1LK3H

Engineered human interleukin-10 monomer complexed to 9d7 fab fragment
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
219
structure length
219
Chain Sequence
b'QVNLLQSGAALVKPGASVKLSCKASGYTFTDFYIHWVKQSHGKSLEWIGYINPNSGYTNYNEKFKNKATLTVDKSTSTGYMELSRLTSEDSANYSCTRGVPGNNWFPYWGQGTLVTVSSAETTAPSVYPLAPGTALKSNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSGLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-10
publication title Noncompetitive antibody neutralization of IL-10 revealed by protein engineering and x-ray crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 219
sequence length 219
chains with identical sequence I
ec nomenclature
pdb deposition date 2002-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lk3H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lk3H02
3VWJA 1T1XB 4K8RD 4JHWH 3AAZB 3O0RL 2C3XA 3Q6GL 2IPUK 5FK9B 1KXQE 3MNZB 2E27H 3U4BL 3V4PH 3OKLB 1DVFA 3KYMA 4ZAKA 4HIXH 2DQDH 1P84K 2IAND 3D2UB 1QLFB 4OCSH 3QCVH 4DVRL 5AD0B 1U92B 4AENB 3K4DA 4I48A 1JNHA 4QCIB 1BECA 3X14A 2Y7QA 2Q3AA 4ZO9A 1C5CH 2FZ3B 4U1KB 3CMGA 4GS7B 4LGRB 1GGCL 5GZND 2EEBA 3BPLB 5ID1A 4XVJL 5E1HB 3MRNA 4APQC 3S4SA 1U58A 2E7BA 2ZKHL 4FFVD 5FDWB 4JRYA 3KHQA 4POZC 4JY5H 4JKKA 2L4OA 5KJRH 1LE5B 3H2WA 3L1OH 5ALBL 3ARRA 1N64L 1D5XA 2DTMH 3DX7B 3TBTB 3VGEA 4NQSB 4ZOAA 1QFWH 4D8PA 4LHUA 3Q5TA 2BOCB 4YGVA 3DVNA 1BLNB 3IGAB 3JSSA 3KPLB 1CDIA 3LN5A 4G9DB 3NFPB 3G6DH 1D9KA 3ARFC 2RCSH 4KDTC 3NCJL 4HIEB 5CAYB 1RV6X 4JHAH 4QRPB 1R3JA 1JGDA 4YFDB 3SDDD 4CGTA 3O45B 4YC2B 2VXVL 2D0HA 2ZPKL 3GSWA 3RX5A 4ODBD 3WXWH 1GHFL 1CDCA 5EC1B 3PNWA 5EOQL 3ARFB 4X6CE 3UC0L 1DDHA 5EZIL 1J8HD 3OPZL 3RA7L 1CVSC 1QFUL 3CCHA 4LF3A 1TENA 3L5IA 1DN0B 4J4PC 5B21A 3O3EA 4LLVA 1PG7W 5C0AE 4WTZG 2X05A 5IMMB 5DD3H 5TGBB 3P11L 5F7EH 2ZWLT 1I8LC 4P2OC 4UTAL 1LO2L 4OM0L 3KHOA 1HOCB 5LGKA 1KT2A 4E41E 1UJ3C 5DUML 4LEOB 1ND0B 1UCBL 5GS1B 1J0IA 3NIGF 1SMOA 1A1NB 2DI9A 3WJLA 4XP5H 4FQIL 4Y19B 1IL1B 4AK1A 4FN0A 1I3RB 1S7WA 5DO2D 1CGYA 1ZOXA 2O5XH 4MA7L 4Q6IB 4PJFF 4KZEL 3EJYC 3HMXA 1UJ3B 1ODAA 1AGEB 2PW1B 4U1IA 4WFFD 3TJEL 2M8XA 4AMKH 3VFUB 1V7ML 3HRPA 4RFOL 3SY0B 2KH2B 5IIEA 4OLWL 2VLLB 2WLZA 2E9BA 2UYLA 3HC4H 4HUUB 3VDBA 3PWUA 1NKOA 1OAYH 5HSFA 1OSPH 2Z31C 3IU4L 3S34H 2ATPB 4DCQA 3FAXA 1DZBA 4KJWD 5EU5A 1NFDF 3BRGC 5JTWA 4JZOA 2MCPL 4N8VB 4P3WA 1CIUA 1LQSR 4Z7WA 1WWWX 2DLFL 4F57L 4KVNL 4Q0XH 2YD4A 2IPKB 2BNRA 3TWCL 2VZVA 4S1SL 3KR3L 1Z5LB 3EO0B 1HWGB 4XH2B 3MOBL 4X80L 9CGTA 3SQOH 3QIUD 3PWVB 4BK4A 4XNUH 3STLB 3AS0A 4OF6A 5I6XB 1NUNB 3P9LB 5C0DB 2DICA 2P48B 4XPBH 5ITBH 1P4BH 4XVUC 3ULUL 3H3PL 3X3FH 5T3XD 1MI5B 1NCAH 4XP6L 2VAAA 1GOHA 2JK5B 3NOIA 2YK1H 5C0CD 3BO8A 2P45B 2VWEE 4JQXA 1OTTD 4XMPH 5BVJA 2A83A 4GUPA 5L6YL 1XGYH 5IGXH 4ELME 2RFXA 1RQ5A 1XGPA 3LN4B 3RZCD 1UZ8B 5J0BA 1B0GB 1NEZA 2KUTA 3AXLA 4EUPH 3KPRA 1KJ2B 1I9IL 4LU5L 4I3SH 3WL9B 5D7KD 1X5HA 1MVUB 1T66C 1BFOA 3S9DB 1OSZB 1ADQL 2X7LB 5IW6B 3NACL 4NZJA 1A22B 5F9OH 5GGSA 4PJ9A 1F11A 4LFHD 5DRNA 1EZVY 4HKBA 5K9QG 3RVXC 3DNKA 2J5LC 1S7SB 3CUPA 2VZSA 3EYQD 1HHKA 2FWOB 3VXRB 4QRQB 4OLEA 1JF1B 6FABL 3TZVA 2OX5A 2EDXA 5ITFB 4LHUG 5DJZB 3GSUB 1FVDB 1I9JL 7FABL 1NANI 5A2LH 5DI8B 3G5VA 1YEEL 5DK2A 5KVEL 4JFDA 1OTUC 4MLIA 3NCCB 4QT5B 4O5LH 4OD2A 2X70A 3SDAB 3LPWA 3BH8A 3QDGE 5DVNA 2AQ1A 2WBJA 1Q8MA 3VXME 3GSOB 4RFNB 3MV7A 2AXFA 3QDJD 5C0BD 4NCC1 2CKNA 4KQ4H 4DKAA 3MZGB 4PJCB 5CZXC 1GIGH 3DWTA 1VFOA 4KHTL 3VJ6A 2V5YA 3LRSB 1MHCA 1MJ7L 1GZQA 4Y16B 2IBZY 4EI6B 3REVB 4YHOL 5E00B 4GXUN 3L95A 1P84J 1I1AD 4L8SA 5D7SH 2XWTA 4QHLA 5TE4L 4C56D 4IMLB 5B4MC 1TNMA 1JUFA 2VC2H 3P73A 2UWEA 4LMQI 4NZDA 4F37K 2BVQA 1IT9L 2ORBH 6CGTA 3SDCC 5GHWL 4BQ9A 3GI8L 4M6AA 5B38A 1VA9A 4I77L 4RQQA 3AU1A 3ARDB 4J8RA 4YHZL 2R69H 4YHNA 2IANA 3DMMC 1A6UL 1MREH 3OHXA 1UWXH 1I1CA 3MLWL 3OX8B 4PV9B 3E1F1 2F54D 5FCSH 1HWHB 4KKLD 4GG8A 4Y4HB 2C1OB 5HHME 4M1GL 3DUUA 3ROLB 4KTEH 5J1TC 3CX2A 5F9JB 1ZVSB 4GXUM 1A6WL 1HH9B 1A7PL 1Z2KA 4G6KH 5I1AA 2EZ0D 5FYKH 3B9VA 4I9WD 5ICYB 5KW9L 4K7FA 4XP4L 4O9HH 4IJ3C 1WC7B 4YPGA 2RBLA 4X0KA 1LDPH 2YA1A 3QXVA 1E4XI 4X4YB 1BD2A 5IM7B 2OTWA 5E6IA 3UDWC 1S8DB 3O11B 1XCTA 5I66A 3OB8A 3I50H 1JGVL 4J3UA 4GSDH 3VG9C 2OMNA 5C08E 3LH2H 5C6WH 3L3GB 4IRSB 4GKOA 3B3IA 1JK8A 3MRCA 4HDIB 5J13B 1QSZA 4RBPK 1HHHB 1UEMA 1N6UA 4RWYH 2GT9B 3SDDA 4HUVA 5CINL 4XBPA 1I8KB 5EG6C 5IEKA 2FR4B 3V5HA 3GUTA 5IK3B 1J5OL 1S78C 4KH2A 1J8HA 1LEKB 3NZHH 4ZPTB 3V5KB 4WHYG 2EDYA 3QA3A 5E8NA 3VE0B 5DEFA 4NKIL 4TTDC 4U3HA 3RPIB 3TH2T 3OXSB 3PXJA 3F12A 4LRNL 4FQXC 4PB0H 1MCOL 1CBVL 1WBZA 3KJ4C 4YDVA 4L9LA 1CXHA 3C2AH 3DX8A 1I3UA 1AXTL 1NEZG 2ARJB 4UINL 5FCUH 1JN6B 1OTSD 3UJTL 2VO5A 4B5EA 3BI9X 3RI5K 1FFOA 4NN6C 1DBMH 1DVFC 1WBXB 4J3WA 4CRPA 4DN3L 3FHQA 2MJWA 5I17A 2B4CC 4PRAA 4N9GB 1O5DT 3W11D 3RNKB 2QQLL 1PEZA 1F6LL 1I4FB 4HS8H 1G7LA 5F44A 5EO9B 4P9MH 4NN6B 3BPNB 4HXAH 2NR6C 4WHCA 4BZ1H 3CFDA 4JRYE 4KROC 1FNEB 5IROA 5IFJB 4JEGB 1MAJA 2Y6SC 1B4JH 5JNYB 4ZUVA 1EAPB 4P2YA 3C5SB 3MRBB 3BP4B 2DQFB 4OLVL 1UYWL 4S0SD 3P30L 3BZ4A 5E2TL 1V3LA 4G43B 4KROB 3LKSA 5IBUG 3TV3H 3UPCA 4F58L 2GUOB 5HBBA 1X5ZA 4P5MB 1MAMH 1LWRA 1FG2A 3CFJA 2AJSL 1BJ8A 4FQHA 4G8GA 4JM2F 4YR6B 2AJ3A 1OP9A 3D2UD 4LCYA 1RUQL 4NHUB 3QIUA 1EH9A 4X7SH 1ACYL 2VSDA 2DLGA 2F58L 5IOPA 4BH8B 3FFCB 1FE8L 5I8CA 1F8TL 4FFZL 1TVHB 1I1FA 4JB9L 5JUEH 3VFTA 1VACB 2IAMC 4HJJL 4QO1A 5C0CA 4NM8H 1R3LA 3O2DA 3AS1A 3S37L 1LK2B 2FHBA 4WVRA 3ZE2F 4P46C 4HK3N 3TCLB 3IF1B 4M7ZB 3TBWA 5EN2B 2YHGA 2VISA 4RIRA 5D7JC 2IAMB 5B38G 5MP6L 3RZCA 2V2TA 4KV5F 3EYVA 3SKMA 3IT8D 1RMFH 2EO9A 5CMAA 1N2RB 2OL3H 1KIQB 4P46B 2IG2H 4RAUB 2XY2A 1NCUA 1ZHLB 3QJFA 3WJLC 2R1WB 5IBLD 4QRPD 2AV1A 4UBDC 5D1XC 1HINL 1A7OH 3IXAA 2YWZA 4LVEA 1S9WA 3X3GH 4LEXH 1K8DA 4X4ZA 4F7EB 1EGJH 1K5NA 4MB5A 4XWGL 4MX7A 1BM3L 5JXAL 1RZJH 1K6QH 2PO6B 3VFGL 3BYTA 1UGNA 4JGJA 4Z7WE 3IXTA 1MJ8L 5DJ0A 2P8LB 1MEXH 1ZK9A 3MLYL 4HXBL 4JO1L 2BNRE 4PGEA 4NRXB 5FF6B 1KULA 3SO3B 1S5IL 4OTXL 4I5BB 1FNSL 3I9GH 1RZGB 2ICCA 4I0PC 4M1CC 4Y19D 3BPOC 3GJFA 5DLMH 3VMNA 4D9LL 1YY9C 1U8JB 3QDJA 2IBBA 3U30C 5C0BA 3B8SA 2VDMH 4NZTH 1MJJA 1ZLSL 3RIFK 3ULUC 2D7TL 1DBBL 4YDJA 3S6CA 3OR7B 1I1AA 2NY6B 4YLQT 4XNQB 4J1UA 3RKDD 3SKNB 4C56A 4YK4B 4LKXB 5GSVB 1KYOJ 5KVFH 3KPRE 3FO0H 4QHUA 2J8UB 4OQTA 4XCFL 3H3BC 2QSCL 5DJ8B 3HE6B 3ZL4H 4O2FA 1G0YR 4K2UL 4F7PB 1DUZB 1FFPA 3KPPA 4RMSA 5DXWA 5J1AA 4E9LA 5C71A 1SY6A 4XVSL 5CGYC 3RWIB 1A21A 2C3VA 3LN9A 4K23L 4KKCD 4TPRH 5HHNB 3O4LA 5H35A 4IM8A 1CZ8H 3NABH 2VR4A 5DS8B 1WWAX 3LV3A 4OZFH 5T5FH 2ATKB 3DI2B 3MRQA 3FO1B 2GTWA 5MHSE 3O3AA 1YQ2A 3BP5B 4R4NC 4HJ0C 1ZT4A 2QHRL 4MJ4A 2JELL 2VDNH 3RWHB 12E8H 1NGWB 1WV7T 3HMWL 4JFDE 4N0RA 1IEHA 1RUKL 3E3QE 1QSEB 3GJEB 3LAFA 2AABH 1FZOA 2BC4A 5A2IH 5I19L 4K94L 1JI1A 3KPNA 2R23B 1OQXA 1M71B 4XBEH 3LZFL 5I30L 1CIDA 1D6EB 3A6CL 2AV7A 3MV7E 5T1LD 2XRAH 5DVOA 4JPVH 4L1DA 1NCCH 1DL7L 5KVDL 1A3LL 2J3SA 4P59H 1AGFA 3V0VB 1SYVA 4PP2A 4QGYA 5EULV 2PR4L 3U6RB 4MSWB 4XCCL 5E9DB 1FH5H 3L3KB 3WKML 4TSCL 5L2JA 4G8FB 3IJHB 2UWEE 2DM2A 4XAWL 2WAHA 5GGUB 2K9UA 3VXRD 4U1GC 3DX9B 4IOIB 5CEZL 3UO1H 3U0TA 4MCYA 5CEYA 5C6TL 1CQYA 3RWDB 3RY4A 4YHYB 3HZVB 4XP9L 3MLSL 5ADOL 2IANE 2MQ0A 1L7TH 3FFDB 3S5LB 4AEFA 4ODWB 4ERSL 1FRGH 4JPKL 3V79C 1D6VL 3GRWL 3SDAD 1W0YT 3BDBA 4D3CH 1FFQA 1WSST 3TO2B 1Z3GH 4GKNB 4OZHB 2XZQH 1XGQA 1YEDB 2FD6L 2W0LA 4LFHG 4BFGA 2K7PA 4P2QB 3STZA 4L3CA 2XKSA 4Y16D 1U9KA 1RK0A 2QADC 2OI9B 1KCSH 1BD2E 4RBPH 4XXCC 1F6FB 4QRRB 3OJVC 3X13B 5FOJA 1T1XA 1HSAB 3P0GB 1CDYA 1IEBB 1CFQB 5FK9A 3MNZA 2QHLA 3L3IB 4YHIB 2WQ8A 3DGGA 3ARDD 3D2UA 1QLFA 5AD0A 1U92A 4JO2L 1XAUA 3HI5H 3WNKA 4U6YB 5FECB 4Y4HD 3C5JB 1J8HE 5AAMA 2FLBT 5LCVL 5D6DA 1TJGH 1XR8B 2EO1A 4U1KA 1ZHBB 2J88L 5ISZB 2CUIA 5CBAB 4XP1L 2HVKB 3LKNB 3QWQB 4JN1L 5IUSA 3U7YL 1AGBB 3S36L 5JMOC 1UXWB 2FECL 3F7YA 1JL8A 4KVCL 1CDUA 5FDWA 4M7KH 3RP1A 1VCAA 3SCMC 2XZAH 1K9TA 4LSTL 3WFDH 4D0DB 5BQ7A 1LE5A 2W0FB 3C8DA 1AR2A 3DX7A 3TBTA 4NQSA 4MXWH 4PBWD 2NYYD 1HHGB 3IGAA 4UNTA 3K8KA 4F9LC 3M17B 5JQ6L 2MQCA 3KPLA 3JBG7 4X6CF 4G9DA 3BH9B 3NFPA 2R0ZL 1X5JA 4IRSD 3UEZA 5I8OH 4QEGA 4QRPA 1U41A 2CSPA 4V1DA 2DMCA 3VI4E 3O45A 2Y36H 5EA0L 1I3GL 5EC1A 1AI1L 1WZLA 4PJAB 3V8OA 1R24B 5FGCB 3QEQB 5HD8C 4Z0BL 3QNZB 5TGBA 2ED9A 5DMJB 3HAEB 1S78D 2DQJH 4JRXB 4Y4KC 1IGFL 3BVNB 3LY6A 1A2YB 5DJAB 1HOCA 4G8GE 1RUAL 2EXWD 3B9AA 5GS1A 4FXLA 5E8PB 4Y19A 1IL1A 1MAKA 4MXVE 4Q6IA 1HYSC 3NH7H 2E8ZA 3GK8H 4OGXH 3QDHA 1DLFH 2F8XC 4R9HA 1FC2D 5T3XE 1JNJA 3VFUA 3S3SA 3P4LA 3F5WB 1NGXA 3H42L 5GRVL 5C3TA 3SY0A 3QNYB 4JDTH 1J9CT 2VLLA 2EIZB 5C0CE 4Z8FH 3OKKB 3QP3A 5KANG 4BKLB 4O02L 3ZHDA 4QHKI 5C9JA 4NRZA 2O5ZL 2VZUA 2ATPA 3FB8B 4OKVB 1WVZA 3MXVH 4BQ6A 1FIEA 4N8VA 1GH7A 2FATH 4KROD 1QFWI 5AWNH 2Y6SD 2KQMA 3NA9H 5E7FA 5ILTH 3OGCB 5FV2A 1G84A 2HLFC 2W07A 2IPKA 1S9VA 3VGHA 2YKLH 4OIAA 5IT2L 5SWSA 5CKAA 3HFMH 1Z5LA 3EO0A 4XH2A 2C3GA 4Q9QL 1BJ1H 4IMKA 4XVTL 5IB1B 2HFFA 4WU5B 1JNLL 1NLDH 3INUH 1S9XB 1V05A 3N9GH 3F58L 1IGYA 4YXKH 2V5TA 5LXGH 4WFHD 3STLA 5EBLB 1U8LB 3P9LA 3WIIH 4DGVH 2OSLB 5C0DA 2HTLD 2XQBL 3FFCD 1SJXA 3W2DH 4ELMF 1N0XH 3V5DB 4NSKB 4LLYB 3W9DA 5SWZB 5I9QC 2IFGA 2WIIB 4TRPL 2JK5A 5F1KC 2QBWA 3FT4A 3ULSB 4YE4H 2NY7H 3EOTH 4EBQL 1CFVH 4ODUA 1MQ8A 1Z0MA 2F5AL 3HE7B 4HX1B 2YUWA 4LKCB 1CDJA 4WFGE 2WMPA 3DYPA 3DROB 1B0GA 2B1AH 2EYSB 1SBSH 1WT5C 1EJ6A 1KJ2A 3QDJE 5T1LA 5GISH 2FGWH 5C0BE 3TYGH 4P46D 4UV4H 1YQVH 1QP1A 3U4EB 1CXLA 1OSZA 4WUUA 2W59A 2OZ4L 4EQ3A 1J1PL 1CGSL 1U91B 3PHQB 1J10A 4C56E 3S7GA 4KPHL 5HDQL 3PWPE 5GGQL 1S7SA 2XG5A 2PO6D 5DWUH 4W6WB 5B39A 1NBVH 3VXRA 3RIFF 3WIHH 1JF1A 4PGJA 3ZT6A 5EIIB 3BQUC 2D7MA 4OLYH 4F2MB 4DKFH 5ITFA 4YXLH 5DJZA 1AHWC 2DM4A 3GSUA 2AK1H 1FVDA 1HILB 2LE9A 2G2RA 1IGMH 4JG0L 1A6PA 4JDVB 4QT5A 4F9PC 3SDAA 3QI9B 5JOEA 4L3EA 2BCKB 5HYQB 1L6XA 3O4LE 1RJYB 4YQXL 3GSOA 4NO2B 4Y5XC 1B2WH 1MQKL 1PKQB 3DSFL 3M8OL 1EJOL 3MCLL 4PJCA 2VXUL 4I9WE 4UOW0 1VERA 4Y16A 3QFDB 3SOBH 3PL6C 4F7CB 3DUHA 4EI6A 2P8MB 2IALB 2O5YH 4OT1H 3REVA 5E00A 2GK0A 3GMRB 2NY6D 3CVHH 1KIRB 5ACLA 2YEZA 5I16B 3BKMH 4IMLA 5LGHL 4OLZL 4LDEB 3ULUD 3BT2H 4Y5VB 5HHVH 4JG1H 4Z7OE 3ULVE 2R0WH 4PBXA 3MROB 3ARDA 3HE6D 5EOCJ 4HT1L 3QFJB 4N0CD 1DANU 3OX8A 4PV9A 4K3GA 3MBXH 4OD3L 3QPQD 4Y4HA 1URLA 2C1OA 5E99L 4J3OC 4JKLA 1NMBL 2FIKB 4UT7L 3ROLA 3NFSL 1R3HB 1IQDA 5HTSA 4JFOA 3ETBF 1HH9A 2CJUL 4UZGA 1OAQH 3NPZB 4D0BB 1MIMH 2ADFL 3WFCH 5FO9B 4BSWB 3HUJB 2FL5B 1WC7A 5DJCB 1ZAGA 1YJDL 3TBVB 2X9YA 4N8VG 1EHLH 4EKXA 1S8DA 2CIIB 1QSED 4HIIB 1P5VA 3JWOH 5DQ9B 1AGCA 5L88L 1EXUB 2VDLH 1TFHA 4UUJB 5GS0C 1OT2A 2FEEL 2OCFD 2VJXA 4GRMA 2VXTH 4N9OB 4IRSA 2N4IA 2C4FT 3ZHLA 4QHKJ 1JZ2A 4G7VH 1HHHA 3MLZH 3MJ8B 5BZWB 5FFLA 1I8KA 4B7LA 4L4TB 3FZUC 5IK3A 4G80B 4FTVA 5E9DD 1LEKA 3TA3C 4ZPTA 5EB9A 1A3RH 3V5KA 3VE0A 3RPIA 5B3JE 3RJQB 1SQ2N 1SEQL 4BFIB 2ZCLH 5I0DA 1JYVA 2YUVA 2AXGB 2ARJA 3IETB 2HH0H 1JN6A 2A6JB 5L7XL 4KQ3H 1XGRB 1GC1H 5JO5B 1WBXA 2JCCB 2X6MA 1YNTB 1F3DH 1DQQA 4N9GA 4HF5H 3EZJB 5IHUH 4JO4H 3Q5YA 3RNKA 5C0GB 1I4FA 3RTQA 2Z91B 3IJYA 3RBGA 4P2QD 1MHHB 1FNEA 1RVFH 4PP1D 1EAPA 3C5SA 5B39G 1GSMA 1MH5B 3CFCL 3QO0B 2DQFA 4CAGA 4QRRD 5A2KH 4G43A 3HMXH 2DWDA 4YO0B 5F7DB 1RZIB 2GUOA 1AY1L 1JPSL 2YRLA 3U1SL 4K3EL 3ESUF 3U79A 3MRMB 2DN7A 2XQYK 4QRPE 3AY4A 5ANMB 3CDFA 4R0LA 4V1DE 4NHUA 1NCBH 4UV7H 4GQ9H 5F1OB 1PAMA 3BKJL 2DKSA 1ZGLB 3QXDB 4BH8A 5ISZD 1UA6H 1C5BH 3GMOB 1TVHA 1PJ9A 2FB4L 2GW5A 3V8CA 4U7MA 3LHPH 1CFTB 2E8YA 2VDRH 4M8QB 1VACA 3H9ZA 2UV3A 3NIFE 2L0DA 1OPGL 3T8XA 4M61B 2M26A 3BD5A 4KHXH 1LK2A 3VW3L 4F33B 3TCLA 1Q1JH 1IGIL 3IF1A 1JTPA 4Y19E 4LBEB 4LLWB 4LPXA 1CICB 4S1DC 4Y2DB 4TULL 1EO7A 3AMKA 4N0UB 5FOBB 1VEMA 4N0FA 3BE1L 1N2RA 4NWTH 5JXED 1G7QB 1KIQA 4PRBB 3DYOA 4RAUA 5TQ2L 1PD6A 3GJFK 5FIEA 4YHPB 4ZS7H 5DEGB 1QBLH 4Z7WF 4S10A 4N1EA 1EX0A 1YNLH 1DEDA 2HG5A 4F7EA 1IKFL 1CLYL 1X44A 4LSQH 5E5RB 3FTGB 3CLEL 3KLHD 3LKQB 2BDNH 3X11B 2APVA 3MLRH 5CZVH 4MDIA 3O6ML 1GGUA 5DUPL 2AK4D 2PO6A 1SM3L 3QEQD 3BOVA 2B8OT 1QNZH 2WBKA 2P8LA 3GI9L 2QR0B 1IBGL 4JRXD 4L5FL 4YDKL 1CGXA 1NSNL 1FVCB 4RDQG 1Y6KR 4NRXA 5FF6A 1KJVB 3VA6A 5E08L 5SWSE 2EKSB 3WSQH 5D7IB 3ET9F 4I5BA 4NUGH 3TESA 3FHAA 5A16B 4ENEC 4G7YH 4OZGB 4UIMB 4DFHA 3A67H 1E6OL 4FMFA 4N8CL 2DQIL 4YJZL 4KFZC 2CXGA 5DR5H 4PJIB 4G3YH 2FIRT 4QF1A 3QHTC 1FAIL 1HIML 3GIZL 1MCKA 3BAEH 5I15H 3HZKB 1RIHH 3A6OA 1A7BA 1DSFL 4KC3B 4X7EC 4CVWA 4EEEA 4LLUB 4ETYA 1HYSD 1II4E 5F96L 1LD9B 3OR7A 4LVNB 2X4QA 1PZUB 1RJCA 3B4NA 2BSTB 4XNQA 4PYGA 3D85B 5TF0A 4P3CH 5IVXB 4I18C 1F4YL 3PV7A 3MRGB 3VD7A 1CD1B 2UUDK 3BMVA 4LGSB 1TQCB 5GSVA 5C7XH 5E6ZA 3MLXL 1A5FL 5EWIL 2J8UA 3DXAB 3OAYK 3HCVA 5DJ8A 3WFBL 1EPFA 1CXKA 4WIQA 1U93B 4F7PA 4WUUE 1QR4A 1X5FA 1IGJB 1UWEL 3K2MC 3O3BB 1QSFB 4CDHA 1A7RL 1T03H 1S9YA 3TO4C 1M7IB 5CP7B 2F5BH 4DN4L 1CE1L 4QY8B 1OAZH 3VFOA 4MQXD 4K8RH 3HC0B 1KTDA 1U0QA 4XI5D 2LTQB 3P0YL 1G6VK 1DFBH 4CU7A 1KNOB 3VXNB 2RIKA 3VXRE 1ADQA 5SWZD 4X99B 3TO4B 2WP3T 2ATKA 2W9EH 1CXIA 3FO1A 1LK3L 4G9FB 3RDTC 3BP5A 4U6XA 4OJFL 3EDJA 1BGXH 1NGWA 3RGVB 4BYHA 2PETA 2D7QA 3LS4L 4YBLB 5IFHL 3HE7D 2BHUA 1NCTA 2A0LD 2V2WB 2VR5A 4PLOB 4L3EE 4DGIH 2R23A 1M71A 2I26N 1D6EA 3WFZA 3IFNH 1T5WB 3O6LH 4Y89A 3U9PL 4PJCE 2IFFH 1T1WB 4FG6D 3WNLA 3V0VA 1DBKL 2X1WL 3U6RA 4MSWA 5E9DA 4YX2H 1H5BA 3L3KA 2Q86B 5BRZB 1I8IB 1BFVL 2G5BA 4HK3J 1ORQA 4G6MH 3IJHA 4G8FA 4Y4FC 1JNNH 3U7WL 5GGUA 2IEPA 3GNMH 4PGCB 1U8NB 5HI4D 4WI2A 1AR1C 5KBNC 3DX9A 4GRLB 4IOIA 3IAQA 4OM1H 1YC8A 1FDLH 3RWDA 4X5XA 1IFHL 2NZ9C 3HZVA 4G6AD 3FFDA 2DLTA 3S5LA 1FZMB 4PGBB 2W1NA 1FLRH 5ADPH 4PV8A 3QQ9D 4YEEA 3QI9D 1NC2A 3L9RA 2UZXB 4MAUL 3EZ8A 1UVQB 4BZ2H 4PJBB 1FL5B 1YYLH 4HPYH 4OZHA 3LEVL 4AEIL 1YEDA 4AG4H 2P47B 1T3FB 4UDTB 3PF2A 2FBJH 3UTZB 4P2QA 2I5YH 3N1PC 2NNAB 2HT4D 2EDKA 1ZTXL 2JJSA 1FNLA 5HHOB 5K33A 3WFHA 5CJ5A 4KTYA 3LPFA 2IMNA 4KK6D 4QRRA 1NMAL 1MHEB 3X13A 1ITBB 4Z9KB 2V17H 2HJFB 1IEBA 5I1GL 1EZVX 5DD5H 4YHIA 4OQ1A 4O58L 1YN7B 35C8H 1PBYA 4OB5H 4WNQB 1ULVA 4HGMA 5JHDA 1FV1B 3F7QA 1N6QL 1J18A 3QFJD 5K9KA 5LWYL 3PGFH 1P7HL 3MZTA 4S1RH 4NWUL 1ZSDB 3RUGA 2EE2A 2CRIA 2VDOL 1UKSA 1HQ4B 4U6YA 4FTVE 5FECA 1A7NL 1YPZA 4UT9H 3RVUD 1XR8A 1H15B 2W0PA 5JHLH 5E7BA 1G9MH 5ISZA 1RZFH 2HVKA 3LKNA 4JM4H 1UH3A 3T2OA 1AGBA 1HHJB 7CGTA 3T09A 1R3IH 3OJ2C 5D70L 2DQEL 4DZBB 2LU3A 1NKRA 1KG0A 1OCWL 1BVKB 3BZDA 3JV6B 3O3DA 2YRZA 3VI4F 4JDZB 1MCHA 1HHGA 2IBZX 2K1MA 3M17A 5CEZD 2UZYB 4QXWA 3DETC 3BH9A 5JXEA 5T3XH 1FVEB 5E95B 1MCWM 5C0FB 2B5IC 3VXQB 3EHBC 1KPVB 2KBGA 2PTUA 2R9HC 5HJ3A 1M4KA 3O2DH 2ZJSL 4XPGH 4NT6B 1E6JH 4NNXA 3SE9H 4Z7NE 1JPFA 2WNGA 4I0CC 4PJAA 2VL5A 1Z6JT 4WW2C 2AK4A 4ZS6D 4KZDL 3QEQA 1A4JB 4MDJA 4MXVF 2X4PB 3QNZA 2DMKA 3QEHB 4JRXA 1MHPL 3JV0A 3BVNA 2ED8A 1A2YA 5DJAA 4ZUUB 1FL3A 2EDJA 3I6GB 3M07A 4WW2B 5I1JH 3T3ME 4I2XB 2P5EA 4R97C 4YDIL 3MODL 5E8PA 3CSBA 2VDQL 5HDOA 4ODTL 2H1PH 4WFHE 1MRCL 2ZNWA 4KJPD 3UTPD 3BXNB 4HMCA 1S7UA 4CDGC 4YBQD 2J7LA 1F58H 1IC1A 2E6PA 2BJML 3QH3B 5FO7A 1MFEL 5DD1L 5H94B 4G5ZL 3UJIH 3QNYA 4F7TB 2EIZA 3QCTL 5E2VL 5IBTL 2DI8A 3OKKA 4IRZL 2OP4L 4BKLA 1J0ZA 2XXMB 5E2UH 3GJFH 2EC9T 3FB8A 3WLWC 4OKVA 1H3UA 3L5WA 1NDMB 5D2LA 3CH8A 1ZHNB 1A6VH 3OF6D 1MVFA 2B0SH 1RIVH 2I07A 5D8JH 1TJHH 3K3QA 1KXTB 1ZV5A 3S5LG 3H7BB 4RX4A 1SYSB 4M02A 2CO7B 2AGJL 1P2CB 5IB1A 4WU5A 5F6HI 4P49A 4JGUA 2NY1D 4MD0B 3QIWC 4OCMC 1U8LA 3ARXA 4ZDHB 2VR9A 1E4JA 4PJXB 3MYZA 4CVZB 3V5DA 4CMMA 1YNKH 4NSKA 2VABB 1I1YB 4RMQA 5SWZA 4OQTH 3MUJA 3QIBB 2P4AB 3UBXI 2WIIA 4ALAL 2Z9TA 3ULSA 1D3CA 1X5IA 1CS6A 4IBLT 2VERN 2ZSWB 4H8WL 1V3KA 3WDHA 5EZLB 4OCWL 3HE7A 1SY6H 4XWOC 2AS5M 4LKCA 4U33A 1CICD 2NPLX 2VZOA 3QG6A 4Y2DD 3DROA 4NP4H 3HNVH 1W8OA 2EYSA 3QUZD 1UM5L 3IU3B 1IGTB 5TF1L 2UUDH 1IQWL 3T0EB 5CS7A 3U4EA 1ZA6B 5C0RL 2R29L 4H1LA 3GBNL 3T04D 2DQGL 3EAKA 3HNTL 2YPVL 2WIMA 1NBQA 1U91A 3PHQA 3OAYH 3LEYH 4OI7A 5BS0A 2DQHL 5SWQB 1VGEH 4P3DB 5FUCE 5EDXA 2ZUTA 3ILPB 2VZTA 1A7QH 3CMOL 3WHE1 4R8WL 2M2DA 1U95B 2HTKD 3ULVH 3F62A 1K4DA 5EIIA 2J8UE 4F2MA 5KZCB 2DD8L 3IDUA 1HILA 2Q87A 2W65A 2YMXL 1E28B 5D72H 2Y5TA 4ZODA 3VH8B 1BVLA 4YPJA 2HJLB 5L0QB 1MFDL 2P44B 3DRQB 3QI9A 1CLOL 1YEJL 4NZRL 2BCKA 4FQ2L 4JY4B 4NO0B 2DKMA 1RJYA 4NCC2 5HGDB 4CNIB 3VG0L 1PKQA 4NGHL 3VFVB 2HFGL 3WIFA 4ENED 3C5ZD 5EZOH 3ARBA 3MA9H 2FX8H 3RWJA 4Z7OF 4OD1L 3IDXL 5GS2H 5DRXB 3ULVF 3QFDA 2ERJC 5IW3A 3L7FB 1UB6A 1A02N 5DMGC 3Q1SL 3GMRA 4LARL 4HKXB 1TJIH 1KIRA 3D85D 4HV8B 3QULB 1AIFA 4MJ2A 4Y5VA 5J56B 1KC5L 4U7KA 2ERJB 2C26A 2W60B 1RFDH 5FYJU 1JV5B 3TNMB 5I1IH 3DXAD 4HLZG 4ZPVA 2GAZB 2X4OA 3MGAA 1DQML 4U6VH 3CDGA 3QFJA 1UM6L 2R8SH 2YWYA 1QSFD 4I13B 3BEVB 2J6EL 4K9EC 2N7BA 5E9DE 2VTFA 3TFKC 2FIKA 3CK0H 2A9ML 1NAKL 4MA1B 3EO9H 1V7NH 2XKNB 3O8XB 1XF4B 2NMSA 5HDLA 1H3PH 3KDMB 4D0BA 3P0VL 4TUOB 1HKLL 3T1FB 3TO4D 3K1DA 1EERB 4RA3A 3ARGB 2WSKA 5I75C 5FO9A 4BSWA 3HUJA 2FL5A 5GGVL 2F9BT 4G9FD 1LEIB 3TBVA 3EYFB 3RGVD 1JZ5A 3H0TA 4GKSB 2CIIA 5MEQB 2CD0A 4JPWH 5DQ9A 1EXUA 2NY3B 4NZUL 2XZCL 1KCRH 1ZHKB 2NZIA 4Q9RL 3SGKA 4OZHE 2R2EA 4KWUA 3LQAH 2W38A 3QZWB 2GFBB 1AXSB 2NX5B 4HQQL 4LPCA 5B3JF 3MJ8A 5BZWA 4P2QE 4ZTOL 1WLHA 3GRWA 4HS6B 5F7HA 3AUVA 4JJ5A 2ZOKB 4JKPL 4G80A 3BYYA 5C86A 3H9HB 5BRZD 4I8DA 2VLKB 1IJ9A 1RY7B 1OM3H 4A2LA 1U8HB 4QRRE 2ZUVA 5FGBA 2B1HL 5FHBL 1ZLUH 2A6KA 3HZYB 1ONQB 4GRLD 1FZKB 2MMXA 5EOCL 5E24E 5JHDE 3EOYG 2R1YB 3IETA 4L3AA 5IJVB 1IVLA 1JZ6A 5F72S 2W9LA 3ARQA 3RUGE 5K59E 3MNWB 1P4IH 1XGRA 5MEOB 1MCJA 5J1SC 1YPZE 3T0DA 4FXKA 3FB6B 3QNXB 1YNTA 5ISZE 3NVQA 4JZNB 3V4PL 2J8HA 4H1LG 2OR8A 4G6JH 3HR5B 5C0GA 4JZJC 1E27A 2F53B 2FJFB 3LDBC 3WD5H 5F9WB 2Z91A 4Q2ZB 5KS9B 3OKEB 1F02I 2R2HB 4LSRH 2W9DH 4YH6A 4GW4A 3GGWB 4Y7MA 1OARL 4MQ7B 3D0VB 4Z7QE 1MH5A 2VXSL 2HWZL 3E6FB 3QO0A 5HHOD 4JR9L 2D31A 4XXDB 1UXSA 1AH1A 5C1MB 3OF6A 2NW3B 3L3HB 3UPAA 4DAGL 4ZD3H 1RZIA 5FUZH 3OKMA 1CGTA 4WWID 4FABH 3MRMA 4LSUL 2MQ3A 1WFNA 1N0LA 2VXQH 5ANMA 3SKJL 5CD5C 3S35L 4ZFFB 3SDYH 3I6KA 5DMIH 4WU7A 2DWEB 5K9QI 3MFFB 5TE6H 4ZUTA 3NIFF 5DT1L 4KK8D 3C6LC 4K3JH 3C8KA 4PJAE 4QYOB 3QXDA 3G6DL 4P9HC 3IYLW 5CZKA 2AK4E 3NGBC 3SDXB 3GMOA 3SGJC 1BOGB 3QEQE 3MRRA 4NKQB 4M8QA 1HN1A 3ALWA 2X42A 4JRXE 4NCDA 4OIIL 4PRNB 5JORB 5JPNA 5L8KB 4YGAB 3S88L 3VFNA 1K2DB 1U3YA 4XC3H 3GHEH 3K46A 4ZFZA 1AE6H 3L3OB 1M7DB 1U3HC 5GRZA 2P5EE 3NGBB 5CILL 4J7RA 1A1OB 4LBEA 1RUMH 1CICA 4Y2DA 2X9XA 5DD3L 2ADJA 4MVBC 5F7EL 2NXZD 3C60C 3CU1A 3GMMB 3QUZA 1U3HB 1KN4H 4FZEH 2Y23A 4QXTB 4HLJA 4PRBA 4HBCL 2OMBA 5BVPL 1T0MB 3JTTA 4MAYC 4YHPA 2A1WL 1T7WA 4KRLB 5DEGA 2VITB 5KAQG 3H7LA 3WXVL 1NEUA 3EYSL 3VRIB 2V5RA 5A3ID 5KN5B 3DETD 4LSPL 4PJEB 5TFSH 3L5HA 4M6MH 3LKQA 3X11A 4MAYB 3TT3H 4OSUL 3LSOB 1P9MC 4EN3C 3VD4A 1B0RB 5D2LE 5SX5K 2DRUA 3FQRB 1ZLWK 2NY5L 1KJ2H 3VXPA 4QRTB 2QQKL 1RZKC 4MA8H 1T0NB 2YD9A 1JRHL 1OAYL 1KJVA 4EN3B 3LQZB 3W5MA 2EKSA 2DQTH 5D7IA 2J4WH 4XNXH 1CLZH 3N0PB 5A16A 4XCEB 1CL7L 4OZGA 4UIMA 4JHZA 4MJIB 4F15C 1CGVA 1U42A 4PJIA 3VD9A 4OAWA 3WS3B 4ODVL 2VUOA 3TM6A 5DYOB 3C5ZA 3WFEH 5SWZE 2R56L 3P4MA 2G60H 4LLUA 3EYUL 1LD9A 4WV1A 3BN9C 1FL6A 4XNUL 1R5IA 4MMZC 3T0VA 5CD3B 5DHYB 5IVXA 1MRFH 1AGDB 5JR1L 1PW3A 5ITBL 3MRGA 1CD1A 1HQRB 3PGCB 1JYNA 3FQUA 1W72L 2CMRH 4NJ9L 1IILE 1HH6B 1PY4A 3F7RA 1KENH 1KBGH 3DXAA 4UI2A 4KMQA 3QQ4B 2CK2A 1YN6B 4XMPL 4PRIA 5FYJL 3IFPB 1JYXA 4WO4A 4PFEA 1XGYL 3O3BA 1IGJA 2CLZA 1QSFA 4M5ZL 2A77L 4M7JH 1MFCL 4QWWD 1QG3A 1PQZB 4L8BA 1M7IA 2WWMD 5CP7A 2AP2A 4QY8A 1B6UA 5BS0E 2WV3A 1G9NL 3HC0A 4I3SL 4JAMA 3BIBX 15C8H 1QRND 3VGDA 3VXUB 4R7NA 3L7EA 1KNOA 1A9BB 3QIBD 4J6RH 2OZ4A 4BUGA 3OZ9H 2NXYB 1RJLB 1I7RB 4XNYH 3MBEC 4IOFD 4G9FA 4XPTH 1UT9A 4M6NL 4YIQB 4PJCF 3RGVA 4GW5B 5T1DL 3NAAL 3S96B 3GKZA 1QQDB 1Z9OA 2H8PB 3F7PC 3EKCA 1BQLH 3BKYL 3MBEB 3CFKB 2AI0L 5IJKA 5GRWA 1FPTL 1CR9H 3CFBB 3H9SB 1PKQE 2CUMA 3MLVH 3B9DA 1ORSB 5DD0L 3EDFA 1T5WA 2ADGB 3QCUL 1VESA 3T0ED 1QPXA 1UM4L 4P23D 1F45A 4LLDA 3GHBL 3QPXH 1N59B 3QR2A 2Q86A 4TYUA 5BRZA 3ME0A 1AFVH 3WHXA 2COQA 5EC2B 4PGZA 5GJSL 2AKRA 4R26H 4HULB 5IG7B 5BV7H 1FIGH 4KJYB 3G04B 4JHBA 1FBIH 32C2B 1CN4A 1U8NA 5CJOH 5AZEL 3VDAA 1F2XK 4GRLA 2H3NB 5J9PA 5HHQB 4L4JA 2F15A 2J12B 2BY3A 2QLVB 3ZYIA 4U1NB 3QFJE 4PGBA 3BJ91 1G7PB 4HWBL 1MCRA 1EO8L 4NO0D 3NBNA 4U1LA 4HIJB 4PJBA 1FL5A 3EW3B 1NGZB 2OM5A 2F19H 4RDQF 2JB5L 4DFIA 1T3FA 4UDTA 2Q3ZA 1XF2A 2BSED 3F8UB 3HUJE 3JWDL 3U7AA 2XWJB 4P5KA 3THML 2EICA 4TUJB 4CMHC 4DGYL 5HHOA 1AQKL 4PJ7A 4KI5C 3O0RH 4WHTB 3S37X 3ZKXB 3DPBA 3Q6GH 2KZ1B 3MRFB 4DEPC 3RZWA 1F3RB 3U4BH 2HJFA 4G6KL 2H26B 3DHJA 5CEZE 5BXFA 3GSRB 2X41A 5DMGD 4BQCA 4O9HL 4WNQA 1JP5A 4DK3A 3RWGB 3PP4H 4DVRH 2BY1A 1FV1A 4PRHB 4DEPB 3VU2A 1ZSDA 4JKWA 2WZPD 4NQDB 4Y1AA 3AVEA 4P99A 1LNUB 1GGCH 1H15A 1KTRL 1KGCD 5BMFL 4CL7A 3MFGB 4J2XA 1PYWA 2FHFA 3B5HA 5ENWA 3O8XD 1OP3H 1XIWA 3ZSSA 1VKXB 1HHJA 2ZKHH 4DW2L 1JHKL 3WO4B 2Z8SA 4X98B 1KUMA 4Z7UB 1T7YA 4O2CB 2OR7A 3ARGD 1C5DB 4HFWB 1N64H 2G9HB 4X7TB 4Y5YB 4XPFH 4DZBA 1TETL 1BVKA 3JV6A 1ZA3B 3OGOE 3WNPA 1WTGT 5GGTL 4NDMB 2NY3D 4Z95L 1DN2A 5C0NC 3NCJH 3UTPE 4Z7NF 4PB0L 1EUTA 1I7TB 1WICA 1C08B 3X17A 1MNUL 5C0FA 5I1DB 1XMWA 1TIUA 2NLJB 5GGVY 4P5TC 3VXQA 2VXVH 2ZPKH 4B53A 2NX5D 1GHFH 3C6SB 3UC0H 5EZIH 2OR9L 3U48A 3FKUS 3OPZH 4YNYB 3RA7H 4RNRB 4NT6A 2EXYD 1QFUH 2QKIA 1INQA 4FFYL 4ZSOB 5BW7A 5FUOL 1QVOB 4W4OC 4EOWL 3U36A 1FGNL 3W0WA 4CN4A 3QJHA 2VLKD 3P11H 4ZXBB 2BVTA 2DLHA 4UTAH 1A4JA 1LO2H 2VDPL 4OM0H 4P9ML 1DEEB 1QBML 3QEHA 1TNNA 5DUMH 2V7NA 1UCBH 3KWWA 5EO1B 3ECBB 4DKDC 3O9WC 4Q9CA 3JV5A 4GBXC 5ANME 3I6GA 5F88B 4FQIH 4I2XA 2E6QA 4U31A 4MB3A 2HMID 4MA7H 3L5XL 2CDEB 1C1EL 3RX8A 3O6KL 4KZEH 3PDGA 3TYFB 5E0QA 2I25N 5EU7C 3MUHL 3TJEH 4WTXA 4U1HB 1I9RH 1DQJB 3BXNA 4WENB 1HZHH 1PY9A 1V7MH 4RFOH 4OLWH 3QH3A 1FZJB 4NPYA 1T6VN 5D2NC 5H94A 2YD5A 2F53D 3BJLA 3HRZB 3OB0H 4N5ED 4F7TA 3TVMC 1FP5A 3IU4H 1YEGH 2X4TA 1WEJL 1J86A 2XACC 3IDGB 5J6GB 1ES0B 1V5JA 1TVDA 4KUCD 3D87B 2MCPH 2EDHA 2GSGA 5D2NB 4HKZB 3N1MC 2DLFH 4F57H 1GGBL 4KVNH 3RNQB 3I02A 3TVMB 3OJMB 4P4RA 1PVHA 4L4VB 3TWCH 2YR3A 3GMPA 2BXYA 4PTUA 3H7BA 3MOBH 4X80H 2OQJB 1EHAA 1SYSA 1PZ5B 2IF7A 3QWRD 3EDKA 5SX5H 2YS4A 1P2CA 1ZLWH 3ZKMC 4IIQC 3RL1B 3PIQB 3WBDA 2XPGA 4OZ4B 5HY9A 3KG5A 4AY0A 3JV4B 3MRPB 1RMFL 5E1AA 2YPKB 5DJDA 5ESQB 5DJYA 4ZDHA 5CD5D 3CGTA 4XP6H 1QRNA 3TN0B 2IG2L 4M4RA 5F7FA 4CVZA 1N8ZA 4LCIL 4IIQB 4PS4L 1I1YA 3ISWA 1AKJB 2X1OA 3QIBA 3J8F7 3KS0H 1FG9C 3TNNA 2DF3A 4MCZB 3X3GL 1A7OL 1MSPA 1X7QB 5L6YH 4NC2B 3JWNC 2EH7L 3W81A 5IQ9B 3NCEB 2AQ2A 2NY4B 4FRWA 2HRPL 2ZSWA 3GBML 3D48R 1NBYB 5D7IE 2YPLB 1NCWH 3D9AL 5EZLA 2X89A 4OZGE 1K6QL 4RGNB 3SKUD 1I9IH 4LU5H 1AQDA 3MA7B 5ICZB 4M43L 3KLSA 4PJIE 1WF5A 4NBXB 1TITA 5KVMC 1U3HD 3IU3A 1ADQH 2ZZUT 1U8OA 3IRZA 4OCLC 4KMTH 4RFEB 3NACH 2WUBL 5GZOC 1ZA6A 4P23A 1S7RA 2OK0L 2W92A 4ONOA 2J8UF 2YOCA 1HSBB 4YBHA 1KCUH 2IPUG 1UKTA 5IVXE 1QLRB 3WNMA 3R8QA 5SWQA 4MAYD 4P3DA 1G6RL 4C4KO 3ILPA 6FABH 5C09D 4FNLL 4ZO8A 1U95A 2OJZL 4WV1C 1QACA 2GJZB 2GSIB 5IKCB 3O2VL 1I9JH 3DXAE 7FABH 4AYFA 5KVEH 3U9UA 3CLFL 4PRIE 4UAOC 2XTLA 4EN3D 4PR5B 1VB9A 1E28A 4X5LA 3VH8A 1QSFE 1OW0A 3MUGB 2HJLA 1UADC 4HG4K 3BEWB 2ZUXA 5KVGH 4JY4A 3K4AA 4NO0A 2DDQL 4MJID 4LCCB 3FO0L 1XGTB 4UAOB 4DOHB 3QHFL 1Y18B 5HGDA 3MGTB 3VFVA 3TT1L 1T7VA 4KHTH 3DI3B 5LAXB 3SKOB 3ZZ1A 1N3NB 3RVVD 5F7WC 1OLZA 4R6UA 4YHOH 4Z7VB 5DRXA 3MYJB 5TE4H 4G9FE 1L7IL 2R1XA 2X1PA 1I7ZA 1QHOA 4EUPB 5HYSA 4HCRL 4HV8A 5MI0B 4FMKA 4LNRB 5F3BA 2KZWA 3QULA 1OD7A 5C70A 3WS6A 5GHWH 4MA3B 3GI8H 4I77H 2W60A 4NOBA 1Y6MR 3G9VA 4O00A 2DQUL 1JV5A 1YMHA 4FQJH 4YHZH 1GZPB 3BN9D 5HXMA 5FM8A 1FNHA 2GAZA 1A6UH 1W2KT 3MLWH 3HZMA 1RK1A 2X4SB 1GOFA 4YXHL 3UAJD 5D5MB 4M1GH 3BEVA 3WMSA 1X5GA 4KK5C 1F90L 3SE8L 1EBAA 1SJEB 5BRZE 1H3GA 1A6WH 3WO3B 2XKNA 4N68A 3O8XA 1XF4A 2VQUA 5D71L 2XRAL 1LILA 5KSAC 1QYGL 3VXUD 5DFTA 3HR6A 5KW9H 3D5OF 4XP4H 3KDMA 5HPMA 3GSQA 4TUOA 3T1FA 3ARGA 4HFUL 4P4KC 5C92A 2NXYD 2EDOA 4OZHF 1T7XA 1P7QB 2A9NH 3ZDYE 1BEYL 3HI6L 5FAAA 2Y25A 5F70A 2BVEA 3EYFA 4OCNC 5FGSA 1KEGL 1Y0LB 4GKSA 5MEQA 3CVIL 5HHPB 3CJJA 5E8EB 1QR1A 3I75B 3DURB 4CJ0A 1ZHKA 2XI9A 3DVIA 4PJBE 4XTRD 3S97C 3H9SD 3QO1A 5E8OA 3D3VD 1XZ0B 4RMTA 2GFBA 2NX5A 3DVGA 5KANI 5DRWB 3V52L 4HS6A 3O6FB 3V9FA 2ZOKA 4Q74A 2ENSA 3GSNA 1I85C 4ELKB 2PUQT 4NKIH 5HHOE 4HGWA 4PJ7E 1EVUA 1U8HA 3B2VL 4LRNH 2UVFA 3RUGF 5HHXL 5K59F 2LU4A 2PXYA 1ONQA 1YPZF 1XEDA 4GW1B 3SGDH 2YUZA 2KPNA 1FZKA 1AXTH 4CN6A 2BY2A 4UINH 1HXYB 3FRUB 3UJTH 3ZKSD 1O7SA 4LVHC 4HEPG 1BIIB 2R1YA 5IJVA 3VRJB 3GMNB 1BZ7B 3BN3B 4Y1AE 4DN3H 5MEOA 1DBAH 4Q7DA 1NUFA 3FB6A 3UMTA 3NA4A 3JVGC 3QNXA 4Z7QF 1S7VB 2QQLH 4JZNA 5BZDA 3HR5A 5GSRB 1MCDA 5I8EB 3FOLB 2F53A 2FJFA 5ID0B 1YEKL 4RZCB 4MNGB 1U8PB 2R2HA 3OKEA 2VZ3A 5D1QD 3VWKC 3GGWA 3ES6B 2YBRB 4OLVH 4P2CG 1UYWH 3P30H 2BNQA 3CXHJ 3E6FA 1Q9OB 4F58H 2NW3A 3L3HA 3MRKB 3NN8A 4KRPC 4PRPB 3MLTB 4E42B 2AJSH 1R3KA 4O51B 1QKZL 4PJHA 3VH8G 1EDQA 4PJAF 4BZYA 4QHMB 5DQJA 1H8OA 1RUQH 2ZUWA 5T3ZL 3CAFA 1ACYH 4PRHD 3GKWL 4KRPB 3MOQA 1S3KH 1EA9C 2F58H 1SVZA 1OB1B 4NQDD 1WK0A 4XHJC 1RHHB 1FE8H 3IDMB 1F8TH 4FFZH 3W0WE 4QYOA 3HNSH 5L9DL 1LP9A 3BZEB 3CZFA 4JB9H 4GO6B 1JJUA 2XN9B 4JM2C 2EE9A 4MJ6B 4HC1L 5I2IB 3D18B 3RVTC 1P4LA 4BQ8A 4LCUB 3FT3B 1FYHB 5BW7C 5HYSG 2AJUL 1WQVT 4PRNA 3S37H 5JORA 1K2DA 1PLGL 3NFNA 3BRFA 3L3OA 1M7DA 1YYML 2IH1B 5CIPB 4I2XE 2APXA 5GRVK 5MP6H 1BF8A 2E7LA 1A1OA 2PYFB 3G5XB 2EDDA 4F8TA 3MXWL 4D9RD 4ZO6A 4QRUA 1X3DA 3Q48A 1TTUA 5IW1B 3GMMA 3FRPG 1T0MA 3K0WA 5D2LF 4ESKA 4QOKB 2VDKL 2VITA 1RZ7L 2CK0L 1VSCA 4DK6A 4LRIC 4XWGH 5D9SA 3VRIA 4CW1B 5KN5A 5JXAH 3VFGH 3IDJA 3BGMB 3D39B 3LSOA 3GK8L 3U46B 1B0RA 1WBYB 1MJ8H 5C09A 4RGOL 4ZXBD 3MLYH 4HXBH 4JO1H 1K4CB 1UC6A 4QRTA 5I1CL 4HWZB 1S5IH 1LO5B 4OI9A 1JHTA 1FNSH 1Q9KA 3FB7A 4H1LH 3LQZA 2GTZB 4ORZC 4TVSa 5IMKB 5FDYA 2BMKA 4GOSA 4NOFA 1GPOL 1TZIB 5CCKL 4D9LH 1XR9B 1J05A 4UB0L 5DVKA 4EDXB 2QQNL 1NC4B 1UACH 5JW5B 5AUMB 3EFFB 2AJZA 5GRJL 1ZLSH 1QRNE 3WS3A 2GKIA 2D7TH 4W6YB 3MREB 4U0RC 1DBBH 5DYOA 4ONGH 4RSVA 3LKPB 4KJQC 5CUSH 1H3TA 1MLBA 1NLDL 2D3VA 5IV2B 4PJ5B 1QA9B 1IKNC 3P77B 4NN5B 1MIEL 4NQVB 5CD3A 4I4WB 4DGVL 4U0QB 1TCRB 2OL3B 2R4RH 3TPKA 4WFED 1HQRA 4N8PA 2IADA 3AM8C 1Z0NA 1IM9B 4XCFH 1RZJC 2QSCH 1HH6A 2PN5A 3TVMD 4K71C 4L4VD 4K2UH 4UIKL 3QQ4A 3QEGL 2NY7L 2OJEB 5I8KL 3BIKA 4OLUL 4DTGL 4XVSH 5I1EH 3MV9B 43CAB 4K23H 3SBWA 2EE6A 1H0DB 1PQZA 1YEIL 4H0HB 3AS2A 4PYHA 3H8NA 1SBSL 1W0VB 2JE8A 3PWJB 2PNDA 4JREC 4X4XB 3AREB 4G6FB 3VXUA 4LSDA 3HG1A 3TN0D 2C7UB 1DQDL 1A9BA 3Q6FB 2P8PB 4FQ1L 1AKJD 2FJGA 4XNZC 1RJLA 1I7RA 2QHRH 4DZ8B 3QUYC 1KIPA 3HMWH 5DZNA 1CGWA 1RUKH 2NY4D 1G6RB 1UQSB 2YPLD 5I19H 4YHMH 4K94H 5LVEA 4AH2B 2AJXL 4OV6F 4XNZB 3FO2B 5I30H 5DWUL 4G8IB 4RGND 3DUSB 3EJZC 3CFKA 4WWKB 2GHWB 4DVBB 4OLYL 1DL7H 4LMQE 1A3LH 3D3VA 1ORSA 4NBYB 1FYTA 4RAVA 2ADGA 4FQCL 5L8LB 3LKOA 2PR4H 2FEDC 2LV4A 1TTGA 4XCCH 4HH9A 1G1CA 1ETZB 2Q20A 3WKMH 2JJTC 3PDOB 2HRLA 4TSCH 5FKAB 4XAWH 5EC2A 4WCYL 4RMUA 1QEWB 3G5ZB 3VXTA 5IG7A 1T83C 4KJYA 4OBRA 3AB0C 3OJDA 5CEZH 4FP8H 4NHCL 32C2A 2H3NA 2NY2C 4XP9H 1NMCC 1L9MA 3MLSH 5D1ZC 4AT6B 5HHQA 5KAQF 2I9TB 1BAFL 3ZKNC 4ERSH 1G7HA 4PJ8D 4U1NA 4JPKH 3CDYA 3CVHL 4TNWK 3AB0B 3GRWH 4D2NA 2G5RA 1JPST 2HFEB 3HUJF 3BT2L 1G7PA 2HT3C 5ACMA 2R4SH 4OZFB 2Q8BL 3WE6B 2AXJA 2WUCL 2FD6H 4HIJA 4JFPB 3B9KB 1TTFA 1NGZA 3DJ9A 4LIQL 3MCKB 3WHE0 4FQPA 3H3KA 5EUOB 2BERA 5FYJD 2YZ8A 2HFTA 2BSRB 5IWLA 1J12A 3T08A 3MGOB 5I1HL 2XWJA 2ZUQB 5D1QA 2ZNXA 4UU9B 4TUKH 2QSVA 4WHTA 3SE4A 3MRFA 4MYWB 4PTTA 5F89B 2DBJA 3IKKA 3GSRA 1J87A 2H2PD 5FM5O 3RWGA 3FL7A 1YMMB 2B4CL 2FJHB 4JO2H 4MJ5A 1D5BB 2NX5E 4XNMB 2BX5A 4PRHA 3V6OA 1LO3H 4NQDA 2XWBA 2J88H 5GIRB 1LNUA 4JN1H 5E8DL 3U7YH 2QQQA 3LQMA 3IFOB 1BQHG 1MY7A 4KVCH 4G7VL 3FN0L 3RY6A 2X2YA 4KK5D 4X98A 4Z7UA 4JFXB 4APQB 4LSTH 1C5DA 4HFWA 3RU8L 2G9HA 4X7TA 4Y5YA 4NM4H 1P7QD 3FN3A 3WNNA 5DTFA 4PB9H 2Z35B 5DDHA 2PXYC 4BSVB 4ETQB 3ZYJA 3V0AC 2AW2A 4QTIL 2BOBB 1AO7B 4NDMA 2R0ZH 4AQ1B 4LDLB 3UYRL 1I7TA 5F3HB 4IRJC 5I1DA 1DUYB 4S11A 5EA0H 4JLRB 1E4KA 1JGLL 1AI1H 3C6SA 4OGAC 5F1SA 1INDL 2CKBL 4RGMC 4YNYA 4RNRA 1JCKA 3O6FD 3BKCL 1QVOA 1SJHB 1AP2B 2BNQE 2Q7YB 4JFZL 4Z0BH 3HPLA 5FB8B 2OXHA 4N1CA 3UTQB 4ZXBA 1IGFH 1ZGLP 3MRHB 4PJHE 1RUAH 2IQ9L 1UB5B 2AEQL 4P2OB 2LVEA 5EO1A 3ECBA 4JO3H 2Q6WA 5F88A 4OFPA 4D9QD 3HB3C 1C16B 5C0AB 1J0YA 1HHIB 1KOAA 2XFXA 2CDEA 5IMOA 1JZ3A 3TYFA 1ZANH 3NTCL 3GSXA 4E41B 1LP9E 4LVOC 1M1SA 1MFBL 3H42H 5J4MA 2IMMA 1FZJA 1N5AB 5MEPB 5SV3A 4EXPX 3SE3C 1MUJB 2CGRH 1DANT 3C08H 4O02H 2O5ZH 4LVOB 3IDGA 3DV4B 5J6GA 1ES0A 4KKBC 2Z31B 4Y88A 1W0WB 4LQ1A 1T21B 2I24N 3EDDA 3NCFB 3RVWD 1OVZA 4HKZA 3EIFA 4JFEB 3LHPL 3RNQA 5DSCB 3PXHA 4PRPD 4MGXA 5J57B 3PQYB 4L4VA 4HUXA 4H26B 5LGJB 5IT2H 1KEML 1D7FA 4L9DA 4XVTH 2OQJA 4XZUB 1PG7L 1PZ5A 1JNLH 4U4BA 5D93C 4E5XB 4PG2C 3F58H 4ONHB 4TQEL 3LD8C 4B0MM 4KRPD 3PIQA 3KYOB 1Q9WA 3FQNB 4JQVA 2XQBH 3JZ7A 3JV4A 3MRPA 2YPKA 5ESQA 3OR6B 3VGAC 4NWTL 5D7IF 4OCRL 5C0IA 2B20A 3WN5C 2D7NA 3TN0A 5C09E 2XN9D 1H8NA 4OZGF 5AG8A 4ZS7L 1JF6A 1AKJA 4WI6A 4XHJD 4MCZA 3MACL 4EBQH 4PJIF 2OTPA 2VWEC 2JJWA 4PLKC 5IQ9A 3VGAB 1N4XL 2F5AH 4LLMB 2BDNL 3W9EB 2YPLA 2NTSP 3KPSA 1VPOH 3P4NB 3B83A 5C07A 2SEBB 3KYKL 3LS5L 3RVTD 1UWGH 1VGKB 3BX7C 3MA7A 2FLRT 3ZSTA 1J88A 1OWWA 5IVXF 3AGVA 3BSZL 5IFAL 3N1QC 1NLBH 4RFEA 2OZ4H 4ELMB 1FLTX 1J1PH 4JFYB 3S4SG 4QOKD 1CGSH 4NUGL 5DQDH 4G7YL 3FB5A 3ZTJG 3RJDA 4X6FA 4KPHH 4N0YL 5HDQH 3TJHC 1RJZB 3BDYL 3V0WL 4X5WB 3HS0B 1R5VB 2R15A 1JGEB 3K7UA 3D39D 4G3YL 2J5LB 3S3PA 2HN7A 1T89A 1WIOA 1ZGLM 4KK9D 3E8UH 1RIHL 3QUML 1E4WL 2GJZA 1KN2L 5TPWL 5F97E 3SGEI 4JG0H 1JGUL 3V6ZB 4PJ8A 3PABA 5KG9B 4XC1L 4PR5A 5E4EC 3MUGA 3QUXC 4AM0A 1W72A 3IAGC 3BEWA 3EOBA 4O2EB 4YQXH 5IB4B 1MQKH 1KFAL 2Z0BA 3DSFH 3DV6A 3M8OH 2LFGA 5INDB 4LCCA 1EJOH 1XGTA 2FX7L 1NC4D 1Y18A 3MCLH 2VXUH 3MGTA 5E4EB 1U8KB 3HG1E 3VXUE 4X6DA 2XY1A 2EECA 3SKOA 5JA9A 3DRTA 1J0KA 4Z7VA 4KKAD 4PJ5D 5LGHH 4OLZH 3VXMB 5DHVB 3MNVB 2E3VA 5ACZB 1Q0XL 4LNRA 1X4YA 4TOYH 5CJXC 3WLBA 3OMZA 4MA3A 1IM9D 4HUMB 1GAFL 3NPSC 1X6NA 5M7QA 3HTLX 3N1GC 1ED3B 2R2CA 1NPUA 1GZPA 3SDCB 1KYOK 4HT1H 4X8XA 3D3VE 4PLJC 1FYTE 5MERB 4OD3H 3EO1B 2QSQA 3DMMB 2HP4A 5E99H 5D5MA 1NMBH 3MV9D 4UT7H 2NY0C 3CSPA 4EI5C 4DGIL 1SJEA 2DKUA 3IS0X 3ZDYF 4WI3A 3WJJC 2CJUH 4L29A 3D25B 2ADFH 3P9MB 3ARED 2BVPA 2XYCA 4G6FD 3ZE1E 1CK0L 1QBAA 4M9OA 3GSVB 4EI5B 1YJDH 5HHMB 1U8QB 4IJ3B 4PJBF 1D5IH 1P7QA 1CT8A 4XMKH 2P24B 3T4YA 5L88H 2DS4A 1T22A 5ALCH 3CXDL 5HHPA 3VG9B 1CD9B 3I75A 4WWKD 2AJYL 4OFKA 2JB6B 2MPAL 4JFHD 4PJ7F 4OZIB 1BX2B 4TN9A 1PEWA 1XZ0A 3CVHB 3G5YA 4HWEL 1A47A 1VFAB 4TNWF 5DRWA 4GAGL 4LAJH 3O6FA 4HWBA 2PCPB 4F3FB 3FQTB 2DIBA 2EIDA 1MJUL 4BZ2L 1YYLL 1JTTA 3VWJC 1SEQH 1A0QL 4LOUD 2A74B 4ZMAT 3ROOA 1KLGA 4GW1A 2FBJL 4FQXB 4NC1E 1BZ9B 4FFWC 3KJ4B 4ZQKB 4ZAKC 3FRUA 5L7XH 1WIPA 4PRHE 3EJJX 3MRJB 3V6OE 4HAFA 5HI5D 3VRJA 1SMAA 3GMNA 1BZ7A 4NQDE 5T5NG 3RHWK 3JWOC 4CVXB 1DVFB 3KYMB 2XT1B 2IBGA 1S7VA 4OBSA 4ONFL 1T20A 3B9KD 5I73C 1X5XA 5CKGA 3NZ8B 5ERWA 4I48B 4PGDA 5I8EA 3FOLA 4Z7UE 5B8CA 2ED7A 2EDWA 5JLZA 4RZCA 4S1RL 5C2BL 3CFCH 2YBRA 4WI9A 1IAKA 1OP5K 5JHLL 5ID1B 3DX6A 1UKQA 1Q9OA 3MRNB 1AY1H 4D9RE 1U58B 1JPSH 4K3EH 3MRKA 4JRYB 1T2QL 4PRPA 4O51A 5AZ2H 1D9KC 4PUBL 1D5XB 2CPCA 2K3TA 5D96C 4OCXH 1YMMD 1MWAL 1S7XB 1WFUA 4LHUB 4A6YA 2GIYA 3BPCA 1ZLVK 5GGTA 1OB1A 1RULL 5KSUA 1CG9A 2I9LB 3IDMA 1ZS8B 1GC1C 3BZEA 5A43C 4GMTH 4JRWA 2XN9A 4LGPB 3U0PA 3GSWB 3D18A 1OPGH 2Z92A 1YEHL 2N1KA 4XBGB 3FT3A 1CTNA 3PNWB 5TH2B 4APQD 2R0LL 2CKBB 1DDHB 3O2DL 3VW3H 3C8HA 3SE9L 1IGIH 4POZD 1IGCL 2CR3A 5CIPA 4LLVB 1PKOA 2ZCKL 4TULH 4K3HA 2DM7A 2G75B 2APTA 2PYFA 3G5XA 1WZ1H 5D7JB 1AO7D 2C3HA 4R3SB 1KT2B 1IAOB 2BXZA 2R2BB 5IW1A 5TQ2H 4DUVA 2BVOB 3KS0J 3ARFD 5DMKA 3VGFA 4AIOA 3DOSA 4M4PA 4GXVL 3C2SA 4XRCB 4QOKA 1INEL 1IKFH 1CLYH 1S7WB 3IDNA 5D1XB 4YFLF 43C9A 5FYLL 4CW1A 4M7LL 1EAJA 4TSAL 1FJ1B 1U6AH 4H0GA 4U1IB 5FV1L 2D7OA 5DUPH 4OUUB 1SM3H 2GCYA 3D39A 3U46A 1WBYA 1ZXQA 4J4PD 1DP0A 1IBGH 3UX9B 4L5FH 1OD9A 4YDKH 4L4VE 1NSNH 1PX3A 3ZT5A 1K4CA 5F7YC 4HWZA 5E08H 1IAIL 1NCDH 4P2OD 2GITB 1LO5A 3MJ9A 1F97A 2QEJA 5IMKA 1P1ZB 1WFTA 5C0AD 5JW4M 2IPTH 4X4MA 4N8CH 3N50A 4I0PB 2DQIH 1XR9A 1A6VL 3BPOB 1QTYT 4EDXA 4CUCA 4CU8A 3GIZH 1HIMH 4E41D 3EJYD 4GG6B 5AUMA 3EFFA 3QAZC 3MREA 3E2HC 4MXQC 2XTJE 4HJGB 4I3RL 3U30B 5T3ZD 1S9KC 3FONB 3O3UN 5F96H 3F7VB 3QHZH 5I76B 5BO1L 3UP1A 4F8QA 5IV2A 4LAQL 4PJ5A 1F4YH 4JQXC 1QA9A 2HT2C 3P77A 1J1XH 4KUZL 2XTJC 2Z31D 4M5YL 2YPLE 4I4WA 3KPSE 5C07E 3CH1A 1OGAB 3RY5A 2IGFL 1A5FH 5AYUL 4RGNE 2MFNA 1IM9A 4JFED 4OQTL 2F54A 3WFBH 2DBLL 5BVJB 3PQYD 2A83B 4LSSL 2ESVB 1TVBB 2OJEA 3DGCR 2RFXB 1A7RH 3ZLQC 2ITDB 25C8L 4DN4H 1CE1H 1VFMA 3MV9A 4MNHA 43CAA 1MI5D 2KL6A 4IEFB 1H0DA 4PJ9C 1MPAL 4NP4L 1JWUB 5F9DC 4EVNA 3P0YH 4M3KB 1W0VA 4PD4J 3PWJA 4AIZB 1BFOB 4X4XA 3AREA 4LLQA 2C7UA 4XVUD 3D0LB 4WUKL 1LK3H 3TZVC 4H88L 2MHAB 4OJFH 2Y4SA 4HKBB 4EDWL 3FCTA 1BMGA 5K9OB 3KJ6L 5I71C 4BA8A 5IFHH 4HSQA 1T6WA 3G6JB 1G6RA 1UQSA 3E3QC 3VFMB 2VKWA 2I60L 1J8KA 5HI3C 4G8IA 2ARJQ 3DUSA 3QUMB 5T33H 2WBJC 4WWKA 4DVBA 3BRDA 2FDBP 3U9PH 4K55A 3G5VB 4X6DE 5FYJE 2XNAB 1OL0A 1DBKH 1T66D 4PJDB 5IEHA 3NCMA 1EHNA 1ETZA 1IC4L 3FMGL 4Z7VE 3MMEB 1BFVH 5HGGS 5E2WL 3PDOA 5FKAA 4L8SC 2EEAA 2AXFB 4R2GC 3SJVB 1J11A 5M95B 1J1OL 3RVXD 2XQYG 1QEWA 2O93L 3G5ZA 5E70A 4K8RC 5GS0L 1BQUA 5EZOL 4U1GB 4F37F 4AT6A 2I9TA 1KB5L 3CFIC 1Q72H 2EYRB 1T7ZA 1JUFB 4HCRA 2UWEB 2WQRA 1V3JA 1MCIA 2XA8H 2BVQB 3KGRA 5D5ME 3BHBB 3S35X 1OTUD 3GSNH 1F4HA 1RD6A 2HFEA 4DQOL 4OZFA 5JDJA 3LEVH 4RQQB 1Y6NR 4AEIH 3QEUA 1GL4B 5GZNC 4YHNB 4JFPA 3B9KA 2DJUA 1G7JB 5EUOA 1T2JA 4GG8B 2BSRA 5CZXD 5JPMB 1ZTXH 3BESR 4FFVC 2EEDA 3MGOA 3AAZA 4RA0C 3DUUB 1N7MH 3ARUA 8CGTA 4UU9A 3VXMD 2QADB 4POYA 4K07A 3OKLA 2CO6B 5E6IC 3O2WL 5B4MD 3QUKB 3RWFB 3WNOA 1R0AL 4K7FB 5F89A 1FORL 4O58H 4JPIB 4AENA 4QCIA 4LLAA 3SDCD 1F4AA 1N6QH 4H25B 1L6ZA 1BD2B 1YMMA 5E6IB 2FZ3A 5LWYH 5CLWA 4NWUH 5I66B 4XNMA 3SDDC 2VDOH 3DMMD 5SX4H 1A7NH 3DLQR 4JPWL 5DFWH 4OV5B 1LMKA 5GIRA 3MRCB 5CFHA 5F7LB 5GRUL 5LQBH 4J3SA 3SDDB 5AYQA 4TNVK 3VFWB 3R0MA 4NJAH 5D70H 2DQEH 2BOCA 4APQA 1BLNA 1OCWH 4EI5D 5JQHC 5HHMD 3UYPA 4WEBL 2YA2A 3SCMB 2JIXB 4L9LC 4NN7C 4D9QE 2P5WB 1B6DA 1X5LA 4WFFE 4KY1L 2MKLC 2Z35A 4HIEA 1OM3L 4ETQA 3F12B 1ZVHA 2BOBA 1AO7A 5DO2C 1WBZB 4Z5RB 4BM7A 4L9LB 4KUCF 4YUEL 4YHLL 5F3HA 3RI5F 2AEPL 3ARFA 1OP5H 2E6JA 3LMJL 4KDTA 3TIEB 1LO4L 1DUYA 2ZJSH 4JLRA 2X40A 1DN0A 1ITCA 4DKEL 2Y5EA 1O7VA 4PJHF 4JVUA 5IROC 1P4IL 4Y8DC 5IMMA 5DHXB 4Q97A 1XH3B 3RHWF 1XFPA 1SJHA 1AP2A 2Q7YA 4KZDH 3I3BA 3N85L 2UZIH 2Z4QB 4KJWC 3MR9B 4OUOA 1FFNB 5B8CC 4J4PA 4LEOA 1G7LB 4NQXB 1ND0A 1G9MC 2EH8L 4HWNA 4RMRA 4XPHL 3UTQA 2MOVA 5E56A 4TTDD 3OAUL 1ZLVH 1MHPH 5HVHC 5D7LB 2XA3A 1A1NA 4L1HA 4PRPE 5HYJB 3MRHA 1F4XL 1AC6A 1I3RA 1I8LA 4FQXD 1LP9F 1UB5A 4LSRL 4P2OA 4Y4KB 1L0XA 3MODH 3SDXF 1UENA 1UJ3A 2VDQH 2WWKO 3PDDA 3V4UL 3BZ4B 1AGEA 2PW1A 4ODTH 1C16A 1HHIA 5J12C 1MRCH 1ZEAH 3QIUC 1CGUA 2I27N 1DVFD 4HUUA 4G8GB 2BJMH 1MFEH 1MWAB 2XN9E 4G5ZH 4JQIH 4M6OL 5DD1H 5J12B 3QCTH 4R7DB 5E2VH 1WIUA 5MEPA 2RAMA 5IBTH 3SDYL 4ORGB 2FECI 2OP4H 4YHKH 2NR6D 3PG2A 1OTTC 5IOPB 4X6EB 5I8CB 5D7KE 1W0WA 2Q8AL 1F5WA 1I1FB 4KGJA 4R90L 5T1KB 3B2UC 3RZCC 4HC1A 2A38A 3GDBA 1L0YA 4JFEA 5DSCA 1PX4A 4JRYD 3AS3A 3PWVA 3PQYA 5LGJA 1HNFA 1FSKC 2AGJH 4NFCA 3SO5A 2JLLA 4XZUA 3TBWB 4LHUD 2Z8WC 4QOKE 3RZCB 3FN9A 3EYVB 1KTKE 3EBAA 1MCEA 5EBWB 1MI5A 1RAMA 1Q9LB 4TVPL 1RURL 3FQNA 3LCYA 1YECH 4MHHG 1A6TB 3KLAB 4Y2OA 2AV1B 3D39E 3IRPX 1FO0L 1GOGA 2VSCA 3DBXB 4ZTPH 3IXAB 2HKHH 1EUUA 4ALAH 1ZT1B 3LKRB 5I9QB 3LN4A 1UZ8A 2IAMD 4MX7B 4OFIA 5HVGB 2XZZA 3NCYS 4OCWH 4LLMA 4PBVC 3WL9A 3W9EA 1VEOA 1CD0A 1MVUA 2DIJA 2SEBA 4X4ME 2QSTA 2X7LA 5IW6A 5D7JD 3DSNA 2GEEA 3P3YA 1ZKAA 1J0JA 1C8PA 3KYNB 1U36A 4CADB 1IQWH 3C09C 1NUGA 3T0BA 5C0RH 2R29H 1ZMYA 3GBNH 2DQGH 3HNTH 4XMLH 2YPVH 4UBDD 4XNXL 3T2NL 2GJJA 5D1XD 2RR3A 2FWOA 4PJ5E 4QRQA 5DRZB 1I1AC 3C09B 3B43A 2ZCHH 4X5WA 1R5VA 5LBSL 3WEXB 4K3DL 1PSKL 1JGEA 4R8WH 1NJ9B 5DI8A 2F54E 2VN7A 2DD8H 4RISL 3BQUB 4OF5A 2YMXH 1WCQA 4I1NB 1AHWB 3V6ZA 3RWCB 3PWPB 3I2CL 5KG9A 3QSKB 1MFDH 4GRWE 5I1KL 1YEJH 2V7HB 3MV9E 4WEMB 4NZRH 4FQ2H 4KKLC 3CSYB 4I0PD 4M1CD 3I6LD 4O2EA 4QHUB 5B3NA 4XB7A 1A6AB 3VG0H 5IB4A 3LRSA 5IHZB 1TZGL 2HFGH 1YY9D 4Y5XB 1U8KA 4OD1H 3IDXH 2EZ0C 5EU3B 4WHDA 2Y1VA 1E0OB 4G8EB 1DE4B 4LARH 2C3VB 5IF0B 4LQFL 3PL6B 3O4LB 2NCMA 3UZEA 2H32B 4AEHL 5DHVA 3MNVA 3N1FC 5ACZA 4FS0A 1KC5H 1LE9B 1OGAD 5HGBB 2FGZA 4YWGL 1PDKA 3O3AB 5IQ7L 4GAJH 1QOKA 3OZ9L 4LASL 3SDCA 1ED3A 3SN6N 1DQMH 2HT2D 3ULVC 1RUPL 1ZT4B 2ESVD 3K2UL 1UM6H 4WW1B 4DJMA 4XPTL 1B0WA 2HJKB 2RB8A 5MERA 1U8MB 3ZE1F 3EO1A 5F9JA 1ZVSA 3DMMA 1XGUB 2A9MH 1NAKH 4LHJB 4AQOA 1JF5A 3OG4B 1BQLL 1CXEA 5ICYA 5CGYD 2Y07L 1EK3A 2WLYA 1M6OB 3D25A 3NIDE 3P0VH 2CH8A 3P9MA 3MX0A 4X4YA 1AGFB 1SYVB 5IM7A 3RL2B 5GGVH 3O11A 3GSVA 3RPKA 5K93A 2D03L 4FXGB 1U8QA 4N90D 1N5YL 2CRYA 2ID5A 2WANA 4R4ND 5L2JB 3L3GA 2P24A 4HJ0D 1FCGA 2D7PA 4NZUH 4HDIA 4R26L 4LP5A 3UDWA 5HDBE 5BV7L 4HGKC 1FIGL 1QFOA 4U6TA 2GT9A 4Q9RH 4MQSB 1FBIL 4MCYB 3O4OC 2FR4A 3ZKQD 5DGQA 3ZTJH 1H3XA 1B90A 1KB5B 4WTWA 4HQQH 4OZIA 5FHAL 3W11C 5EUOE 5F1IB 4ZTOH 1T0PB 1VFAA 1EBPA 3VD5A 4JKPH 4GJTB 2MNUA 3O4OB 3OKNB 2AEWA 4XCYB 1RIUL 1CI5A 3OXSA 1EV2E 2DMBA 3ESVF 1XGQB 3TA3B 3SJVD 3PE9A 2B1HH 5FHBH 3MLUL 2BK8A 3STZB 4L3CB 5EOCH 1XT5A 4FQXA 4QXGL 1BZ9A 1H8SA 2QTEA 4ZQKA 1YMME 4IDLA 4PY8I 1QSVA 5DA4A 3MRJA 2Q76B 4Z7UF 3ZYOA 5EO9A 5I74C 5CSBA 4CVXA 5D6DC 5IFJA 3DGGB 2YD3A 5F7MC 1VFUA 2R39A 3B5TA 4GS7C 5JNYA 3BPLC 3PP4L 3MRBA 3CX5J 3NZ8A 3BP4A 1MRDH 2AJVL 3LQAC 4U1MB 5I74B 1OARH 4WGVB 4GAYB 4RAHA 2VXSH 2HWZH 1MCQA 4P5MA 4JR9H 4QTHB 1NAML 2QADD 4YR6A 4DAGH 4UT6L 3F7YB 4TNVF 1AO7E 3QG7L 2ZOLB 3ARTA 4LSUH 2FEEI 4NRYB 5BQ7B 3SKJH 3S35H 3MOAL 3AMLA 4XPFL 5D4QA 1ZE3C 2YD6A 1BD2D 1S7XA 5IBLC 5E6ID 4P57B 3FFCA 4BK5A 5DT1H 4YC2C 4ODHL 4V2CB 4C57C 1BF2A 4LPTA 2I9LA 3G6AB 1ZS8A 5GJTL 3QXWA 2FH8A 1T80A 4V1DB 1FNAA 1NGYB 3T4AB 3EDEA 4OIIH 3S88H 5EN2A 4R4BB 4XBGA 5TH2A 3V6FB 2CKBA 2IAMA 3LIZL 4OIBA 3SCMD 2JIXD 2XKUA 2BY0A 5CILH 2P5WD 5DURB 1CF8L 5GS1C 3TP4A 4P46A 2G75A 1ZHLA 2JJUA 2R1WA 3CU7A 5LJYH 5A40E 5D7JA 5E2WH 1DQLH 4Q6IC 4R3SA 2DJSA 4HBCH 3EGSB 1IAOA 5BVPH 1L9NA 2R2BA 1QLEL 2BVOA 2A1WH 4OFVA 5JDSB 5T3ZE 3WXVH 4XRCA 2VL4A 3EYSH 5L8JB 2VRAA 5F8RC 5D1XA 4LSPH 3RKDC 4OSUH 1FJ1A 3S98A 3V4VL 1GGIL 4OUUA 1I9RL 2ITCB 1HZHL 2NY5H 1NGXB 1CDGA 4JFEE 2QQKH 1HI6B 5HD8D 3I85A 5D7LD 1ZT7B 3HI1B 1RZGA 5HYJD 5K9JH 3PQYE 1JRHH 1LO0L 4Y4KD 2GITA 5C9JB 3EOAB 3PV6B 1YEGL 4NRZB 1U8JA 4EIZC 5DGRA 1CL7H 1P1ZA 2KKQA 2FH6A 4FQLL 4IMKC 2DYPB 1MI5E 4I0PA 5E5UB 2XXCB 4ODVH 4KKCC 5I6XC 1S9VB 4G8GD 4GG6A 5SWSB 1VHPA 4HIHB 4HJGA 2R56H 3SKNA 2HFFB 2FX9L 4LPYA 2EE3A 3FONA 1DR9A 2E5EA 3F7VA 1IGYB 3EYUH 5KTEL 1NDGB 3T3PE 5CWSB 4LKXA 4OGYL 5I76A 1MFAL 4YFLI 5JR1H 4QLRA 5T5NF 5A2JH 4CVUA 1NL0L 4LSVL 1OAKL 1W72H 1AJ7L 4I18B 3HE6A 1JWSB 1FO0B 4NJ9H 3W9DB 1DCLA 1JHLL 1OGAA 5T1KD 1DUZA 3OWEA 2FRGP 3R1GH 5JIHA 1I1RA 3FT4B 1RU9L 3W82A 2ESVA 5FYJH 1J7VR 4ODUB 5FEBA 3RWIA 2HLFD 5HHNA 2YA0A 2Y06L 1TVBA 4M5ZH 2A77H 1KJMB 4M48L 1MFCH 3B2UD 2ITDA 5DK0B 1NCWL 2H9GB 2PKDA 4GQPH 3CZJA 1YY8B 5DS8A 2B7DT 4JY6B 1G9NH 5F7NC 1JWUA 5T1LB 5DD6B 1TMCB 4WY7L 3X12B 4PY8J 4AIZA 1NGQL 4WUUB 3RWHA 4KMTL 3D0LA 1IC5L 1QSEA 3AC0A 5ELIA 1MF2H 3GJEA 2MHAA 4M6NH 5FYLD 1QFWM 3T2PA 2D9QB 1E4XL 3NAAH 5T1DH 3RDTB 5K9OA 1KCUL 4X6DF 3G6JA 5B39B 2P49B 3BKYH 3VFMA 2AI0H 2VE6B 1F3JB 1SBBA 1FPTH 4NQCB 4Z7VF 3SDAC 1GJIA 4HHAB 2MCG1 4K9EL 3QUMA 1EIBA 5DD0H 2RHEA 4RFNC 3FJTA 2G2RB 3QCUH 5IESH 1UM4H 4URTB 4HPOL 2XNAA 4QXUH 2FO4B 4PJDA 3GHBH 4WFGD 1NUDA 4L3EB 4Y16C 3MMEA 1T04B 5GJSH 5KVGL 3EFDH 3SJVA 5DFVC 1KJ3L 5DVMA 1F4WL 2YD2A 5D5MF 5AZEH 4Y4FB 2YC1B 5GGRB 4ODWA 4U2ZA 1LEGB 4XT1C 2GK0B 1A14L 3BQUD 2YEZB 3ARDC 2EYRA 3TO2A 1OT1A 1OAXH 3PWPD 4KAQL 4GKNA 2VAJA 2VLMD 2CRMA 4HWBH 3BHBA 5SV4A 1EO8H 4Y4HC 3IFLL 3T77B 2JB5H 4FQJL 1G7JA 5A1AA 3U0WL 3G9AB 1BFTA 3JWDH 4U3XA 4QGTA 5L2KB 3KPTA 5JPMA 5CEXB 1HSAA 3THMH 4DGYH 5CJQL 3PL6D 5ABDE 3O4LD 2P1YA 1AQKH 1OAUL 1CFQA 1IQDB 4JCLA 3L3IA 4GMSL 4JFOB 3BWUC 4AL8L 1DBJL 3RGHA 4ZUWB 2D4DA 2NYYC 4XXCA 1KTLB 3QUKA 3RWFA 5EORL 2VKXA 4DWHA 4UDUB 5BV7C 4JPIA 3RAJL 5GGRY 3M1BB 4IRSC 2GQHA 4H25A 3C5JA 4OZIE 1P69B 2A9NL 2PW2B 3UTSB 5J13C 2VUYA 5KOVC 1ZHBA 1T5XB 1LHZA 2XV6B 2GK2A 1AGCB 5CBAA 5BV7B 4GRMB 5BMFH 1UXWA 3OKDB 4OV5A 3MO1B 3ULVD 1B88A 5EZJB 5IVZB 4LDOB 1K3IA 4D0DA 1R6VA 4LIQE 4DW2H 1JHKH 3B6SB 2W0FA 3VFWA 1CU4L 4E0RB 4FTVB 1TETH 4A6YH 3SCMA 2JIXA 2UY6A 2EXWC 2P5WA 4W70A 2FSEB 5GGTH 4UTBL 4Z95H 1CDHA 1CQKA 5H37G 4Z5RA 2WW8A 4TSBL 1MNUH 5GS0D 4F9LA 4L4TD 5GS2D 4PY7B 4MLSA 4P9HL 1U8IB 2B5IB 4Z78B 3TIEA 2OR9H 1R24A 1REIA 1VADB 4FFYH 4WDIB 3RTQC 3BPNC 5FUOH 3OQ3B 4EOWH 3UJJL 1FGNH 4MWFB 5CIPH 3FZUD 1XH3A 2BFVH 3HAEA 1DBAL 1DQQB 3TA3D 4UQ2B 1QBBA 2ZUYA 2VDPH 2VQTA 2Z4QA 3MR9A 1FFNA 4NQXA 1QBMH 4J3TA 3IJYB 3RTQB 5D7LA 1CWVA 1FNGB 2LQRA 5HYJA 4X7CC 3L3DB 1UEYA 1JWMB 1YUHB 4Y4KA 3AY4C 1NAMB 3L5XH 4R0LC 1C1EH 3FFCE 3O6KH 5GQBA 2JKXA 4R97B 3RBSA 2DWDB 1IC7L 2EIBA 3F5WA 1YZZA 4ISVB 5CHNB 5SX4I 2HTLC 4R0LB 3LVEA 1MWAA 1KF9B 1FGVL 1RZ8B 1CE6B 4R7DA 3STBA 5M94B 4ORGA