1LK3H

Engineered human interleukin-10 monomer complexed to 9d7 fab fragment
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
219
structure length
219
Chain Sequence
QVNLLQSGAALVKPGASVKLSCKASGYTFTDFYIHWVKQSHGKSLEWIGYINPNSGYTNYNEKFKNKATLTVDKSTSTGYMELSRLTSEDSANYSCTRGVPGNNWFPYWGQGTLVTVSSAETTAPSVYPLAPGTALKSNSMVTLGCLVKGYFPEPVTVTWNSGALSSGVHTFPAVLQSGLYTLTSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-10
publication title Noncompetitive antibody neutralization of IL-10 revealed by protein engineering and x-ray crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 44
structure length 219
sequence length 219
chains with identical sequence I
ec nomenclature
pdb deposition date 2002-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lk3H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lk3H02
1A14H 3AROA 1KEML 2YA1A 3PIQA 3DV4A 5DJCB 5F9JB 1IQWL 4FMFA 2LTQB 5ITBL 3RUGB 1OAUL 5AZ2L 2Q8AL 4AYFA 2H26B 3KPSE 5CBEB 1OL0A 1KN4L 1ORQB 3FTGB 2MHAA 1OTTC 3O2VL 5CP3H 5CBAA 1EAJA 4N0UA 4P46A 4PRHB 3MRLA 3I02A 1IC5H 3MRJA 4XHQA 3W0WA 3GSXB 5ANME 4D9RE 4O4YL 4NUJB 4U7SA 2WANA 4XPAL 2ILLA 3L3JB 5E2WH 4HUMB 3LRHA 2WV3A 3QUZB 3F5WA 5ID0A 3NVQA 5F71A 4YJZL 1CFBA 1UC6A 3ET9F 4TPRH 1EHNA 5C3LD 4YGVA 4CN6A 3I84A 4MA8L 3MRQB 2QQNL 2MKWA 4QOKE 2IALA 4NCC1 4W6XB 1RULH 4HF5H 5E2TL 2QHRL 4Y4KC 43C9B 5BS0B 1QSZA 4BQBA 1M7XA 2V2WB 3QIBD 3OPZH 1MH5B 1UB6A 2JCCB 3CX2A 3LD8B 4RGNE 3PHQB 1T7ZA 3CVHA 3L95A 5D2LA 5GISH 4JQXC 4O58H 2NY4B 5JW4Q 5CAYB 5D5MF 2I07B 3NH7H 1ZXQA 3AXLB 3NPSB 2B4CC 4WRLA 4WFFD 2ATKB 2CDGB 1QRND 1JWSB 3S5LB 2EDYA 5ITFB 1DQQA 3MMEA 1SJEA 2Y5EA 2X6MA 3IKCB 4UIKL 4KXZI 4NCC2 2YWYA 3L3DA 1T1YB 3PWUA 5C0CE 4ACPA 1FYTA 3QIUA 2G9HB 4MXWH 3VXSA 2XN9B 1EHLH 4Z7UB 3WS6A 4ZD3L 5GS0C 3V4PH 2VAAA 2X9YA 1Y6MR 1NLDH 5DC4B 5KSVA 2PYEE 4F2MA 4RCAA 3B9AA 4PJHF 1FSKB 3DURB 3D0LA 4RWYH 4HFUL 2A83B 4N9GA 2G2RA 2PXYC 1ZS8A 3P0VH 5DJXB 3U1SH 4BZ1L 1FJ1B 3FB5B 3ZE2F 3BRFA 5F9JA 2H32B 1CLZH 1T22B 4M5ZH 3I9GH 4NQVA 3FMGL 3LOWA 5D1XA 2H26A 1PLGH 5CBEA 3TPUB 3KG5A 3T3ME 1F4WH 3WE6A 3SDAB 1D5BB 1J8HE 4RRPA 3FTGA 4G6JL 4P23B 2HH0L 2VWEE 3CLFH 3PGDB 5DUMH 3T8XA 1CVRA 3HI1A 4ODHH 3UTSD 3SJVD 5C3TA 2EXWD 3T0DA 1TQCB 4O5LL 1JYXA 1AGCA 4NUJA 1JGUL 3L3JA 5I2IB 3FFDA 2R4SH 4MXQD 2XZCH 1A5FL 3QUZA 1AD0B 2KZ1B 3SKUD 4LLVA 5DI8B 5D7KD 4YXLH 2YXMA 4KROD 1ZEAL 1AO7B 1EHAA 3RNKA 4KQ4H 3MRQA 4PR5B 4BZ2L 4YX2H 5IVZA 4HWEH 2XTJC 5GGVH 3EYFB 3SDDD 4FQ1L 4K94H 3RWIB 1QLRA 1YYML 2XI9A 2IGFH 43C9A 3VXPB 1GAFL 1GRWA 2V2WA 1NAMA 1MH5A 1I4FB 3O4OC 3PHQA 3MZTA 5J7CC 2VSDA 2I07A 2IAMC 4LSTL 3JWDC 3BWUC 4ONHB 2ATKA 2CDGA 4M6OH 3S5LA 3CVIL 5ITFA 5HYQA 5DUBB 5GXBB 4HBQA 1AY1H 1VERA 2VERN 1ZTXH 2NW2A 2ESVD 1TCRB 2ZPKH 4CNIB 2N56A 2MPAH 2QSVA 1T1YA 2NY0C 5FGBC 5L9DL 5DJAB 2G9HA 5EPMB 3TO4C 3TV3H 4AEIH 3LQZB 1BM3H 1UENA 4H1LG 5E7FA 1NUNB 1OTTD 1X5IA 4KK6C 1QHOA 4ERSH 4MJIA 3DURA 4F8QA 3P11L 1N0XH 1QSEA 4MJ5A 4WI2A 4Q2ZA 4LBEB 3RGHA 5AWNH 1IC7H 1RVFH 1FIGH 2D7MA 3AAZA 3KNBB 5L2JB 4G7YL 4K2UL 5DURD 4JRXB 1MJ7L 2FBJH 5TDOA 1VFOA 3TPUA 1MREH 2WUBH 4I0PB 4OLUL 1OTSD 1NC2A 2DL9A 2HVKB 1J0IA 4P23A 5T3ZH 4PJBA 5JIIA 4OZHB 5D6DA 1T5WB 4MLIA 5IB5A 4JO4H 5E2VH 4BUGA 4U3HA 3AS3A 5FB8A 4CN1A 4Y4KD 2AJYL 2D4DA 3CFDB 4Q9RL 1FV1B 3I50H 2JELL 2IF7A 5I2IA 2X4OB 5D2NC 2EEAA 1MFCL 3K3QA 3PNWA 5BVJA 4UV4L 3Q2CA 4X6CB 4E0RB 5IB1B 4IM8A 5L0QC 2XWBB 5DJYB 3BHBA 4LCUA 3OKEB 4YXKH 3F62A 3T0EE 3PWPE 1M05B 1BPVA 3T4YB 2DQUH 4JDVA 4K7FA 3TT3H 3P4OB 2UUDH 2VL5B 2V2TB 5KSAC 1G7PB 3FCTB 3VXPA 5SX5H 1I4FA 3NFPA 1YEHL 4OLVL 5GS0D 3MLTA 4P3DA 3VXUA 1XH3A 1MFNA 3GIVB 2ZCKH 3D39E 4NIKB 5JPMB 4NKDB 4ONHA 4GS7B 2P8LB 1FPTH 4LIQE 5DUBA 4GRWE 4QHMB 4XVTH 2PXYD 3QEQE 3MLWH 1TCRA 5F7FA 3BZDA 3V7AG 1UCTA 4ZSOE 3INUH 1Q9KB 5EZIL 1OGTA 2DQJL 5EPMA 5I15H 3O41B 5E6IA 1YZZA 3LQZA 3EZ8A 1G6RH 1TIUA 1P7KB 3MV9B 3VXRE 4OCLC 1NGPH 5JA8B 3MJ9A 1GH7A 4Y5VC 3H9HB 4IMLB 4PREA 4Z0XA 2UYLB 4CJ1A 2DTSA 5L2JA 5ISZA 3PL6C 1IGFH 3F8UB 4JRXA 4QRPD 2I5YL 2Z8SA 1RUQH 1G0DA 5EIIB 4LMQI 1A0QH 3T2NH 3U2SB 1CR9L 4I0PA 2MJWA 2HVKA 1NCDL 2H2PC 5FO9B 5FECB 4OZHA 5J89A 1CBVL 3I6LD 4P2QE 4UIMB 5T1KB 3LPWA 4EVNB 1M71A 4OQTL 3O6LH 3CFDA 4P57B 2X4OA 3GHBL 2ZKHH 5DR5L 3UTZA 3HMXH 3O3UN 5T1MA 3BN3B 1WBZB 1T21B 3RIFK 1B4RA 4E0RA 2IAMD 2XWBA 1CT8B 3OKEA 5DGRA 3SCMA 1MY7A 5BZWB 3KWWB 1WEJH 2O61A 5MI0C 3BPCA 2LVCA 1ACYH 2OL3H 4IOFC 3QHFH 3QA3B 3WHE1 2NY0D 4AEFA 3FCTA 3T0VA 4ZO9A 1U91B 2OQJB 4Y1AB 5I30H 3CXHK 3TO4D 1YEIL 1CTOA 1U8PA 3QCVH 4KTEH 1P9MC 5DT1L 4DQOH 5JPMA 5HVHC 2P8LA 4KK6D 5IGXL 1CWVA 2EYSA 1RUAH 5HBBA 5JMOC 4CGTA 3W11C 4KUZH 1SEBA 3VFSB 3S6CA 3LKNA 1NGXB 4FFYH 3PV7A 4BH8B 3K8KA 2EDXA 4CVXA 3ES6B 4QGYA 4BSJA 3OR6A 3BH9B 4Z7WA 3VGAC 2JB5L 5GGTH 3TJEL 3HA0A 4HPYH 1BGXH 3DRTB 3O3BB 3IFLL 3FQUB 3DVFA 4XPHH 4XWOC 5F7EH 4ESKA 5KS9F 1DBML 1AFVH 3H9HA 2DICA 1UWEL 2VZTA 5DD1H 4FHBD 2UYLA 2WW8A 2ICWI 3BKML 2FLBT 1EUTA 4XP5H 3LH2H 3LKSA 2DM2A 3EHBC 4JRYA 1H15A 5EIIA 5JOPD 4J1UB 4V2BA 2HKFH 5E8NB 3MV01 3U2SA 1INEH 1HXYB 3QJHB 3GSRB 5IFJB 5FO9A 2VDQL 1P4BL 3S88L 3O3DB 4G9DB 1N5AA 4XBGB 1FE8H 1M4KA 5IHZA 2AV1B 3L6FB 1QG3A 1YEKL 3DYPA 3IJHA 2ZP0T 3E2HC 5FHAH 3MYZA 4P57A 1KB5L 4JFDB 5DD3L 4CKVX 3RL2B 1RI8A 3ULUE 3MX0A 4GBXC 5C6WH 3B6SB 1A7OL 4AENB 1WBZA 1F13A 3EO9L 4EQ3A 3HI5L 4XNUH 1S8DB 4DKEH 4LPWA 1RK1A 1O7SA 4BELD 4OFIA 5BZWA 2XPGB 2R0ZH 1NBVH 3MOBL 1A8JH 1JF6A 3WHXB 3QDJB 3B5TA 3BRGC 3TA3A 4S0TD 4Y1AA 4DN3H 2Z91B 5FYJD 1J1XL 5I1IL 4PRPD 5D7SH 4JQIL 5ENWB 5IJKA 2DLIA 1KIRB 4X7TA 4U6VH 4MD0A 3UBXA 1OAXL 3REWB 1NCTA 3N1PC 1EO8H 5HGDB 1U95B 2CPCA 3ARGB 4BFIB 5IJVB 3GK8H 3VFSA 2GY7B 1U92A 3WFCL 2XG4A 3HLAB 3PL6D 3SGEI 3OKOA 5JHDD 3LQAL 4F58H 3VH8G 4LARL 4DGIH 4IOIB 2I27N 4UI2A 4H20H 4GKNB 2VITB 3OAUH 1TVBB 1BQHB 5DJDA 1HHIA 5I75C 4KKBC 4WFED 1L7TL 3KS0J 4JZNB 3SQOL 1N7ML 3BKCL 4IIQA 5KOVC 3U30B 3S7GA 1MCCA 4BSWA 4OI9A 4ODWA 2VDRL 3LPFA 3STZB 3ULVC 1RMFL 2YEZB 1XF3B 4M7LH 4J1UA 5E5MA 1MUJB 4OM0H 1HXYA 1QO3B 2H45A 2YZ8A 2Q76A 1A6WL 2FZ3B 5CIPA 2PYFB 5F96H 4NNYB 5TDNA 5EO9B 4HGMA 3O3DA 4RGNC 4U7KA 4G9DA 4IOFD 5F1NB 4KI5C 3L6FA 1FNFA 4JFDA 5I71C 3GMPB 1K8IA 5HYJB 2OP4L 1MI5B 5IKCB 2R9HC 2YBRA 4PJ7F 3WNMA 1P4IL 3NA9L 4YUEL 3QCUL 3NBNA 2YUXA 8CGTA 2IG2H 2OM5A 1BZ7B 3NN8B 2IANB 1F58H 4OFPA 1U3HA 4ZAKA 3T0XA 3W11D 4MD5B 5HPMA 4GMSL 4PGCB 3QNXB 1D5IL 1JWUA 1R3HB 3G5ZB 5GRWA 4ZG1A 2ED7A 1IAOB 1OARH 1WF5A 1KCVH 4YFLF 3M8OH 1DL7H 4H8WC 4KKLC 5GRJL 4NNXB 2XA8L 1RURL 5C7XL 5IROA 5DO2C 4D2NA 1FCGA 5EN2B 3SOBL 1D5ZB 1OLZA 4FTVB 5TDPA 3C9NA 4UU9B 1I85C 5HGDA 2VLJD 1ORSB 2LVEA 1U95A 2ZNWA 3ARGA 3GI8H 1C12B 4N68A 4PJGB 4BFIA 5IJVA 3MLPA 1NCWL 1WIOA 1DBJL 2UZYB 2PNDA 1R0AL 2PR4L 1H3XA 3EHBD 3G6JF 3MRGA 4IOIA 3ZL4H 4WIQA 5EU3B 1MAJA 4Q6YA 1LEIA 1ADQA 4P5KA 3TIDA 2AEQH 5KVMC 1MFEH 3C87A 1BQHA 3OKMB 4P3CL 1J86A 2EE9A 2J1KA 2Y6SC 3BPOC 4LEOB 4OCXH 4NM4H 4H0HB 3O9WC 1SEQL 3HMWH 1HYRC 3BJ91 1NL0H 3ZDZF 4NZJA 1JZ3A 1ZHKB 4GBXD 4OQ1A 3STZA 4Q97A 2YEZA 5FHBH 3BPNC 1C5DB 1QEWA 4KKNA 5DDHA 1XF3A 1TJHL 2J4WL 3HUJF 1IAIH 4P5TA 2XG5A 3KVQA 3ULVF 4ZXBB 1QO3A 4GMTL 3F7PC 5GS2D 3V5DB 1NJ9B 4NRZA 2PYFA 4NNYA 1BREA 3MRBB 5EO9A 4OZFA 3FOLA 4PRDB 1CLYH 3QUMA 4X6DF 3W2DL 2OYPA 5J06A 4Y16B 1N59B 5CJQH 3NCEB 3FONA 1WCBB 3AMLA 4MHHG 2G75B 4HT1L 3ARZA 4WHTB 4JM2A 1OAYL 5HYJA 1G9ML 1MI5A 3LVEA 4KI5F 4MQSB 4Y5YA 4Z9KB 1QBLH 1IGIL 2ENSA 3BD5A 4OSUL 2GK0B 2LFGA 2VYRE 5K9JL 2GKIA 1U2CA 4PJ9C 3DYOA 5I1DB 1H3UA 5E8PB 3KPSB 5B38G 2H8PB 3NN8A 4Y4HC 3TIEB 2GY5A 4HH8A 5GJSH 1IGYA 4MD5A 4X9FA 3ZKXC 4XCFH 4PGCA 5C0BB 2OMNA 1S7VB 3I85A 4APQD 2BXZA 3G5ZA 2IPKA 5ANMB 1XR9A 1OGAD 1AGBA 1IAOA 3AC0A 4HH9B 5CINL 4JFHD 5JXEC 4ELKB 5J1AB 3GGWB 3HN3A 3RU8L 2R56H 2JJSC 1VDGA 4FZ8H 5LCVH 5EN2A 4KZEH 4PD4J 4LIQH 4KKBD 4GRWH 1N8ZA 5FGRA 1MIEH 4PG9B 4OI8A 3EFFB 3CSGA 3WXWL 1MJUH 2A77L 4ONGL 1C12A 3C6SB 4M7KH 2W0KA 4K71B 5GGRB 1CDYA 3U9PH 4QOKB 3ESVF 1S7UB 3GSUB 5J12B 2EKJA 4UV7H 3WDHA 3ULVD 4TOYL 4X7CC 3RZCC 2JJVA 4JKLA 1KPVB 2Y23A 3OKMA 3SO3B 5D96B 4Z5RA 1F8TL 2BSRA 5B3JE 4KI5D 4HC1A 3OR7A 1I8LA 2AJVL 1IFHL 5C0AA 1QR4A 4W4OC 2R9HD 3BP5B 4LGRB 5C0CB 1C5DA 2VXUH 1NGZB 4XBPB 2R2EB 4JB9H 4ZFOL 1EPFA 5AAWA 1XIWB 3V5DA 4RIRB 2MQ3A 3Q1SH 2PYEB 3MRBA 5ESVB 1OAQH 3RWFB 3L1OH 4OZIF 3WO4B 4Y16A 5J6GA 5M7QA 1AE6L 2GSIB 1RZFL 4QRRA 3UC0H 1J0YA 1WCBA 3GKWH 1MFDL 3FN3A 3VRLF 1RZKC 2X1XR 1IGML 5EORH 1W72H 2F19H 4NOFA 3MLYH 1KSRA 1JNLL 4PLJC 1K4DB 5ELIA 2NW3B 4O02H 2X09A 5DO2D 2GK0A 5EU6E 1T0PB 5I1DA 5H2BB 2H8PA 5C70A 4YHYC 1HSBB 2XQBH 4JFED 4AEEA 1NBQA 1BFSA 4DWHA 2XV6B 3FQTB 4P2RD 4UOW1 5C0BA 1FNHA 4M93C 4NN7B 2F53E 1KCUL 4KVNL 1S7VA 4R6UA 4PGEB 3SE4A 5TPWL 5JOPE 4M7ZB 4HH9A 4ZPVB 2VZ1A 2ATPB 3GGWA 4LCWA 4P49A 1RUKH 1IBGH 3LIZH 2P5EA 3OKKB 1JHLH 3V6OE 3V52H 3H7LA 1YEEH 1UACL 3CSPA 3EFFA 4PG9A 1U2HA 5K59E 3LKOB 3KHOA 1DLHA 3C6SA 3BGMB 5HGBA 2QBWA 6CGTA 3O9WD 4PRAA 5GJTH 2EO1A 1P5UA 1OAZL 3RIFF 1QNZH 5KSBB 3OKDB 2EECA 4OZGF 4ZDHB 1NEZG 1GGTA 4G5ZH 5DJ6A 5F7UA 2JJWA 2VE6B 1FFQA 1MHCA 5I8OH 1I1YB 4KHTH 2X9XA 2BNQE 5AZEH 3K2UH 5C0EA 1AJ7L 3FAWA 4TTGA 3ROLB 3T2OA 2VLMD 3LKRA 3MRCB 1D6VL 3CFKB 1T1XB 2XICA 2VLKA 3GBLA 3QG6B 1MWAL 2GTWB 5I1LA 3BZFB 3TBSB 1XF1A 3BP5A 3HZYB 5E5RB 4YEFA 1C8PA 3RWEB 1NGZA 3CDFA 4F3FA 5FUCC 2HG5A 1XIWA 1TQBB 4PJ9D 4MQ7B 4G8IA 5GS1B 3C8HA 1ZA6B 2AJSL 3NIDF 5ESVA 2X89D 4XXCC 5I74B 4QHLA 2YS4A 4KHXL 5EZOH 3A6BH 5C1MB 2GSIA 4PRNB 3ARBC 4MJ4A 5C9JA 3U46B 4EJ1C 3ULUH 2Z31B 1HKLL 5JXED 1A7PH 1YN6B 2XZQH 2BDNH 5SWZB 1IGJB 3WSQL 2QLVB 4EN3C 3ARXA 2BHZA 4A6YA 1EFXD 3PV6A 5H2BA 1PQZA 1HSBA 2IFFH 3RIAK 3HRZB 3FQTA 4KV5F 2ADFL 5JW3H 3IB4A 3NCFB 2W91A 5C0JB 3MRHA 2CKNA 1S3KL 12E8L 5D7IE 3UMTA 2BNRE 2P48B 4RAVA 4ZPVA 4UUJB 1FGVL 2CLZB 4FMKA 2XWTB 1UM4H 1JGVL 3JWOL 3RZCD 1JPTH 2ATPA 5IVXE 3B9KA 4EI5B 4U1IB 4JZJB 3O3AB 2VXVL 2X5PA 3AS1A 4WEUD 3OKKA 4MX7B 1UA6L 4NQSA 4LF3B 4DVRH 3JV5A 2EE3A 5C09E 4H88L 2E9IA 3LKOA 2PCPB 4M1DL 2OJZH 4ONFL 2DQEH 3PWPB 3DMMC 4NPYB 2VQUA 5GZNC 4LQFH 3HZVB 3FQRB 1BHGA 2P5WD 3HE6A 1KEGL 3EOTL 4JREC 1DQMH 5KSBA 4LRNL 3P4NB 1NFIB 3QEHB 3OKDA 4ZDHA 1CK0L 3EYQC 3TM6A 5INCB 1KJ3H 4XPTL 3SPVB 3O2DH 4N8CH 3TFKC 2WBJB 1I1YA 2E9WA 1S9VA 2XRAL 1CIDA 5I73C 1KLGA 3BEWB 3RDTB 1G7IB 4EUPG 4RGMB 2IPUG 4GRWB 4HGKC 5L2KB 5D1ZB 5EO0A 1T1XA 4P5MB 5JXAL 3QG6A 4XPFL 3QJFA 3EYUH 4ZSOB 4PLJD 5SV3A 3L5WA 4ENEC 3D2UA 1CXHA 2VDPH 4KY1H 4N0FB 2SEBA 2VLJE 4U3XA 2B1AL 5GS1A 5TQ0L 5J1SC 4HUKB 4ZPTB 4JEGB 5CGYC 3L7FB 3VXRB 3ZTJH 2HJFB 1MPAL 4MAUL 4UNUA 4NWTH 3C5SA 35C8L 4CBPA 5CEYB 5D71L 4PJEE 4S2SA 2BVYA 3WNKA 2GUOA 4JFOB 5L88L 1DLFH 3BYYA 2Z31A 4XP9H 3LKQB 5T3XL 2OZ4A 1DN2A 4MD4B 1BBDH 3C60C 1IGJA 4RGOH 5SWZA 2ICEA 2IADB 1AI1L 5DQ9B 3NIGE 2L7JA 3QDMA 5E00A 5SX4H 5FA3A 4HKZA 1UFUA 1DVFC 4P4RB 5DUPL 5C0JA 3BP4B 5FFLA 3S37H 4F7PA 5BOZG 4P2QB 1J10A 4N5EC 3O4LD 1CXFA 4M02A 4UUJA 2XWTA 2F8OA 1EIBA 2BOCB 4EI5A 2DN7A 5J9PB 4U0RB 2MWCA 4U1IA 5TF0A 3WJLA 4LF3A 1U8QB 1OB1A 5AYUL 3VMOA 1A7QL 2C26A 2OR9H 4IS6A 4GXVH 1S9KC 3F58L 1EUUA 4XXDA 1EA9C 1F6FB 4YBLB 2F58L 2AEPL 2UWEB 4J6RH 3FFCD 1CGWA 5TF1H 3C2AL 3U83A 1DZBA 2WWKO 3MXWH 1MQKH 1NFDF 1ZWIB 3QG7L 5GGQL 1A9EB 4UAOC 5E99L 4PJCB 1REIA 1CS6A 3BEWA 3RDTA 3QDGD 1G7IA 2DWDB 4WUUD 1IAIM 3QRGH 4JHAL 1C5CH 3BEVB 1Q72L 3V0AC 5K9KB 5L2KA 5D1ZA 4TSBH 3MXVH 1GCFA 3ARBD 3GJFA 4KQ3L 1XGTA 4K9EL 3BJLA 5A2FA 4GLRH 3RKPA 4OIBA 1SMAA 3BQUC 3MO1B 2IQ9H 4N0FA 4EN3D 4PG2C 5IVOA 3WNLA 1JRHI 2EC9T 2DB8A 2VC2H 5EU4B 1GC1C 1U8KB 4YR6A 1T83C 2UY7A 5ESQB 1O5DT 3AS0A 4HCRA 5I16B 4LCCA 3RGVD 3P9WB 3OHXB 3T2QA 1ZOXA 3TBVB 3QIBB 3GBMH 4L8DB 5DD6B 1OSPL 1ZLUK 5E24E 3ZYZA 4OCWH 2ZSWB 1YNTB 3X3FL 2GIYA 2CR3A 5JDSA 4JN2A 4NHCH 4X99B 4BKLB 4HJGA 3CXDH 1T1WA 3I2CH 1ZT1B 2E6PA 5B39G 1AQDB 15C8H 4WWKC 1QYGH 1XMWA 3HNTH 1X5YA 4GAJH 4X8JA 4FS0A 3DMMD 4H0GA 3LHPL 5CEZL 1WSST 5GZND 2D7NA 5EWIL 3BP4A 3QEGL 3MA9H 4KAQH 4OCRL 4WU7B 4XNZC 4WW2B 3U82B 3QQ3B 3GRWA 5F9WC 1U8MA 5JW4N 2BOCA 4U6HB 1WC7A 1GL4B 5IM7A 5J9PA 2CGRL 2DYPD 4K7PH 1RZ7L 2ZCLH 4C4KT 4U1GC 2NY5L 2DMCA 2J5LB 4TUJB 2CK2A 4XVSL 5E2UH 1IKFL 3AMKA 1R6VA 1QFUL 3KPRE 2UWEA 1LQSR 2VNCA 4PY7A 4ENED 5C6PB 4QYOA 1A4KB 2BJMH 3HAEG 4S1SH 2EDFA 4JPVH 4FXGB 4YDLB 4K8RC 3O45A 4N9OB 4PJCA 4HG4J 1IZKA 5CGYD 2DWDA 3SJVB 3DSFH 3JVGC 4TTDD 4O9HL 4OCMC 5SWQB 5IW3A 3BEVA 3H9YA 2EDEA 3CXHJ 4PJXE 1A3RH 4YHIB 2E7MA 3DI2B 2D0HA 4G6KL 3VG9C 5E4EB 4DAGL 5CILL 2D7TH 3OB0K 1PG7H 3BD4A 4M6AA 5BCAA 5CJ8A 4X4MA 4KROB 2V7HB 1KN2H 4M5YL 3QFDB 1B6UA 4ISVA 5ESAA 3MLVH 1BOYA 5ESQA 4XC3L 1OD9A 4X7DC 1DVFD 5I16A 1JHKL 4LVOC 3DX7A 3SDDB 2VXTL 3CH1B 2WWMC 3FB8B 3OHXA 1Z0NA 3TBVA 2R0KH 3QIBA 1IM9A 3G5YB 4RMSA 1I1AD 4GAYA 3BO8B 1FC1A 2GW5A 4OD1L 4YDKH 1YNTA 2QADB 6FABH 2VRAA 3TC9A 2VH5L 3ARDB 3PGCB 1QRNA 1A14L 1FG9C 2DBLH 3DYMA 1PZUB 1ZT1A 1AQDA 1TITA 4FQIH 5DD0H 2ZCHH 1MCNA 4GG8B 3W81A 2BRQA 2MKLC 1ONQA 4M43H 3UBXI 4RNRB 4UB0H 2ZG1A 4HWNA 2DM3A 3QQ3A 2VZSA 4M00A 1FZMB 2EKSA 5EOCH 5HI4C 1AGEB 2A6DB 2OJEA 1IC5L 1HXMB 2G5RA 1WZ1H 3BDYH 4Q6IB 4PJAF 1I1FA 3MCKB 4EZMA 5E2WL 3STLB 2F74B 4TUJA 2OSLA 3DV6B 1RHFA 1HEZA 2OR8A 4OF0A 2NTFA 2BHUA 3V79C 4NC2B 1JF1A 2JF1A 5F7MC 2HTLC 4TPRL 4YPGB 4XCNB 5DURB 2Q86A 2QKIB 1P7QD 1A6PA 1A4KA 3BQUD 4U2YA 4WO4C 5FKAB 4LLQA 1RULL 4HF5L 1UEYA 5HHME 1F42A 3L7EB 3BDXA 3UTSA 3SJVA 1I1RA 3OPZL 1E6JH 1TVHA 2DQCH 5TE6H 5SWQA 4MXVF 5GISL 2VIRB 4O58L 1KCKA 4Y4KB 4YHIA 3U6RB 3NH7L 3GJEB 1XCQB 3MLZH 1MCWM 5D5MA 4HLJA 1J05B 2E9BA 4MYWB 3HC4H 4NQCE 2VN7A 4X7FC 3K0WA 1BZ9A 2AKRB 3QIWD 3QO0B 3QFDA 4WWKD 2AV7A 5AG8A 1C7TA 2HLAB 4MXWL 1EHLL 5ACMA 3QNYB 3SDDA 1FORH 3CH1A 3MJ6A 3FB8A 3V4PL 1NLDL 2AERT 1WZMA 4OGXH 2A73B 3G5YA 1MCFA 1B90A 4YZFE 2MCG1 4PJHA 1DP0A 3U0PB 5EU5B 3STBA 1BIHA 4RWYL 3GI9H 5IWLA 4I77H 4BZYA 3PGCA 2ORBH 4HKBA 4LPXA 5D4QA 3P0VL 3BAEH 5FEBA 3QFJD 2RIKA 3U1SL 3C8KB 5HXMA 4EDWH 2PXYB 5JUEH 1CLZL 3EDDA 3P4LA 4XVUC 2ESVA 4ORGB 5CZXC 4M5ZL 4IJ3C 2A6IA 3I9GL 4RNRA 5K9QI 4WI8A 1PLGL 1A2YB 4G3YH 1F4WL 5IB3A 1BX2B 3UJJH 5DUML 4BFGA 2P8PA 4ODHL 5HDBF 1AGEA 2A6DA 4MNGB 3HG1E 4K8RD 3T2PA 2Q3ZA 3NFNA 2R4SL 1CU4H 4C54A 2Y25A 3O3EA 2XZCL 4U1SA 4C55A 2EXYD 1DANT 4GAGH 5DJ2B 3DETC 4XNXH 1WQVT 5EIQA 5BZDB 2QKIA 3NAAH 4YXLL 3H42H 1EFQA 1QQDB 2XQYG 4EI6B 4KQ4L 2FDBP 4NQDD 3T1WA 4YX2L 4IOSD 4XCYB 5L7XH 4HWEL 2GAZB 5GGVL 4K94L 5ECJE 2IGFL 1HQRA 3L7EA 4ODSH 1K5NA 3VD3A 2B1HH 3E0GA 5CZKA 3M1BA 2WWMD 4Y4KA 2DQFA 2W92A 3GJEA 4S1QH 5EUOF 3DX8B 4M6OL 2FBOJ 4ETQB 5FYLE 4R26H 1J05A 3SGDH 3PQYD 4JQXA 3PE9A 4WJ5A 1XGUB 4DVBB 1AY1L 1CDGA 4HKXA 1ZTXL 5DTFB 5B8CC 2ZPKL 2MPAL 2NY6C 3SDCB 3QO0A 1SMOA 2HLAA 4HEME 3B4NA 5HJ3A 5IMMB 3NCJH 3CFIC 3TV3L 4AEIL 5DK3A 4BQ6A 1BM3L 2HFGH 2Q7NA 3WFHA 3SDXF 5IQ7H 1L7IH 2VLRD 4NFBA 3MUY1 1P7HL 5HI4D 4ERSL 4X83A 5I6XC 1EX0A 3DECA 4MQTB 2AQ2A 1KUMA 1N0XL 2CDFB 1IC7L 4XHJC 3RVUD 3AREC 3LDBB 1FIGL 3KYKH 5D93B 2DQGH 1YPZF 4JGJA 4X6BB 5FKPB 2PXYA 1MCBA 1INQA 2FBJL 1A2YA 1MREL 2HTLD 1S7QA 1JPSH 2J88H 2WUBL 1S9XB 3B8SA 4DEPC 3IRPX 3K1KC 5CGMA 5T3ZL 1Q1JH 4ZFGH 1CGSH 1BX2A 2DWEB 3MFFB 3OKLB 1WAAF 4WO4D 3VA6A 4O2EB 4JO4L 5E2VL 4MNGA 2Q87A 1BD2D 1M7IB 5EU6B 3VXNB 1U6AH 5A2KH 4LHUA 1LNUB 2NXZC 3HC0B 5HI3D 4YDJB 5DJ2A 1CICC 2Y5TB 3NGBB 4QRPA 4YXKL 3OB0H 4JFFE 4NHUA 2X4PA 3RA7H 3DLQR 4NQED 2DQUL 3TT3L 2MMXA 4L4TE 2GAZA 4TUOB 3G04B 3V2AR 4LMQE 3IXAA 5ALBH 5A3IC 3UPAA 4UT6H 1ULVA 5IESH 1AD9B 1Z2KA 1CL7I 2BSED 4NBZB 1BQSA 2XY2A 4K3EH 2LE9A 2ZCKL 4KZDH 4KUCD 2QEJA 1FPTL 4NN6B 4ETQA 3SKOA 3OZ9H 1XGUA 4DVBA 2IAMA 2VDKH 4XVTL 1VFAA 5DMIH 1UH3A 3D25A 3MLWL 1A02N 4Z78B 5I1HH 2E7CA 3NFSH 1HINH 5HYSB 3INUL 4GJTB 2BSSB 3RX7A 4NFDA 5J11B 1AQKH 3UTPD 5I15L 2V5YA 5IMMA 5DHVH 2BNQB 5CZXD 3VGEA 3BWAB 5FGBA 1V3KA 5EZLA 3H2WA 3F7QA 3G6AB 1G6RL 4N0RA 5DHYA 1PX3A 1U8NB 4WFGE 3TO4A 1CGTA 3TBWB 1CFNB 3FN9A 5FO7A 5JOFA 4HLZG 3QYCA 1OP3H 4PRPB 5EFIA 3VW3H 2CDFA 1OD7A 4WI7A 3WJJA 5D1QC 1IGFL 1R3JB 1RUQL 5AEAA 5I9QC 4YDIH 4LNVA 1A0QL 3T2NL 5J8OA 3PL6B 4LPUA 3CX5K 4FNLH 1S9XA 4CDGC 2X40A 4HS6B 1MRFH 2F5BH 2C4FT 3E3QE 1J88A 3PWNB 3MFFA 3MOQA 3VXME 2WM0A 4O2EA 5KSUB 4ALAH 3O6LL 4PJDE 4X9BA 1M7IA 3WNNA 1CLOH 3LSOB 2ZKHL 3M17A 1ZHLB 3HMXL 1LNUA 1MLBB 4NC1C 4X9IA 5D2NA 2VUOA 4HS3B 2PETA 5EUKA 3OL2A 4ODTH 4D0BA 1D9KD 1DUZB 1T7WA 5DLMH 1WEJL 5CD3A 2VJXA 4ZOEA 1ACYL 5IVNA 1LO4H 3JZ7A 2OL3L 3QHFL 4WEBH 3MGAA 3G04A 2NY6D 5IVXB 1ZGLB 4Z7NF 5I30L 1AD9A 2B0SH 3QCVL 3W39B 4KTEL 2EEDA 3UPRB 4ODBD 4DQOL 3CC5A 3R8BB 5DMGC 2KDGA 3IAPA 4G8GD 3EDKA 5E2JA 5FYKD 4P99A 1RUAL 3ARFB 2IQAB 2ARJQ 4LOUC 4KUZL 5GRVK 1FFPA 4Z78A 2MSPA 3ARED 1Z3GH 3G08B 3D5OF 3EGSB 5A2LH 2MOVA 1BFVH 3UTTD 2I9TB 4H5SB 2BSSA 2FCBA 4FFYL 2BFVH 4TN9A 2H3NB 4HUWA 2PKDA 5CCKH 2EDJA 3BWAA 3BMVA 3O6FC 4FXKB 4B5EA 4LVNB 4YWGH 5FYJU 5GGTL 3LCYA 4IRSC 4HPYL 1BGXL 3CU7A 3KLAB 1G7JA 4XPHL 1WTGT 5F7EL 2ADJB 4Z7OF 1AFVL 5KS9A 3CFEB 3DVGB 4PRPA 2NMSA 1I7ZB 1R3LB 1BOGB 4PLNC 5DD1L 4KJWC 4OLWH 4TQEH 4MAYC 1RZJH 5KOMC 4Y5VA 2VLJB 4P4KC 1RK0A 4GT7A 3LH2L 4XP5L 1F97A 1R3JA 2M1KA 1G1YA 1QVOA 1JUFB 2NXZD 1NGYA 2HKFL 1CICD 4MCYB 5C92A 1INEL 1G6VK 3PL6A 1Y18B 4JO1H 4HS6A 5BQ7B 5JHDA 4LLDA 4PJEB 2ADGA 9CGTA 3EYVB 1SBBA 1H3WM 1QSVA 3PWNA 4CADA 1FE8L 5C0FB 4V1DD 5FHAL 5A3ID 1F11B 1NANI 3LSOA 3MNWB 5C08A 1ZHLA 3LV3B 3PWLB 3FHAA 1MLBA 3IU3B 4QCIB 3S98A 4XNUL 1FNAA 1U3ZA 4DKEL 3CDGB 1KACB 4HS3A 1JZ7A 2DQTH 3WS3B 1RJZB 5C0IB 1A6ZA 2R0ZL 5KANI 1NBVL 3VDBA 1TFHA 4DZBA 4N5UA 3PHOA 1J0HA 1ZGLA 4PYGA 4XNYH 1PAMA 2FD6H 5D7LE 4DN3L 1A1NB 3VMNA 5D7SL 2F8XC 4JPWH 3VRJA 1VKXA 4U6VL 3DPBA 3CDCA 2Q7YB 2GI7A 1FCCA 2NZ9C 3BDBA 1EO8L 1P9MA 1S9YA 4I18C 2IQAA 1I7UB 4PJIF 2LU3A 4G42B 3X11A 1YN7B 1ERNA 3GK8L 4L3EE 3Q0HA 4MJID 5DEZA 4NFCA 4H5SA 5D1QD 4F58L 4DGIL 5B4MC 3QUKA 3G6JB 4H20L 4APQB 2GT9B 2X10A 2VB5A 5DJ8A 3TGXA 4HJJH 1OGAB 3OAUL 5LAXB 3VI3F 4L4VE 3WXVH 4P2OC 3RVTC 4QNPE 2A6JB 1R3LA 1BOGA 2V9RA 1FNGA 1BWMA 3VFRB 3GIZH 2E3VA 4OCSH 2VLJA 5CSGA 1JUFA 2BSTA 4M7LL 1WGOA 1QUNA 4URTB 3PQYE 2WMPA 3N9GH 4MCYA 4OM0L 2AEIT 5BQ7A 1KJ2A 3L5HA 1BJ1H 4PJEA 1S7TB 3MLXH 4OCYH 5F96L 3T0BA 1YEFH 2PTTA 5CUSL 1HHGB 5ICZB 2B2XH 4UINH 5C9KA 1PYWA 3IF1B 4I0KA 4G9FE 4JG1H 4GXUM 3QQ9C 2CLRA 3D85D 3MNWA 5CWSA 3QH3B 3LV3A 3PWLA 2IEPA 1O0VA 3C5JB 4PJ7A 4HX1B 3IU3A 2WP3O 1OW0C 3AB0C 5DMGD 1KF9B 4B41A 4GBXA 1M7DB 2IG2L 2XT1B 1RJZA 2VABB 3VXUD 5C0IA 2VXSH 5T5NG 1F58L 3P40A 4YHMH 3VD9A 4LOUD 5IT2H 2GQHA 3TPKA 3IS0X 5KVFH 1C08B 5M94B 1EO7A 3L5IA 4R97C 4XT1C 2HJKB 4ZUSB 1OARL 1KCVL 3M8OL 1F3DJ 1DL7L 4IRSD 3UJIH 3UEZA 3T65B 5FYLH 5K33A 1QBBA 1TMCB 4MB5A 1J87A 3KPRB 3SKJH 1YN7A 3GI8L 1PY4A 1S7SB 2XQYK 4LPCA 4NUGH 3WIFB 4KJWD 5FO8B 2FECL 2DS4A 4MAYD 2NXYB 4P4KD 4JFEB 2J8UF 3U4AA 2FR4B 3ZL4L 3G6JA 4APQA 1CXIA 2GT9A 4AH2B 2AEQL 1MFEL 1OGAA 5LAXA 3REVB 2FL5B 4PJXB 1FLRH 3EYOB 2BNUB 4C57C 2YPVH 5HDLA 2CDEB 5JW5B 1XT5A 1VGEL 4NO5A 4OCXL 4NM4L 3EO1A 3RJDA 3HMWL 1NL0L 3F12A 3V9FA 3OSKA 1GGCH 3VDAA 4YHLH 5FHBL 1DBMH 2JJTC 3O9WB 1IAIL 4XBEH 3P73B 3U4EB 1FN4B 2XACC 1S7TA 5C8JA 2YD4A 3TNMB 3VFGH 3IF1A 1CLYL 2F54E 4GXUN 2AJ3B 4KJPC 5CJQL 4X6DA 4X5WB 1E4XI 4JR9H 4XP6H 5SV4A 3QH3A 4WW1B 4XNQB 3HRPA 1QBLL 2OCFD 4HIHB 4HX1A 4J2XA 4QF1B 1HHHB 2DF3A 1PKQA 4X7SH 2NZ9D 3WIIH 2VABA 2DLFH 1T3FB 4N0UE 5GJSL 4XCFL 4XGZB 1W0WA 4PJ9B 3ZDXE 3W0WE 1CI5A 4NRXB 2AJXH 2YPLD 3FN0H 4KJYA 4AQOA 4QRSB 3ZKXB 5CS7A 5E8EB 5EZJA 5DK2B 2R56L 3H9SD 4LLWB 2HFEA 3CUPB 3MROB 4M61B 1NCBH 4FZ8L 5LCVL 1KPRA 3E1F1 4Y89A 4KZEL 4LIQL 3SGKC 4P2OD 1MIEL 3RVTD 1MJUL 1MCOH 4JFXB 4M7KL 2X4SB 2V2XA 1GOHA 2CRMA 3QWOA 2P45B 3U9PL 1I85A 4FN0A 4WHYH 4JFEA 4UV7L 4PBXA 3F6IA 4P2RA 5SWSD 4EDXB 1BF2A 5D2LE 1BVLB 4YXHL 2F8VA 1NMCC 3REVA 2FL5A 5E8OB 3TBYB 3ECBB 3I75B 4MDJA 1E0OB 4L1DA 5JW5A 3LN5B 4RFNC 3KPOB 5F7NC 3QQ9D 1FYTE 4YEEA 2HT2C 3VXSE 1UZ6E 2HTKC 1JTPA 1MVUB 3O9WA 3V6ZB 4G8GE 4X6EB 4GUPB 2VXUL 3BKCH 4HWBL 1XR8A 4JB9L 2P5WB 3P73A 3THMH 2I60H 1J5OH 3U4EA 1FN4A 1XF5B 3Q1SL 5ICYB 5I66A 1OAQL 2G5BB 1RMFH 1X5ZA 2C7UB 3L1OL 1I9EA 4NYLB 5CEXA 3SKNB 4RFOH 5I8KH 3UC0L 5KTEH 4OZIA 3GSWB 3GKWL 3TT1H 1FVEB 1QFOA 4YK4B 5EORL 3VXTB 5I8CB 1W72L 2F19L 3MLYL 5DEFA 4XNQA 1JMXA 4HIHA 2JKXA 1QRKA 3SO5A 4O02L 2ICES 4CUCA 3KYNA 4WDIB 1NGWB 2XQBL 1T3FA 3KPPB 1X5XA 3IDIB 4PJ9A 2J2ZA 3IDUA 1KJMA 4WI4A 2HA1A 4J7RA 4PJ5D 4QRSA 2X89A 3QI9C 3S4SG 3JTTA 4OI7A 5E8EA 1S9WB 4WCYH 1IEHA 1WZLA 4KKCC 3A67H 1JTOA 3FL7A 1DN0A 4Z7VE 3LQAC 3CUPA 3MROA 1IBGL 2ZUUA 4M61A 3AM8C 3LIZL 3TO2A 4POZC 2C9AA 1JHLL 5DEGA 3ZKND 5JXEA 4KVCH 4S1DC 3V52L 3KPTA 1YEEL 4XAKE 3ZE0F 2JJSA 5LKNA 4JFXA 3F7VA 1G9NH 1HKFA 2HT3C 1EFXA 5INDB 1FZJA 2Z93B 3TF7C 5GJTL 2NCMA 5F7LB 5ACZB 2V9TA 1QNZL 3A6OA 4BM7A 3BT2H 4EDXA 4RMQA 3MJGX 1UCBH 4G5ZL 4OZGA 3UX9B 2VDMH 3BH8B 3MPCA 3NPZB 1KYOJ 5I8OL 2F9BT 4KHTL 3RZCA 1R0AH 1B0WA 5AZEL 4JKPH 3AY4C 3K2UL 3P0GB 2JLLA 3AUVA 2CKBH 3VFOB 3TNNA 4KJPD 4NBXB 1LP9F 2AJUH 1I3VA 4HIIA 1U8OA 5JA9A 4F33B 1MY5A 4PFEA 1KIQB 4JFZH 3ARWA 4GUPA 1E28B 3QCTH 1JYWA 2Z4QB 3HNSH 2P5WA 4HV8B 4W4OA 5DK0A 5DSCB 1KCRH 4WFHD 4HS8H 3SGEH 1XF5A 4NSKA 4MJIE 1URLA 2EH8H 2WQRA 4NYLA 2C7UA 2CD0A 1QSEE 4HQQH 5EZOL 3LEXB 2PTVA 3A6BL 4IHOA 3SKNA 3GSWA 4J8RB 5HHVH 2FX7H 2COQA 3QDGB 1RHHA 1BEYH 3C5ZD 3ULUL 2GSGB 4WUUB 3VXTA 1A7PL 2BMKB 2XZQL 2BDNL 1YDPB 2AJZB 3ARBB 5E1AB 1H5BB 4HAFA 4NM8H 4Y7MA 1IL1B 4LDEB 3DUUB 2WUCH 3OG6B 1F4YH 3FJTA 4PJBE 4PRID 4WDIA 1QD0A 4QKXB 2IFFL 4PJFF 4PP2A 3KPLA 3IDIA 2GJZB 5JW3L 3MUJA 1SJHB 2BP3A 4AIZA 1U93A 3QUYB 5E6ZA 1S9WA 3RGVB 1UM4L 4MB3A 5GRUH 1JPTL 4GQ9H 4LSRH 4QHUA 3IFNH 2R69H 3LS4H 2VQTA 3N85H 5HHQB 4F7EA 3LS5H 1UEMA 4DVRL 1EH9A 3NACH 4FQXB 5ALCH 1U8LB 3ZYJA 3FQNA 1Q9LB 2DQEL 2D0FA 1GPOH 5EULV 4NQTA 1EJOH 4PV8A 3GBNH 2NQCA 1DQML 5F89B 1T89C 3DMMB 2EDTA 1UJ3B 4BFEA 4L9DA 1R24A 3VXUE 1KJ3L 5F6HJ 2XWJB 4N8CL 3O4LA 4XC1H 1Q0XH 1ZT4B 2GJJA 2PN5A 2VUYA 2YA0A 4J3TA 3AFLA 2NY7H 3N1QC 1JGLH 5FDYA 4MB4A 4FFVC 2WQ8A 4QRUA 5I73B 3DWTA 5E94A 5C71A 3FT2B 4F33A 1CZ8H 5DD5H 1ETZB 1HCFX 1TTFA 4ELME 3EYUL 1D5MB 1KIQA 2VDPL 3GMRA 1E28A 1G9MC 5I1AB 4KY1L 2FB4H 3LEYH 2NY2C 5DSCA 3QPXH 3HZKA 3FFCA 1TZIB 2A9ML 5FGSA 4Y2DB 4L9LC 1NUFA 2X4RB 4NWTL 1EEZA 2XNAB 3LEXA 1R5VA 1BFTA 3TZVC 1Q38A 1B0GB 4Q9BA 4J8RA 1KNOB 1A1MA 1OF2A 3QDGA 3QI9D 4NOBA 4O2CB 5ID1A 5ISZE 1DLFL 2GSGA 4WUUA 4JRXE 4XP9L 3EOBA 2FJGB 4X4XB 4ZYKB 1U8HA 4OKVA 1J9CT 4KKCD 4Y19D 4TNVF 2BMKA 4ZOCA 1BBDL 2KUTA 3D6GA 5KVGH 4RGOL 3ARBA 4UDUB 5E1AA 1YMMD 4I9WE 4POZD 1IL1A 4XPBH 1FAIH 1DQJB 4S1DD 5HGHB 4XCCH 4KTDH 4OZHE 4XAWH 1Z9LA 5IHUH 4UT7H 3WYRA 3MJ8B 4EN3A 5GGUB 2YD6A 1M1SA 2HT3D 3VXMB 4XH2B 4OV5B 1SJHA 4ZTPH 3S37L 1A7NH 1KFAH 3P30L 1PBYA 1FFRA 1A7BA 4D9QE 2AABH 3GMNA 1FO0B 3MCLH 4PJDB 4I5BB 2E6QA 3HC3H 2A38A 3RY4A 3GSNB 4JAMA 3IDYC 3KHQA 2X1WL 4GKZB 1MF2H 3IDMB 5HHQA 1N6UA 2FHFA 1I1AB 4H1LB 5MHSD 1HNFA 3RL1B 2ICWB 1WK0A 3ARRA 1Q9LA 2OR9L 5BV7H 5KG9B 1SY6H 4GXVL 2MQCA 1JPGA 3EIFA 2ZOKB 5F89A 2NYYC 1ZV5A 3DMMA 4J6RL 1W0YT 4YGAB 4JVWA 5HI5C 4Y5XC 3JV0A 5TF1L 3ZO0A 1QTYT 5C0AD 5ADPH 2XWJA 43CAA 3MXWL 1QHPA 1MQKL 2FATH 3Q6FB 1ZT4A 1NFDA 2JE8A 4CMMB 2HT4C 3C6LC 3D87B 1I7TA 3AU1B 2BCKB 5DFVC 2DYPA 4BSVB 4LGSB 4W6YB 3CGTA 5DWUH 3QRGL 2R29H 1C5CL 3GSQB 4LLMA 3VWKB 1MRDH 3BXNA 4TSBL 3MXVL 3Q6GH 4KMTL 3FT2A 3UZQA 1ETZA 5L6YH 1HHJB 1P53A 4OF5A 4DN4H 1P84K 1ES0B 3IETB 4Z7WE 2X7LB 2ERJC 5I1AA 2IQ9L 1GZQB 1QKZH 3BGFB 1CVSC 2VC2L 1P7QB 1L0YA 1JHTA 1TZIA 3BQUB 4XX1G 5IOPB 3HS0B 2X4RA 1A6AA 3MODH 4EIGB 1Z5LA 5TH2A 3U4BH 1HWGB 5D7JB 3GBML 2FJGA 1JNNH 5EBLB 4JRYE 1A1OA 4OCWL 1N4XH 1YEJL 3WFDL 4UDUA 4NHCL 1I8IB 3QULA 4MNHB 1AXSB 3CXDL 3OGCB 1DQJA 3I2CL 2QR0B 1FNEA 5HHNB 2P24B 1Q8MA 15C8L 4QTIH 1QYGL 5HHOA 3HNTL 1EK3A 3MJ8A 4IRJB 4GAJL 5GGUA 2FIKB 3VWJC 4HHAB 3X14B 5CZVH 3QO1B 4EQ2A 3QIWB 3QQ4B 3MA9L 3RVVC 4WWKB 4KAQL 4R90H 5DRNB 4FRWA 1DVFA 2PW2A 4Z76B 3Q3GB 1FO0A 4I5BA 4JY4A 3GSNA 4YDVB 3KJ6H 1N6VA 4GKZA 3IDMA 1LWRA 3O2DA 4K7PL 1I1AA 3L3OA 2ZCLL 4H1LA 5IB4B 4FQCH 5DC0A 3QEUB 2W59A 2KQNA 4HZLB 3ZE1F 4U4BA 5E2UL 4FFVD 3TH4T 2DLTA 4RBPK 3VI4F 3ZT6A 5KG9A 3FO9B 3HCVB 4G7VH 2J6EA 2ZOKA 1QA9B 3CVHH 2VLKD 3JWNC 2BJML 5IF0B 3RVXD 2V7NB 4WV1C 3FB7B 4R3SB 4S1SL 4LGPB 5K9OB 4JPVL 2NY2D 3SBWC 3Q6FA 3S37X 4F9LA 3DARA 2AVGA 1U41A 4MZ3A 5JTWA 3FRUA 3DSFL 3AU1A 2BCKA 3T4AA 4J3VA 3GSQA 3HE7C 1CGVA 3TZVD 4U7MA 1A3RL 2IH3B 1QZ1A 3U9UB 3GSVB 2D3VA 1AKJA 7FABH 2FX8H 2D7TL 1FL5B 2D03H 1ES0A 3IETA 1PG7L 5HVGB 4D0DA 1GZQA 3VRIB 1M6OB 4G43A 3HPLB 1P7QA 4LLYB 4GH7B 1AP2A 1JK8A 1PY9A 1KN2L 3BQUA 2ARJB 2GJ6A 4DKAA 3MLVL 4NQDB 4HD9A 3HS0A 4L4VB 4PG2A 3WKMH 1JZ4A 5D70H 5ERWB 2I24N 2X42A 2K7QA 1CE6B 1T83A 2CUIA 2R0KL 3TESA 1UWGH 4JZOB 1CCZA 3I3BA 4YDKL 2C1PB 5EU7E 1A3LH 4OUUB 2MCPH 5E08H 1FG2B 1HILA 2FSEB 2DLGA 3S97C 1I8IA 4L8SB 5DYOA 1AXSA 3JWOC 3MV7D 2DBLL 1AIFB 2E6JA 3PQYB 5GPRA 2P24A 1AGDA 4FQIL 5DD0L 2ZCHL 4ZO6A 2FIKA 4HHAA 4XB7A 4M43L 4UB0L 3QIWA 1RPQA 3QQ4A 4WWKA 1JWMB 4JFDE 5DRNA 3CJJA 3IDGB 1FVDB 2NYYD 3QB7C 4G9FB 3UDWC 5EOCL 3RWJA 5IBLC 2R1XB 3CMOH 5HI5D 5L8JB 2B5IC 4HJ0C 4GKSB 1ITCA 2BC4A 2X4QB 3P9LA 1WZ1L 2VLRB 4WGVB 3BDYL 4R96B 1F5WA 3C2SA 2HT4D 3C6LD 4PJAA 2WWKT 5DFVD 1UXSA 2WBWB 3CFBB 3QISA 1XCTB 5IMKA 3T3PF 1X4XA 4HZLA 1MIMH 4R0LC 3QFJA 3WEXB 3FO9A 3MFGB 5CMAA 3HCVA 1UKQA 1WBXB 3DO7B 1NAMH 3FB6A 1I8KB 1QA9A 2HFFB 1Z9OA 2NZIA 3T08A 2YRLA 4POUB 1A7QH 1EV2E 1HOCB 3DBXB 1KBGH 1LD9A 3D2UD 4TVPE 1J1PH 3KXFD 4YHZH 3A0OA 4PLOB 4WO4B 1E6JL 5F44A 2DMKA 2DQCL 2CMRH 3CSYB 3FO1B 2LTQC 5TE6L 1BD2B 4K7PX 1VENA 1QLFA 3U9UA 1ACZA 3FOMB 3ZLQC 3MLZL 3NCYS 5C86A 3JVGA 2XOTA 5BV7B 1JF5A 5FF6B 1TCMA 2D9QB 1FL5A 2EYTA 3CCHB 3HC4L 1M6OA 1NLBH 2VMFA 3HPLA 5D6CB 2VL4A 2F15A 3S96B 1F4XH 3QWQB 4K23H 4NQEB 3RWHA 2ARJA 4M7JH 4NQDA 1TLKA 3MRPA 2FJHB 5LGHH 3ULSB 5HYFA 3ZKSD 1FORL 2UZXB 3VWJD 3OKNB 1CQKA 1CE6A 4M7LT 3RVVD 1S7WB 4P9HH 4OAWB 1F3JB 4OGXL 2X4NB 1K9TA 3SDXB 4NKIH 2C1PA 5JPNA 3GI9L 1FG2A 4I77L 3QPQD 2ORBL 3GM8A 3BAEL 1QP1A 1AIFA 4AIOA 2CXKA 4L29B 4JO3H 4LDOB 4EDWL 5JUEL 3LD8C 1SYVA 1PG7X 3V4VH 2NY4C 4G3YL 4LSUH 3BUYA 4M8VA 1X5LA 1O7VA 4Z77B 3BX7C 1MI5E 1WIUA 3S3PA 3WMSA 3UJJL 3PIQB 3DV4B 3RBGA 4A2LA 4JM4H 4KRLB 2X4QA 2VLRA 4CRPA 5EWIH 4R96A 4YHNB 2FIRT 1CQYA 5HHXH 5I19H 1CU4L 4BA8A 2MHAB 5D72H 1JFQH 4BFBD 5CBAB 3HE7D 3WEXA 5MEND 5JOEA 4N0UB 4P46B 3VD7A 4GAGL 2QSTA 4HUVB 1VPOH 1T0NA 3I02B 1WBXA 4XNXL 4POYA 4L3AA 3W0WB 4D94A 1I8KA 3NAAL 1TZGH 2AI0H 3H42L 1FSKC 2J7LA 4CAGA 4MGXA 1OP9A 1HOCA 3DBXA 5L7XL 4K9EC 3CMGA 3WIHA 2YZ1A 3J7HA 2YMXH 5I1JL 4ODSL 2P42B 2B1HL 2AK1H 4WO4A 1DUYA 3CSYA 2QSQA 3FO1A 1BD2A 1EZVX 4S1QL 5HSFA 3FOMA 2IALB 2XY1A 3SDAC 2HWZH 3RUGF 5EUOA 2QV2A 3TWCH 4LCYA 4R26L 5FF6A 3CCHA 1CXKA 5F72S 4U1LA 2FEEL 1TQCC 3EW3B 3CVHB 5D2LB 5D6CA 3MJ9H 1D9KB 4LHQB 1F3RB 4NQEA 1E4KC 1LE5A 3CPLB 1UH2A 1Y0LA 2YUZA 2FJHA 4HK3N 2BY2A 1YMHA 1FFNA 3NCJL 1SJEB 1EJ6A 3OKNA 2NY6B 4F7CB 3TCXA 1UXWA 1S7WA 2HFGL 1NGQH 2VO5A 5C0AE 4FG6C 3L3DB 1L7IL 5IQ7L 3SDXA 3PWUB 4D0CA 5IBLD 4PS4H 1FYTB 3QIUB 4M4PA 3RNQA 4GG6F 3VXSB 4HJ0D 3I6GB 5SX5K 4G8GB 1K4CB 4HFWA 1U0QA 3KYKL 2DQGL 4OF3A 1G7MB 5KSVB 2EC8A 4WI3A 4BJLA 4W70A 3UZEA 5TE4H 1DDHB 3BYTA 4QRRE 1TJIH 2NLJA 3D0LB 2H6PB 2NY5C 4XP1H 2JCCF 4KDVA 4N9GB 2G2RB 1JRHH 2J88L 1JPSL 1ZS8B 5GGSY 4Z77A 2FH8A 3SQBA 2FRGP 1D5XB 3KJ4B 1FZKA 1MCDA 1Q1JL 1CGSL 4ZFGL 1JTTA 3VH8A 2HN7B 2Q1EA 5DJZA 1Y6NR 3PABA 3QXDA 1WAAA 4UDTB 2ENYA 2E5EA 5E6YA 2HJLB 3M45A 4NQVB 5D1XB 4YHNA 3RWGA 3WE6B 5F7KC 1U6AL 4BQ8A 5C0BE 1AR1C 1KJVB 1W0VB 3T8XB 3HI1B 4HUVA 2KZWA 4Z7UF 3KLHC 1AGCB 1XF4B 5F21B 1K6QH 1L0QA 2NXZB 2VDNH 3RA7L 4PRHD 3FFDB 3IXTB 5T3XD 4LCWE 3NA4A 1EVTC 2P5EE 1YUHA 4LLVB 2C5DC 4Z7VB 5ALBL 4MS8C 1ND0A 2WIMA 4UT6L 1MCLA 5IESL 4UOJA 3RNKB 4K3EL 4ZODA 4NC0B 3RI5K 1CYGA 1MHEA 4I0PC 3ILPA 5IVZB 1VGKA 5DQJB 4KZDL 2OTUA 1QLRB 4R4FH 3OZ9L 4QY8A 2VDKL 1PG7W 1NAMB 1IM9D 4HIXH 5DMIL 3DIFA 2E8YA 4JFQA 5I1HL 5BS0D 1D9KA 3NFSL 1HINL 3CPLA 4XB8A 5T5NF 5L8KB 5B38B 2YUVA 2YOCA 1AQKL 3TCLB 4GRMB 5B8CA 5HYQB 1EGJA 3CH8A 2NY4D 3MYJA 4F7CA 1OWWA 2E7LC 1T20A 2VLKE 2NW2B 1CE1H 3OF6D 5DVOA 5EOTB 5FYKU 2YR3A 1JNHB 3VW3L 3I6GA 3G5VA 4G8GA 1K4CA 3BISA 4Y88A 3SEPA 1G7MA 4ZS7H 3WLBA 4F15B 1T03H 4K3DH 2XN9D 3TN0C 1DDHA 4G6AC 1XGRA 1KV3A 1L4IA 3AREA 4MJIB 3RPKA 2H6PA 4YDIL 3UTTA 1QSEB 4MJ5B 4FNLL 4Q2ZB 5GIRA 1GZPB 3T0AA 4GS7C 1NQBA 1MRFL 1D5XA 2F5BL 5I9QB 2VQ1B 5JMRA 3AAZB 2HN7A 4LSQH 4XMKH 4PGJA 4UDTA 1JV5B 1Q94A 4K3JH 2HJLA 4ALAL 5TDOB 2O5ZH 3P9MB 1NC2B 1HSAB 1CLOL 4JKKA 1DJSA 1GXEA 4XVJH 4PJBB 4X6FA 1G7HB 1KJVA 1W0VA 1YY8A 5GSRA 5A2IH 3T0WA 5IB5B 4OKDA 3SDAD 5FB8B 2XZZA 1XF4A 4ODTL 5DLML 1CD8A 1CICA 1TNMA 3IXTA 1GSMA 5DZOA 4CL7A 2RQ8A 3PNWB 1LO4L 3NABH 5BVJB 5IQ9A 3LB6C 4WEBL 3ALWA 5E1HB 3MGOB 5LG1A 4Z7VA 3BHBB 2GITA 4LCUB 4OGYH 3BIAX 2X41A 5DRWA 1WLHA 2B0SL 4V1DA 2W0LA 3BE1H 4JDVB 4K7FB 4C58B 2FYYB 5DQJA 5CEZD 4FG6D 1NCUA 5KSBE 1AO7D 2IMNA 3MBED 5J4MA 4W81A 1CFTA 4L5FL 4LVEA 3NFPB 4PJIB 3B2VL 3MLTB 3RHWF 1Z3GL 3HNVH 4P3DB 1X5JA 3VXUB 1BFVL 1XH3B 5JO5A 1KGCE 5B38A 2BFVL 3TCLA 4GRMA 5F1IA 5IFHH 3QXAB 5CCKL 3G6DH 4F7MA 3QP3A 4YWGL 1LEGB 1LEKA 4ZNCD 4Q7DA 3DX9B 1R5WB 4X6CF 4E9LA 5EOTA 3V0WH 1OGTB 2IBBA 3QAZB 5EA0H 4IRSB 4ELMB 1OY3B 1G0YR 1JNHA 5E6IB 3MRDB 4MCZB 4OLWL 4TQEL 5CIPH 4L8CB 1RZJL 1AR1D 4M8QB 2R2CA 3LN4B 5CJBA 5B22A 4AG4L 4NWUH 1Z6JT 4PREB 5D1QA 2Z0BA 5J56B 1GZPA 1ZSDB 4JO1L 3KLHD 4Z0XB 1T1ZA 3ZDYE 3V5KB 2XFXA 4QEGA 2VQ1A 4Q74A 1V7MH 5ISZB 3JBG7 5SWZE 3QXUA 5BW7C 1OOAA 1JV5A 1CFSA 4CU7A 4J12A 3QDME 4MS8D 3P9MA 4U1MA 4XNMA 1HSAA 1S5IH 3BVNB 4K94C 2OX5A 3ZTJG 2NY1C 3T77B 1G7HA 1IILE 3B9EA 1Q9OB 2LQRA 4LFHG 1TZHB 4P59H 1M71B 2DQTL 1EEUA 4NCDA 4Z7QF 3UTZB 1H3VA 5T1MB 4TVPH 2P43B 1NEUA 4WGWB 2Z8VC 3MGOA 4XNYL 4ZQKA 2FD6L 2KBGA 4ZO8A 3SCMB 2BOBA 2O61B 3BPCB 4JPWL 3L3KB 2FYYA 4ZMAT 3D85A 4MDIA 5IEKA 2BY3A 1QLEH 3OQ3B 1ADQH 1D7FA 3VG0H 4PJIA 4KRMB 1U8PB 4WTWA 4WTZG 4PB9H 3LY6A 4HSQA 4G80B 4ODUA 4PRBB 3TN0D 4MVBC 3GMMB 5B3NA 3QXAA 2EYSB 4G6AD 5FK9B 2YPLB 3NIFE 5L2KE 4LPYA 1LEGA 4PTUB 3L3GB 1SEBB 4HJJL 2H2SC 3DX9A 1R5WA 3DGCR 4DFIA 3WXVL 2AP2A 3LKNB 4NO3B 4IRSA 1E4JA 3ZMRA 4E41D 4ELMA 2AQ3A 4OFVA 3ZKMC 2C1OA 3MNZB 2P47B 4CVXB 3LMJH 3OR6B 4HUXA 3MRDA 4MCZA 3Q48A 5AUMA 5A43C 3GIZL 4Z7WB 4OCSL 3D0VA 4L8CA 2CIKA 4OZFH 2AQ1A 3QUMH 3BPLC 4M8QA 5H94B 4Z18A 3JV6B 4CVUA 3X3GH 4JPKH 4MAYA 4JG0H 1PGRB 3LN4A 4EEEA 3N9GL 4P4KA 1RZ8B 3MV9D 4LHUD 1ZSDA 3UYPA 4U6YB 5SWSB 2OI9B 3V5KA 3MLXL 4OCYL 1NKOA 1YEFL 3PG2A 2B2XL 1G7LB 3LKSB 4UINL 2YHGA 5DRZB 4JRYB 1MCJA 1H15B 3LB6D 4H25B 4JN1H 4J23A 4JG1L 2YD5A 1A4JB 3BVNA 1F02I 4EUPB 3ZZ1A 1KLUB 3T77A 4G6FB 5F7WC 1CXEA 1Q9WB 1Q9OA 4MSWB 4L3CB 1TZHA 1N5AB 2XTJD 5IHZB 1CLCA 3PP4H 1V3LA 3B8YA 4OT1H 3IJHB 2FGWH 2YD3A 2VXSL 3ALXA 3PP3H 4YHML 4WY7H 4J3XA 4XMPH 5IT2L 2ADIA 5T1KD 4RMRA 3U30C 1NPUA 5KVFL 5DMKA 1RK1B 4UQ2A 1NDGB 1MJ8H 2A1WH 4KKAC 1WTLA 3UJIL 3L3KA 1EBPA 4KRPB 4QLRA 3P4MB 4DZ8B 5FYLL 2O93L 2UWEE 5DQDH 3TA3B 5J6HB 4OD3H 5IW6B 3SKJL 2IMMA 4BK4A 4NUGL 1YEDA 3DNKA 1MAMH 4PJCE 4R7NB 4JVPA 4X7TB 4G80A 4MD0B 3UBXB 4PRBA 5CFHA 5BRZD 5BVPH 3GMMA 1MFBH 5FK9A 2YPLA 3MJ7A 2J8UA 4HC1H 1SYSB 4PJ5B 4PTUA 1DE4B 2EH7H 3L3GA 5FA4A 1OVZA 4YH6A 1U92B 3JTSA 1FLRL 4LDLB 4LEXH 1AGFB 3IJSA 3H9SA 2YPVL 4NO3A 3OKOB 2E27H 1CL7H 3MNZA 5JIPA 2CXGA 4P2OA 4X4ME 2H1PH 4X7EC 1OP5H 3WUWG 3TYGH 3ROOA 1GGCL 2NY1D 5DJDB 1HHIB 4YHLL 5H94A 4NP4H 3CU1A 3JV6A 2WAHA 4I2XE 5LVEA 4XBEL 1CF8H 1RZ8A 3WFEH 4IIQB 3GJFK 2YD2A 4U6YA 5SWSA 3R0MA 4QHKJ 3WKNA 1IJ9A 4MZ2A 1MCQA 4BSWB 4ODWB 3DJ9A 2BHYA 2IH1B 1G7LA 4J3OC 3VFGL 5DRZA 4DTGH 1JGEA 3IDJB 4WFFE 1QRNE 4H25A 5E5MB 4QTHB 1A4JA 4JR9L 4XP6L 3UJTH 4U6XA 2Q76B 1RUPH 4EUPA 1KLUA 5CIPB 1CGYA 1Q9WA 1C16A 2J8HA 5TDNB 4MSWA 2EDHA 3JXAA 4L3CA 3R06B 5E9DD 4OGZA 3LKPB 5KSAD 4X7SL 2AXGB 3UTQA 3WIIL 1BIIB 1BZQK 2DLFL 3ZTNH 4F37F 1K8IB 3H0TB 1OW0A 5GRVL 3EFDH 2YBRB 2APFA 3OJMB 1KPUB 2AJXL 2ZNXA 5I1EH 5IIEB 3FN0L 1L0XA 1K8DA 2F5AH 1NDGA 4MVBD 4KK5C 1U3HB 4ZAKB 3WV0A 5HPMB 4ZXBC 4ZFZA 3C5ZB 1NCBL 3P4MA 4DZ8A 1KCSH 4Y8AA 4YHOH 1JWUB 3QNZB 5J6HA 3IGAB 1DQTA 5IW6A 3IFOA 4GSDH 1MCOL 3ZKMD 4QXWA 5IK3A 5T3ZD 3ZYOA 3QDJD 1T2QH 4PRIB 4R7NA 3BRDA 2EC9U 4UZGA 3UTSE 3SJVE 5B39B 1YNKH 5TDPB 3F7RA 1HZHH 3C9NB 2D7OA 1SYSA 4PJ5A 1DE4A 5D5ME 1HE7A 1AGFA 2N1KA 4QXTA 3IU4H 5D7KE 5HYSG 3MRGB 1UM6H 4K07A 1XEDA 1LEIB 4GKOA 3SE4C 4P5KB 1LP9B 3TIDB 2E8ZA 1BVKB 2H2PD 1GOFA 1Z9MA 4FQQB 3X13B 2I9LA 5C08D 3THML 1N5YH 2I60L 4OQTA 1J5OL 2JJTA 1KB5B 3NTCH 5FIEA 3S36H 4PJHE 2IH1A 4AY0A 1QEWB 4A6YH 3IDJA 5DDHB 4K71C 4RFOL 5I8KL 5KTEL 4X98B 2R0LH 4QTHA 4P5TB 5J12C 3TT1L 4PJGF 4XRCA 1IGTB 5I1KH 2O5XH 4J4PC 1MHHB 4NRZB 3ZE2E 2ESVE 5CUSH 4KKAD 4OZFB 5CJXC 4YC2C 3FOLB 1PDKA 3QUMB 3R06A 2V5TA 3LKPA 4R7DA 3FONB 4F7TB 2AXGA 1BIIA 4FABH 4PP1C 4JM2B 3H0TA 3GB7B 5B21A 1RSFA 4PJFB 4Y5YB 4CVWA 2MQ0A 1KPUA 3C09B 5IIEA 5JIHA 1FDLH 4PUBL 3MLSL 4WCYL 4LNRB 2ZOLA 4RMUA 3A67L 4OTXH 1IGYB 3C5ZA 1XIWC 3V4UH 5MEOA 3EUUA 4KVCL 2IAND 1NANH 3QNZA 1R3KB 2IPKB 3IGAA 5IMLA 2NX5D 1XR9B 1AGBB 2A2QT 3TYFB 2Q8BH 1MHPH 4JFPA 1G9NL 3WO4C 2V9QA 4ZFFA 4RAUB 2H9GA 1RZIB 3OKYA 3SGKA 4PRIA 4X5XA 4NDMA 2YN5A 5B39A 4XWOD 3BT2L 3VCLB 1ZE3C 1N8ZB 4TULH 1UCBL 3W9EA 1QFWI 2VDML 1EO5A 3RZWA 5JIKA 4FFWC 4FTVD 1PZ5B 3PXJA 5J57B 5KZCB 4JKPL 4MA3A 2CKBL 2VWEC 2DQIH 3MUZ1 2AJUL 1LP9A 4OLYH 5I0ZA 3VXQB 3RP1A 4M7ZC 1BVKA 4JANA 4UOW0 3MA7B 3O2WH 4FQQA 4JFZL 2X4TB 2Y9RT 3X13A 4Z5RB 3QCTL 1WWAX 2BSRB 1VGEH 4Z8FH 3HNSL 3MACH 3U7WH 1KCRL 2OZ4H 3LAFA 4HS8L 1KB5A 3OR7B 1J1OH 1A22B 5JNYA 1FFOA 5C0AB 2EH8L 2FHBA 4LPTA 5AG9A 4HQQL 3HAEA 2UVEA 4X98A 5HHVL 2FX7L 2ZWLT 3DVNB 1IGTA 1BEYL 3SHSA 1JGDA 1MHHA 1X5KA 5HGAB 2RBLA 3HFMH 4KK5D 2ZUWA 4LKCB 2R4RH 5HYIA 4ZXBD 2JB6A 2CQVA 4NM8L 2BXYA 2YA2A 4M6MH 5J6GB 4E41E 4QRRB 4YLQT 3OWEA 4F7TA 2WUCL 4HDIA 1A3QA 1F4YL 3NZ8A 4AEHH 2K1MA 5CKAA 3BKJH 3GB7A 4MNGE 4PJFA 3D3VD 4PV9B 4DKDC 2BRRL 1CTNA 1B88A 4I1NB 3R4DA 4LNRA 4YIQB 5F9DC 3V5HB 4U0QB 5GRUL 4GQ9L 4LSRL 3CDYA 3IFNL 3QI9A 2R69L 3LS4L 3N85L 1TQBC 4QRPE 2OTWB 3KPSD 3LS5L 4RZCA 4Y19A 1R3KA 3NACL 5ALCL 5DHXB 5I74C 3RY6C 1YMMA 4TUKH 3AM8A 4KH2A 3TYFA 3F7YA 1MCPH 4RAUA 1GPOL 5ADOH 1RZIA 1C5BH 3P0YH 4OZ4B 4HMCA 1EJOL 4LCWB 3GBNL 3MRFA 2P5EB 4D9RD 4HMDA 3I6LE 1FGNH 3VCLA 2DI7A 2ZUTA 3BSZH 1WWCA 2R0WH 3DRQB 3GJFH 1DLHB 5HGBB 4XC1L 1Q0XL 4PRAB 5DVMA 1PZ5A 1IRAY 1RZGA 3L3IA 4TRPH 3FT4B 1TPXC 2NY7L 3T3MF 1JGLL 3M07A 1T4KB 5DJ6B 4QOKD 4YXHH 2I25N 3AY4A 1CZ8L 4MA1B 5DD5L 3VXQA 4J4PD 1MHCB 2DLHA 4HCRH 3MA7A 3BGAA 1RIHH 2X4TA 4D8PB 4EI5C 5C0EB 5LGKA 4RGND 4JZJC 2YPKB 3V0VA 1FH5H 2FB4L 3LEYL 3WJLC 3LKRB 3QPXL 1NAKH 3FQWB 2VLKB 2NY3C 4PP1D 5I1LB 3EJZC 3T0EC 1XZ0A 3RAJH 1UH4A 1X4YA 1OSZB 3DVNA 4HWBH 4F3FB 2HG5B 1JPST 1NMBH 5C0CD 2QQLH 5FM4A 3DROA 4G8IB 5HGAA 3S34H 5CP7B 4LSPH 5KVGL 2Z9TA 4LKCA 2VR4A 2EE2A 2XKSA 4J3UA 4Z0BH 4QHLB 4NO2B 2WBJC 1DANU 4XPBL 1FAIL 4HK0B 3GRWH 2PYED 4XCCL 1KB9K 4KTDL 4ODXB 5C9JB 4XAWL 5IHUL 3QXTA 4UT7L 4YNYA 3OG4B 5H37H 4RGMC 2BX5A 5IFAH 1ZANH 4KKLD 4PV9A 5D1ZC 4R4BB 4ZTPL 2W07A 1A7NL 1KFAL 3VFNB 4CDHA 1TNNA 2AABL 4A6YB 1V7NH 3MCLL 2BY1A 4YIQA 3PV6B 1A21A 3HC3L 3MC0A 4IRZH 1PQZB 1T66C 3FRPG 3V5HA 1KT2A 1E6OH 3FQXA 1MF2L 3NOIA 5D2NE 3SE9H 1YYLH 2OTWA 4FFWD 1E4XH 1PD6A 4NKQB 3MRHB 1J8HD 3UO1H 4RAVB 5BV7L 2YD9A 3MV7B 4UTBH 4OZ4A 5DRXB 1SY6L 1KELH 2WINA 3B9KB 2X44D 5JZ7C 3NCBB 5FUZH 3VJ6A 4NQSB 4JDZA 3VXOB 2Y6SD 5ADPL 3DRQA 4IBLT 4YHPA 3E6HB 2FATL 5GS3A 5IBTH 1T89A 3FZUC 1PKOA 2D7QA 1ZHNA 3HE6B 3FT4A 3IYLW 5DWUL 2R29L 1MRDL 1T4KA 3I6KA 3Q6GL 2ZJSH 2UV3A 3VGFA 4AQ1B 5L6YL 1MJJB 1S9VB 5ETUA 2VAJA 1KLGB 1ZLSH 4DN4L 4JPIA 4D8PA 4N0CC 4U0RC 1WFNA 2YPKA 1QKZL 5DA0B 3FQWA 5EO0B 3S9DB 3BFOA 5KS9E 1BAFH 5FYJE 4PRPE 3QJFB 3W9DA 2DKMA 3DUSB 3L5WB 3D2UB 5FV1L 3MODL 3QT2A 3U4BL 1OSZA 1J0JA 1RJCA 2SEBB 3IT8D 4YBLC 4WEMB 5GGSB 2FWOA 2X1OA 4L9LA 1JNNL 4GO6B 1MLCB 5CP7A 4Y4HD 2L0DA 3TZVA 3EYSH 1N4XL 3X12B 4NO2A 3C5SB 5JHDE 5EOQH 4HK0A 4S2SB 1HNGA 3O6KH 5KJRH 1WFTA 4ODXA 1B6DA 2GUOB 4JCMA 4QTIL 1G0XA 5EBMA 4N0YH 1AHWC 4MHHI 3IFPA 5CZVL 4R4BA 4WFEE 2ICEB 2Q20A 3VFNA 4R90L 4GRWF 2VOTA 5C08E 5DC9B 3LRSB 3QDMB 3VWJB 3OXRA 1WZKA 5I8EA 2BVOB 3KJ6L 4H0IA 5E00B 5CLWA 5FA3B 4HKZB 1VHPA 1BJ8A 5A1AA 1LO0H 5EG6C 4F7PB 4FQCL 5F6IB 3N0PB 4EIZC 3EO0B 3MV7A 5DRXA 4AMKH 1EBAA 4G7VL 3QIBC 4OCNC 5IB2B 1JP5A 4Q0XH 3TP4A 3CVHL 5I1CH 3VXOA 1U3YA 1OB1B 3U36A 4LLAA 3E6HA 2BVPA 4IS6B 5D9SA 1YC7A 1MWAB 2NY3D 2RFXB 2VDOH 4XI5C 4Y5XA 1X7QA 1UZ8A 4WV1B 4XXDB 3EJZD 3T0ED 4P2YA 3PWPD 4EKXA 4LVHB 1BBJA 5I1GH 4MJ6A 4ZFOA 3C6LA 1IZJA 4WW2C 2HLFC 1MJJA 7FABL 1EMTH 2FX8L 4R8WH 1P2CA 2D03L 3ULUC 1H3PH 3QDHA 5IBUG 1VADA 1A9BA 1DBAH 2WBJD 3H7BA 4W4NA 4MQXC 4O51A 3VFVB 3D39D 3AVEA 1RIVH 5FUOH 1NCCH 3S35H 1P1ZB 3GJFB 5IR1B 1TTUA 2ZUQB 5TE7H 4PD4K 5DZNA 1GGIH 1XGTB 2C4FU 3WKML 3DUSA 5D70L 1F2XK 3QEQD 3KXFA 4KI1A 1U58B 5GGSA 1UWGL 5CGTA 1MLCA 1T66D 4YR6B 2A9MH 1A3LL 3MZGB 4KRNA 4I3SL 2MCPL 3X12A 5E08L 1LDSA 4LCCB 4AL8H 3VXRD 1OT1A 1D6EA 1P5VA 5E0QA 3PJSA 3KYAA 4U05A 4N1CA 3WL9A 2CRYA 3PF2A 1X4ZA 4NN5C 5JZ7D 5JDSB 4JN2B 4G6MH 5E4EC 1YECH 4HJGB 1T1WB 3LRSA 3VWJA 2R8SH 3QHTC 2BVOA 3CMOL 3MUGB 5FV2A 4PJ7E 4X8JB 1S7RB 5GZOC 3DHMA 1DQLH 3FZUD 2Q6WB 3P30H 4U1KA 2FX9H 4HXAL 3EO0A 7CGTA 3HB3C 4KC3B 1MIML 1U8MB 4E42B 1WC7B 5IM7B 4LCIH 4P2QD 2JJUA 5JW4M 5IB2A 1NAML 3QZWG 4JKWA 4R9HA 3WFZA 2QADC 3ARDC 4HWZB 1KBGL 2DJUA 4QT5A 1J1PL 4PBWD 2RFXA 1MWAA 2IBZX 5H35B 2X2YA 4WV1A 4YHZL 2ZG3A 5CSBA 2B4CH 4M6NH 2CMRL 4PY7B 3SBWA 5JORB 4QYOB 4PGDA 1GGBH 2V5SA 1H3TA 3O45B 5JQHC 3HE7A 1KC5H 4WU5B 5MENA 5BXFB 4WW2F 3G6JE 3K74B 2DLEA 3PWJB 1VSCA 1I3RA 1NLBL 1OGAE 5F3BB 1UQSB 3VFVA 2IFGA 4Q6IC 3ULUF 1G84A 5GS0H 4JFHE 4OM1H 1F4XL 4K23L 4KMTH 1P1ZA 5IR1A 2B8OT 4LAQH 4M7JL 5EBGA 3V6FA 5LGHL 1IEAA 5J13B 3KS0H 4NT6A 1MCEA 3VFWB 25C8H 2Z35A 4JHWH 1U58A 4P9HL 3H3PH 3IVKA 4JQVA 3ZDZE 5A2JH 4ISVB 5ESAB 3GSOA 3QXVA 4NKIL 1PVHA 4JGUA 5F8RC 1OTSC 3DX7B 4GG6B 3HUJE 3VE0B 3ULVE 4RMVA 1IC4H 4I2XB 2JK5B 4JO3L 1IM9B 3DTXB 3GKZA 3GFUA 4HXBH 4GAYB 1WWWX 5FAAA 2W9DH 3OX8B 4I3GA 3V4VL 1I75A 1YEJH 4X6DE 3BZEB 3WFDH 5F9OH 4LSUL 4I3RH 2X70B 1QRNB 4JDTH 4AJ0A 4DUWA 3OJ2C 3IKKA 4KI5E 1OHQA 1JN6A 3MUGA 1K3ZA 4JM4L 5IW1A 1S7RA 1ONQB 5BMFH 5HD8C 1PKQE 3UDWA 4BQ9A 2Q6WA 5HHXL 4XI5D 5I19L 4S1RH 3B3IB 3OAYK 5D72L 1JFQL 2EDKA 1WT5C 1K85A 3EYQD 2EKSB 4JLRB 4E42A 2A9NH 2XA3A 2DTMH 5F6HI 1VPOL 2OJEB 3TFKD 4OFDA 2HLFD 1TZGL 4Z95H 2AI0L 4R0LA 4LASH 1I1FB 3ULUD 5FDWB 3SDYH 3SN6N 3JV4A 2OSLB 4HWZA 1HEZB 1N2RA 4MQXD 4GQPH 2NTFB 2CIIA 2YMXL 1GOGA 1JF1B 2JTDA 5H35A 5F1KC 5FM8A 2VZVA 4KK8C 2AK1L 3JWDH 2Q86B 1OAKH 2APBA 3ZT7A 1FAKT 5JORA 2RJMA 5BO1H 1BMGA 3CIQA 5DJCA 4JFEE 2XXMB 2HWZL 3ARQA 4LLQB 3TWCL 1NCAH 4P2RE 1RV6X 3RUGA 4WU5A 5BXFA 3EAKA 3UTSB 3PWJA 1TVHB 2VR9A 1ORQA 2OLDA 3N1MC 5F3BA 1U8JB 1UQSA 3MJ9L 4NQUA 2DQDH 4PRHA 5D5MB 2EDRA 3GSXA 1AXTH 3VFWA 3G9AB 3C60D 1CFVH 5HHOD 3RWCB 3OJDB 1NGQL 4WHYG 1BZ9B 1T7VA 4O2FB 2AV7B 4PS4L 5C07D 4GG6A 1IGCH 5GZOD 1ZKAA 3VE0A 4I2XA 3MBEB 1WISA 2JK5A 4N5ED 3DTXA 2R1YB 3HB3D 4FQLH 5TE4L 3MLUH 3OX8A 4PJHB 5BS0A 1TJIL 4A2MA 3BZEA 4OZIE 4XP1L 1JRHL 2JCCA 4HKBB 4Q9CA 3VRLE 2X70A 1WICA 2VLME 2QADD 1MNUH 1B9ZA 3AXLA 3ARDD 4WTXA 1JWSA 2ESVB 3OF6A 2A6KB 3TVMC 1F4AA 2A6IB 3SDCC 3IKCA 2XIDA 5TFSH 1NMAH 3B3IA 5IB3B 4HGWB 4JLRA 2P8PB 1RU9H 1OP3K 3RTQC 1A6UH 2XN9A 4Z7UA 4LFHD 2R1WB 2EIDA 1K6QL 2VDNL 3NFNB 2VKWA 3DOSA 5FDWA 3JUZA 3O3EB 3GMOB 1AKJD 4U1SB 2BVTA 3LDBC 5D93C 2EDDA 5FM5M 3WJJC 2A83A 5FOJA 5DJXA 1KCLA 2GJ6D 1SJXA 1FJ1A 3FB5A 2H32A 5JR1H 4FP8H 1T22A 1ZA3B 4ONOA 4R4FL 1T80A 1HQRB 1K5NB 4OZGE 2YRZA 4HIXL 2M8XA 3FO0H 3SDAA 1D5BA 4FFZH 3BP7B 3M1BB 1U8JA 2PW1B 2DQFB 3PGDA 5FYJH 1NUDA 2W60B 1JVKA 5D8JH 1KENH 2D2OA 4NZRH 4WJ5B 4LHJB 3DXAD 1E4KA 3RWCA 2E7HA 3OJDA 4HKXB 2PO6C 3NGBC 4BK5A 1HHKB 1CE1L 1N26A 1AD0A 4O2FA 3TEUA 1I9RH 3IDNB 5CJOH 2HAZA 1N6QH 2X05A 5DI8A 4JY6B 5HD8D 5HJ3B 4R4NC 2P5WE 5CHNB 4DK3A 5KVEH 1AO7A 3MBEA 4HPOH 4PR5A 1GHFH 4ZS7L 3WFHB 1T03L 1T6VN 4K3DL 3EYFA 3NIDE 3RWIA 2R1YA 3V6OC 1CXLA 4UQ3B 4GOSA 3IS1X 1IM3B 5JLZB 3TN0B 4NN6C 3GNMH 4QXUH 4LSQL 1UG9A 2Z8RA 4XMKL 1CGXA 5IEHB 4K3JL 2A6KA 4YQXH 1INQB 3N06B 2O5ZL 1S7QB 4KK8D 4E41B 5J11C 1PFCA 4XVJL 4CNIA 4HGWA 3UXFA 3SE8H 4KV5E 5DJAA 2R1WA 5B3JF 4QGTA 4N1HB 3GMOA 4LHUB 3MTRA 3NABL 2QHLA 2LU4A 1FLTX 2UZIH 5EB9A 3U0TB 4OGYL 4QRPB 5F1OB 1R3IH 4LBEA 4NHUB 3VFTB 3RX8A 2X4PB 5T1DH 4M9OA 2A0LC 3BE1L 3D18B 1VESA 3KNBA 4X8XA 5HPOA 3R1GH 1LO3H 1ZA3A 3RIAF 5I1JH 3IXAB 3UZVB 3DSNA 1UYWH 2XTJB 3MBXH 4DW2H 3BP7A 3MOAH 3O4LE 4Q58C 5DJ0B 2PW1A 5GHWH 3HNVL 2OR7A 1T5WA 2WNGA 1CIUA 2HKHH 2RGSA 2W60A 3O4OB 1FYHB 3SKOB 5IFHL 1XAUA 3G6DL 1NCNA 2IAMB 1FV1A 2WZPD 3OJVC 1VFAB 1H0DB 3D25B 1HHKA 4N8VG 3S4SB 2EO9A 3IDNA 4X6CA 3WD5H 4M3JA 5IB1A 3V0WL 1YEGH 1B4JH 4RX4D 3K4ZA 5DJYA 5EA0L 2E7LA 4JY6A 4MNQD 4WNQB 4OIIH 1KJ2H 5CHNA 5JDJA 5FM5O 3TVMD 3SDCD 2NY0B 2WSKA 3FFCE 5EZLB 1M05A 5EDXA 3T4YA 4J3WA 5DHYB 1Q0YH 3P4OA 3OAYH 2VL5A 3TO4B 4HG4K 4OJFH 5FUCE 5FO7B 5CP3A 5JOFB 1OPGH 1U36A 2V2TA 4D9LH 4UQ3A 1G7PA 4WI5A 1LDPH 5EFIB 2DBJA 1IM3A 5JLZA 4NWUL 3RTQD 3QDGE 2R2HB 3TN0A 5BRZB 4WUUE 1SM3H 5CJ5A 5K59F 4NJAH 3ARFC 1V7ML 3GIVA 4NKDA 5IEHA 1UKTA 5JQ6H 2DKSA 4QHMA 5C2BH 2ITCB 5LXGH 2D7PA 1HIMH 4E41A 1S5IL 3LEVH 5GS2H 4LRIC