1LK3H

Engineered human interleukin-10 monomer complexed to 9d7 fab fragment
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
219
structure length
219
Chain Sequence
QVNLLQSGAALVKPGASVKLSCKASGYTFTDFYIHWVKQSHGKSLEWIGYINPNSGYTNYNEKFKNKATLTVDKSTSTGYMELSRLTSEDSANYSCTRGVPGNNWFPYWGQGTLVTVSSAETTAPSVYPLAPGTALKSNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSGLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Noncompetitive antibody neutralization of IL-10 revealed by protein engineering and x-ray crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Interleukin-10
total genus 44
structure length 219
sequence length 219
chains with identical sequence I
ec nomenclature
pdb deposition date 2002-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lk3H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lk3H02
4HUWB 3REWA 1VB9A 5IROC 4P2RB 1LHZA 1FAIH 1P2CA 1KIUA 4PRID 1K5NB 1J5OL 2JJTC 4LCWE 1AGDB 2ARWA 3ZZ1A 4NRZB 2JLLA 5DQ9A 1IEBB 1CZ8L 1CD9B 3FO1A 2JJWA 3MOAH 3F7YB 4S2SB 3ULVE 2UYLB 4L5FL 3VWJB 2FSEA 3OGCA 4TNWK 3O2VL 1HHGA 4NKMB 1TTUA 1NDMA 3QQNA 2Z31B 2NQCA 4ZFZA 4MA1C 2W1NA 4HS6A 5DD1H 3K8LA 4G7VL 1VCAA 2E5EA 5GGUA 3OAYH 4WEBL 5E4EB 2IBBA 1JIBA 4M1DH 4K3EL 3MYJA 1OTUD 1XGRA 4IDJH 3GMLA 1IMHC 4G6AD 4J8RA 4JPKL 2PO6D 4LARL 1SEBB 1T1YB 2OTWA 5F3BB 2EO9A 3JTTB 3UJJL 3RU8H 1PY4A 4MHHG 3PHQA 4ZQKB 3DX6B 4Y8AA 4WUUE 3NGBB 4QRSA 5I6XB 3RTQA 2GHWB 3O6ML 4ESKA 4P46C 4D9RE 3HE6D 2NYYD 1R5VB 3KYKL 5I8OL 3QEHB 4X7DC 1W2KT 3WLBA 1RZGA 3ARBD 4XVSH 4U6XB 2GTZB 4H88L 4XCEA 3EYVB 2WBJC 4MA8L 4FZ8H 5JR1H 4AIZB 5C2BL 1CG9A 1FO0A 2LU4A 2AK1H 3WS6A 1EDQA 5DMIH 2HWZH 2IBGA 3MRFA 3IFNL 1B0RB 3IU3B 4G6KH 2ZOLA 5CEZD 3EW3B 1NBYA 2W65A 1T20B 4Y89A 3ULVF 5CHNA 1S9XB 4FQLH 3ESUF 1PX4A 5E8EB 4Y4HD 4MA3B 1ZWIB 4OB5H 3IJYA 1HXYA 2YC1A 5FYJU 4FTVB 3D9AL 1S5HA 1QYGH 1IQWL 4RGOH 4OZGA 4ZOBA 1ZLWK 2A9NL 4DN4L 5BXFB 4JO2H 3H7BB 5FHBL 4R90L 5D7SL 1KFAH 1JPGA 4OZFA 3UJIL 1QSFB 2C3WA 2A6IB 3ARFC 1CFNA 4KKAC 1GGUA 4LFHD 2CDGB 2WZPD 1KEGL 1OGAE 3V5DB 1CDGA 1UM6H 5DSCA 5L2KE 1J0IA 3O0RL 2F74B 2ICEA 1ZTXL 3LVEA 1RZFL 2OK0H 5DHYB 3DUSB 1DANT 2C3GA 2UVFA 4JFYA 4K8RL 3NH7L 1ZVYA 1PQZB 3VG0L 5IR1B 4HT1H 4EDXB 5AZ2H 1YEEH 1ZSDA 3UYPA 5I15H 3IXAB 3RA7H 3MYJB 2AK4A 3NIGF 4NQEE 4PRIA 4Q6IA 4X6DB 1S9VB 2YMXL 3O2WH 4FABL 2Q86A 4ODUB 3O4LE 1NC2D 2ZUYA 3MRMA 1F58L 4HK3J 4HGMA 4LLQA 3Q1SH 4PJ5A 4U1LB 3AS0A 5ECJE 5JHDD 3GSQA 2AQ1A 1C5DA 1NFDA 3FN0L 4YHMH 3IB4A 4QRPE 3UTSA 1KC5H 5CKGA 2G75B 5D7IE 3DV6B 3LKOA 3JWOL 2ERJB 3T4AA 4PBWD 3X12A 1D5MB 4JM2B 3BKCL 4KXZI 3FMGH 3MV9A 5F9JB 1BF8A 1KULA 1U8OB 2X70A 3DTXB 1AGDA 1X5KA 3QH3A 3ZKQD 1XGTB 2HKFL 5SV3A 3RAJH 3U9UB 4E0RB 4P2RA 3L3KA 4RIRB 3OB0K 3E3QC 3BW9A 5FECA 1NMCB 3OKKA 2EKJA 1HH9A 4JO4H 4QHLB 3OKLB 4IJ3C 4R97B 1J1PL 2VR9A 4C56D 3RI5K 5LJYH 1RFDH 3MNVA 3FFCE 1J9CT 3VH8B 2BNUB 2DDQL 2DYPD 2Z93A 2FGWH 3DSFL 4KKLC 5EC2A 3S8WA 2FZ3B 5F7KC 2NY1D 2DQHH 1ZA3A 4U7SA 1TJIH 1MCRA 3DVNB 1EX0A 4DJMA 5AD0A 4JANA 1G9NL 3WEXA 2FGWL 4BK5A 1ZLVH 5KVDH 4QXTB 1U8MB 4JZJB 4M7ZC 2IG2L 5JW5B 5JLZB 1MWAB 5EN2B 1CICA 1JNNL 4ORZC 1HILB 1KJ2H 1IKFH 2IH3A 2X9YA 3TYGL 3MGTA 3QCVH 1DJSA 4JPIA 3MV11 1AGEB 3LS5L 3MRPA 3L3HA 3SDDC 5KOVC 4XVTH 3OB0H 3QCUL 5J6HA 1INQB 1PFCA 4LLDA 1J1XH 4HBCH 2BXZA 2OZ4L 5LQBL 3FO2A 4M6MH 2QQQA 3UTTE 1MIMH 3HR5A 1I9JL 3QFDA 1ZHKB 2DD8L 3H9SE 2X89D 3WLWD 3CZFA 5FKPB 3UTTB 5LWYH 3D39B 1KOAA 1XIWD 3GRWH 4FXGB 5GHWH 5DJYA 1JCKA 5JIPA 2FBJL 3P30H 3RDTD 1E6JL 1FZJA 3NCEB 4WV1A 2QKIA 1KG0A 2QQNL 2JTDA 2EO1A 1LO5A 1NC4A 2J1KA 4S11A 2D03L 1II4E 4PJ8B 5D1ZA 3MRNB 4UV4H 3ZT5A 1T7ZA 3FOMB 4I8DA 2NW3B 4XH2B 4ZNEA 5BCAA 1LEKA 3MUJA 5JDJA 1Q94B 3SE4C 1OCWL 2E6JA 4K94H 1MJUH 3ZKMD 3S3PA 1MWAH 2LAGB 1BAFH 1LDPL 4QHMA 4OCWL 1W72L 5E2JA 2OK0L 1D5ZB 4L3CA 3IKCB 1Q9WA 3L7EA 1ODAA 1EZVX 2I5YL 5E99H 4XPAH 4M48H 4NO5A 4RAUB 5ALBH 4XC3L 5CLTA 5C09E 1A9EA 3I75B 4EQ2A 3MUY1 4YH6A 3QWRD 5DJZB 3EOTH 2LFGA 4U7KA 5I1IH 1WC7B 2W0FB 3FB6A 3FB8B 4CU8A 4XBPA 4OFYA 2FJHB 3K2UL 3ALXA 1NCNA 4JAMB 5CZKA 2I25N 4YXLL 4ETQA 3RWIA 1T03L 3VFUB 3MR9B 3PQYB 1F4YL 3P73A 4PJAB 4BFEA 4MWFB 4LSPL 3MRGB 3GK8H 3HKFA 3C6LA 3WIHH 4GRLC 3CSGA 4X7SL 2FDBP 4RWYH 4Z8FL 4O4YH 5EOQL 1BQHG 2DQJL 3X13B 4WEMB 1LP9A 1JGVH 3EYSL 3IRPX 2EDXA 1IGCL 5KTEH 1GSMA 3SDAD 1XZ0A 3GSUB 5LBSH 3OKLA 5JHLL 4ZS6C 1SYVB 3IFLH 3MODL 3GMQA 4X5WA 3P3YA 4MA8H 5DXWA 5HHME 4NQUA 3BUYB 4NBYB 2N56A 3DGGB 3ZDYE 1Z0NA 5D70H 1QRNA 1CCZA 1XFPA 3V52H 5IB2B 1IT9L 1U8OA 2X70B 1N6QH 2R1YB 1DSFL 1RZKC 1UM4L 5DJ8B 4HG4K 5TDOB 3FN0H 4M61A 3TCXA 1KPUB 4KHXH 4YHML 3D69B 1FSKC 4JZNB 5EBGA 5GGSA 1WT5C 4IRSB 1SYVA 1BWWA 1D6EA 5DR5L 1JUFB 5B4MC 4K3EH 4L3EE 2YSSB 1P7HL 2ESVE 3CNKA 1XGQA 4OFPA 3MRGA 3I2CL 4DTGL 1ERNA 2FL5A 5K33A 6FABH 2A6JB 4PJ9D 1KB5B 5SWQB 3OZ9L 1NL0L 2X44D 4P3WA 1EEUA 4X9FA 5B38A 1UYWL 1PQZA 4YHNA 5FYLH 4R8WL 5ANMA 4Y4KD 1NCCL 4EN3B 5BS0B 4YR6B 3MGAA 1OAYH 2J88L 3MNZA 4UU9A 2EYRA 4P59H 5HHVL 4NFBA 5DMIL 4YFEA 3U0TB 1C08B 1P4BH 2IBZY 1CXEA 2AI0H 4MJ5A 2BC4A 4KV5F 1WQVT 2CQVA 3UJIH 5BS0E 2DQFA 5IEHA 5H35A 1YNLH 4LVNB 2YK1H 3PDOB 1MJJA 3WL9A 4FQ2L 3O8XD 3VFGL 2E6PA 1YN6A 4JRYD 1ZLSH 4CVUA 1YEHL 1CFQA 2X6MA 1JV5A 3TT1H 1G7JA 3EJZC 3H3KA 1UWEL 4P9HH 3ZSSA 5E94B 1MJ8L 1UFUA 3WBDA 4PGBA 1EV2E 3MYZA 2DTMH 3BGMA 1Q0YL 3WFBH 1ZVHA 4RBPH 4OM1L 2P4AB 1AE6H 3VWJC 5F72S 4WW2A 3MFFA 1B0RA 1BQLL 8FABA 2ITDB 2Z92A 1OGTA 1FGNH 2ZJSL 4P2CG 2Z31C 1FO0B 2YOCA 6CGTA 5F6HI 2P1YA 3HR5B 4ALAL 4Y4FA 1BQSA 1QLFB 1WIPA 4R4FL 1K4CB 5I66A 4QNPE 5EPMB 5DRXB 5I8CA 1QLRB 4ZTOH 4WWKD 1KB5L 5E2UH 4Y4HA 2XTJE 2DQTH 2X4NA 2XACC 2X4SA 4R0LA 5HDQL 3S6CA 3PWNB 1OAYL 2VWEC 4UIMA 4XWGH 3FB5A 4LAQH 1U3HD 5EBWA 1RV6X 1TCMA 3BKJL 4L8CA 5EU6E 2XQYG 3NCYP 3GJFB 3NIFE 1HILA 5FCSH 1J0KA 1KIQA 1MAKA 3FQNA 2AQ3A 2I24N 1W0WA 1J87A 1A6VH 1FRGH 2P5EA 1LVEA 4P46B 5ID0B 2MSPA 2XKSA 3WFCH 5C0BD 3B3IA 3PWPE 4OLYL 3PQYE 2M2DA 3EO9L 3C6LB 4AG4H 1PVHA 4P99A 1B0WA 5AZEH 2H26B 3FN9A 1MCIA 2WBJB 4GAGH 1BPVA 2DAVA 5GGRB 4HGWA 2YR3A 3CLFH 1JRHH 4GXUN 2BNUA 3UTSD 1KJMA 1DEDA 5D6DA 3RY6A 4AIOA 1RURH 3LIZL 3KPRD 3SCMA 3P9MA 1SVZA 1PG7W 4P3DB 5IHZA 3L6FB 2NZ9C 3NTCH 3OAUL 4JG1L 4JRXD 4LP5A 4S2SA 1L0YA 2PO6A 5CD5D 3MJ8B 4PV8A 2VDLL 5F7EL 1GC1C 1NLBH 2X1QA 1I85C 5GS3A 3HLAA 5D1XA 4JKLA 2BVPB 1DVFD 12E8H 2GEEA 1YYLH 4N0UB 4RGNB 1FVCA 1NCTA 4LMQI 5GZNC 3L6FA 3G6DH 1A8JH 1JGEA 1OARL 5M7QA 3QHZH 4H8WC 1G7MA 1IGTA 3V4VH 2K7PA 3J7HA 1CE1H 4GRWB 3RNKB 2AV7B 4HC1H 2NLJB 2H32H 3HZVB 5T5FL 2NXZD 2XN9B 3ARFB 4XP4L 4PB9L 1DANU 1NAMB 4CN1A 1IM3A 4RMQA 3QXUA 1PZ5A 5GS2D 5MHSD 2YD9A 2LVCA 2VSCA 3SDYH 3RX7A 4PJ8A 1AQKL 4GKNA 2DQIH 5FOBA 1RK1A 3QJFA 2WANA 1KG0B 2VJXA 4ONOA 3TT3H 3JV6A 4MNQE 1YA5A 3TA3B 1DLFH 1KYOJ 4G9DB 1EAJA 35C8L 2J6EH 1JK8A 1ROWA 1JWUA 3L5WA 4YDIL 3BQUD 2R9HC 3D25B 3HG1D 2X40A 3VXRA 4EOWH 4M03A 5I76A 3EFDL 3P0VH 4JDTL 4WU5B 2MCPL 5IESH 3LQZA 5IIEA 3F7VB 5T33L 1DN2A 4X9IA 5EU4A 1NC4D 3WXVH 1NBZB 3TJEH 4QLRA 4C59B 3A6BL 4N1EA 4UDTB 1F8TL 3RWGB 4HKBB 5DT1L 4MSWA 1H3PH 2BVTA 4BSVA 3D0LA 2ERJC 1M6OA 4GUPB 4XX1E 4YUEH 4LL9A 1DLHB 1NBVH 4RISH 2BHYA 5J7CC 2X89A 1FVDB 1AJ7H 4HUMB 4I77H 3PV7A 3AXLB 1VGKB 3NZHH 2BVOA 5EUKA 2ATPA 4POZD 1FNSL 4WRLA 3JWDC 5IG7B 4YUEL 2DL9A 4KKCD 5E1AB 2OZ4A 5F1IB 2IALB 3GM8A 4R97C 4GO6B 2B4CL 4F33A 4KAQL 1CL7L 3FQRA 4KUZH 1AR1D 3TBSA 4NO2B 3T8XB 3ARSA 1I9JH 3DECA 3DXAB 3SJVE 4M62H 2QLVB 1XGYL 4HPOH 5FM5M 5DEFA 3V4VL 3S4SA 3OAYK 1R5VA 1PYWB 2A2QT 2L7UA 2CLVB 4P23B 4M7ZB 5D5MA 2E7HA 5HYQA 5CIPH 2KDGA 3T2NL 5IJVB 2ICWA 4LHJB 4PLKC 2HJKB 5CJOH 4KDTA 4LSPH 4MDIA 3BI9X 1IGFL 1EVUA 1YPZF 2LE9A 3U7YH 3HZKA 1P5UA 4FXLA 4PJ5B 4U1LA 5CZVL 2AV1A 4PRHD 1F4AA 5JQ6H 4JGUA 4KMLB 5IM7B 4ODWA 5HGHA 1W72A 2H1PH 4X4YB 4KV5E 4MGXA 4ZOCA 1ED3A 1AGFB 1HH6A 2MQCA 4WI7A 4XZUB 5DK3A 4LU5L 1EHLL 4IBLT 2AV1B 5E00B 5GRVL 1T4KB 2FHFA 3DNKA 5L2KA 1ZV5A 1N5AB 2F5AL 1NDMB 4Z77B 3K80A 1KCKA 4I77L 5J12C 1U8QB 1AQDB 4PJGB 3FT3B 4X8XA 3VW3H 2P8MA 1KLUB 4F37F 4YX2H 4U1NB 1JWMA 4PJFA 1DQJB 2IADB 4PJ8C 4HIJB 1P84K 3A6BH 4HFWA 2DM7A 4XHJD 2F74A 4JM4H 5IVNA 2GTWB 4KVCH 1TZHA 4QWWC 1JZ5A 4LSUL 4GW1A 1MCHA 2RQ8A 2XG4A 3V5DA 1NCAL 5T3XD 1SJHB 3DVFA 3IFLL 2EZ0D 3WS3B 4UV4L 1IARB 4PPTA 4E41B 5K9OB 1PW3A 4N0CC 1SYSA 2AGJL 4JDTH 3WKMH 3VE0A 1F3RB 3IAQA 3K3QA 1XGUB 2V9TA 1N5YH 1FNFA 4K7FB 2XI9A 5H2BA 1I9IL 5LWYL 3BUTA 3F6IA 3H0TA 4ZPTB 4XBGB 1U8HA 3QIUA 2R2BA 4TNWF 3V0VB 1UEMA 4YXLH 3TCLB 5KSAA 1HN1A 5ITFA 3KPPA 1HKFA 3TBVA 4TSCL 1HHIB 3M45A 4XHQA 3KPOA 4ETQB 5C0JB 4Z0BL 3KLSA 1QQDA 3TNNB 1M6OB 4GUPA 3SCMC 3TPKA 4D8PB 4U33A 3WFHB 5C08A 1HWHB 1LNUA 3RY6C 1JN6B 1BREA 1RIUH 3EGSB 1S8DB 1K2DB 1MHEA 4GKOA 5HDQH 4JFDE 4XC3H 3R4DA 4ZFGH 3QDAA 2CDFA 4LIQH 4MAYC 3L3IB 3R06B 3NOIA 1N7ML 5EFIB 1B2WH 4OZIF 1BVLB 2E3VA 1T83A 4NM8L 4P5TD 5CKAA 5F93C 32C2A 4TUJB 4Q97A 5A16A 4JO3L 1TNMA 1TVBA 2PCPB 2Y6SD 3LHPH 1QA9B 1KTRL 3G5ZA 3RZWA 1LK2B 3LN4B 3QWOB 1NCDL 1Q94A 1NAML 1A7PL 1KJ2B 4AL8L 3B5GA 3QJFB 4BFIB 3MV7A 4W6XB 3N1QC 4G8GA 1WLHA 3RKDD 4L4JA 3IDXH 3RNQB 4ZUWB 4Y5VB 5F89A 1ZVSA 5FYKU 1UXWB 1KXQE 1YN7A 4KKNA 2I27N 4IRSC 2CLRB 4JY6A 4LCUA 1FNGA 1BX2A 3G5VB 3B9DA 4KU1A 3UTTA 1G7MB 3MRHA 2VKXA 2AEQL 3FFDA 3NA9L 2UYLA 4L9DA 3QPQD 5B8CA 1A1NA 5FUOH 3MZTA 4G80B 5I75B 4L5FH 2AXHA 4DCQA 2MFNA 5BW7C 3V4UL 3WYRA 4WI8A 4QOKA 1QOKA 3HB3C 5EFIA 4XPHL 3U46B 4X0KB 5T5NG 4K7PY 4UB0L 3CAFA 1OTTD 4ERSL 2WP3O 4PV8B 3MJ8A 1A5FH 4YZFE 3RZCC 5D8JH 43CAB 4XGZA 4FTVE 3BIBX 4L1HA 4G9DA 3BKMH 4YHZH 5BMFL 3TN0A 1D9KD 5EN2A 4LNRA 4NDMA 1A4KB 5D7KE 4XMKH 2A77H 4IDJL 5JXEC 5T1LA 1SEQH 3DO7B 1KT2B 3NH7H 2GCYB 4GXUM 4UILL 2GJ6A 3MLUH 1MRDH 5E7BA 3U7WH 2F8OA 3O4LD 4QXWA 1CDIA 2ATKB 3QXAA 2AS5M 4LVNC 3FB7A 4G7YL 4JGJA 4JM2F 4QEGA 2AV7A 2W9DL 4P2OD 4UOW1 5T1KA 2NW2A 5E9DA 1XGUA 2ESVD 3IU4H 4MQTB 3VE0B 4ENED 2ZP0T 4KJQC 1L9NA 2D9CA 2OR9H 2XIDA 4L4TA 3SE8H 4LKXB 3VRJA 1KCVH 2HFGL 1CN4A 3TWCL 1CFSB 2W38A 1NLDL 1XH3B 5SX5H 1HYRC 4X0KA 2BJML 2WMPA 1OLZA 2J8UB 2HG5A 3I9GH 1K4CA 2HVKA 5I18H 2V5YA 2DMBA 1EEZB 4G5ZH 4OV5B 5ALCL 4NJ9H 5EBMB 2DQCH 4QRUA 1NJ9B 2CIKB 4P5MB 2Q8BL 2NY7L 3PP4L 3WNLA 1U58A 2IAMD 2V2XB 3KLAB 4ODUA 2Q86B 1ZT1B 4D9LH 2VO5A 4HX1A 2AJ3B 4JFPA 3OKEA 3GGWA 1RULL 4DQOL 4JO1L 3T1FB 3N06B 5FDYA 4UT6H 4XT1C 3DUHA 3BIAX 3GB7A 5FO7B 2YPVH 2PW2B 3LPWA 1U8IA 2Z9TA 3V5HA 3HS0B 1KGCE 3I02A 1QSEE 4PGEB 3U30C 4Z7WA 3G6JE 2J5LC 3C8KA 1WF5A 4EDWH 1JFQH 2A9MH 4LLMA 4U6VL 4X99B 2O61B 2ZUSA 5DJ2A 4JFQB 2N7BA 2WLYA 4Y16B 5GHWL 4GOSA 5EPMA 5DEGA 3R06A 3C6LC 3LSOB 5CGYC 1FV1A 1IGMH 4WJ5B 5K9KA 2CDFB 4NHCH 5HI4D 4EI5A 3BAEL 3T8XA 1FO0L 1L7IL 5GJTL 1UWXH 4QXGH 4D9RD 5FO8A 3RPIA 3VXTA 2OZ4H 5LQBH 2R69L 3BJ91 4K3GA 5DD0H 5JPMA 3QUZC 1TQBB 4UI2A 1UH2A 2YC1B 3SQOL 4BZ2L 2BRRH 4OBSA 3HE6B 5ERWA 2QADD 3LQAH 5CZXC 1MIEH 3MLRH 4YDVB 4P9MH 1F90L 2XFXB 4RGNC 1S78C 2CUHA 2DQUH 1Z9OA 4RA0C 2YEZA 4NNXA 2DQTL 4JKPL 1BBDH 2PW1B 4PTTA 4D3CL 3V95A 4PJBB 3LQAC 3QUYD 4IRSA 3K4ZA 1U8JB 3PWUA 1P7QD 3CDCA 2P7TB 1Z9MA 1U2CA 4O58H 4P4RA 4PJDB 3UZVB 3C5SB 5IB3B 1CR9H 3VXOA 2BNQA 3SDXB 4L4VA 3RIAK 5BVJB 3S97C 3GM0A 3ULVD 1F13A 1FGNL 5IGXH 5MI0B 1JWMB 3HAEA 4FTVD 5IT2H 4HIHB 3ULUL 5ICYB 5SX4H 3DIFA 3TA3C 4X5XB 4UUJA 3DX8A 3C5JB 4JR9L 3QWQB 5DFWH 4IMLA 3BYTA 2FATL 2W60B 1MFEL 2FO4A 2IG2H 3KJ6L 2P8LA 1QHPA 5IMKA 1KACB 3RGVA 1BAFL 1T83C 2GFBB 1AIFA 3VMOA 2EDKA 3GI8L 3ORJA 1EMTL 2F54A 4ZO7A 4P2QE 2FH6A 2ZSVA 2C1PB 2OMBA 2VQUA 2AJVL 3UPAA 4NZUH 5C0DA 2CIKA 4UT9H 2JB5L 4YDKH 4KK9C 5B3JE 1RJLA 1HK6A 1U93B 3IDMA 3DARA 2G9HB 1P4BL 2W0LA 5D7LD 5DS8B 1NCAH 4N0UA 3RHWF 4S10A 1K8IB 1S7TA 3PIQA 4HPYH 1FFNA 4BQ8A 4UAOB 4XCNB 3HNSH 4XWOC 1XH3A 3BKCH 3FHAA 4RSVA 5LCVH 25C8H 5FCUH 3T77A 4OJFH 1N2RB 1T0NB 4F9LC 1KN4H 3P9MB 3Q6GH 5TJWK 1QBLH 3H9YA 4J6RH 4YJZL 4JZOA 2EDDA 3K8KA 4MMXC 4KUCF 3STLA 4ZYKA 3FB7B 2VZ1A 4JM2D 1A6AA 4CVWA 2GKIA 1XGPB 2PKDA 4O9HH 3QNYA 1QHOA 1EO5A 5SWZB 4P23C 5JQ6L 1FG2A 3MCG1 3GSVB 3G6AB 2QKIB 1WFUA 4NQED 4LSDA 3CFDA 3OV6A 3GUTB 1P1ZA 5GJSL 4XP5L 3FB5B 3QRGL 5L6YH 3CFJB 1KCUH 4NCC1 3VI3E 5EO1A 1FORH 3IF1A 5LAXB 4HK0A 3TO4A 3MV8A 4ELMB 4NNYA 4EI6B 1GGCL 4WGVB 2BNRB 5JDSB 1CK0H 4XP9L 1GIGL 5MERB 1EHNA 3IAGC 1F4WL 4Z76A 1NUDA 4M7KH 4NKIH 1CK0L 5CWSA 3DMMA 3TFKC 1A6PA 2B7DT 4M93C 3VGFA 4M43H 3OF6A 1MFNA 5J12B 4BZYA 1FGVL 1Y0LB 1ZGLB 2R1XA 2GIYA 4KMTL 2A1WH 5E6IA 3TNMA 3SDCD 3U0PA 3WHXA 4I48A 3DYMA 4XH2A 2NW3A 4AENB 4FNLL 4JFFB 1MCCA 3MRNA 5K93A 1OAXL 4HWEH 3LEXB 1WJ3A 3BN9C 4O5LL 4LSVH 3PHOA 3BEVA 1INDH 1TJHL 4NUJB 1U8KA 1QKZH 4JY4A 1MI5E 3MRRA 1LWRA 1IEAA 3T0ED 4OI9A 1NCWL 3CZFB 3AU1A 1JGEB 1XF5B 1TVHB 5AYUH 1OSPH 1T7XA 5FUZL 4DWHA 2QHRH 3PL6A 3TIDA 3WN5B 3T77B 5IEHB 3QIUD 4HDIB 1GGIL 4NQCB 3X3GH 2WM0A 2A1WL 1F3DH 1AGBB 3OJDB 5DMYA 2NNAA 4E42B 4LQ1A 3T2PA 3DTXA 2GAZB 3QIWB 1PJ9A 2WIIB 1XF4B 4NHUA 4MAUL 3EGSA 1AGEA 4MX7A 3IXTB 4AEIH 3SCMB 3GMMA 1MFAH 3QDJD 5E8PB 3KLHC 2CUIA 4OLZL 3GJFK 3D6GA 3MRDB 3KPQB 2FCBA 4M1DL 1CDYA 2UY6A 5JORA 3SJVD 4MAYB 2J12B 5GISL 5KVEH 5I74C 3VD7A 3D3VA 4UIKH 3V0VA 5AD0B 4OKVA 4TQEL 3ZKNC 4DN4H 3H0TB 4XP5H 5E4IA 5FF6A 2O93L 3DHJA 2P8LB 3HCVA 3TO4D 4LVEA 3H3PH 4Z7VE 1U2HA 1A6VL 1FRGL 1MEXL 4ZFOB 3QO1B 3HPLA 3KR3L 2HMID 4TNVF 2XWJB 3QA3B 4UT7L 4WW2F 5T1MB 2HRPH 2VN4A 1JHLH 1R0AH 4OIIL 1FE8H 2X2YA 1OSZA 2X4NB 5DVMA 3HNTH 2LU3A 3PABB 4K8RD 4Y5VC 1JJUA 1U3YA 4ZTPH 3TYGH 3TF7C 1OSPL 3QDJA 3T4AB 4U1KB 1J8KA 3VGAB 3FT3A 1HYSC 1IGIL 3C5ZC 1OGTB 2EE6A 1EAPB 3KYKH 5EUOE 3MLXH 5FYJL 3QHFL 2BK8A 3FFCD 4P4KA 4HPYL 4UT6L 4PRPB 5I75C 4ORGA 2H2PD 3ARYA 1P4IH 4JDZB 3IDGB 1JL8A 5IK3B 2ZKHH 4P2RE 3KPSE 3B6SA 1V7MH 2UV3A 1WUNT 2AK4B 5EG6C 4JO4L 4X4ME 4MAYA 4PP2A 3MR9A 4YQXH 3SDDA 2YA1A 2F5BL 3P4MA 3RZCB 4HF5L 3BP6B 4JDVB 3RVXD 3IU3A 4Y2DD 3O41A 1P9MC 5DF0A 1UH3A 1NFIA 4QTHB 5L8KB 2OSLA 4JFYB 1JGLL 2DJ4A 5C1MB 2UUDK 4KRPD 1T1ZA 5GJTH 1FYTD 1A9EB 1NSNL 4XBEL 4I13B 3QCTH 1HDMB 2FATH 5DZNA 3AMLA 4Z95H 2YWYA 2R2CA 2WQ8A 5DZLA 2DJSA 2EYSA 4QRTA 3UYRL 4MQXD 1XF5A 5C9JA 3F8UB 1TVDA 3MRRB 3MRQB 5BXFA 4F8QA 3MLRL 4PJEE 2NR6D 3PP3K 4YIQB 4EZMA 3V4PH 1JWSA 2FJGA 4HFUH 5E2VL 1I8IB 3ARGC 5HD8D 2EKSA 3MZGB 5HXMA 3QNZA 3AXLA 4ZODA 2HFFA 5IK3A 3ZKSD 4JFFA 1BBDL 3BP4A 4D3CH 5CHNB 3TJHC 4DGVH 1KELL 1FYTA 1U58B 3JZ7A 4JB9H 4JPWL 2DLFH 1P7QA 5C3LD 1L6XA 5F21B 3QUYA 5DD5L 3O8XB 2GITA 5HGBB 4YNYA 4Y19A 5DUBA 1UJTA 3JWNC 5ANME 4BJLA 1J05A 3QEQD 3CFCH 3TGXA 1HEZA 1QBBA 3NCBB 3QDMD 4X6CF 5FCUL 2C3HA 3BSZL 2HT2D 5GSRA 1W8NA 5K9JH 5IIEB 5E8OB 5F9WB 2IFFH 2D2OA 3L3OB 5DMJB 3X3FH 4HBQA 2MNUA 3EDDA 1DQMH 4M6OH 1AO7D 1K5NA 3L3JB 5J6HB 5IVXE 5EU6D 4YBLC 3VXPA 1KGCD 1EEQA 1LK3H 4IHOA 1I8LA 3U30B 2J5LB 2MPAH 5F71A 1JF6A 5EU6A 3IU4L 5JLZA 4HJ0D 5D2LB 3BKYH 4Y16C 3P4NB 4Z7OE 2A9ML 1VKXA 1FZOB 2OXGA 2CR6A 5IW3A 5EZLA 2A6DA 2WWMC 5C09D 3KJ6H 1L7TH 2VLMD 3QAZC 4D0DA 1JZ6A 2ENYA 1J8HB 3OGOE 3AVEA 2G5BA 3RWFA 3QO0A 3H9HA 3CPLB 3FQWB 4CADA 3T2QA 1A9BA 4MCZB 4NHUB 3FTGB 2ZUUA 3QUZB 1TQBC 3FO1B 2IQ9L 3QIWA 2PYED 4I0PC 4WCYH 5IVOA 3EFFB 3EOTL 3VDAA 1H15A 1UYWH 4XCNA 5GZOD 4P46D 5JOFA 1Z6JT 3HE6C 1I7TA 3RGVD 1A6ZA 3T3ME 2CK0L 3HMXA 3HPJB 3H6JA 4HIIA 3PNWB 3QQ3B 3ZT6A 4OZHB 1WZ1H 2F9BT 2IGFH 3VDBA 1MHHA 4L29B 1DL7H 4ZFOL 2VDOL 4MCZA 5DK0A 5ESQA 4Z7UB 3AU1B 1U6AL 2BFVL 2AI0L 4LSRL 4LSTH 1FPTH 2CLZA 2CRZA 2R2HB 2VL5B 4NP4L 1T80A 3QDME 5FGRA 1MFBH 1ORQA 1FN4B 1JRHI 4TUKL 3MC0A 4L3EB 2H2SC 1KPRB 5DR5H 2QTEA 5HPMB 3WUZA 5IKCA 4L4VD 4RFEA 3RY4A 1HQ4B 5MI0C 3O6LH 4AENA 2QR0B 2YBRB 3W39B 1BBJB 1OP3K 15C8H 3S96A 5DRNA 1LE9A 1KIQB 3BX7C 1YEJH 3G04B 2DBJA 1WFTA 1MCWW 5BJTA 5GS0D 4QGTA 4TUKH 5F6HJ 2ILLA 3NN8A 4ZNCD 2EIBA 3EJJX 2VC2H 1G9MC 1FO0H 3IJHA 4NQXA 3U4EA 2J3SA 5I1IL 1IEHA 1HHHA 1S7XB 5T1KD 4XXDB 5DGRA 2XYCA 3ARFD 2YD3A 2X4TB 3MMEB 1UQSA 2AJSL 3FRUA 1GAFH 4LLDB 4XMLH 2DOCA 5DMKA 4RMSA 5F9OH 2IQ9H 4PGDA 1FYTE 2BOCA 3H7LA 1UZ8A 2M8XA 5FKAA 1Y18B 2D31A 3RL1A 1MY7A 1G7PA 3O8XA 4YHOL 5JA8B 3T08A 1ITCA 1RUQH 4Z5RB 5F7DB 4BQ6A 4XPHH 1H3XA 3JTSB 1JGUL 3T3PF 4DTGH 1QKZL 4N1HB 1T21A 2FHCA 5ESAB 1TJHH 3KPPB 3TBVB 2C7UA 5ITFB 4TSBL 5F9DC 1CGSH 3ARED 1IZKA 3K4DA 4UAOC 1EIBA 5I17B 2X9XA 3NCJL 3S7GA 3SE3A 3TBTB 1I1FA 5JPMB 3MJ7A 1WIUA 5IVXA 5D7IF 3MNVB 3GK8L 3G08B 2F15A 4BSWB 5F3HB 4L4TE 5IUSA 3T2NH 3QEUA 3UP1A 1A14H 4U1MB 4NQEA 5E7FA 5BQ7A 1PKQE 5JHDE 1IGIH 1ACYL 4FQPA 1DFBL 3NPSC 3SKNA 2X09A 4FG6D 3LSOA 1U8PA 4JFDD 4YHIB 3LKQB 1LO2H 4UTBL 3FT2B 3Q0HA 2IADA 4LOUD 1ONQA 1D5MA 4JM2A 4Z7NF 4GAJH 1M7IA 2AJZB 4HIEA 3AMKA 5J4MA 4PJCE 3QUMA 2K7QA 5KVEL 4NSKA 1MH5B 5TFSH 5C6TH 5KVGH 3RWDB 1I3VA 2PETA 3EOAA 4G7YH 5GS0H 4OZFG 1T6WA 2F5AH 3T0WA 3N85L 2D9QB 4M7JH 4OFKA 4XZUA 4P5TA 1AGFA 3OBAA 4OLUH 5T3XL 1S7VB 3GBLA 1WBXA 5C0FB 4XTRC 2ZNWA 3KJ4B 3MV8E 4DZ8A 3D39E 1XEDA 1EFQA 2X1XR 4O2FB 5C07D 3HZYB 4M93B 4UIKL 2IPKA 1D6EB 4UUJB 5F6IB 4TPRL 4MDIB 4KK8D 1WEJL 2A0LD 4U6HB 1B0GA 3BD3A 4MNQA 4Y1AE 2VOTA 3G5XB 2NXYC 5INDA 1YUHA 4TVPL 4UDUA 4HKXA 5DMGD 3NIDE 3ZYZA 1IC1A 1WFOA 4NWTH 2B20A 4JKWA 4MD0B 4PRHB 4PJ5E 2I9LB 2W9LA 4RFOH 2F54D 4OLWL 4X9HA 2X4OB 1NCBH 2AJUH 1WCQA 1MNUL 2VLLA 2CDGA 4M62L 3TN0D 1XGYH 4HPOL 3IFOB 4BK4A 1OAXH 4HWEL 1KNOB 3ZDXE 5GRUL 5KSBA 3C87A 4HHAB 4NYLB 4HBCL 4YXKL 4WI5A 2Q76A 1MREL 5I1GL 3V6ZA 3F58L 5DRWA 4F7TA 3ECBB 1RHFA 4G9FE 1P5VA 1AH1A 4QKXB 1JNLL 3WN5C 5A3ID 1GGTA 3CDYA 3JV4A 2ATKA 3F7PC 3QXAB 2F53D 2I60H 3QCVL 4RZCB 2Y1VA 5EUOF 4PLJC 2D7TH 2LQRA 4FMFA 4L8BB 2IH1A 4XP4H 5CP3A 3HI5L 3QIWC 2K9UA 3KYNB 1R3JB 2F19H 5MEQA 1C8PA 1AJ7L 5I15L 4KJYB 4JHBA 1S9YA 1G7IA 3VXUA 4N5UA 2AJUL 4NQCE 3PP3H 3C60D 3DUUA 1IAOA 4K3JH 5DHXB 1EFXD 2HWZL 3DURA 2O5XL 4E42A 3TM6A 2WLZA 5I74B 2G2RB 1WEJH 1YJDC 3MROB 3FRUB 2R0KH 3KXFD 5FUZH 2QSTA 3L7EB 2O5XH 4U1HB 3LS5H 1D5ZA 2EH8L 2EDYA 1HHJA 4G80A 4H8WL 4OF6A 1I1YA 1GGCH 1Q9KA 2XG5A 2NX5B 4YDJB 5D5MF 1INDL 4OLWH 2KZ1B 3J8F7 4HUKB 5CBAA 1T1WA 2YD2A 3G04A 3R0NA 2YXFA 2R4RL 2FX7H 4OZIE 2BSED 3FOMA 3H3PL 1HQ4A 3OKEB 4M8QA 1CDJA 1PZ5B 1ZHNB 3OSKA 5C6TL 4FZEH 4W6WB 2Z4QA 4GRLD 4U2YA 1HIML 5CJQH 2UUDH 3QZWG 3VXSD 4L8SC 3VGAC 2R1XB 3C5ZB 2YUVA 5FKPA 2R2HA 4J1UB 2VXTH 5D1QD 4XP9H 1ADQH 5KSAD 3D2UB 3PG2A 5D7SH 2R23B 5CCKH 1YNTB 2IMNA 2B2XL 4NRYB 2ARJQ 4OJFL 5KVGL 3EYFA 3W5NA 1AD0B 2BCKB 4ELMA 5BZWA 5GIRB 3HR6A 4NQVA 5DT1H 4EQ3A 2CIIA 1EGJL 1KJ3H 1I8KB 4JQXA 1RUML 4YPJA 3H9ZA 5JZ7D 5HHPA 5HYFA 1NEZG 1ZEAL 4DKEL 2V9QA 3TPUA 3BZ4B 3V6OA 3BP5B 4EIGB 1RD6A 5JUEL 4APQB 1ACYH 2C3VB 4OLXL 5KJRH 4N68A 5H94A 1W0YT 1OAZH 3S35X 4KMQA 3TCLA 5EZLB 2RGSA 2XWTA 2Y9RT 2GCYA 4IOFD 2AW2A 5D5ME 3QPXL 1ULVA 4P2QD 4JGMA 4MNGB 4P46A 4P49A 5ID0A 2P5EB 2GK0B 1FG9C 4IOSD 2DQDH 1DQQA 2FWOB 1AR2A 3LRSA 3PP4H 5D6CB 2QSVA 2FX8H 3BP5A 1P9MA 3EHBD 3MCKA 1HH9B 1FJ1A 4PJ7F 4XNUH 1JF1A 1FBIH 1FZMB 4JY5H 3RWHA 1H5BB 2VDOH 2D0HA 5C71A 5D7IB 3ARGB 2UZIL 4PD4K 1Z3GL 4PB0H 1GGBL 2VC2L 1YNTA 4PRHA 4MD0A 2R1WA 2KUTA 3OMZA 2VWEE 3HHRB 5GSRB 1A1NB 1CXLA 4P4KC 4OQTL 3MRHB 4P2OB 3SQOH 1AQDA 4BZ2H 5HHQB 3O8XC 3BZFB 4HQQL 5I1DB 3STZB 2IPUG 4DFIA 2VE6A 2W91A 4KPHL 4PG9A 4AM0A 5F9WC 3N0PB 3MRCB 2MWCA 3CLEL 1CBVL 2B1AL 4NP4H 4F37K 3MV7B 4LSRH 4DVRH 5KS9B 1SEQL 1S9WA 4RQQA 3W2DL 4YBLB 5TDNA 3T2OA 1DUYB 3OX8B 4R4BB 4IMKC 4JRXA 4JJ5A 1FNHA 2R0ZL 1PGRB 3CFKA 3WHE0 4NSKB 4YBQC 5D7JA 4X5XA 1DBBL 1MLCB 3ZYIA 5ICYA 4QRTB 4Z7WE 5A16B 5CLWA 1MRFL 1W8OA 3U79A 1DCLA 1HOCA 1DUZA 1YDPB 1PYWA 1CF8H 4X6FB 1AD9B 4F8TA 2G60H 3OKNA 1BZ7B 2W9EL 5I1JH 1I3GL 4LSTL 5E03A 1PEZA 2VH5H 3P77A 3ZO0A 3QAZB 3ZT7A 4P4RB 5D72L 1WTGT 3QEUB 2EC9U 1JI2A 1JN6A 3PXHA 5DYOA 2UZIH 4KY1L 3O41B 3V6OC 1RZ8B 5IB5A 3VFRB 1D5XB 3X14B 4GRMA 4PJIB 1U8NB 4LCWD 1KB5A 4NO3A 1T2XA 2OR7A 4I0PB 1G9ML 1HHKA 2ICES 3HE6A 3CU1A 2M26A 4ZPTA 5J0BA 1ZT7B 4S1SH 3TT1L 1JGUH 5CINH 3MOBL 3BQUA 4J3UA 4X98B 2W65B 4AM0B 4MVBC 1ZHBB 2OTUA 2Q8AL 1FDLH 3QYCA 3SGKA 3ECBA 5IWLA 1OT2A 3IVKA 2HJFB 1F45A 2GT9A 2ZOKB 1ZS8A 4PRNB 4IRJA 4Y2DA 1XCQA 1CE6A 1SJHA 2NZ9D 1WZ1L 3HZMB 4N9GB 5ID1B 5ALCH 1RZJC 2GTZA 3DWTA 4XCEB 2L4OA 5I2IB 1QZ1A 2W9DH 4UQ3B 4X6FA 3D1MC 4I2XA 4X6BA 1KEMH 1XMWA 1CLZL 5BRZE 1ZLSL 4EBQL 4UDUB 2GQHA 5INDB 2MCG1 3V52L 3RWHB 5JQHC 1KLUA 1JWUB 3C8KB 3V6BR 2CH8A 1GZQB 1TZGH 1U8QA 2BSRB 4OUOA 1CDCA 5F3BA 2YUZA 1NFDF 4L8DB 2E27H 4PJHB 4ODSH 5F7LB 5IBTH 1QR4A 2DQEH 3P0GB 4MXQD 3N1MC 4GMSL 5B3NA 2JIXD 3H2WA 2QR0A 5AG8A 3T1FA 4YQXL 2OJZH 2OL3L 2YRZA 4HX1B 1A5FL 3BGAA 5C0RH 3GKZA 5ADPL 2BRRL 2V9RA 2DI9A 4LMQE 3U1SH 2OS7A 3RUGF 4YDLC 3TZVB 3S3SA 3HMWL 1DN0A 4ZOAA 3JXAA 2A77L 4DKAA 4M9PA 1NSNH 5HY9A 2WIIA 3MCLH 3BQUC 2BVUA 2R9HD 1UACH 4OT1H 2Y07L 1EERB 5IBUB 3AM8C 5JO5A 4NO5B 5D9SA 1MQKH 1ITBB 1A3RL 1I7RB 1VHPA 1UC6A 1YC7A 3ARGA 2SEBA 4OLVL 2V5SA 3HFML 3IKCA 3KPSD 3FTGA 1MCNA 1R3HA 1X7QB 4U6VH 1U3HA 2XPGB 5B38G 3H9HB 1BD2D 4JY4B 2FX9H 4Y5YA 1G7HB 4ONHB 4RWYL 4Z8FH 1ZMYA 3CXDL 3ESVF 5AWNL 4LF3A 4YHPB 1S7QA 5D7LB 1INEL 1IGJA 4X9GA 4ODSL 3NPSB 3RBSA 3T0BA 5FV1L 3Q5YA 2JCCA 1T0PB 1QD0A 3V8CA 5T3ZD 3ARVA 3LZFL 1QR1A 4D9LL 1UWEH 2FJFA 4IIQC 4F7MB 3TPUB 5GSVB 4ERSH 3DBXB 5HYJD 5FAAA 5EO0B 5FA3B 4O2EB 1GZPA 2P49B 1QFWI 4ZNEE 1E0OB 1F02I 2CKBH 3FZUD 4JFZL 1YMHB 4BYHA 4K07A 3MLTA 3B2VH 4HLZG 5D71L 5FFLA 3ARDA 3KJ4C 5GQBA 5KS9E 3RQ3A 3NA9H 1A7BA 3KR3H 4PJBF 1WBZA 2AEQH 4BELD 4WTXA 1U92B 1S7XA 3CVHA 2XZAH 2VLKE 2CSPA 4OKDA 2CKBL 4JFZH 4Y19B 4PLKD 3MUGA 3FCTB 1RZKL 5F6IC 1BM3L 4LRNH 3TA3A 2F5BH 1G9EA 2NXYB 4TVPE 1OAKL 3ZTJH 3DMMD 4LSSL 4JZJA 1KJ2L 3EO0B 3B9EA 5D2NA 4UT7H 3GI9L 4UBDD 5EA0L 1F6AA 5C0AE 1CS6A 1A0QH 2ORBH 3EJYC 4DGYL 1I8IA 5HHOE 1L0XA 4NOBA 3UCRA 1IGJB 1RIHH 3SY0A 1H0DA 4ZSOB 2O5YL 5E94A 1QUNA 3O3AA 1Q9OA 5DRZA 2VLKD 4J3TA 1MAMH 4OZ4B 3K46A 1NBQA 2NX5A 5CIPB 3MXWL 5SX4I 5KN5B 4M6ML 3D39D 3DXAE 3T0EE 32C2B 4TUJA 2Q7YB 2LV4A 4OZHA 1LP9E 3R0MA 5D1XB 3MNWA 3VD5A 1FFNB 5T3XE 4GKSA 4HJGA 3D18A 4WU7A 2H8PA 4PR5B 4R9HA 4WTZG 3S35H 4W4OA 3DYOA 1KENH 2CUMA 5F97E 3GHEL 4WFHE 3PDDA 1DFBH 5T3ZH 4A2LA 3RWFB 3QULA 4JDVA 4CVZA 1DE4A 4G8GE 1QSZA 1KIPB 3T0EB 1MHCB 4FFZL 4EI5C 2A6JA 1I8MA 5FOJA 2EEDA 1MCOL 1S3KL 1DVFA 2BVYA 3L1OL 4KK5D 4CW1B 1U41A 5DA0B 5GISH 1BD2E 1YJDH 4JDZA 4Q2ZA 5TE6L 1J1PH 5I16A 5F7HA 3GJFA 3VJ6B 4DVBB 4ODBD 1CTOA 4IMLB 1GGBH 4ISVA 4L8CB 4KQ4H 3L9RB 1HNFA 5IR1A 5GXBB 2P24A 4L8SA 3IFOA 3KHQA 4LEXL 4IEFB 3L3JA 1BFVH 2GJJA 1TZHB 5C7XH 1RZ7L 4YX2L 4KI5C 3SDXA 2VDLH 5F7EH 1RHHB 4EVNB 2WIMA 1WAAF 1CFNB 1YEDB 5L8JB 4L8SB 2DYPA 1E27B 3QG7L 5HGBA 1MFCL 3L9RA 2OTPA 3FQTB 1EHLH 5L2KB 3WJJA 1T4KA 3G08A 1F4XL 2ADJA 1RIHL 2HRLA 5H37H 3EOBB 5MENE 4FTVA 5J3HD 4PJBE 1ZWIA 2CRIA 3F58H 3RKDC 2YXMA 3HG1A 4AH2A 3O3BA 1IGFH 4M1CC 2N1KA 3WIIL 5E6YA 3B8SA 1HQRB 1QACA 5EBLA 2DKMA 4J4PD 2FB4L 4FQLL 4KMTH 4PUBL 1DDHB 4ELKA 1JV5B 2Z91A 4GS7B 1CIUA 4IRSD 5JW3L 4P57B 4ACPA 2P42B 3KPTA 3SN6N 1TQCC 3PV6B 4APQC 3SQBA 4X6CB 1JZ2A 4G6JL 1BMGA 3SPVA 4NOFA 3QPQC 1F4WH 4CBPA 1F8TH 3P77B 2HT3C 1EJOH 2NNAB 4NQDE 1M1SA 1H8NA 1TLKA 1CLYH 4N8PA 4LRIC 1ZA6A 3MBED 4XVUC 5ELIA 2PXYD 4S1RH 2B4CH 2AK4D 1KCUL 4FZEL 4QRRB 2HLAB 3SKMB 1MRFH 5CEZL 1A21A 4HH9B 3HI6L 1ZTXH 3HNVH 2H9GB 3D5OF 3P4MB 1WWBX 3CX2A 3JUYA 4LSVL 1H5BC 3W9DA 4OM0L 2GJZB 4PFEA 3ARDD 1BBJA 1OWRM 2YBRA 3HI5H 3W39A 3QUXB 3BXNB 5EOCL 1NBVL 5F1KC 3G6JB 2FYYA 3HUJE 4G9FD 4PRAA 4ODTH 3NVQA 4OGZA 3VFTB 3VFVB 5MHSE 1JNLH 4P4KB 1RMFH 4KXZH 3D0LB 3KPRA 4P2OC 4H5SB 3B9KC 4OLEA 1S5IL 5DURB 4FQHA 2ED9A 4Z7UA 5DGQA 2AEPH 3WJLC 25C8L 2Y72A 4F80A 4NT6B 4OSUH 2YZ8A 1MVFA 3NBNA 1OARH 3WDIA 3LS4L 3BO8A 1UKQA 2I07B 4NQSA 4YHKL 5FB8B 3MV8B 2YD4A 4P59L 5HHVH 4PJCF 4N8VG 4MD4B 3U4BH 1KCRH 1YYML 4U05A 2YHGA 4X7TB 3QG6A 1ZLUK 4WTWA 4PS4H 2XY1A 4JRXE 3SDYL 4H0HB 1DQQB 2Y7QB 2PTUA 3O6FA 2W92A 3QEQB 4D0DB 3WSQL 5C0AB 5ACZB 4JG0L 2YZ1A 3DV4B 2BDNL 3RJDA 4HUVA 3ARUA 3MA9L 3ARBA 5GRUH 2ZG2A 1LEGB 1WAAE 4N1CA 4HWUA 5DUML 1AO7B 3QNXB 3RTQD 2BDNH 3CX5K 4MJ2A 3ALPA 3O81A 3BZ4A 4XMLL 1PSKL 4BA8A 4RGMC 5JNYB 2YPLD 3VFPA 3AY4C 4JFOB 5IMMA 4M4PA 4G5ZL 2H8PB 4KROC 4PR5A 4PRIE 4YGAB 3L5JA 3V6OE 5I0DA 1HCVA 1C7TA 1AXTH 2JIXA 2PF6A 3O9WC 4GG6E 1KTLB 3C6LD 3S37L 1X4XA 2YPKA 5FK9A 3S88H 3BGFB 3TWCH 1G7QB 1J88A 3DV6A 1J05B 1B4JL 1GPOL 1KLFA 2H32B 2Y23A 4JO1H 1L4IA 4YE4H 3KPRB 1IGCH 4HGWB 3TVMC 4WUUB 5TE4H 5CINL 3VFTA 2C4FT 2H26A 3VFVA 3BP4B 1QSEB 4AJ0A 5L8LB 5D1ZB 1K9TA 2BSSB 3T65B 3VH8G 4F15C 3U2SA 3HTLX 5IBLD 3CUPB 4PRDA 5TE4L 3GNML 2WW8A 5DUMH 4HH9A 4LGPB 5EBWB 5AUMA 1QA9A 3BZEB 1I9EA 2JE8A 2P47B 5DHVA 3MA9H 3PWNA 5C9JB 1K85A 1V05A 4ZTOL 1C16A 1FCCA 4PJ9A 5F9OL 4JCMA 2EXYD 1CLZH 2EYSB 1Y6KR 2VXSL 1Z5LA 4UNUA 1JHKH 3GSNL 5ENWA 1J7VR 1O0VA 4JQIL 3LEVL 5BRZB 5JDSA 5E8OA 1S5IH 1HI6A 3ZTNH 2NY6B 3EO1A 5LAXA 5IF0A 1WIOA 3O2DA 3NACL 2P7TA 1G6RL 4YDLB 3TZVC 1S8DA 3TA3D 5FDWB 1XIWA 4PD4J 2R29H 1MI5A 3AAZA 5DD6A 3UBXG 4PJEB 3BQUB 1ETZB 4WFEE 3QQ9C 2EH7H 4JANB 4WUKH 3DJ9A 5DJ0B 3I3BA 2FZ3A 1IM9D 2VISB 5DD0L 5KSVB 1S9XA 2DRUA 4KPHH 3P4OA 1TETH 1OW0A 4LF3B 2HAZA 5D7JD 2MKWA 4Y5YB 3MRQA 1EZVY 5DRWB 5D96C 1RUKH 1IFHH 4HHAA 4U0QB 2NY0D 5C8JA 5IMLA 1KNOA 1RQ5A 5CJ8A 4WDIB 3WS3A 1BHGA 3A67L 4AIZA 1DL7L 5IB4B 3I6LE 3UPRB 2SEBB 1MUJA 4GW1B 4LCYB 3CFCL 2VABA 1L9MA 1K8IA 3AREB 5JXEA 4J3SA 2NZIA 4JFQA 1G6RA 5DQJB 3SE8L 1X5ZA 3KPMB 1V5JA 4YAQB 4DK6A 4IIQB 4UB0H 4EJ1C 3CIQA 1DBKH 5HHNA 3VA6A 6FABL 2EECA 2OTWB 1SEBA 1I8LC 3QO1A 2R0KL 4MA7H 4DFHA 3DRQA 1BQLH 1RULH 1T66C 3ETBF 5I9QB 3IKKA 3VRIA 4YC2C 3V7AE 1NEZB 4CW1A 3EYSH 4PRIB 1XGQB 2BY3A 1NDGA 1MVUA 3LKSA 4OLXH 2LVEA 3MRDA 4MLIA 1JHKL 3O3DA 1DE4B 1M7DB 3DI2B 4PV9A 5HHQA 1N7MH 4WCYL 3FOLA 3DIFB 4OV5A 1KJ3L 3D69A 1IT9H 3DUSA 5JHDA 3LDBB 2ID5A 4PJ5D 3LKNB 3ZE0E 1FGVH 4P23A 1QBML 4GXVH 3O11B 3QEGL 1NC2A 3UROR 4M5YL 5AG9A 1PKOA 1Q9LB 4ZG1A 1E4KA 1T6VN 2BY0A 3NPZB 1KCVL 3VMPA 1RK0A 5C3TA 1OSZB 1FQ9C 5CUSH 3S5LG 3UPRA 4C57C 1T04B 4QGYA 5ESVA 5JW4M 4MMZC 1UCTA 4F3FA 1FC2D 2PW1A 1FAKT 2VL4A 5HYSB 5E08H 1IEAB 3H7BA 5CJQL 3L1OH 1JHTB 1ZHBA 2BMKA 2CDEB 2VQ1B 2XA8H 3Q1SL 4NC1C 4QRRE 5T5NF 2C5DC 3WE6A 3K2MC 1F2QA 2P43B 1CGYA 5D1XC 4S1QL 2O5ZH 3KPLB 1KT2A 3QHFH 2CKBB 4X4XB 3DO7A 3P73B 1FVDA 1CU4H 1A2YA 5IQ9A 4XMPL 3UBXI 1U42A 5F96L 1J1XL 5DJAA 2E9WA 1VGEL 2A83B 2BY2A 4DOHB 1J0YA 5L0QB 3B9AA 2BOCB 5FKAB 1EGJH 4IS6A 4MJIB 2EDRA 3T0EC 3SGEI 2DLGA 4K8RH 4LASL 4EI5B 4X7CC 4KKBC 1VADB 4FXKB 5A2IH 3EYVA 3CMOL 1QBLL 3HAEG 4YGVB 2GY7B 5D7KD 4NBZB 1FIGH 1YPZE 2F53B 1HSAA 5B21A 4HDIA 1W72H 1DUZB 5CJXA 3D2UA 1WZKA 5F44A 2HLFC 2CXKA 5IFJB 5H8DA 1BD2A 3RVWC 5I19H 2AABL 3B2VL 3DBXA 2I9TB 2QBWA 3G5VA 1P1ZB 1MJ7L 3LMJH 4M1GL 3MUZ1 2YD1A 1I7UA 2HFEA 4XMPH 2B0SH 3C60B 4BKLB 3KLHD 1CFBA 4X6EA 3T65A 1U91A 2VITA 1PG7H 4NO0B 3RJQB 1EFXB 1OGAA 2QJDA 4B0MM 1NANH 4G43A 4KI5E 3UTZB 4AEFA 1ZT1A 2R4RH 1IJ9A 3K81A 1GOHA 1WICA 3GRWL 5F88B 2V2XA 1V3JA 3GSOA 3LMJL 4M1GH 3VXUE 4NN7C 1I7UB 2HFEB 2NY3B 1G84A 3VXUD 1MHPL 3RL2A 3VFOB 1A7OL 2ITCB 1EUTA 2LAAA 4XCYA 5M95B 1X7QA 2DI7A 4KJWD 4Z78B 1WWCA 3ROOB 3SGJC 5T33H 2EEAA 4RMWA 2VIRA 1V3MA 3ZE2E 1ADQA 4YGVA 1NCWH 2AXFB 5EZIH 5ISZA 1YY9D 3U6RA 4GKZA 5IHLB 3O6MH 5EIVA 4Y8DC 4QF1A 4ZPVA 4NFCA 1XCTB 3MRKA 1UACL 3FQWA 4GS7C 4N0YL 2NTFB 3VCLA 1HYSD 3K0WA 1OL0A 2IH3B 2DLIA 3C5ZD 4KDTC 1TQCB 2NW2B 5E9DB 3ES6B 3CXHJ 5CS7A 4WFFE 1CICB 4JHAH 2P45B 3GDBA 4QRPD 2GK0A 3GJEA 3SGDI 5D1QB 3QI9D 1OCWH 4OZFH 4LU5H 1EEYB 4H25B 1U8LB 3NZ8B 5BV7H 3QNYB 2H2PC 5DK2A 1SM3L 1VFOA 3MBXL 5F7WC 3MLXL 1AHWC 1OY3B 3QDGB 3CZJA 1B4RA 5EC2B 5D2LA 2XZZA 4JVUA 4IRJD 3RUGE 1E4XL 2NTFA 1A7QL 3VDCA 5HYSA 3O6LL 1NPUA 1ACZA 2WINB 3IDJA 4HCRH 1VENA 2BX5A 5C0EA 4ZO9A 5HHPB 4Q9RL 1IL1B 3RAJL 4U4BA 3BRDA 1B3JA 1CTNA 4KWUA 2DWDB 3DROB 4GAYB 3CD4A 3D48R 1R3LA 2PYEE 3PWLB 5J1AA 3QUXC 2GTWA 5KZCB 3CXDH 5DRXA 2C1OA 5E8DL 4KHTL 1N3NA 1QFWH 5DFVC 4MB5A 1MI5D 3KYMA 4U6HA 2P5ED 3QJHB 1U93A 3ET9F 4CVXB 1RJLB 3IGAA 3O6FD 4IS6B 4MJIA 1TMCB 1YNKH 3DSNA 4TQEH 4MQXC 1EO8L 1NFDB 3B9KB 4PJHF 4HEPG 1BX2B 4OF3A 1FNGB 3IETA 2CK0H 3IVKB 3QQ4A 4RNRB 4LLYB 1E4WL 3QUKA 4WNQA 2BVQA 1FNSH 3CFEA 3LKSB 1OHQA 2RR3A 3A6CL 2XFXA 1WBYB 2VLJD 1H3UA 2X4UB 4CU6A 2IJ0C 2VXVL 3KPLA 4LPYA 1S7VA 5HD8C 4AEIL 1YECL 3GJFH 3GSWB 3QUXA 4BFIA 3E6HA 4XP1H 2WWKT 2FJGB 3ILQD 1KJ2A 4BKLA 1RZJL 5E2WH 5IP4A 4CL7A 3IT8D 3PGDA 3PWVA 5E2VH 4MXWL 1RAMA 4Q9QL 5E2TL 1CFQB 5LGHL 3VGGA 2ADIA 3KPNB 4RWHA 1YN6B 1GGIH 3WCYA 4YAQA 4KRMB 4G6ML 3I6GB 1HHJB 5ESVB 4IOIA 1J1OH 5M94B 3U7AA 2ICEB 4HXBL 1QNZL 4W6YB 4PRHE 3E1F1 2VDML 3QHZL 4Y16A 4KUZL 2ZUQC 4R90H 3TBYA 3UYOD 2V2WB 1FORL 4GG6B 5C8JB 3PUCA 4HCRA 4ELMF 3PV6A 1K3IA 4O5LH 4UQ2A 3BFOA 1F42A 2XQBH 1M7DA 4M6OL 5C0NC 4RGMB 3T0XA 5H37G 2J8HA 4LVOB 4OZGB 4GQ9L 4R2GD 1AE6L 4KROB 3MXVH 5AAWA 5IQ9B 1N0XL 3FT4B 4P3CH 5HYEA 2FL5B 4HJ0C 4JPKH 3QXDB 2XZQL 3O9WB 4RZCA 3MBEA 3DETC 2X4UA 1BVZA 3KYAA 3UAJC 5CD3B 2XTJD 1R5IB 3BGFC 4PG9B 1J10A 2EICA 3P4LA 2J4WL 5F1NA 4FQXD 4OD3L 2XWBB 3S37X 2P5WB 1ZT4A 5DD1L 1NJ9A 4H26A 4I2XE 3ULSB 3RWGA 1HNGA 5FO9A 3EO9H 5EBMA 3SE4A 5KG9B 4H1LB 2E8ZA 3C6SA 5DJ6A 3CX5J 4CMMA 4JZNA 4WHTB 3TVMB 5JA9A 4WJ5A 5K9KB 4PY8J 1T1XB 1MAML 5TF1H 4I0PD 5GZOC 5D7LE 4HIJA 5D1ZC 3RGVC 1IC5L 3G9AB 4RMTA 4XAWH 3B4NA 1UM6L 1OPGH 4F15B 1Q0XL 4QO1A 1IL1A 2R2EA 1FE8L 3W9EB 4U6YA 3I02B 5E56A 3S5LB 1WWWX 5HGDA 5TGBB 4LKCA 1N5AA 4AT6A 4S1DD 5IVXF 1CGTA 5JPNA 2YD6A 3MLWL 4HUXA 4JO2L 4R0LC 4JRYE 1KJVB 4GKNB 2BSSA 1N64L 5FOBB 2R8SL 4N5EC 3B5TA 5LGKA 5DDHA 1REIA 4OD2B 1KPRA 5T5FH 2NY6C 4HQQH 2DWEB 4PJIF 1OWWA 4KH2A 3KPQA 1ORQB 4P5MA 4M8VA 3ZYOA 1A47A 3LRHA 5D71H 4MNQD 1X6LA 2H6PB 3WMSA 4HULB 4Z7QF 5EOCH 3GO1H 1ZKAA 3OGCB 4NC0B 1WC7A 1TCRB 4DW2L 2IGFL 1G7QA 3OG6B 2ARJB 5A40E 5J89A 4NQDA 2VAAA 3QG7H 4G9FA 1O7SA 2HG5B 3TYFA 4Z7UE 2DL2A 4YFLF 1KIRB 2AJYH 2NY4C 3LB6C 5FYLL 5C2UB 5BRZA 2XQBL 3BD5A 1RUPL 4KTEH 1GVIA 1CD1A 4TRPH 4L3CB 4NO2A 2AEPL 3V0AC 4JFOA 2E7LC 1CFVH 3MLYL 4Y5YC 4HKZB 4MCYA 3GIVA 4XI5D 1J11A 4UNVA 5D96B 3QO0B 5FGSA 4OFYD 3T3PE 1CFTB 4F7CB 4JE4B 4PJDF 1M4KA 4R96A 3QPXH 4K3DL 2E7CA 3CUPA 1MCDA 5GGRA 4Y4KB 2VISA 2Z4QB 3PHOB 3W0WB 1RIVL 3D85B 5DJ0A 4JR9H 4XVJH 2AKRA 3UJTH 4ZUWA 4HXAL 2YPLE 1QTYT 3D3VE 3AREC 1EFXA 2Q1EA 4KJPC 1P6AB 5AAMA 5ETUB 1LEIB 4Y0GA 1P7KA 2JK5A 4HS8H 2NY5C 3U0WH 3IJSA 2R56L 4X6EB 1F4YH 3AC0A 3C2AH 3KVQA 3WUWA 3GZKA 2EIZA 3KPSB 1IVLA 2EEBA 3C60A 4LLWA 3MLVH 2KKQA 4N90E 2R8SH 3B2UD 4QY8B 2VMFA 5GGTH 2J7LA 4YDJA 5FM5O 4ODVL 1K3ZA 3VU2A 1SJXA 5TQ2L 2Z35A 1UWXK 1ZHKA 5I9QC 5DMKB 1CYGA 1KENL 3ZMRA 5F70A 4YC2B 1X5AA 3BH9A 4OF7A 3KS0J 2OR9L 3I6KB 2BERA 3LV3A 3MODH 4PRBB 5I1HH 1UJ3A 2BXYA 4FG6C 5GGSY 2EIDA 5SWZD 1B9ZA 3N1FC 5B39A 4G6JH 1OAQL 3SDXF 1A64A 1J8HE 5GSVA 4O2CB 4G42A 2X4PA 1ZAGA 1WT5A 4HUNB 4A6YL 5EUOA 3G6AA 3S96B 3LDBC 5ILTL 1R3JA 1R3KA 4WFGD 2FECL 5FGBC 2ZCKL 4PP1D 3K2UH 1L6ZA 4KQ4L 3D85A 3W0WA 1Q8MA 1T0MB 4XTRD 4Z7VA 3FHQA 1R5WB 3W82A 5IHBA 1OTUC 3Q3GA 3CVIL 1ZE3C 3BDYH 5MEOB 1JTOA 4G6AC 1HZHH 1T7WA 1N0XH 3QG6B 1MCOH 1EA9C 5EOTA 4ZXBD 4FFWC 2V2TB 1KCRL 4TULL 3L3KB 4RIRA 3E0GA 2DD8H 2NXYD 5MP6L 3GBNH 5SWSD 4KVNL 1HDMA 3EYOB 4OCWH 2Z0BA 5JO5B 5C0BB 3EFFA 1GHFH 5JOFB 4N0YH 3HE7D 1NC2B 4GSDH 2OCFD 2XICA 4UU9B 1JGLH 2YA0A 3QCUH 4NQDB 2ADGB 3CSBA 3MFGB 1YQVH 2G9HA 4PBVC 2NPLX 3QB7C 3EDKA 2XTLA 3UTSB 1MCQA 5L0QC 1GIGH 2PTTA 4Z77A 5IVZB 2ZUWA 3WS6C 5EBLB 3FL7A 4C56A 5JOPD 1FP5A 4KGLA 4PP2B 2FLRT 1TDQA 4KY1H 1DQLL 2DQCL 4NJ9L 3H9SD 4G8IB 1KN2H 2DMKA 1W72B 2GFBA 1BFOB 1OP5H 2CKNA 2ICWI 2NMSA 5GJSH 1ZXQA 3ILPA 3QXTA 2MHAB 4JHAL 4C56B 5AWNH 4DGYH 5I1KH 4L8DA 3FQXB 1URLA 1UG9A 2PTTB 4NM8H 5HHNB 4HLZH 4WFFD 3C60C 2FD6H 2VDPH 1N6QL 5IJVA 5FB8A 3DGCR 2VKWA 3DVGA 2CLVA 5D5MB 5HYQB 4GJTB 2QV2A 1EO8H 2UWEB 3IRZA 4WVRA 3W11C 2VABB 4XPFL 1RZKH 3L3OA 4NIKB 3EYOA 3B83A 4XNYL 4PJFB 3CVHH 5IV2B 3RVVC 4OT1L 3N50A 4F7EB 1C5BL 1KCSH 1MCJA 3HMXL 4NN7B 4OCYH 3GMQB 3L5XL 2NY3C 4OCXH 5HPOA 3MRBA 4PJBA 1SHMA 3E6FB 3CLEH 2EDBA 3HAEH 3PDGA 4ELME 4H26B 2ICCA 3O2DL 2P5WA 1YJDL 1OQXA 3Q3GB 5FM4A 9CGTA 2E7LA 3C9NA 2DKUA 2YRLA 1ED3B 1HH6B 5EIIA 4YDVA 4UINL 3HG1B 1MCKA 4NFDA 4AH2B 3THMH 2JJTA 3BGMB 4I4WA 2VXUL 5HI3C 3W5MA 1OD9A 1KLGB 3SO5A 4ZUSB 4UNTA 5ABDE 5IROA 3T0EA 3AAZB 4LRNL 5DD6B 3ZHLA 3IAPA 4CVZB 1XIWB 1RZ8A 2FNBA 5IB5B 4LSUH 2O5ZL 4KVCL 2HJLB 5FO8B 3U36A 1CICC 2AABH 2ICWB 4FFYL 4NKOB 4PGDB 4ODHL 1E6OL 2R0WL 3FFCB 5D1QC 5FYKD 4ZS7H 2DQFB 5KSAC 4QT5B 1MAJA 3BAEH 1MFEH 3MNWB 4PGJA 3LQZB 1AHWB 3QEHA 1AD9A 3E2HC 5KBNC 4PIRF 2QHRL 1J18A 4DKFL 1A3QA 1HOCB 5E6ID 3TBWB 3TIDB 4LASH 4LLMB 3SO3C 1ZGLP 1MOEA 1TVHA 1XF3A 5EZIL 3OPZL 3HA0A 3S34L 3KG5A 4GRWH 3T3MF 4EEEA 1DDHA 3PWVB 1P84J 1I75A 4JQXC 4XP6L 1A0QL 2ORBL 4ZSOA 3JV6B 1T2JA 3IJSB 1CU4L 2A74A 4KKLD 1VSCA 3VGBA 1E4KC 1MHPH 1KC5L 5DO2D 2NY1C 3DXAD 2PYEA 5AZ2L 2NY5L 2BY1A 5JXAL 1QFHA 2AP2A 1INEH 4BH7A 4FRWA 1XAUA 4HZAA 2BVQB 3QUKB 2ADJB 3SE9L 2AXGA 3WJLA 4DUVA 2XN9A 4ZFZB 5FGCB 4R96B 5C0RL 2J2ZA 2YMXH 3V79C 1HKLL 5EB9A 3KAAA 2WUCL 5C09A 2RAMA 5ACLA 1G0YR 1JPSL 5J9PA 3ZE1F 3SDDD 5I1EL 4BZ1H 4HIIB 4ZUVB 2H41A 4NRZA 1GXEA 1RZIA 4XWGL 3NFNB 3INUL 3VFNA 3Q6FB 1XR9A 3S3JA 4BM7A 5HHXH 4G9FB 4YZFF 5EO1B 4PTUA 2EXWC 1A9BB 4P4KD 2YKLL 3IDIA 1H3VA 3CPLA 2AJXL 3NZHL 5CEZE 4BQBA 1GAFL 2HYMA 1QSFE 2XT1B 1PLGL 3GI8H 1DBJH 3RDTC 4GLRI 4RX4A 2P8PB 2O5YH 5GGVL 1OP3H 4OKVB 1KFAL 1XGPA 4EDWL 2XWTB 1VFUA 3P11H 2JCCF 2VLRB 2Y06L 4JRWA 4R4NC 5FYKH 2X05A 4K71B 5T1LB 1IZJA 1KTDB 2ZUQB 4NDMB 5E24E 1KIPA 5F7FA 1LD9B 4HUUA 2QEJA 5I8KL 3O45A 4PJ7E 4O2CA 1AFVH 1E28B 4TRPL 5LVEA 4LVOC 1FVCB 3VI4E 1UEYA 3AB0B 3VW3L 2OI9C 3VFNB 3FAWA 4QHKI 4ZUVA 35C8H 4XCCL 1Q38A 1QLFA 4ONGH 4FFYH 4C56E 3GO1L 4JFEA 5KANI 5DS8A 3ZHDA 3M1BB 4YO0B 3C6SB 4XCCH 4CDGC 2H1PL 1A6WH 3BVNA 4WEBH 2CLRA 1UZ6E 4EN3D 5BS0D 3L7FA 3RUGA 4Z7NE 1H0DB 3O2WL 2YPLB 3GSXA 3UX9B 5F88A 1EHAA 1P7KB 4LLVB 4JPWH 1A7RL 5C0CA 3B3IB 2X42A 3UJJH 4WI4A 5CJOL 2VDNH 3RGVB 1JP5A 1XR8A 4HUXB 1JWSB 1LO0H 4FP8H 2IAND 1S7QB 5CMAA 4J3VA 1ZSDB 4MVBD 1CIDA 4EDXA 2BSRA 1FL5A 2A6KA 2I9TA 4I18B 5C86A 1BF2A 2ADFH 1FFOB 2Q6WB 3FKUS 1SVCP 4R0LB 2X4SB 1AP2B 4EUPH 3OJ2C 4OD1H 4TYUA 3SKOA 1I1AA 1DBKL 3FO2B 3QXVA 4L3ED 3EDJA 5BOZG 1T1XA 4N0FB 1C08A 1DZBA 1VADA 1YMHA 4FXKA 1GYAA 4EOWL 3GFUA 1A6UL 5EO0A 5FA3A 1HINL 5C0IA 2VRAA 3VG9B 1EVTC 2C4XA 3VFMA 4PG2A 2ITDA 3OB8A 3SGEH 8FABB 5HI5C 3GUTA 3KPNA 1J0HA 4AQOA 2GK2A 3INUH 4X8JA 4AG4L 1UENA 1DLFL 3RZCA 5JW5A 2FEEI 4ZUSA 5EORH 1JPFA 4HS8L 3U0WL 1ZT7A 3FO9B 2NY4B 4I4WB 4XNUL 4M6AA 1A6AB 1HHKB 1PSKH 5T1DL 1QFOA 1UWGH 2FX8L 3MRLB 5FHAL 3RX5A 5FYLD 2Z93B 4WW1A 3AY4A 2Q8BH 2PO6C 4ORGB 4PJ9C 2CGRL 4U1SA 5HDOA 1IE5A 3BH8A 3GMRA 1WFNA 3ARRA 1I9RH 1ZLUH 4AQ1B 1E27A 4GRWF 2W9EH 4GSDL 2VLLB 3T4YB 4C83B 2IMMA 3R8BB 4Y4KC 3TIEA 1NUNB 3CXHK 4QHNB 1RZGB 1U3ZA 5JMOC 2WBJD 3ZYJA 3P9WB 3PABA 5DUPH 3ARQA 3KPRE 2E6QA 1IAKA 3DGGA 4Q58C 4WV1C 2MQ0A 3RRQA 5D7JB 4Z7WB 3OAZK 2HJFA 3W2DH 4PY7A 1V7ML 2WBKA 4LLQB 3GMLB 1A6TB 2GI7A 5E00A 1YECH 3X11B 1FDLL 2KBGA 4LLAA 1T5WA 3HNVL 3EUUA 4U1JA 3VGEA 3O9WA 2E9BA 1UM5L 4JFXB 5LGJA 1IAIM 4XMKL 2CR3A 3VWKA 3NZ8A 3V5KA 3PXJA 3WSQH 4ZD3H 4PGZA 1I8MB 2HH0L 5D1QA 4PY7B 4P3CL 4MXVF 5FUCC 5EH1A 2V5TA 4NJAL 3VWJD 3X14A 3FRPG 1A4JB 2D03H 4P2OA 1A02N 5GPRA 1ZHLA 3OXRA 3VWJA 4KKAD 3VXSA 5DQJA 2E9IA 2XXMB 2CRYA 2XV6B 5DJZA 5DJ8A 1TZIB 2GJ6D 2JCCE 3FZUC 1V3LA 3Q48A 5CP7A 4M3KB 2GSGA 3PWLA 1R3LB 4NQCA 3WKML 1FNLA 1I1CA 3SDCA 4DGIL 3EYUH 2XRAH 4RDQF 1NGWB 4WDIA 2VDKH 4TTGA 1JF1B 2BP3A 5C07B 2GT9B 4XCYB 5CIPA 1XZ0B 1JPTH 1U3HC 5F3HA 1UWGL 5F7UA 4M7LT 4R4BA 5L9DH 4ZOEA 1HIMH 4NUJA 3X13A 5IG7A 3QDGA 3WFZA 3KYOA 2IPTH 3KXFA 1D5IH 2F58L 2Q20A 3L95A 3T0DA 5FYJD 4N8CH 4OFIA 4UBDC 5A1AA 3EJYD 4NO0A 4OM0H 1NC4B 3HRZB 3RHWK 5EZOH 3HRPA 2FJHA 3TNMB 4JCLA 5F7DA 2VE6B 1S7SA 4BQCA 3RP1A 1NKOA 5E8NA 5EU7C 3VI3F 1IQDB 3LY6A 2JELH 2CIIB 4S1RL 4WY7H 1ES0A 2J8UE 3QFDB 2H3NA 4GAJL 4OQTH 4QHUA 3LPGA 4PS4L 1YNLL 1AD0A 5DQDL 2C1OB 5HHOA 1YYMH 1MREH 5I1GH 2F53A 1UQSB 3SKOB 3FONA 2WNGA 4JQVA 4M02A 3O6KL 4NNYB 4X4ZA 2VDRH 3IF1B 2Z35B 3D25A 1C16B 4KTDL 4ZQKA 5MENB 2XNAB 5J57B 5GZND 5AUMB 1T3FA 4ONFL 1OM3H 3V5HB 1K6QH 2DLTA 1NL0H 2FWOA 5GRXG 1U95A 1UXWA 3LN9A 2RHEA 1IBGH 3GSVA 1RI8A 2V5MA 2NXZC 2DQDL 4EI5D 3JBG7 4U1GC 1WCBB 5HDLA 2B5IB 4QCIB 1QSEA 1LQSR 3VFGH 4AL8H 1LO4L 4KK5C 1LE5B 4LQFH 3CK0H 2EDTA 5C08D 1PD6A 4EIZC 4QRUB 4FN0A 3RKPA 5I1EH 3BHBA 5A2JH 1IGTB 3NMEA 3QP3A 4Y5XC 4M48L 1IGYA 3GIVB 4OLUL 4YO0A 1OPGL 3JSSA 2QQKL 4KZEL 2IANA 3OKOB 4U1HA 1CD1B 2NTSP 3QFJA 3VG0H 1I7RA 3IDNB 1I7TB 4TN9A 5LGHH 3IS1X 3LPFA 2R0WH 4D2NA 1UKSA 1YPZB 4I3RL 4TVPH 4MD5A 5CEXA 2Z8SA 3REWB 4YXHL 4KRLB 1E28A 2R0LH 5JNYA 3VXSB 5ITBH 1XIWC 1MFDH 1R3IH 4Y7MA 3VXUB 5I1HL 1J8HA 1BEYH 3LRSB 3BT2H 5FYKL 5ACMA 3RL2B 2OJEA 1E4XH 1MCWM 4I1NB 1U8MA 3VXMB 4OF8A 4CN6A 5KSAB 1N6VA 4JFDA 1T89C 3GMNA 4OZIB 5J3HC 3P2TA 4POYA 3E2HB 3KWWA 3WE6B 2XA8L 4R7NA 2OL3A 1N5YL 1U91B 4E41D 2Y7QA 3SO3B 4POZC 4HG4J 3CH8A 3Q2CA 5E8DH 3NCJH 4J4PC 2CJUH 4M4RA 3WIFB 3C5JA 4O02H 4V1DB 4FQQA 1IAIL 5LXGH 5C6PB 4PTUB 3UJTL 3WFEH 2B1HL 5MENA 2VZUA 4APQD 5E9DD 4HIHA 4LAQL 1AR1C 4LP4A 2Z8RA 5I19L 4H8WH 2HTLD 3TP4A 3O4LA 4HF5H 4U1IB 4ZDHB 2NY1B 5LBSL 1KSRA 3BJLA 3MV9B 2D3VA 3BPNB 1MUJB 2BOBA 2FD6L 4I5BA 1A1OB 3X12B 4RX4D 4FQCL 2PXYC 2H45A 5E5UB 4QRPA 3UTSE 4WY7L 5IB3A 1FFPA 3WKNA 1CR9L 3I50H 3C5ZA 3GMRB 4O51B 4QXUL 4U1SB 3K74B 2VZ3A 4W70A 4B5EA 5IFHH 2F54E 5TQ0H 5E1HB 5C0BE 3VXME 4X98A 3CK0L 5F89B 2DICA 5KSVA 4I0CC 5HGHB 1RFDL 1QP1A 1I85A 3RVTD 4WO4B 3A6CH 5KZCD 3FO9A 4LSSH 4RISL 2GJZA 2DTML 3LKRA 4LEOB 1T20A 1NBYB 2BMKB 1MRCH 2VQ1A 3QWOA 1MI5B 4GRMB 4UINH 1OP9A 1LK2A 3LN4A 3TH3T 4TVPD 3UTTD 3B9KD 5IOPA 3KPMA 2XZAL 4UTBH 3GEWB 1EJ6A 3TBYB 3RDTB 3SDCB 4XCFL 1OOAA 5C0CD 3EYQD 4JPVL 1A7OH 4N0FA 3O2VH 1C5BH 4JFFD 4U6XA 1Q9LA 1U6AH 4K71C 5TDPA 2Q3ZA 3MV7D 3WO3B 2FR4B 4EN3A 1K2DA 1YUHB 4JKKA 5BS0A 4DAGL 5HDBE 4OGXL 3WUWG 2HJLA 1C12A 2D0GA 2EZ0C 5FUCE 1BP3B 1A4JA 1FL5B 3GMPA 4KQ3H 2UVEA 4K7PX 1I1FB 4NPYA 1S9WB 4RCAA 4RQQB 3AB0C 3MXWH 4EXPX 2OI9B 4MA3A 4NGHH 3QIUB 5DJCA 2ZZUT 4ETYA 1TZGL 1VFMA 1ETZA 1Z0MA 2YSSA 3X11A 4L4TD 4CRPA 3JTSA 4KTYA 5AYQA 4NC2B 3WXWL 3DRQB 2Z31A 3FQTA 1DEEA 1RZFH 1G7PB 1NBZA 2OJZL 1IGML 4C58B 4U1KA 3PE9A 4XPFH 1VFBA 4OFDA 5IF0B 3UYRH 1A1OA 3LD8C 1BFTA 4G8FA 5TDOA 4KROD 2E9JA 1N3NB 1EGJA 1CGVA 3SJVB 3BDYL 1BQHB 4MJIE 1JE6A 4ZUUB 5SX5K 5BO1H 4KDWA 4LCYA 2W07A 4U1NA 43C9A 4BH8B 3CCHA 4JG1H 4PJEF 1H5BA 4QRSB 4U1MA 3L5WB 3K1KC 5DHVB 1NLDH 3NCMA 2WQRA 3D9AH 2P5WD 3EJZD 2Y6SC 4FMKA 4I18C 1CGWA 2DQHL 1JZ7A 4U3HA 4DQOH 1WWAX 3VFWA 2FHBA 3DVIA 4DEPB 4GAGL 5DRNB 5HVGB 4D9QE 1S7UB 1AO7A 2HH0H 4MNGA 4H20H 1H3TA 1QVOA 3O3EA 2V17H 3ULVH 1UH4A 4LRIA 1F97A 4ODWB 4QOKD 1IM3B 4HS6B 3H3BC 5F8QC 1YEIL 4HC1L 3RWIB 3VG9C 5GGQL 4XC1L 2HKFH 4HW6A 5F1SA 1JF5A 4PJXE 1EXUA 1GC1L 2EYTB 3MQIA 5FDWA 5BOPA 5I1JL 4CNIA 2XY2A 2IQAA 2FSEB 2MTPA 4MX7B 5I8OH 1YYLL 1XF4A 4LPUA 5FK9B 3I75A 4PRPD 3EDEA 1OGAD 1A6UH 3V6FB 5B39G 5C0BA 3DO3A 4RAUA 4A6YB 1M05A 1H15B 2YA2A 3HB3D 1OVZA 2B8OT 1BVKB 1HE7A 2R0ZH 4B7LA 3BISA 3PWJA 3NTCL 1UGNA 3OAUH 2PO6B 2AERT 4HUWA 3EBAA 4PJ9B 3FQRB 3SGDH 3CJJA 2O26U 2CXGA 3WJJC 1A1MA 3QIBA 7FABH 2IPTL 3F5WB 3BHBB 1DSFH 4WTZA 5MEOA 1AY1L 1TTFA 4KK6C 4QYOA 1L7TL 1CLOL 4Y88A 5CMAB 3QNXA 2QSCL 2Y36H 3SY0B 1XR8B 1D9KC 5CP3H 1KCLA 3GNMH 1VPOH 2Q3AA 1IC7H 4K9EH 1VKXB 3QQ9D 4M8QB 2G5RA 5CILH 5BMFH 3GIZL 4HFUL 3Q5TA 3OWEA 4WV1B 4HWZA 4WHCA 2VDQL 4YHLH 5D7JC 1NGYB 1BJ1H 4NKQB 3NIDF 3KNBA 4LPVA 3MUGB 1Y18A 2D31B 2VLME 4IMKA 3U7WL 1HXMA 4PB0L 4ENEC 4YBHA 5IWLC 4KJQD 1Q72H 1IC5H 3CSPA 1Y6NR 1UCBH 1H8OA 1OF2B 2I07A 4M00A 1BVLA 1IM9A 3I6KA 3LV3B 4JO3H 4PRBA 3W0WD 5DD3H 3IDUA 4OZGE 4NNPL 4QT5A 4E5XA 1TXKA 5EWIH 3FFCA 3D0VB 3VFPB 1Q1JL 4X6CA 5KOMC 1IAOB 1AC6A 4LIQL 1F3JA 5E8NB 1FVEB 2G5BB 4WEUD 3CDFA 2DBLL 3WO4B 4RAHA 5L2JA 3WUWB 3OF6D 5SV4A 3NABH 4DVRL 1T66D 1DQTA 3N1PC 2DMCA 2DBLH 4Z0BH 3A0OA 1C1EH 2RBLA 3QEQE 4HLJA 3KYOB 3SGJA 3ZDYF 5H2BB 5EU6B 1DBAH 1I3GH 1CFTA 1I9IH 1U3HB 2V5RA 5CJBA 4XPTH 1RUPH 4KTEL 4AEEA 4Z95L 1YQ2A 5D4QA 1AC0A 1MLBA 2YK1L 4MD4A 3TO2A 4M43L 5E5MB 1OD7A 2XKNA 4EVNA 5H35B 4Q74A 5L88H 1BOGB 5EU3B 3S88L 1JMZA 4ONGL 4HK3N 4MNGE 1ZOXA 4ZUUA 4MQ7A 5MEPA 5C0GA 4HFWB 3O11A 2EDQA 4H1LH 3SJVA 5CGYD 2VXQL 1NCCH 5HYSG 3AFLA 1DQJA 5F1OB 1ZANH 4G8FB 1WZLA 1X5HA 3FMGL 3IDMB 3R8QA 4OSUL 2P24B 4YHNB 1EXUB 4WGWB 5HBBA 4GBXD 1UB5A 5EORL 5EIQA 1C5CL 5E2WL 3GSQB 4YHYB 3VJ6A 5TH2A 5IQ7L 2GUOB 1T22B 4ZXBB 4BH7B 2EE2A 3QUZD 2EC9T 5CJXC 1NDGB 4XNZC 2HTKD 3CSYB 5HVHC 5CZXD 5FYJH 4ZXBA 2FO4B 3MRJA 5K9QG 5FV2A 1N4XH 4NQDD 3HZKB 4UOW0 4PRPE 4OD1L 1GZQA 2DYPB 2HA1A 2K1MA 4JHWL 3RWCA 4Q0XH 2I26N 5A2KH 1W0VB 2FGZA 5ISZE 5EZJA 2NXZB 2XN9D 1I4FA 4FQ1L 4XAKE 4U1GB 5C0GB 3LKQA 2B5IC 3BEWA 1X5FA 5CBEB 3H9SB 1DP0A 1MCLA 5IB4A 1XCQB 3NFSH 4Z7OF 2V2TA 1LMKA 1ORSB 5IMLB 4PRNA 2OLDA 1Z3GH 3RVWD 1DEEB 1T7VA 4LPWA 4Y5XB 4BSWA 4TSAH 2XWBA 3BP6A 4TVSa 2VB5A 3ZDXF 2HFFB 1T0MA 4Z7VB 5I1AA 5EUKB 1SY6H 1GGYA 4WO4A 2VTFA 3JWOH 4WWKA 5I1LB 3AM8A 3LKPA 5IW6A 4I0PA 3V2AR 4AMKH 3WNPA 1EH9A 2X9WA 4NM4L 4YE4L 1T5XA 2BJMH 4Z5RA 4QNPF 4O51A 1IC4H 4Y5XA 1F6LL 1F3JB 1QRNE 1NFKA 4HKBA 1OAZL 1NCBL 4UQ2B 1EAPA 3UPCA 4AYFA 1B90A 4PJFE 1X5IA 3CGTA 3OPZH 2XXCB 4LSQL 4PJ8D 5ALBL 1CDBA 4XHJC 4MJ5B 4D0CB 1AKJB 2PYFA 3U0TA 3E3QE 1OF2A 5I76B 4IOIB 1I4FB 1RUAH 2ADFL 3BE1L 3GSNA 4XWOD 3M07A 2B2XH 1MSPA 5GGVH 5GGRY 4PGEA 1NGPH 5KW9L 4ISVB 3BMVA 4MLSA