBWA 1RCFA 2W4MA 1KDOA 1UC8A 1XJ0A 3Q7QA 4O1HA 1U9YA 2DFTA 4I1RA 3K71B 4ND7A 3C15C 3SQXA 3IT3A 5LQCA 4B3TB 4DA6A 3ZHYA 4PO9A 3T3GA 1VJDA 3TIIA 2PTGA 5ALLA 4O02B 4LVOA 4OP3A 2R66A 3A4LA 5AUOB 1JPUA 4LVUA 1UBMS 1WLSA 4BO9A 4B5LA 4LHXA 3OIDA 4I1VA 2VZLA 4QHYA 2BEJA 3AMVA 2OAEA 1NGSA 1V9LA 1MOZA 5JG7A 1EFAA 1ADFA 1U2RA 2QE6A 2CHFA 3L7CA 4G01B 4IZ6A 2QMZA 1ICEA 2YY6A 5SZKB 2JATA 1G6OA 1ZM7A 2V4UA 3CLVA 3VTKA 3TWOA 2E5FA 2IS4A 4ESOA 2IS2A 1ETUA 1WZNA 2B1IA 2W98A 3CT4A 2ZEJA 1LPNA 4L4SA 1G55A 3RJ9A 2B35A 1CQXA 2GZHA 2W6PA 4YRTA 2FN8A 3AR2A 2WWYA 3MWLA 4BQRA 1M0SA 1J2JA 3GJ7A 4Q05A 2E1RA 3DTYA 4CCAA 2FEXA 4E2XA 4F3RA 4E5NA 5A2GA 2O2EA 5DN6D 2DT5A 4WH0A 2ZRAA 1P1JA 3CZMA 1EXWA 1VJRA 4QFBA 1RM3A 5K0TA 5KNBH 5LQJA 3SR3A 2AZXA 2QZ9A 2Q9BA 1DIRA 4AG3A 3UW1A 2YWXA 5IKPA 2XUFA 4RVFA 4L9RA 4MSUA 4CM4B 3SGLA 5AIAA 5KYWA 1MO4A 1Q1AA 3A70A 2WAXA 3EGDA 4L9SA 4AKIA 4MW6A 4QM7A 2X2EA 3R5SA 4MCHA 1IK4A 4Q0MA 2N1MA 1F8XA 4ND8A 4DJEC 1A69A 4JHXA 5GJWC 4YAJA 3W6ZA 4C03A 5C52B 5T4HA 3DLHA 2I33A 3X0DA 1KA9H 2FQXA 4N40A 1HDGO 5JD5A 3TBKA 1HETA 5EIOA 5AKEA 4EHFA 2BHLA 3M4XA 4BIIA 2HJWA 4R40A 2DU8A 4DTCA 2C00A 2JD0A 3UTDA 3OY2A 4EPRA 2C9OA 1H69A 3LHFA 2G09A 4DXAA 2PTHA 3CF0A 4ILEA 4DMMA 1T5SA 2DFKB 1DLIA 3NT2A 4I9HA 4EG3A 1JAZA 4NICA 2R47A 2FP4B 2QRNA 3AZOA 1FRFS 4F7WA 4V3CA 1E4YA 1ENOA 1E4VA 3PC4A 4ZEXA 1YRYE 4K28A 1FA9A 1Q1ZA 3K1YA 3JD2A 1Q1BA 1VB3A 2C2GA 2XEXA 1GU0A 4KDEA 5EQDA 1DS6A 2VSFA 4D4GA 3QPBA 1HFKA 4V0LA 3V7NA 3FTEA 4OUKX 3C8DA 1X87A 1J56A 5FWXA 3SU8A 1YFJA 3RD5A 4WGFA 1PJ3A 1JBQA 2GDJA 2CSUA 2R4TA 3L41A 1GQRA 5A4DA 1LLDA 2XUHA 1NKTA 1QYDA 6LDHA 1PV4A 1DC4A 4OO3A 4QAJA 4C87A 2Y8EA 3EPRA 3IBYA 4CLOB 3AJEA 1ZGHA 1R27A 1PJCA 4QYSA 2JFHA 2ZYHA 3PGJA 1QLJA 1JHZA 3KB2A 3K0KA 3OPYB 1U31A 1T5DX 3DC7A 1I4LD 621PA 5KYWB 4DJAA 3EGDB 2W2KA 4BV2A 5FLKA 2FR8A 1Y6QA 1K88A 4ND8B 1BFKA 3E15A 1G64A 1Q95A 1T8UA 2AOVA 3HU2A 3MQ4A 2GZMA 4YRFA 1VSBA 2Y27A 3D3EA 4BMNA 3FWYA 4CTOA 5L4LA 1W0CA 1M5TA 2MSWA 1PP4A 4AF7A 1JDNA 2VH2A 4YI5A 4RDCA 1VHLA 2QXYA 1XZIA 3OKFA 4KQ2A 3PITA 1E1DA 4YIHA 2EFDB 2XUOA 3ZZ0A 1SVUA 3IUMA 2PXAA 5EIBD 4BBPA 4TWZA 2O1WA 4C0BA 3FCYA 1RYYA 2G83A 1UZAA 4QHSA 3WNDA 5BPHA 3QE2A 4RA6B 1YQGA 1HWYA 3NPMA 2CW5A 1E3IA 2YVLA 3QW4B 4LXYA 4URFA 4XGIA 5DYGA 3S2ZA 1ISGA 4OHVA 3OEED 1L5KA 1YUBA 1Z75A 2VSNA 5D3ZA 2OO7A 5EG5A 3DULA 1FDIA 4YREA 4ALMA 4ENRA 2NO0A 2NTYC 3NIDB 4UBNA 1GIAA 3R20A 3S8MA 4ZOQI 5CFRA 1AV6A 3EGOA 3OMXA 3PHHA 2FZEA 3DKKA 4J1SA 4KTTE 1ZHFA 1UIMA 1CHNA 3N6XA 3PL1A 1XEWY 4KR0A 4IXDA 3DEYX 3LF2A 5A06A 2NN3C 5IULC 2W83A 5ANRB 1HYQA 4KXYA 3VH1A 2FFJA 2WD7A 4CKBA 4FP9A 2JZCA 2UAGA 1YZTA 2WJYA 2JF0A 2FWMX 5C1BA 2ORED 1KQNA 3GDGA 5AVQA 5EJ5A 3LL7A 2V7GA 3ZWBA 2BCEA 3QEOA 5DHUA 4WX2B 1A1VA 3QTBA 4A8TA 4DMHA 1WUHS 2C2OA 1TYDE 3GLTA 1E32A 1PGQA 2ZSAA 3IKVA 3QKWA 4W7HA 4ZYYA 3MHTA 2ATCA 4KGZA 1JTFA 3NLLA 2C2YA 3R3UA 2PGNA 4JENA 3W9BA 5E4JA 4M6WB 3DEZA 3LXXA 5J23A 2Y1LA 3MXOA 4B3GA 3ASVA 2Z3ZA 4CMGA 4I19A 1PJTA 4PC3A 2QXUA 3T7SA 4RUKA 2GEJA 1G5QA 1EA5A 1OUMA 1L1EA 1Y4ZA 3FTCA 1WZIA 3GJZA 3L0YA 4JX9A 4LA4A 4MIEA 4AKGA 2ZYTX 1BNCA 3NYWA 4L5IA 3H2ZA 3ILYA 3TRFA 4K03A 1E9AA 3ZIUA 4LVNA 2BL4A 4UDOA 3RSZA 2PSEA 3QLEA 1V71A 3OQ1A 4BBAA 5JH7F 1GOTA 3LYHA 3HB5X 3QI2A 5BQXA 4L9WA 3GZJA 1MO5A 3IB6A 2WR8A 4O3MA 1U8AA 3EF1A 4A0FA 4LE1A 2FQ1A 4Q4LA 3DCJA 3DWEX 3GNQA 4KUEA 2VEOA 4G0PA 3H5TA 4BTEA 3BYZA 3BOSA 3BPSA 2UVPA 4BNNA 3D4OA 3S1SA 1JG1A 2JNWA 3B5IA 3EOBI 3K53A 3R6TA 4Z99A 4KE7A 4J75A 4JELA 4RVGA 3ND8A 1QMPA 4MCJA 5LYJA 4D3XA 4EUHA 1UT5A 4PNEA 1P6QA 1X14A 4LSGA 3ROZA 5ALRA 4EECA 4ZHQB 5DI3B 4D0SA 3VAAA 3OKAA 4MVCA 5BNTA 3T61A 2NXJA 1Z45A 1FZQA 2ZPAA 3GRAA 3UJHA 4RDXA 3BTVA 3OZCA 3UKJA 3B5JA 5JI3E 4QECA 3C6MA 3JWPA 2R9VA 5EIBC 2PJRA 3CWZA 4U8GA 4DDTA 4HT3B 3T34A 3RK1A 3SSNA 3OUTA 5D51S 2EU8A 1NRJB 4A2CA 4IEFB 4Q4JA 1R0RE 1XLWA 5EKUA 2M2IA 4OSOA 1W88A 3HCFA 4LRYA 3SDBA 4MW9A 3WFZA 4PQRA 4PG6A 4ZCPA 3OIFA 1ORWA 2GX6A 2GYVA 3LG2A 5I8WA 4KGVA 1D2RA 3GCDA 4GF5A 4QC2A 5B3JA 1HEUA 3DZBA 2A1TR 4DDUA 2BH9A 1K2WA 1VYHA 2JH3A 1NULA 3KP1A 3A6ZA 4EYQA 3M0EA 2AI2A 4Q3LA 2WAOA 3GLKA 2C7QA 4D4HA 2BZSA 1OH7A 1KS9A 2OGZA 4MRRA 4DRXB 3GPIA 1LX7A 5GQSA 5IBQA 4JJ6A 3D7MA 2YVAA 2QVGA 4I1SA 5BSGA 5F2NA 1NG9A 1CY1A 1KHHA 1P4JA 1SZPA 3GG9A 4V02A 1H2HA 1C30A 3EZ9A 1PWZA 1Q0SA 2XTMA 1RADA 2Q5IA 1CTQA 2NTNA 2YWRA 3KWFA 2UVPB 1C1YA 1PZXA 2F3QA 2XUZA 3MNFA 3ORQA 4JT4A 1JFFA 4GZ6A 4RQBA 5DXJA 3GEHA 5TC4A 1ZHOA 5U4QA 3BJEA 4EF4A 4CDRA 5ILOA 5ABPA 2IUEA 2FRDA 3CCFA 5IT4A 5DM2A 3HS3A 5EKXA 4MS3B 1NVFA 1XN1A 5B4TA 2BFEA 2VK4A 4C7OA 1JEAA 4RHFA 1DAIA 3MFQA 5AKYA 4UNIA 4R1TA 5FHQA 4DAOA 5A4FS 5JR3A 3ADCA 2PS9A 3O4VA 2GK7A 2OGWA 4LJSA 5AHOA 3ZIDA 3GFFA 4IWNA 4OXKA 4WA7A 4ZT6A 1NVMB 3NPAA 4XDGA 1P33A 1C3LA 1QGUA 2Q29A 2XMPA 3OFND 4ZC8A 3WIDA 5LWQA 4IH1A 4GBED 5CA0A 3I9MA 3O1IC 1DBRA 4K3VA 1C5KA 1WXXA 4UFNA 4RFSA 2YMPA 4F4DA 1VCNA 2VOEA 1W88B 2H7VA 3FUXA 4UULA 4DZRA 3U4QA 3LGXA 4Q9AA 5EHIA 3GEPA 3SD7A 3UJ3X 5A02A 4EPTA 4B45A 4RKFA 4Y6QA 3D3KA 2OFXA 3UFXA 4B3SB 5EUQB 3U3JA 3H1FA 4AMUA 2JLZA 3O9MA 5I7SA 2ANCA 3LBAA 4UD6A 1U5CA 2BJVA 2VTDA 2CNNA 4JP5A 4ZT7A 3Q7SA 1WXQA 3IQEA 1BE1A 1Z8FA 1EH5A 3CH7A 3F6RA 2DUUA 4LC9A 3BEOA 3LUHA 4MEJA 2KQUA 3G23A 4U2CA 4YRKA 3Q2IA 4MAMA 3NVKI 3NASA 4XD7D 4RK5A 1X38A 1U6IA 1YOBA 2ZT7A 3ZV3A 3MCVA 4EPXA 3Q85A 4ZEVA 1JFFB 4UXHA 4BLRA 2PD3A 1QHHA 3NT5A 4O2LA 4WJLA 2H48A 1GSHA 3D2LA 2WKRA 2ZULA 1Q91A 3KAJA 1W2HA 1PT8A 2FMHA 3NBAA 4ZAFA 1F6WA 3CRMA 1FNNA 1Y3IA 2CXXA 1YE3A 5FRDA 5HF8A 3R1IA 3SOPA 1HFEL 2BFEB 2VP6A 4BRZA 4DADA 5IJ9A 4L4RA 1YR9A 4UE6A 2Q3DA 1EM6A 2BKVA 3DE7X 2QUHA 3C1TA 3KZXA 3PF9A 1FDOA 3P0JA 2BP7A 1ILWA 1PGOA 4GQAA 4UJ5A 1V4BA 4C14A 4DBLE 4J4HA 4HATA 4LZWA 5IT5A 2AE2A 4KWCA 4AJ9A 1H2AS 2QRKA 1BA2A 1O89A 4CQLB 4Q1VA 2GM5A 3N59A 5CFZA 3LWZA 3SC2B 3MUOA 4QTYA 1YNSA 1P2SA 2HA3A 5KKAA 3S2IA 1ULUA 4IDOA 2BT4A 4I3GA 3UA4A 4E31A 2GESA 2WB4A 2WWRA 1NM5C 2QU8A 1YRWA 2R5NA 1NONA 4QYIA 2A1UA 3U4QB 1XZEA 5ER6A 3TFQA 2ZYRA 4KFTA 1Y3DE 5F1KA 2X5XA 1PGPA 1RI4A 1L4BA 3HJTA 7MHTA 1ZU5A 2QP9X 3K1ZA 1LRJA 1G5HA 1YB6A 2WFZA 4GZ3A 5BT8A 2Z6UA 4IVNA 3VZRA 4OX9Y 2G7MC 1TVKB 3W2TA 2JI6A 1UWVA 3V8EA 4Y2TA 2V9ZA 1MQ9A 2PBZA 4RHTA 4RSHA 5DNWA 3R7BA 3RV3A 1XBTA 1IHDA 3GAFA 3R7DA 3FDJA 3MTJA 4YRZA 3BFXA 5FOTA 3G6WA 3I37X 3EGVA 3L1IA 2HBYA 2OYCA 3RH0A 2P9FA 2N3ZA 2PIAA 3PKIA 3Q9SA 4IIDA 4Z1MA 3TQOA 4NNPA 2P6PA 3UKDA 1QHHB 2R6CA 4CU2A 5AYVA 1V3UA 3HSSA 4RTSA 3BTSA 3RVQA 1M8GA 1CD5A 1TB4A 1NY6A 4A10A 1AHNA 2GEVA 4X66B 2Z8YA 3MLAA 2IY7A 5IJ9B 4I46A 1BX0A 3I8SA 3EIUA 1HPLA 3F97A 4TSFA 3O2SB 5H0IA 1KQ3A 2Z8ZA 4ZEMA 3E1SA 5JD6A 9ATCA 2V7XA 3NNNA 4CT5A 1N2GA 5DLDA 3AJ8A 3BH7A 1RRKA 1J49A 1PZMA 3HCNA 1XRRA 1Y1RA 2AF3C 2X7HA 3IHKA 4EDHA 3KTFA 2I5PO 5LJLA 4P8RA 3IDSA 5JSYA 5KOIA 3EVDA 1WDWB 5CR9A 1CZKA 2N75A 5CAEA 3FE2A 3BAFA 4LJYA 4M88A 1AGYA 4E22A 1E98A 1RBMA 1V96A 5FPKA 3HM9A 1ZGJA 3ET5A 4ZT2A 2QAGC 2GETA 3K8QA 5J2UF 1PLJA 1FDTA 3UK0A 4M46A 3NTLA 1ZVJA 3LTEA 3GF4A 5ESDA 3WKEA 4B44A 2CHVA 4BNKA 5JTTA 1J8FA 3EBPA 8ADHA 3I6YA 2ZTSA 1HY3A 1AK1A 1I1QB 1UZUA 3HCRA 4EWLA 4L3OA 1LXCA 4F6CA 3HHEA 3TLGA 2KLHA 1SFRA 3B51X 3LMKA 2XCOA 4P3YA 5HGJA 1NHGA 1WP4A 2CXOA 2P9CA 3G1TA 4GRDA 4KITB 3UGJA 4X9XA 3ROMA 3RTEA 1BA3A 1XNHA 4WJKB 1PSDA 1JAYA 1T0UA 1P18A 5KYVA 5JEDA 3A1UA 3I32A 5TEWA 1G20B 1N2JA 4LFBB 5MN5A 1M0TA 1W25A 1D5CA 3L7NA 1DWPA 3WC4A 1FU7A 2Y1FA 4LKOA 3O3CA 4QLBA 2BZ0A 1U28C 2P79A 1UDXA 3G79A 4GC9A 4HDMA 4IVPA 2ZJ6A 2WHQA 2DQYA 3UK7A 3K15A 3NHRA 4M99A 4CF4A 1EX9A 2QLFA 1PSZA 2ZJ7A 1EFTA 3AO0B 3FNGA 1ZMOA 3JASA 1U63A 4JYMA 2CBXA 2C20A 2QN3A 3N07A 3LC0A 5IWAB 3FYUA 3PVZA 2V9CA 3FLEA 3BT7A 4BNMA 4N01A 4RGBA 3TZQA 3T4UA 1QIDA 3BJRA 3QJ5A 2VUSA 5G1PA 1O94C 4UUOA 4ZK2A 1LQTA 3QEMA 5AIBA 2O8DA 5LXTF 1UOOA 3KLMX 2IU6A 3IIEA 5C18A 4BJ3A 4O2RA 3PXEA 4M8LA 2JBWA 4NV0A 3QUAA 1Y9EA 1DAKA 4GX2A 4PFJA 2EJWA 4I3FA 5LSAA 3QE9Y 2AEMA 4YBRA 5FFMA 4TS3A 4D9CA 2V0GA 2BTOA 1Z8NA 2D5AA 1EFVA 1E3EA 5LBTA 3TPZA 1K0UA 1K5PA 4CQMB 1N0UA 2PRJA 5LOVF 3AL2A 4JB8A 4ABTA 1AQ6A 5G0SA 5KWSA 1N92A 1L1RA 4LE0A 2XF2A 1HLFA 3OETA 2BBOA 1SVSA 2H8KA 2XTZA 4XQCA 3DSRA 3UKOA 4WKPA 1IZYA 4B84A 3FSGA 4DWJA 5C32A 2G1UA 3TLGB 2IYSA 1A7KA 1M72A 3OUZA 1Q2UA 4D56A 2R7MA 4AJOA 1KI8A 1Z8HA 3EFBA 1DT5A 4BBJA 4EB6A 1VYTA 4GNKA 2OCDA 1E9RA 3I6IA 3FNHA 5KVVA 4AJLA 3ENKA 1DKQA 3AY0A 1NQUA 3MPOA 4PRKA 1RWMA 3FBTA 3DE0X 3ETNA 3LKDA 5EGNA 3KD3A 1X1TA 3LPAA 2OCGA 2X8LA 4KP7A 3IE1A 3PXBA 5EXEA 5HOQA 2AKEA 1KK1A 1X8LA 2Y0EA 2HPZA 3KOOA 3B89A 2DH6A 2ZRMA 1IQUA 4CMEA 4HDMB 3DDOA 1PFQA 1V4VA 4D79A 5EHZA 2GO1A 4PLZA 4CG2A 1RI5A 4K1XA 1A2QA 3LU1A 3GBPA 2E89A 3HP7A 1KI7A 4I1YA 1Y81A 4RLHA 5AMXA 2WD9A 4UZFA 3K6SB 2F55A 1KAMA 4P0QB 3PYMA 3NC1C 1TYBE 1WZUA 3H9GA 5IKEA 3M6IA 3ETEA 4Q3BA 7REQA 3R8FA 3RBAA 1JEYA 2G0NA 4OAPA 3CTPA 3QY9A 1OA0A 4DWWA 2QW0X 3DAFA 2AWNA 2IZ1A 3CW2A 2HT6A 3GI1A 4LSMA 1Y42X 1KH1A 2V6FA 3K4QA 2FQWA 3DVAA 4OB8A 1WG8A 3RKUA 1DJPA 3UUGA 7ABPA 4XGQA 4S04A 1C7ZA 4AI6A 1WO8A 3D1VA 1B1AA 4OF4A 1CUZA 2HQOA 2CZQA 5ARDA 2DX7A 4CR8A 1MOSA 2WKSA 3FFXA 3ZGZA 1AQNA 2SECE 3JYPA 3K1AA 3K9CA 2M6KA 1XN4A 1ORRA 1F8GA 4MWOA 4YMHA 3DDNA 1EFVB 1GTG1 5SZJA 3E7DA 3N76A 3ZIAA 1ZMXA 2JEZA 3W34A 3AL3A 4DV5B 3VZQA 4XJXA 1R0CA 1COWA 2DYKA 1R37A 3QP9A 3DWGA 3L6BA 4GLFA 2PJZA 2XCUA 2GCEA 3I5MA 3NHBA 4JUIA 3LLUA 2I7DA 1R6DA 3QEJA 1OXKB 1ULSA 2H16A 3MFYA 4TGLA 1GA6A 2P77A 2G72A 5T4EA 3U81A 3AM1A 4EB6B 2LIPA 5GM2A 1K6JA 3F5MA 3VR3D 1OY1A 5FR2A 3O1HB 2XRYA 1H1DA 4D0RA 2PAAA 5JS8A 3NJ8A 2D2VA 1ZNWA 1AVTA 4X3PA 1OREA 4NECA 4B8WA 1C4XA 4OQDA 1GUFA 4UUPA 3ACDA 3TLXA 2CV1A 1MVLA 1T35A 2Z6VA 2ZAMA 4Q6BA 1Z36A 3HZHA 1T1RA 3O8NA 3AY6A 4XYEA 2WVAA 5J4VA 3GIDA 1BU5A 4GUAA 3RJMA 3MA0A 1QPGA 1QDUA 3WLKX 4NMMA 2NU8B 3QUQA 2OD7A 4H7PA 3ND6A 4KGDA 1DCMA 1A9XA 3HJGA 4JJAA 3WIOA 3B85A 1SQGA 2C5AA 1C14A 1RWPA 3B6JA 4MWSA 4IMPA 3ZE7A 3U7GA 3AHEA 3DVAB 4XIFA 5ALJA 3HR4A 2VH5R 3VHLB 2R6R1 2ZAGA 4QU0A 4B81A 5JHGB 2IDZA 1JN0A 2VJMA 3O0TA 2Q5OA 2R96A 2ZJ2A 3NGXA 1GUAA 4ITUA 4I5IA 2DERA 3QLUA 1G8JA 1MT3A 5BNFA 5D6OA 5K0LA 4BU0A 1EDDA 2MR5A 2BH2A 5IN4A 1TLTA 3VPBA 4KO8A 1H4TA 5JRDS 4ZMRA 1F1JA 2YWFA 2CKMA 3PDWA 1RWVA 1IY9A 3CGWA 4WTOA 5IDYA 1VFNA 4O2BB 3EE6A 1Q5PA 4K6FA 1P1IA 1AKTA 5CUQA 1OASA 1SULA 2XLCA 4HRYA 2O3QA 4EHNA 1UPFA 3K1JA 4QYMA 1RWBA 5HWSA 5JARA 1GTL1 1BDBA 3WNZA 1K06A 2W22A 3RFUA 4Y9UA 2GN2A 2OHXA 3KR1A 4HTFA 3TTSA 4AQ7A 4ZVSA 3C45A 3JD1A 5I9LA 4YUVA 2JI8A 2ET6A 2TSYB 3GJTA 4X1OA 1HR0B 3R0QA 2IA5A 4CIVA 2ILTA 2ZE7A 3BG5A 4PBRA 2IW1A 5FADA 5F7JA 3RQIA 2ERYA 4BNTA 1V8DA 2NUAA 4L8FA 3DV9A 3GZ4A 1HC7A 3ROKA 4DWVA 1GPLA 1QRSA 1EJBA 2QI9F 1VP9A 4QBHA 4PLPA 5CVDA 1E0JA 2FFRA 3SDZA 6AT1A 5A62A 1BX3A 2QTBA 2JLRA 4K9SA 3TZCA 4BJ6A 3OIWA 3I4FA 1C3JA 4CM9A 1USKA 3B1KA 2X0NA 1HG0A 1K27A 3DOHA 3OLYA 2ZVQX 3AKZA 4ADSG 4CDNA 2GASA 3D31A 3OE1A 1GFIA 4IRXA 4QPNA 1J9EA 2VJMB 1CQZA 3ZWPA 4C0SA 2VAPA 4EPWA 3N28A 4QXRA 3BHJA 3NC0C 4QEDA 2OV1A 4B34A 2WJPA 3W7VA 1MENA 4BZZA 5JAUA 4ZU3A 2HA7A 4ZVQA 2RHBA 1BFUA 3W0LB 4MVXA 1UQUA 5CEJA 3V4RA 4CMAA 1THGA 1ZR4A 1T4CA 2IP1A 4KX3A 1X7YA 1L2TA 5AVJA 1HNXB 1F5SA 3FOAA 1OH6A 1LS6A 4J03A 2ZUVA 1LF0A 2IYZA 3SLRA 3GQBA 4KWTA 2GBPA 4FQ8A 4I66A 2YV5A 1YZUA 1W94A 3FMVA 3V7WA 3KIPA 5C7YA 2AL7A 5D3MA 5LVAA 3COZA 4UQLA 5JNRA 1X2EA 1E4EA 2G0AA 4OH1A 3RLFA 5DGTA 1RM0A 3LQYA 2BSXA 4Z9AA 4ZGWA 1XDSA 2W90A 1F6BA 4HTFB 4BAUA 3WIEA 1YDGA 1OBHA 1SZCA 1TKBA 2XGJA 4O5AA 1ONOA 3IMCA 1PR4A 1X86B 1M2FA 2OG2A 2VXCA 4NNOA 4TRRA 4OYRA 1JAHA 3ETCA 3ME5A 1MX1A 2NUAB 4IG9A 3VKUA 3VR5A 3GUZA 5JPDA 4IDQA 1J0EA 2PWAA 1LTHR 4HZUB 4QO7A 1SGWA 3HJRA 3LY9A 4L95C 2XMDA 3CISA 2D1YA 2QRUA 3FGZA 3MM4A 1UKAA 3N05A 2PWZA 3HBAA 3AR9A 1DRJA 2I6FA 4M0UA 1FP1D 2QJRA 4DR7B 3C3XA 3EHEA 3EIFA 4JFAA 4IUBS 1KAHA 3NETA 4LNUA 1AMUA 4P4NA 1L7XA 1MPTA 3SVLA 5C3MA 4DA8A 4Y9RA 3WO0A 4YP0A 5EUMA 1JIQA 3AR5A 2GFIA 3UJ6A 2IP2A 4M87A 2NXCA 4KZKA 3UICA 1V45E 4JUFA 1NWCA 3UVEA 2JIZD 3H7AA 2I2CA 1H23A 2VK2A 1JVSA 3RHZA 1U2QA 2AN5A 5D1HA 1TLFA 2BCGY 2IHVA 1X7YB 3RAGA 1F06A 4TTRA 2BEWA 1S2NA 4D81A 3GQBB 1CLUA 3R7LA 3WLJA 2I2AA 4HDCA 1GRCA 4UUNA 3DTVB 1R00A 3HJCA 3KC2A 1JFTA 2XRMA 5BMVA 2PV7A 4W5JA 4UMDA 2KYRA 3BXXA 4HPXB 3T35A 3TXAA 3G2PA 4MKHA 4X0EA 2QLMA 5KQLA 3KQHA 4RK7A 3JRXA 1VGQA 5LMCA 4Q00A 4AJIA 2HTFA 1GXSB 1QCCA 3G49A 3NTVA 2HRBA 2QY6A 1APBA 3WBBA 4Q15A 5C35A 1UBNA 2Q2QA 3F47A 1F14A 2BIFA 5JECA 4BJHB 2AK2A 1N2CE 1N8NA 1E89A 2NU6B 3S68A 3X1MA 2GTIA 2DFPA 2O57A 1EHYA 2CLDX 3D5TA 3EK2A 3LUFA 1WCWA 4JL8A 5TGDA 5CDTA 5MF6A 2HJVA 2H85A 1YCGA 2BFBA 2HCFA 3RVMA 3A3PA 1GN9A 4P2GA 4OGLA 3AU9A 4LDNA 1Z7YA 4Y2YA 2HXGA 4AZ3B 1TUBA 2PGIA 3DW3X 4JC0A 3N5CA 5JYDA 4E2ZA 4QDZA 1FNSA 3R6GA 4UHJA 3QU7A 4M9ZA 1QG4A 2ORIA 2Z4RA 1K92A 1RYFA 4N5DA 3LY7A 1S6YA 4M0KA 4Y3UA 1AB5A 1U3UA 3QHAA 1R6BX 4MV6A 1RRFA 1YACA 3RIHA 1R2QA 2QGFA 4UREA 3TR0A 3I2GA 2EDCA 3RWMB 4WVFA 4B6FA 3EIXA 4LTMA 4C0HA 4GZMA 4EJ6A 4AY5A 2QTVA 4Q4AA 1OZAA 3GLIE 5BWBA 5FBZA 5CD9A 3B82A 2R00A 3G0OA 4D3FA 4NEQA 1FYVA 2BEWB 3IDFA 2HLDA 3C70A 3LVFO 4NBWA 3QVMA 3RIMA 4DPLA 3CZ4A 1R1DA 4W1QA 4BVLA 3LKVA 5FUBA 1KYTA 2D5BA 2Z2ZA 1NQWA 3LDFA 2X0DA 5HVNA 1U8CB 5BMVB 2FLKA 3GEEA 1F7UA 1OFIA 1RACA 1WHSA 2H4HA 3DVRX 4LRXA 3F6SA 5M2QA 3G85A 3MRTA 3BCUA 4OP1A 1IXZA 4C4ZA 1W36D 3CGGA 2NQTA 3AZPA 5GTDA 4JBNA 1KMHB 4XQ9A 4Q6WA 4K6KA 3ZHOA 2YZMA 4Q82A 1E62A 4AJNA 2F1HA 2PT6A 3IVRA 1Q0LA 5TDHA 4AG5A 4EG8A 1MC4A 3LOQA 4FWBA 3VYRB 2JHGA 3LNTA 1SHLA 2OXCA 3OEHD 4XIGS 4R6XA 4Y2VA 3KQOA 1YVDA 4XPIB 3RIXA 4OQXA 2Z8XA 4ZC1A 4GXNA 3SZMA 3PRJA 3WLMA 5KX5F 1ZSNA 4OFWA 1J21A 4G0NA 1QVVA 4FGWA 8OHMA 4JBHA 2HREA 3D0RA 3OU6A 4ZPJA 7YASA 5AVSA 3CTMA 1VL0A 2FPIB 2ONYA 4Q7LA 5EJ8A 3SBXA 1GTSA 1VSQA 2Y3IA 2DR3A 4PBTA 3DCNA 2XMBA 3AF5A 3PXCX 3I1JA 3W9SA 3WGVA 1EVEA 4KV7A 4AG6A 3IAEA 1SBIA 1G3IA 1TYEB 5CB0A 5IABA 4ENPA 1MG0A 4I8DA 2AX3A 2JJ1A 2QJOA 4TLBA 4BQIA 2GZRA 1L6IA 4Q4AB 4Y9TA 2GK6A 4RV4A 2BFPA 4RZUA 5GZ1A 3ZDXB 1ZCZA 5UKDA 3AUYA 4GL4A 3V9PA 4GS5A 2A7XA 3OM1A 2D6FA 1V3QE 2YQZA 4ENQA 4J0DA 1Q20A 3BJZA 3J81k 4G6ZA 4KAJA 5KI6A 3TW6A 1J09A 1PEAA 5BN1A 1AMNA 3NTQA 3EH2A 1E0KA 4JB2A 2B4YA 5HKKD 1AKYA 2WTEA 3ZG6A 4WZAB 3ST7A 3ZWKA 3ZW9A 1D1PA 3NCTA 4YROA 4TVSA 1UK9A 2OXRA 2WYVA 2A9PA 2XCLA 5EJMA 5I4KA 2OLEA 3RU7A 3LBHA 4AF8A 4MVJD 3TLCA 1MFZA 2N0SA 4NK4A 4NCHA 4RPGA 2ZTHA 5BWMA 4EG0A 3IUEA 4EB3A 1DLJA 3WWZA 3MT9A 1SVMA 1JG6A 2QLNA 1U9CA 1XD2A 1U5BA 3CUTA 3RAFC 1T43A 3BORA 4IOKA 5K3OA 2RGGA 2CMKA 2CY0A 4JASB 5JAOA 1ZH8A 2E4XA 4Z6KA 2W9XA 2VQ6A 3L8ZA 4ZVVA 4UCWA 4BMSA 1OWOA 3AV0B 4ND5A 1HO3A 2CUTA 2OHIA 2XDQA 4LZAA 5ELMA 1XP8A 1V11A 2J4FA 3COSA 1AUQA 3L7LA 2B36A 4ZFNA 2GM4A 2PBLA 2HMWA 4FSXA 2CK3D 3LA8A 1NYQA 4B31A 4DEXA 1VRVA 1ECFA 1TZJA 3K4HA 4OY3A 2C54A 4HY3A 4GC5A 2BMJA 2FWAA 2G82A 3GLUA 3QVGB 1O8BA 4J2OA 3B52X 3NTRA 4DG8A 2IZ6A 4G63A 2D2XA 3FPLA 2I22A 1W5BA 4L50A 4MAAA 1S2IA 1RMYA 4ENSA 1LBEA 3OOHA 2F43A 2W4QA 4K9DA 1Y6JA 3T15A 2ZJBA 2C88A 2Z2KA 2BKLA 3PPIA 3OF5A 5HZMA 5CT4A 1JYSA 1X7XB 2DHRA 4AJEA 4V0RA 3TXYA 3QWIA 3Q9LA 4F3YA 1DVRA 2IYAA 4DSNA 2RGNA 5TNXA 2ZTMA 2HADA 4GMFA 3AOEA 2J3LA 4Z2YA 4F4JA 1I13A 4UTZA 2PT9A 3WLHA 3DMTA 3NEYA 4QOGA 5AW6A 3DF7A 3V8NA 1VMEA 3ED1A 3NFYA 1K3UB 1MJHA 1BYIA 5AOBA 1A04A 1SCAA 1A4XA 2W71A 4DRZA 3ZU4A 4TYQA 3NEAA 1P91A 3U4IA 3V8VA 3GP8A 3FVTA 4ZJUA 1XQWA 3DR3A 1L8AA 4AN1A 4CQNA 4CN9A 3K2BA 4DFDA 4RAOA 4WJZA 4ONEA 3L9XA 4LHWA 1C9JA 4YUZA 5BNZA 2OM6A 5KWIA 1RAIA 3ZY2A 1UM9A 1JLSA 4MLPA 1KS2A 2J6CA 4ARZA 3COWA 2AJCA 1XD2B 1TD9A 1U5BB 2O2JA 3IA2A 4NOJA 2MJLA 3D6UA 4B5KA 3OCCA 1PQPA 4TMTA 3QVVA 1DEKA 2QR5A 3L8EA 2BMFA 3I45A 5IDXA 2B82A 3V8QA 1RPTA 4PZ9A 4JLWA 5LQRA 4IGIA 1KQPA 3KLNA 3FVQA 3WGHA 1JG3A 1Z6AA 3AUUA 3VR6A 5KKNB 2V0CA 4DLXA 4XDYA 3PUZA 3K92A 1DQNA 3ILSA 1M2WA 3NHFA 3BZWA 5HMMA 4CI0B 5LQSA 3KSAC 4HNUA 3N2KB 4Z4FA 1DAFA 5F98A 3W3ZB 4BVAA 4EKDA 2OY0A 4GSYA 4YLEA 3HQ4O 1EEXB 1P7PA 3H2BA 3OH8A 3TOXA 2FUNB 3ZGXA 4TKVA 5L9AA 1X8XA 1K63A 3CVOA 4I1OA 3IQWA 3NWOA 4WUVA 1A9TA 4IDFA 5F2OA 3V4ZA 4C6SA 5HS4A 5HUQA 1BMFD 1JX6A 2VNJA 3LD9A 5ARCA 1Q0RA 1BVUA 1ZEMA 5B2FA 4UE2A 4DLPA 1Y1KE 2ADFA 5JOQA 2XPCA 4DANA 4J91A 5HTOA 4FONA 3KPVA 4IQ0A 4O4IF 4AIRA 5CB6A 1EWRA 3TNFA 2YV4A 3UMSA 4HWPA 3JX9A 4IUDS 1ZD2P 2B7BA 3CB2A 1M1YB 1UIRA 2FW6A 1GQ2A 3DMYA 4BCCA 4LISA 3OIYA 1JLLA 2Z58A 3ZZ1A 3VHQA 1PW7A 2AZTA 1LKZA 3OCVA 1CUUA 1OT5A 3OM0A 2W70A 4EKNB 2E55A 3ND7A 3OPVA 1UM9B 4KRGA 3AF3A 2BELA 1EG7A 3O91A 1P2BA 4K26A 2YOGA 1LK5A 2MSNA 1QFJA 4HUQB 3VAZA 4YYEA 3BWXA 3AEUB 4J0IA 3LV8A 1AURA 8ABPA 5AK3A 3EUAA 3IEIA 5C53B 4MV7A 4PEVA 4CLEA 3DFKA 4E33A 3KOYA 2XZDA 4KNVA 3CKLA 3A7DA 3KJIA 1T5TA 3OIVA 4NYIQ 5AM4A 1YSCA 4UTXA 2EX1A 1RZ3A 4J0CA 4V0MA 3EGWA 4WCVA 4FYYA 3WL5A 4U4AA 2P4SA 2H0AA 1LDGA 5AM1A 5FB3A 4EHLA 2C0CA 3K73O 1N75A 4FT2A 5U4XA 1GPBA 1MABA 1RIIA 3IHLA 4RVDA 4TKMA 5KJ1A 4NAHA 3UOAB 4C6RA 1CUEA 5JS7A 2I91A 4RS3A 2QQGA 3HBJA 1BXKA 3EXG2 3IQXA 4ZQHA 2D5LA 3CNOA 4Z0HO 4PAOA 4YV7A 3E03A 5B37A 2F6RA 2UV8A 3Q15C 1P1KA 5H7XA 2PL1A 5LDGA 4CF3A 1PKEA 1YH3A 3ZHBA 1I7SB 3E8MA 3N2EA 2R87A 3E82A 1Y8QA 1VSTA 2CC2A 3B6IA 2CE2X 2GAAA 4JLOA 5I4IA 2GRUA 1EB8A 4HXGA 1T9KA 2J9FA 2M98A 3U0VA 5MFPA 2XOKA 2R8EA 3ZHTA 4CG0A 2CYCA 1WBBA 3DL4A 3WQQA 3ZU6A 1QNLA 4JJKA 3FY4A 4KCGA 1YVPA 4BE4A 3R09A 4TM8A 2V7PA 3P71T 3GFPA 4OUDB 5ALPA 1K3TA 3S2YA 3U5ZB 4IDDA 1KK2A 1PT9A 2OHOA 1XTSA 1YZLA 5A4KA 3T1NA 1EI9A 3PQ3A 5JWOA 3KLOA 1ZD9A 3K9WA 3NRBA 3U9LA 3HKBA 1FFCA 5LP6F 2Q3FA 5AKIA 2HWXA 1WKCA 1D6NA 1F2UA 2BHNA 4UUMA 3RT9A 1QP0A 5KDOA 4GP6A 4PC1A 2FW0A 1GFSA 1E69A 2LBPA 3AUSA 1IMOA 2YICA 1MQAA 1L7RA 3H1GA 4MR7A 5D86A 1KMMA 3AU8A 3L0SA 3KHUA 3P27A 4UDNA 5FHRA 2AF4C 2CXNA 4JMPA 4OXNA 4YUXA 5EMJA 3P96A 3L4BC 4IQGA 2FN4A 3W77A 2YINC 1MABB 1N9GB 3EXG1 5EZ5A 2DE0X 1L5FA 5D3QA 1E7MA 4KLZA 3P9IA 2UZ1A 3CVYA 4IOLA 3C7TA 4UM7A 3Q2KA 5DLQC 3MWKA 2HNKA 3QMMA 3GRUA 4JR0A 4PZUA 1EBBA 4K6CA 5K3FA 1X7GA 1TI7A 5E1MA 4R16A 3PL5A 3B38A 3LCCA 3OUUA 4JITA 4QTUB 3ICOA 2QVLA 2H1LA 4K9LA 4E1AA 3KEGA 4AO6A 2P0EA 1AUOA 1GT91 1C3XA 1CKEA 1E59A 2FETA 4AJHA 3B8HA 1NBIA 5HIJA 5EZQA 1HYGA 2GZAA 3A25A 3E84A 4B35A 2O0KA 1QP4A 4UUAA 2C7BA 3QF7A 5BO5A 5TXGA 1W46A 3MQ2A 3LSTA 4M9XA 4RE6A 4TSKA 5L4SA 4O25A 2AFHA 2REOA 1JLRA 3EIQA 1SXJE 4KXUA 1YZQA 4PXSA 2AK3A 2KHZA 3Q7EA 2ATXA 3IA7A 1J4AA 2J87A 3LHDA 3A8TA 5EMLA 4JXZA 5AESA 4EMSA 2KBFA 2XVYA 1OA1A 2KMLA 1YR3A 3PGLA 4PG7A 5BV1A 2EZ8A 3HKBB 1Z5UA 5J4KA 3R24A 2EL9A 3G0GA 2G6BA 1IQPA 1F2UB 4RF3A 5KAPA 3ZCXA 2HK9A 3RM3A 3GB9A 2EX0A 2G1JA 1JKJB 5IC6A 3H05A 4RL6A 2X0FA 1LZKA 4I2VA 1WXGA 3UMVA 1ODTC 4MQ6A 5T64A 4C0WA 2NO7A 4KACA 2FPSA 4X44A 1QGYA 4PYNA 3CHYA 5DHRA 5DX0A 4ZV9A 3RVPA 3L0OA 4QOHA 4IAOA 1AMOA 2ZXUA 2VLBA 1D3AA 2FW8A 1CIJA 1T5IA 2IKQA 1E2QA 4CM7A 3E61A 3DV0B 2BUCA 2XGGA 2AG8A 1S5PA 2UZ1B 3E53A 1GNVA 1HA3A 3MJ4A 4EARA 3B1XA 4YDRA 1AY0A 4XTCS 4EJSA 3R75A 4EG1A 5K3FB 2CFCA 1UBCA 3UXYA 2CLIB 1JEQA 2E87A 3QIVA 3I42A 3ILXA 1ANKA 1MCZA 2BTQB 2Z0MA 1YTUA 3HDGA 2XQGA 4BO8A 4BEWA 2VP3A 3WKBA 5MHTA 4D9JA 2CCGA 1OT3A 2QUJA 3GJ3A 1UPUA 1EHIA 2E48A 3MJEA 1QV9A 1MU0A 4PIPA 1JE0A 1OD6A 1M8FA 5JT1A 1RAEA 3HFJA 1TO6A 1SC9A 2FWBA 3PNYA 1HDIA 2Q4DA 5CXUA 1HNWB 2ZE6A 4ZVLA 2OV6A 2PWYA 3EZLA 1MIHA 3B78A 4I55A 1GUDA 2X7XA 1YXMA 5K6AC 1XDWA 2WJ4A 4FOPA 4MQFB 1VGVA 3PNLA 4UHHA 5A5GA 1HF3A 1RCUA 3BHNA 3OZRA 1KNXA 3GZNA 4LEIA 2BRUC 1BQ3A 2VYQA 2H2DA 1M6WA 5JC8A 2WHRA 5CT5A 1T0IA 2EF0A 4ES6A 4N0MA 2NTJA 1JIKA 2PY6A 3DAYA 5LWHA 4HS4A 3GAAA 3TKLA 4YT4A 3PC8A 1XYGA 3O4FA 4NBLA 3FJYA 4XM1A 1XVAA 4FW8A 2C9MA 1MDBA 3A6DA 3CV3A 4JU9A 1B76A 3N7UA 16PKA 4BLUA 2WWXA 1DBWA 4BE9A 3FJOA 2O5VA 1H2FA 1AS3A 5J4LA 5A9SB 2FDXA 3G0HA 4Y2PA 4UCXA 5SY9A 2BMVA 4IHJA 4YJ2F 3PHJA 5I8PA 2O59A 1R0YA 1JEOA 2XMRA 1Z7EA 3D0KA 3PDIB 4CUKA 3R4CA 2PMWB 1XZNA 2IEBA 2JC3A 3I92A 1U7UA 1QPBA 2H1HA 4HMOA 3P2EA 2XBUA 1FBNA 4XXHA 5LYYA 3WL8A 2WIFA 1ZUIA 1SB8A 1XJCA 2P5YA 1UBOS 4TL8A 1HYBA 1OLUA 2TRSB 4G0XA 4QTXA 1E2IA 1XO1A 3HZOA 2H2AA 3INYA 1EJ0A 1X7WB 1SIUA 1Y5IA 4NFHA 2OTCA 3TIVA 3KDPA 2NZYA 3SS8A 3DZCA 3VNVA 1H9AA 3O6VA 4RQTA 2HR1A 4BU1A 4ZXPA 4NYIR 3K8OE 2G88A 3A4MA 3JAMA 2LVBA 3JQDA 2BR5A 2YBEA 1E77A 1KOJA 3JQFC 3GRVA 3MCTA 2G77B 1RKQA 5FBWB 3V1UA 1ZD1A 4TKLA 4LXXA 3O95A 3TMYA 2YXNA 4QNRA 4Z9BA 5I7AA 1ENPA 4HHEA 2BI7A 1DU4A 5TRTA 1MX3A 4R1SA 4QASA 4I55B 3RCBA 2REQA 1MXFA 1B4DA 4XDZA 1PG0A 1USVA 2XEDA 5CXQA 3HV0A 2O3SA 3QLVA 5ICCA 4G4SO 2FOXA 3GZNB 2DTDA 1XKTA 4QARA 3WIUA 4FXPA 3AJRA 2IP4A 2I66A 1VJ1A 1G5IA 1VDZA 2WOJA 3FXAA 3HNOA 3NBKA 3WLNA 3GMTA 1WF3A 3K9LA 3M4JA 4Y98A 1NJ1A 4MUJA 1UOQA 2JGLA 2XBMA 1WP9A 3TOZA 1JQBA 3AVXA 3QW2A 4XSVA 1Z6ZA 1LLUA 2DFNA 3AWDA 1XDUA 2VTKA 1NRWA 3EN0A 4HDRB 4JKIA 4QUIA 3QKSA 4X63A 4ZI3A 4NHOA 2Z83A 1JH9A 4F5ZA 3BN3A 3ZLBA 2CDNA 4FE7A 1JDPA 2ZS9A 4DGQA 1YA4A 1UBUS 3TM4A 4GM0A 1SHTX 5CTJA 4D26A 4JC5A 3RS3A 1QGED 3QY0A 3WAJA 3OHMA 5A2QA 1IN6A 1D6MA 1CVLA 1S01A 2NU9A 2WG2A 2BM8A 2X76A 3LCVB 3FDFA 2X2PA 4MKIA 3VR6H 1PQYA 3IKLA 3J7AC 1YO6A 4OREX 5CA1B 1DZ3A 2OZLA 4CHTA 4H60A 3ZWAA 2G9ZA 3B48A 3ESAA 1H0HA 1KTVA 2QQFA 5ADWA 3DE1X 4R2XA 1XTUA 1GQYA 3H2IA 1CWUA 3ONWA 1KBZA 1LBIA 2GEKA 2C95A 4X95A 2C1ZA 1PO7A 5E8JA 2W11A 5JXJA 5CCBA 3AESA 1CNMA 2HU5A 4EYOA 2PH5A 4BP1A 1XKLA 4UM9D 1EGAA 1U0HC 4LF4B 2REQB 4FS3A 3MQFA 3U3ZA 2D8AA 3G2MA 4P34A 4BS9A 4BJ5A 5TLSA 1AKEA 3ZE2B 1M2KA 1OYVA 2JK0A 2ZCVA 5CGZA 3TTTA 1HORA 4A03A 4CTKA 3VKGA 2AG5A 5C3UA 5F4BA 2IIBA 1L5MA 4HWTA 4KHPB 4EA7A 3M9XA 2WM2A 3H9BA 4FEGA 5KNLA 1EAYA 3GT0A 4UPEA 1CY0A 2CNLA 4PSUA 4OMCA 1SCJA 3MOIA 3ABIA 3SZ3A 2BEKA 2YUIA 4AM8A 1E63A 2C92A 3VHRA 2VQDA 4E1VA 3HA7A 2QT1A 4Y2RA 4ZRMA 1TQ2A 3KKEA 1VBKA 3CUSA 2YFHA 3NB0A 4G56A 3GLSA 4RD2A 3E7XA 2ZYDA 2YZ7A 1P3DA 1H5NA 1H2BA 2ZATA 3BE6A 3QVXA 1DAGA 3QVWA 4OK6A 1T5BA 3PNPA 3VSBA 1JYEA 4G1VA 1DAEA 1OIVA 1F4PA 1PSWA 1XD9A 2EFGA 4M9CA 4N3BA 3V8BA 1YVEI 3TVTA 2YXBA 1BJKA 5FBQB 1IEWA 1T9HA 2C1EA 3UAYA 2VF5X 5LDDC 2OZLB 4LS3A 2X9QA 5KYYA 4NKRA 3KELA 5FEUA 2G9QA 5EP2A 1RZRA 1GUBA 3QMVA 1JYFA 3MTBA 2HF2A 5E6UA 3H11B 3OQJA 4TTJA 2RKOA 4UKDA 4CUZA 4KREA 3SYMA 1LBHA 1R6UA 3A6LA 4JI3B 2AMFA 2PIDA 5ALXA 3OX2A 2O1XA 4BNXA 3KEOA 2NXNA 1VHDA 3ABOB 1O95C 3G59A 3L7BA 1QANA 3IR6A 3DM5A 4H4EA 4C6TA 1G3MA 4OLJA 1ACJA 2DWUA 3P2OA 2PL5A 1JW9B 3X44A 5K0JA 3LQKA 3N58A 3NOOA 4F3KA 1DMRA 4PLFA 5CBKA 1KJQA 3WP0A 4IOJA 4EEXA 4YAIA 2WTXA 3LPDA 4MW7A 4U63A 3A4IA 5DOZA 1G9XA 3V55A 1ORVA 1XZJA 4C0QC 4LJKA 2ORWA 3TM5A 3MJSA 1XCPA 1HQDA 4DEYA 1A8UA 1KPIA 2QG9A 4BLTA 1N77A 1OWLA 4GG1A 3WGOA 1ZGCA 4UBLA 2XB4A 2YH2A 4HNRA 5DISB 4DPMA 1HQYE 1TJ5A 3HWX1 4CKCA 5KNCA 3IC5A 3OZEA 1TNDA 4JMLA 4MQMA 1I30A 1YRHA 3RYTC 2Q5FA 4HAXA 4IDAA 4Q1EA 4DBLC 4AD8A 5IYZB 1G21E 2BTEA 1ESMA 3BSYA 2E5WA 4M76B 3M6WA 4BFYA 2NW6A 4R3NA 5FBHA 4DT1A 2XH8A 1O5OA 1Z33A 3SKYA 4EM6A 5C8ZA 2PVPA 4H6WA 3NEJA 2O1EA 2QPOA 2Z2XA 3LUCA 4KK4A 3FFTA 1FOEB 1I1NA 1E0SA 2I1QA 3VO2A 2QUAA 1EFKA 3L84A 5KYYB 2YWEA 5C34B 5H59A 4DLBA 2W2LA 2AN3A 1DQRA 1NVTA 3SCZA 1IFXA 2E18A 4HQ6A 4K6MA 5E6UB 3WIBA 1KE1A 3LC7O 2JAOA 2XT0A 3DOCA 2DBZA 3M4NA 2J5RA 4X1IB 5DGIA 5DIFA 1NF8A 4RTKA 1XPRA 1YMQA 5J5CA 2XT6A 4II3A 4COOA 4DMRA 1IRXA 4DXHA 2YYZA 4IDGA 3CRQA 2RJNA 4OD0A 3GYBA 3N8DA 4C6TB 1QPZA 1QF9A 1TZCA 3O8BA 3TRHA 1U9ZA 2XOEA 3BQNB 3V1YA 4DWOA 5JDIA 1ISPA 2PX8A 1G2IA 3EUFA 4X84A 1YBHA 1DCKA 1ECCA 1IL0A 1FCJA 1JP7A 2F9LA 4FYKA 4G81A 3USZA 4WE3A 1N3YA 1FP4B 4FGJA 3NX4A 1UDBA 1V2GA 4GKBA 5AHKA 5FO0A 3HP1A 3NHWA 1SUAA 4U5XA 4DMGA 1D03A 3YASA 2QRVB 2A9JA 4MIYA 2WRZA 2HU7A 3ND9A 4KIJA 5DW0A 4KR9A 2UDPA 2X5KO 3BD6A 3M6UA 4I4TB 4Q7MB 3RYIA 5B64A 2FY8A 4B4UA 2IZOA 2I4TA 2ZJYA 2MU1A 3EVFA 1HDXA 1KAEA 1Q1NA 1WVMA 3LXMA 1NIJA 1H3FA 4KO2S 5JQGB 1HUQA 3H1AA 3CINA 5B58C 2I71A 2Q0XA 2CJWA 5IJXA 3SMVA 3T94A 2HAEA 5CM8B 2XNKA 2GBLA 2YBDA 3P9CA 1FDWA 3KTAA 1EB9A 2GZ2A 4R8VA 2ID9A 4US0R 3CZ9A 5D87A 4D9EA 5B57C 1EFLA 3IXMA 2ENUA 4CMJA 4NENB 3FNBA 3BULA 4GXQA 1LC3A 2O8VA 2XYGA 3E5HA 1V26A 4WY5A 2VDRB 4HAOA 3JVUA 4MPJA 6ADHA 1IG0A 1ISFA 1PX0A 2P67A 3Q7RA 1LSUA 3K6RA 5I48A 2IIPA 4US2R 2IX3A 1UINA 2PUCA 2XA1A 4HJXA 4ZT4A 5JFOA 5AOCA 1WJGA 1M8KA 1GJRA 4KR2A 5GONB 1KR2A 3OE7A 4RVUA 2PR2A 3BE5A 5AW4A 3D3WB 1RHMA 1GAQA 1V9CA 4XWKA 4DLVA 2JIMA 2W6JA 3VUEA 1W44A 5EXPA 3D8TA 1V9SA 3CN7A 5CHYA 4JNKA 4F3NA 4R8KA 3RRJA 2NYAA 5JNLA 3MWGA 1KEKA 1TE2A 1YZGA 1THTA 2PLWA 4WECA 2RSLA 4G4JA 1E1CB 4EFDA 4F38A 5DLYA 1KZGB 1S2DA 4ODIA 2ZKLA 4HPWA 4IP0A 4QOSA 4BN0A 1HE3A 3DCIA 1XZDA 2Q7XA 3DD1A 3PQ8A 1KRHA 4JUCA 3C6ZA 1UMDA 4B2LA 1PEYA 2ZI4A 4BLPA 2WF8A 4OGWA 2UXDB 2ARKA 2O4CA 4H0CA 4HYTA 3RUFA 1QH0A 1DELA 1TMOA 3M5CA 4C3OB 4EYGA 2BFCB 4JEMA 2C4WA 1XLTC 1R3DA 2DC1A 1JSZA 3VR0A 4UCQA 4AUKA 5K5EA 3K9HA 1QYRA 1RRMA 4OU4A 4D44A 4MGYR 2OHGA 3E9QA 4OGFA 4QE3A 5K3AA 1ZD4A 3SXUB 4DYDA 1N6PA 3PWSA 2XNSA 1XTKA 2CJWB 3IT2A 1CR6A 1JLKA 1L5OA 3D7LA 4LSWA 4OQ4A 4QTZA 5CNKA 4YRPA 3IAAA 3ZV6A 4AAYA 3G5LA 3R9WA 1H5QA 4RGQA 3ZC3A 3TW8A 4OQYA 3LI2A 3QX9A 3QYAA 5E7MA 3EJ6A 4OQEA 2ZT5A 3MGGA 3NC4A 4I08A 1HV8A 2YYAA 1N2BA 5DXFA 4ZOAA 3UHJA 4LF6B 3WFJA 1I8TA 2J08A 4RKWA 2B8NA 3C4VA 3WL6A 2OBYA 4R81A 1UFKA 1VE9A 1SKUA 1YI8A 4K8OA 4MRNA 1PRYA 1T3LA 1FDVA 4A1OA 3ADKA 1LQ2A 2NT3A 4PANA 1AXGA 4FFBA 1Z0FA 3A26A 2P3OA 1E6LA 1D6SA 2WMDA 5BXYA 3M83A 2QD1A 4RS4A 4PX5A 1NZJA 3QBVA 1LNSA 1QBKC 5TGTA 3SM3A 5B1YA 3TLMA 4GOOD 1MV5A 4TRJA 1Z22A 3UHOA 2VTBB 2Q4BA 3NANA 1I24A 1BW9A 3BMNA 1OROA 1JNXX 3A1VA 5FL7D 5EWMA 4IPTA 2R65A 2ZLBA 1GPKA 5EYPA 5J2TF 5K2MA 3L8HA 2XYVA 4MQ4A 1N5RA 1XZLA 2WWIA 4IS2A 5CLQA 5AK4A 3RVSA 3TGPA 5C4IA 4P4LA 3HYSA 2J5KA 4KWHA 2HF7A 2V59A 2VC2B 3OQBA 2XAAA 3FLMA 1QIKA 3D0QA 4KFRA 4O63O 3A9SA 1H2RS 2JJYA 1HM5A 4LYGA 4ZARA 3RUIA 1M6VB 2HHLA 4ZXFA 5K3BA 1FPQA 3DO6A 2VP9A 3U6BA 3GVHA 1OLSA 2H2FA 3I9FA 3ESYA 3B2QA 4AZSA 4EYKA 1RD4A 3R3ZA 2YXDA 2IL1A 3DV2A 4E5VA 1SH7A 3RS0A 1E5TA 2QROA 3DMNA 2ZPUA 3Q11A 4GR4A 4NFSA 2G9UA 3TW8B 4EG5A 4IJQA 4XLTA 2CYBA 4ZJZA 2AYZA 4HXEB 4XWOA 1NW9B 3LYUA 1HL7A 1UP4A 4B2PA 1CDEA 1LU9A 3DW1X 3GY0A 4LF9B 1QYXA 1NAIA 1Q57A 4C7JA 2OENG 4C7VA 1W0KD 1CETA 4AT1A 3L7OA 5CLIA 3UK2A 3PLRA 1G5FA 2I3ZA 3AP3A 4GWGA 2GN6A 2WG0A 4I99A 2IYQA 4MB0A 2E5LB 1JEJA 4HH0A 2UZ3A 2QXTA 2RGDA 3L1KA 4L6CA 2NACA 2V6JA 4EYSA 1W7AA 1J7JA 2JD1A 3F2VA 3P7MA 3QLTA 3BBLA 3QF4A 2ECOA 4U2BA 3FFAA 2Q7OE 2A57A 3I1YA 3W5UA 4U1RA 1LSJA 1LK7A 1SQSA 4WXHA 4G89A 1YR2A 1ADGA 2XYRA 5EWJA 4A27A 1W2WB 2EZUA 1KPGA 1ZWLA 1E1NA 5DHTA 5EWMB 2EIHA 1ADBA 1JS1X 5EYPB 4FFRA 1WL8A 3B9RA 2YOHA 1XF9A 1WBJB 1QC5A 2J09A 4HEJA 1D2AA 2Q9AA 4P5EA 5EJFA 1I7DA 3E4DA 3IHWA 3BXEA 4FSHA 4HN2A 2B98A 4RDHA 4EYEA 3M2TA 4U7TB 4KI0A 1SCUA 4RKEA 1CFZA 3BKWA 3L9WA 2L69A 3X1YA 2YJTD 2QOEA 1CHDA 1YR1A 1N2HA 4ZYTA 5AUNB 4GW3A 5T41A 2OQ2A 4RCYA 4CEIB 1NI4A 4TZKA 1FUUA 3TW0A 3TG2A 1Z4PX 2H5LA 1CUGA 1RJEA 2FUEA 1E3TA 1TEXA 1VKHA 2HT1A 4BGEA 4QNMA 1E3SA 1TQ8A 3LX8A 5JNUA 1E5QA 1T9GR 1U2EA 1LUAA 2WK1A 1QQTA 3AFNA 5BWNA 4M1KA 4KN5A 2J0VA 1V35A 5THXA 2OCBA 3UZUA 1P7WA 4LF7B 3K09A 1FLAA 3QMWA 4EPVA 2H4WA 1ZN8A 2O8EB 4QTTB 2HIMA 1XCBA 3KNZA 3UMYA 3BVPA 1W19A 1BHSA 1KI4A 1E9SA 4U7JA 2PA3A 3NKFA 3LE8A 2IYUA 3R3VA 1BRMA 1T1GA 4BIMA 1HLGA 3A6KA 3H8SA 4U9HS 4FFVA 1B43A 3QF4B 4GPBA 4HWGA 3T7JA 4C0XA 4M37A 4Q93A 3W3AD 4B17A 1LRLA 1EIWA 1B14A 4ABYA 1E2KA 5PGMA 2BLNA 1CQWA 4ZV4A 2JJ2A 3GEIA 1QLHA 1RAHA 3B9PA 1DJLA 3JR3A 5CT8A 2CL7X 3AI2A 2DFDA 2OPBA 5JPCA 3U19A 3FRIA 1NC1A 3UM9A 1N3BA 2B9VA 3H5IA 2F3RA 2VJDA 4FYWA 4PWYA 3S99A 1SM4A 3SX0A 4C4AA 5CB4A 1F2VA 1LLCA 5DHAA 4PZLA 1JFRA 1ND6A 4IR7A 5E38A 1N5KA 1SCUB 2C2WA 2RGCA 4TXLA 3AUKA 1BIFA 2BJHA 2RG1A 1L5ZA 4M0DA 4XRRA 1VL5A 1ZFNA 1UT6A 1KZ6A 4L5AA 3WZMA 1PCXA 5F52A 3I8OA 1SC6A 4X00A 1N6HA 3NBFA 2GPSA 2L19A 5T6MA 2D8MA 2O23A 2GAJA 3PRKE 1AHIA 4X54A 3EEYA 5D85A 1S8NA 2AMLA 3GFQA 4RTMA 2Z2JA 2AV6A 1WF6A 4ETNA 4OM8A 3I3SR 4HDSA 2V8OA 3WGLA 1Z08A 2ZRKA 5GOZA 3FPGA 3GJ4A 1LQUA 1WRBA 2VZ9A 4YX9A 1MJGA 1UAAA 4FGUA 5EUCA 1T34A 1T8TA 1YRAA 1U2DA 3JARA 1KQGA 5EE1A 3H4VA 2G8NA 5DSTA 3RS8A 3SNKA 1OBVA 2QRGA 3GMDA 1HMPA 5I51A 4LHVA 3OEYA 4U0KA 1DMSA 2EQAA 1XZBA 3AB8A 4EOGA 5IFLA 2R2GA 5CX1A 1F2TB 2CV0A 5FXMA 4I6JA 3PSAA 5I4BA 3U13A 3KXPA 4TQAA 3PUXA 5EP1A 2O2ZA 2C7OA 2X8BA 2QZZA 4E11A 1UCFA 2GRJA 2RI1A 1B0UA 3TAUA 1I32A 1QG0A 3D7NA 3K9GA 1Y80A 2C99A 4GOND 4NATA 3H6HA 1M2VA 5CG2A 2YZKA 3AF1A 4HVTA 2Q0HA 1I01A 2J4DA 3MT8A 1WUJS 3DQPA 4TV9A 4JI2B 5D84A 1ZIPA 4BGIA 3OZDA 1ZG3A 4Z86A 1CB7A 5HEKA 2I6TA 3I9LA 1QB7A 4YNBA 1KP2A 5AVZA 1AQJA 2P7HA 1DO0A 1H8ED 2OO3A 3FGOA 4A2PA 5AKJA 4AWXA 1MF7A 4MARA 4I4NA 2XB8A 4F11A 2PUGA 4LG1A 3TH5A 4C20A 1C81A 4R8SA 1NJ6A 1Q77A 5AVXA 1SVLA 3DEHA 4H77A 4FFDA 4BUJA 5AQ1A 3U49A 1TRHA 3IMKA 4RD6A 1FDUA 2FEMA 2HWKA 2PS3A 1SAYA 1VG0B 1PJ8A 4OHKA 4LXIA 2ZXFA 1YOVB 4LJRA 2FG5A 3FX2A 2DQZA 2WINI 3SY8A 3A37A 1NVKA 2XQKA 2IOHA 3EOAI 5ERGB 1RAGA 2I03A 4UBJA 4JT2A 1ZM9A 1ODKA 2PD6A 3JZAA 3Q9NA 4B6QA 5BV8A 3JARB 3PS9A 3ZDDA 2YJ3A 3H2JA 2IUTA 1MBZA 2Y2UA 1GPAA 3GRCA 1P1FA 1RVV1 2OC9A 1BH2A 3I01A 1TCAA 2HIAA 1E6KA 1IH8A 4FEEA 3MTAA 1YDWA 4JH0A 5NLLA 3W2EA 2RFLA 5EIEA 1XU7A 1JU4A 3QHPA 4G65A 4F1WA 3BSSA 5HIMA 3IP5A 1WU7A 4L75A 4C2AA 5JCOA 2F1IA 3AUAA 3DZDA 2VR1A 4Y0VA 5H3HA 2R1TA 1QH8B 2KB0A 1J7KA 3P4YA 3EGIA 3H2HA 3N8GA 4EAQA 4LECA 2J0EA 3FNIA 4JDUA 4BFWA 1RJ9A 4ICIA 2B9EA 1RRVA 2NGRA 3NHLA 1IUPA 1E1QA 3MGAA 4O4JF 1G7TA 4QDUA 5J5AA 5A6SB 1VLHA 2GBCA 2GZ3A 2WIAA 3R74A 1T29A 4DLWA 4F5DA 2GF9A 5FWAA 4QFCA 1QHEA 3M3HA 3ONDA 1JMKC 1G4HA 4B73A 4UU1A 3U2QA 2JGAA 3THXB 4RMNA 3PNKA 4RNCA 4KVGA 2FF5A 4BKQA 5IPFA 1L4NA 5FI1B 1DTEA 1I10A 4JOCA 3KWLA 1TRKA 4JJ8A 3VSDA 2DQKA 2GYUA 5KYKA 6CHYA 1GYQA 4HNHA 4RHXA 3B60A 5CVCA 4Z4CA 1Y7TA 2P75A 3MWYW 1XAJA 4DLKA 2QRMA 3LUPA 3INGA 2EJBA 5LU9A 1SXPA 2HWYA 2Q1WA 3FLAA 4M22A 5EJGA 4EEZA 1Y37A 1E20A 2NUTA 1E3MA 4B47A 1JIXA 2A33A 3D4PA 5ALVA 4J07A 1RYHA 1YS7A 4R51A 3TD9A 4CIAA 2G5GX 2OMKA 1KDTA 3OQOA 1J07A 2Q3MA 1W1IA 1RC0A 4MV3A 1T0JB 1AKVA 1N2OA 4DV6B 1BHJA 4C4PA 3EXIB 4Y30A 1FLDA 4E51A 4H9GA 3E9EA 1NXVA 4MI3A 2ZU6A 2QB5A 3BMOA 4RELA 4EZIA 3BGVA 1XNJA 3R6WA 1AA6A 3L1HA 1E2BA 1U5AA 3KHSA 2PXXA 4MUEA 4PGAA 5DOVA 5FKJA 4GPD1 5TJHA 2HQBA 1HGXA 2PX3A 3EEQA 2R1TB 2FTKE 1EGQA 2CHUA 2V7BA 2ZJZA 2PZLA 2YWGA 4GUDA 5ECGC 5FV7A 3RFCA 4D8TA 1JU9A 1XVUA 3LZDA 2QLBA 4LOLA 4QU9A 1TTTA 4W8GA 2OORC 2J45A 4OSEA 3VDXA 3LX6A 1OVGA 1A0OA 3NM5A 3EIOA 1E8MA 5BYJA 1UP6A 4TLAA 2R6DA 2WV9A 5B1SA 2PKQP 5AJXA 4XFKA 4KLCA 5IJZA 1G20E 4R9NA 5DB4A 4G5FA 1XMXA 1YS9A 1E2PA 1R6TA 1NVGA 3P0FA 5TSDA 1RE0A 2UKDA 3CLRD 5A9RA 1I2BA 5K8IA 3JATB 3CU5A 1LDYA 1XELA 4ER0A 2Y4NA 3KT3A 2V4ZA 5EI5A 5ALSA 3N70A 2ZSBA 4AMVA 3N86A 4KIUA 5BN3A 2XQJA 2V7QA 3V32A 2B99A 4WY8A 3T1HB 4MIOA 3HDTA 4YP1A 4ZQBA 3UMRA 2FU5C 1Q12A 5DYIA 4GLBA 5JWHA 3VZBA 3LFUA 3ABZA 3MD9A 3BDAA 4JLDA 1JIUA 2PXCA 2NUBA 1XDZA 2YTZA 3OU2A 5F3DA 2I2DA 3PUHA 2MSDB 2II6A 3S5JA 1MIOA 4AUEA 4U7WA 4V0OA 4FCWA 4UU0A 4ZVRA 1V37A 1R4AA 2BAGA 4HX2A 5IKOA 2P4UA 2R8XA 5HRAA 3L3BA 1Q0UA 1NVBA 2VSOA 2ZSDA 3BA1A 3BRWA 5ITZB 3SHOA 3I58A 1OBFO 1GA4A 4D7AA 2XDYA 2EATA 4KSCA 4ZMSA 2FLVA 4GWLA 2ZB7A 3OFSA 4HAIA 1TAUA 3T5GA 2H07A 4RPJA 1QHXA 5DHSA 5B4UA 4ZREA 4WVLA 3B1FA 1XDDA 3RSSA 3PWZA 5H70A 2Q6IA 2BKUA 2FV8A 4CMIB 1OZ0A 3WL7A 1A27A 4JI4B 2VAMA 2Q2WA 2YUTA 2WNHA 3D8UA 3OAAD 1RQ2A 3ZR4B 4BO4A 3ZCUA 4DV2B 3LPNA 3TR6A 2GJAA 5FTNA 4M8SA 3ZU5A 3CURA 3VRHA 1UPBA 2P2LA 3B7WA 3Q5EA 1T2NA 4FBLA 3HYTA 3FPCA 1NBAA 3FTDA 2I99A 2IXEA 2CNDA 1H4VB 3LJKA 4YACA 3SE7A 2YVKA 4AICA 5JJ5A 5K2OA 1QO9A 1GR1A 1ZJWA 1NR5A 2QX6A 1B0PA 2XXJA 3C8HA 4KQWA 1P2DA 2IYVA 1FXWA 2FG7C 2FZGA 1GLGA 3JQ9C 4JN6B 3PQFA 3ZKWA 4LOAA 4AO7A 1LCIA 2PBRA 3PE3A 2Z08A 3HB9A 3Q8WA 2WHXA 3GCGA 3OD5A 5I7VA 1QK5A 5EQJB 5JXGA 1R8QA 4CG1A 3DAGA 2GVNA 1JEEA 1CIVA 4BB0A 1HDRA 2VAVA 2FQQA 4N0EA 5ALKA 2QPAA 1MIOB 2X1LA 5I9SA 1FNMA 1G8AA 1NZFA 2BE7A 4JLJA 2EKZA 2J1LA 2QHXA 1W4BA 3L02A 3T7DA 4WIAA 5JI2E 4OKIA 4ZYUA 2PPLA 1PZNA 2BM0A 1Q1GA 3UO8B 1DRWA 5E1BA 2QYOA 2WHPA 4Z9XA 5HMLA 4H1TA 1DI0A 2QL9A 2KE5A 4K6OA 1X3LA 2ZUCA 3I34X 1E79D 3I1FA 3FUVA 3V2HA 2HD4A 3GGSA 4BO0A 4Y1EA 3H0KA 3JZFA 1EQ2A 3QV2A 4H16A 1BXGA 3FB4A 3SX4A 1ISJA 4QBKA 4UAVA 5GZ3A 3DHYA 2EG5A 2ZSJA 5EVCA 2XA9A 1I6WA 3NIFB 2OE2A 2DBVO 2RAVA 2WM8A 3AR7A 4J1TC 4RANA 2IWRA 4L73A 3RIEA 2PVCA 4MXDA 3QXCA 2WABA 3VC2A 4NC9A 3W9YA 3NUGA 1LDNA 2V97A 2XVAA 2Z57A 2NQ8A 3L6OO 2NUPA 4UU7A 3OIUA 3TB4A 4X24A 4EVQA 3NDRA 1KMIY 5A71A 4AMBA 3GDFA 5FYQA 4GPEA 2D7DA 1EE2A 8AT1A 4V2UA 1C7RA 3PYLA 2X0JA 2FRXA 4TT3D 5CJJA 2L2QA 2O7QA 5DN6A 3SP1A 1H1LA 1ODLA 2WTBA 2A2ZA 2JFBA 2IZ5A 1VHWA 1YBVA 2YV3A 3FDIA 3P9QA 4IF6A 3ZLJA 1VDMA 2EKLA 2VRCA 3VTAA 3C7CB 2DCMA 3KYIB 1Z6YA 3PNSA 5CM9C 2H4FA 4AO8A 4N47A 3VYUB 3CNLA 2JIRA 4EMUA 4QUKA 1PTJA 1C7QA 3CT6A 4DLZA 1LPMA 1VXOA 2ZPTX 4KWEA 4RKYA 1EUCA 2IV2X 4D57A 3PR1A 2WPNA 1FYXA 4DQ0A 3QFHA 1R50A 3TZBA 3BX1A 1JJBA 2NMVA 1FMFA 4G0ZA 4L08A 1W87A 3G8DA 1NA5A 3SICE 1PFGA 3Q5DA 1GSIA 3QVLA 4YMTA 3IERA 4KAAA 4E5PA 4TMZA 1B0AA 2JAUA 1P2FA 3MWEB 5FWDA 4JU8A 1PG5A 5EC8A 1U9IC 4EO7A 1M34A 1BXGB 1N0WA 2ACKA 2I65A 4EA9A 1D0SA 4ROSA 3ZQKA 3MYRA 4JKYA 1JFSA 4YC7A 1GNSA 1S2MA 2PLRA 2FJUA 3HLKA 3HYRA 1RXWA 2H54A 4TTTS 2VA9A 2XZOA 3FKSD 3LBYA 3C16C 5HTKA 3UJ7A 1IOWA 3GT4A 4DW8A 5IMBA 4Q9KA 2NUPB 2VQSA 4OMUA 5K8LA 1DEAA 5DFAA 2ZJ0A