1LK3L

Engineered human interleukin-10 monomer complexed to 9d7 fab fragment
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
210
structure length
210
Chain Sequence
b'DTVLTQPPALTVSPGEKLTISCKASESVTSRMHWYQQKPGQQPKLLIYKASNLASGVPARFSGSGSGTDFTLTIDPVEADDTAIYFCQQSWNGPLTFGAGTKLELKRADAAPTVSIFPPSTEQLATGGASVVCLMNNFYPRDISVKWKIDGTERRDGVLDSVTDQDSKDSTYSMSSTLSLTKADYESHNLYTCEVVHKTSSSPVVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-10
molecule tags Immune system
source organism Homo sapiens
publication title Noncompetitive antibody neutralization of IL-10 revealed by protein engineering and x-ray crystallography.
pubmed doi rcsb
total genus 51
structure length 210
sequence length 210
chains with identical sequence M
ec nomenclature
pdb deposition date 2002-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lk3L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1lk3L01
5D93C 3OJDA 3I6GA 4NUGL 3IJSB 3PIQB 5LBSL 4P23C 4TSBH 1H15A 3LRSB 3WXVL 4U6TA 1CICA 1R5WA 2CIIB 3MRQA 4XMPL 5HYSG 2EXWC 3LZFH 4S2SA 4JY6A 2GJ6E 1A1MB 5JPNB 4L9DA 2YKLL 1D3CA 4KXZI 5IKCA 1AHWB 2P5EE 5F7FA 5KVDH 4OSUL 1KB5H 1DBJH 3O2DH 1RIVL 3G5VB 2CO7B 4IRJA 4QRRA 3EJZC 3FJTA 3U4AA 3VRLF 1Z0MA 2DWDB 4PB9L 3KS0H 1IKFH 3AC0A 2P5WD 3C08H 3FOMA 4G3YH 3KPRD 3P77A 1MFAH 3BXNA 2J8UA 2XZAH 4JFQB 1FFQA 1NPUA 4WFEE 1MY5A 1K8IA 4HBCL 3OJVC 4IMLA 4L3EB 5DURB 5C0FB 5GRUL 4NQVB 5IB1B 2VDOH 5HHOD 5E6ZA 1I1FB 1BBDL 3HAEH 4QXGH 5C0NC 5CILH 1HZHH 1FSKC 2WLYA 1T2QL 4S10A 5HPMA 1OAUH 4V1DA 1J9CT 1P4IH 4LNVA 5HD8D 2BSSA 5K33A 4RAUB 1QVOB 3VMNA 4L4VA 1SVZA 1E28A 1AD0A 3U4EB 3NZHH 2EDKA 1FORH 1PYWA 4PRPA 1I1AA 3HG1A 3L1OL 4NSKA 5IHZB 4XAWL 3ZKND 2QLVB 4J7RA 2QKIB 4LP4A 5SV4A 4P46C 1K8DA 2KQMA 5K9KA 2X4SA 1ZHKB 4HWEH 5DMGC 4V2BA 2RB8A 1R5WB 4NYLB 4LEXH 3WJLA 4YFLI 3VXRD 1AE6L 1F3RB 4G6AC 4WEUD 1JNLL 1AGBB 1JFQH 5I18L 3EO0B 4O5LL 4QRSA 4HK3J 3SE8H 1JWSB 3IDMA 3HC0A 3L3JB 1VA9A 5B4MC 2OP4L 4D0CB 4F8QA 1F3DJ 2VITB 5CMAB 1IGCH 2X1QA 5T3ZE 2PYEE 5LWYH 4PJ7F 5J13C 4X7TA 1UCBL 3ZE1F 3MLTB 1JPFB 1QO3A 5L8KB 2QL1A 3N1FC 3CK0L 5ICZA 3ES6A 4XNXH 1EBAA 1VPOL 3KJ6H 3SGJA 4OM1H 5DMYA 1QSVA 3BP6A 5MP6L 1OTUD 4L8CA 1IBGL 2IMMA 4P0DA 1U0QA 3H0TA 3K0WA 5HI3D 3ZKXC 5KVFL 4E41D 3VCLB 5J1TC 3K4DA 3BE1H 2C1PB 3HLAA 2JK5A 3FFDA 3AAZA 4LOUC 4EXKA 5ETUB 3EOBA 4M7JH 3WDIA 2NY1D 1A6TB 1ZVSB 5I6XC 3N06B 1XT5A 4OCXL 2B1AH 4OLUL 1NFDF 4AH2B 1RFDH 5D7LB 1S5IH 4M61B 1MCPL 3DX9A 4JM2D 5IVOA 4IRSA 4PJFE 4WCYL 5DMKA 5HVGB 4C83A 3EJYC 5HSFA 4Y1AA 3GSUB 3SDXA 1QFUL 1WAAE 3EYFB 2P1YA 3O3EA 1CE1H 2RCSL 3PV7A 2AJZA 1CXFA 1CFTA 4JKPL 4L8DA 4B41A 5BO1H 1MUJB 1IM9D 2BNRD 4HIHA 4MD4B 1I8LA 1H3WM 3ARPA 1CD0A 3HZMB 1UACL 3AM8C 5JIHA 3VD5A 2WSKA 3L3JA 3UTQB 2R9HD 3D3VE 4BZ2L 3WEXB 4OLYL 3D0VA 5FHAL 3BDYH 2YBRA 4MSWB 1R0AH 1KB9K 5HD8C 1FNSH 1PFCA 3O0RL 5EB9A 3ZL4H 5IG7A 4L9LC 5HVWA 1JYNA 4HCRL 4RGNC 3PXHA 1DEDA 3X14A 1JMZA 4DFIA 4QTHB 1NGZB 5D7IE 4B0MM 4W6XB 1PLGH 4Q9CA 3B9VA 3KJ4B 1U8JB 1KACB 4NO0B 1IC4L 5I15H 3B9KD 1CXKA 2EDDA 2P47B 5T1LB 3FO2A 4M5ZL 1FNFA 1BFOB 4ZG1A 3D6GA 3U36B 4FZ8H 4WHTA 4MNHB 3T1WA 4JFYA 3EDKA 4N5ED 1Q94B 5C07E 2CIIA 3JWDH 3MRQB 4XC3L 4U31A 3TBYB 3GNML 1A5FL 5ADPH 2D0GA 1I9IL 5E8DH 1DQLL 3WIHH 3RBGA 1QEWB 2DYPA 5C6TL 4CMHC 3GNMH 4X0KB 4G8FB 3FRUB 2Q6WA 3IAQA 1XR9A 2VYRE 4R8WH 3RY4A 3O3BB 3HE6A 4KXZH 4Z95H 4NCC2 2PXYD 1AXTL 2BCKB 2RIKA 5EU6B 5DRWA 2XA3A 1DLFH 4UIMB 2BXZA 5C0GA 4KMTL 4OLXL 2UZYB 3SO3B 4ZYKB 3IFPA 2VLLA 1TVDA 4HJ0D 5CEXB 5I30L 3TPUA 5I1JH 3PWNB 3RVXC 4OZFB 5C0FA 1MCWW 3UTTE 2F54B 1A9BA 4OZGA 4KGJA 4MS8D 3HPJB 1EX0A 5E4IA 1NLDH 3PDGA 4ISVA 3PHQB 4Z78B 1DVFD 3AS0A 4O9HH 4LCWA 4HWUA 3UZVB 4PB0L 3OKNA 4FFWD 4U6YA 4PJIE 4H8WC 4YAQA 3VG0H 4IOIA 5E03A 1U8JA 5ADOL 4M1CD 1WCBB 2Y7QB 3VWKA 1QR1A 3GSQB 3V5DB 1FYTB 4HUMB 3HB3D 3X3GH 1JRHL 1GGCH 5C9JA 4FFYH 4PP1D 2R8SL 3EOTL 2J4WL 2AV1B 1V05A 1JGEA 3BP5A 4TUKL 1B6DA 2A6DA 3R8BB 3KLHD 1PY4A 4YDJB 1WZKA 3NA4A 4OFPA 5D7JB 4KH2A 4HDIB 2DBLL 2BC4B 2FX9L 3OKYA 5BV7H 3VXMD 5IR1A 1YNLL 4ODTL 1TMCB 2P24A 1OAXL 4MAUL 1C7SA 4NWTL 3GEWB 5C0DA 4XB7A 5E5RB 5C0BA 2DQGH 1LNUA 4MB3A 1A4KA 5FV2A 5KSBB 4OT1L 2IFGA 5GGSB 1M7XA 5IM7A 4JO3H 5D1ZB 1LEIB 1YYLH 2B0SL 4P2QB 3CXDH 3JV4B 4GKZB 1U95B 3P3YA 3ALWA 3UJJL 3MCG1 2VOTA 1HHKA 3O2WH 1JHTB 2XZQL 3BE1L 2XZAL 1BZ9A 1F2QA 5A2FA 3ILQC 1KOAA 4IRSD 4R4FH 4NUJA 4XCFH 4NOBA 1YMMD 5B3JE 5EZIL 4M93C 1JGUH 1RJCA 1N2RB 4QGYA 1H3GA 2XN9B 1CGTA 3MLRL 2HFEB 3SKUD 5K59F 1JZ8A 1SJEB 1AO7A 1IZJA 1XGRB 3GKZA 1G1YA 5C07A 3RGVB 5CD5C 4R4BA 1U8QB 4OBSA 3BMVA 1X4ZA 3LD8C 1BIIB 4L4JA 1Q8MA 5E2TH 3UJIH 2J88H 3S7GA 1A7QL 2G60H 3GHBL 1S7WB 4HZLB 3A6CL 1F42A 3LEXB 2YHGA 1AKJD 3VFRA 4DW2L 1DBBL 5C9JB 1G7LB 5J6GA 1DN2A 4FA8A 4UDUA 3HE7B 2AV1A 2NY5L 3J8F7 1FGVH 3WNLA 3KPQA 4PJIB 1JGEB 3BUTA 1AJ7H 4N8VA 5IB2A 1I1AC 2HP4A 2C3VA 3FT3A 1SYSB 1X5XA 1MFBL 4OKDA 1BFVH 4FTVD 4OZIB 3BW9A 4J3VA 1Q9OB 5A3IC 3OKDB 2ADFH 5ID0A 1BJ1J 2A6KB 4WI5A 3RBSA 5CJ5A 5F7LB 2VRAA 1EO8H 1FVCA 3PJSA 1OTUC 3HNSL 1UGNA 4ODUA 3IF1A 4S1DC 2Q76B 4YHKL 5GRXG 4J12A 1T22B 2YD6A 1HHIB 1MHHA 4PG9A 3WDJA 3D25B 1HHKB 3C8KB 4MX7A 4Q6YA 4GRWB 1OAZH 3UJTL 3PNWB 4V1DE 4OLZL 3VFOA 2FJGB 3UPRA 4GJTB 4OUOA 1C12B 1ONQB 2X1OA 3X17A 4N8VG 4MCYB 2DIJA 5IHUH 1J86A 4X7EC 4FS0A 5MENB 5DJ8B 5HXMA 2R0KL 2XT1B 1AXIB 3QFJD 5I1EL 5GS0D 1D9KB 1R3LB 2Z31C 3OBAA 3EYOA 1NH6A 1LE5B 2J6EL 5FK9A 4ONGH 2IH3B 2OQJB 4P9ML 5IGXH 5IKCB 1OQOA 3I3BA 1YN7B 3U36A 2ITCA 1DDHA 5C0AB 3DX6A 5SV3A 1A6AA 3TNNB 4XMLH 4BK5A 4IRJD 4QRRD 5C70A 1S7VB 4RMUA 3MYZA 1RIVH 3TBYA 2C9AA 5F6HI 5IQ7L 3OG6B 1AKJB 5FGSA 4KV5E 2D03L 4YHIA 2ED7A 3OZ9H 1KGCD 4YX2H 4N8VB 2Z8RA 5IB2B 1GVIA 2O5ZL 1K8IB 5HDQH 3B9EA 3R0NA 5F7WC 3I9GL 4XH2B 1J1XL 3ZYJA 3MV8E 2X42A 1EAPB 5BQ7A 1KNOB 4X6EB 2FO4A 2NTFB 4BUHA 4NO5B 5GGTA 1D5XA 2OXHA 4G6JH 1UEYA 2DQFB 2OMNA 3FFCA 1DZBA 4BFEA 2CH8A 1L9MA 2A6KA 2ICEB 1BQLL 3VXNA 1E6JL 2BVQB 4TUOA 4EVNA 1ZA3A 2IBZX 1A6VH 4RAUA 1JP5A 2F54A 5HYFA 2M8XA 3GSVB 5ALBH 3OKKB 3VFUB 1UWGL 5DJYA 1UM4L 3QUZD 4KC3B 1AJ7L 2LVCA 3K80A 4RMSA 5FECB 2CKNA 4L4VD 2L0DA 5FEBA 1MCWM 5HJ3A 4WU5B 2DQHL 4KY1L 1ADQH 3IJHB 4TN9A 1W72H 2F8OA 4XB8A 4J4PC 2CK0L 4OAWA 4OZHA 4X4ME 2R0LH 4G6KH 4LHUA 2D4DA 4M1DL 4CAGA 1LP9E 1FGNH 1WFUA 4H1LG 4WV1C 2NNAB 2FRGP 1QLEL 1FLTX 3D9AH 2FDBP 2Y07L 3KPPB 4UUJB 4FQLL 5I1EH 5I9QB 3R1GL 1JGUL 5TFSL 5EZIH 1BGXL 3I2CL 4LSTL 4XVSH 2BC4A 4PJBF 5KSAB 3HHRB 4EI5B 4X98A 4YBQD 1H5BB 2XACC 4P99A 1BF8A 1MRDL 5JW4R 1OAZL 1G9NL 4QY8B 5CGMA 4C54A 5DUML 5HVHB 4LARL 1FL6A 3UTTB 3MRMB 4E42B 4KRNA 1QLFA 2DQGL 2NTFA 1WBZA 4JFXB 4HBQA 4CW1B 4P2QA 4L8CB 2DQFA 5DRXB 4JE4B 4PGZA 1HH6A 2GI7A 2UWEE 2X4TB 1NAMH 1BJ8A 1J05A 2W0FB 2R29H 4JVWA 3GMMB 2OX5A 3FFDB 5GRVL 4FFYL 1DN0B 2W92A 4DKAA 1BZ7A 1ZWIA 5EN2B 2JLLA 1A7OL 5DVKA 3U46A 5ADOH 2Y5TA 3M1BB 5TDOA 4M4PA 1WUNT 3BH8A 1NGQL 3QCUH 1KXVC 4ZO8A 4JY6B 4S1SL 3CVHB 3FO9B 3CD4A 1NCBL 3PUCA 1QLRB 4X7CC 4Z7UF 1N6UA 3IDYB 1D5ZB 1A7PH 4GUPB 1BD2E 4LHUB 4GKSB 1UB5B 3PWPA 1CIDA 1CBVH 1INEH 3IFNH 2W9DL 1NL0H 3I50H 4CMHB 4ZFOA 4GW1A 3HZMA 3ALXA 2R0ZL 5FAAA 3RP1A 2J88L 2YC1A 4HKXA 3SDCD 5TQ0L 1JWMA 2APVA 3MSPA 5EOTB 2XA8H 3C2AL 2M2DA 2W65B 4Z7VA 1R24A 3D0LB 4OKVB 4FNLH 2QQNL 4OCRH 1I9RH 5JXAL 1I8KA 2DS4A 3CU1A 5CIPH 1A4JB 3ULVD 4HKJA 3VXSB 4B50A 4BJLA 1A7NH 3QFJA 2R4RL 1BF2A 5IESH 3SDAB 1Q9WA 3HAEB 3S36H 1AXSB 4EEEA 4RRPG 3VFVA 3QUYB 4HEPG 2IALA 4JB9L 5CKGA 4ACPA 3U4BL 1HNFA 4M6NH 1RIUL 1DJSA 4HPYL 2JJSA 3EO9L 4MX7B 3UEZA 2X4PB 3RWJB 3BD4A 2CXKA 4OBRA 4LPVA 1YNLH 4ODTH 3D2UA 4QRTB 5EIVA 3ARTA 1JVKA 32C2B 1UVQB 4KDTC 2AQ2A 4JR9L 4K3HA 4F7TA 1JZ2A 3MA7A 1DCLA 2OQJA 3QDGE 5HYQB 5B22A 5KSAD 3QNXB 3AB0B 3GB7A 4K94C 4Z8FH 3WNOA 4EDXB 3WO4B 4XVTH 1TVBB 2GJ6D 3IFOB 1QUNA 2FL5A 2P5ED 4NQDD 3PGDA 4UQ2A 3MNWB 3TPKA 4PB0H 3BMWA 4ODXB 3QI9B 4OF8A 4OJFL 4K3DL 2J8OA 2IQ9L 3VXPB 5IVXF 4TRPH 4MD5A 1BWWA 3ZTJH 2FIKB 1E4KC 4YHMH 3UTSB 5B38G 3X13B 1NGXB 2CJUH 3WDHA 3C6LC 3G08B 3ROOB 3WHXA 1S78C 3Q6GH 3WFBL 4PTTB 2WP3T 4MJ5A 4JVPA 3UDWA 3PWVB 4P23B 5AWNL 4ODVH 3F7YA 4JFOA 3AAZB 1KIQB 2P8PB 3D39E 5TF1L 2OTUA 3QEGL 1FYTA 4R8WL 1IGFH 2GEEA 2AK1L 1ORQB 1MCPH 5DK3A 3VGFA 5T33L 1PG7X 4OZFH 3GI9H 1DQQA 4JQIH 1BAFH 5ADPL 3B2UD 1KPUA 2IAMB 2Y5EA 1MWAL 3EYFA 3O3EB 4XP1L 1RHHA 1I75A 5I1LA 1Q0YL 1T83C 2BX5A 1X6NA 3O8XC 5CBEA 5L7XL 5IW6A 1VDGA 3B9DA 1J12A 2D9CA 1I7UB 1TTGA 5DURD 1WV7T 5E08L 1YA5A 1R5IB 4J8RA 4Q74A 2BVYA 1IE5A 2Z8WC 3OXSB 2EDTA 4Y4FC 3VI3E 1FNGA 4OZGE 4Z0XB 2CLRB 2H8PA 2YSSA 5C0DB 2H41A 1IC4H 3PHOA 5KJRL 3WEXA 1LNUB 3ARDB 4WFFE 3IFOA 3D0VB 1KTDA 5FUOL 3Q0HA 4HXAH 1IGCL 3F6LA 4UTBH 4U1MB 3QDJE 1NCNA 2VLJA 4JM4H 1C5DB 3RRQA 1EFXA 5I75B 4RWYH 3TT3L 4XXCA 3MACH 5D8JL 5IBLC 4E42A 1E4XL 4HMDA 3LD8B 4GFTB 4JFXA 1N5AB 5IMMB 3QQ3A 5DC0A 4DCQB 1A6WH 2OR9H 1EFQA 4LF3A 4M62H 5DD5H 2I5YH 5CGYC 1TJGH 3L95B 4JHBA 5JHDE 1NCBH 2YPVH 4C59B 1J5OH 3SE3A 1L0XA 3F7YB 1N8ZB 1G0XA 4R7DA 2N4IA 3V4PH 5INDA 4JKPH 3LPWA 4XZUA 4YDLB 4M8VA 1IQWH 4TYUA 2IC2A 1JI1A 3MJ7A 4AZ8A 1EBPA 3MA9L 2ADJB 4NC0B 3O4LD 4LIQH 2XZZA 1CTNA 1OTTD 4GUPA 4LLVA 3O6FA 3GI8H 4NIKB 1P7QD 3SDDD 3AXLB 1BBDH 1UJ3A 4TVPE 4P9HH 2VZ3A 4EUPG 4AMKL 1V8HA 1F13A 2IWGA 4JPIB 4HKXB 1BVKB 1W0VA 1MRDH 4I2XE 5SX4H 4J3OC 4LSQL 4X9FA 2IGFL 1CE6B 5E8EB 3V0WH 3PHSA 5HDLA 3RFZC 4ZUSB 4A6YA 3FTGB 2QR0B 3EFFA 4PLNC 1ZTXH 5FCUL 3QWOB 3HC4L 2HTKC 5EZOH 3D3VD 2CKBH 4N0FB 4ELKA 3HE7D 2PR4H 3PHQA 5FF6A 4X7SH 3C6SB 3RHWF 4RIRA 1J0ZA 3T0XA 2WUBL 3BRFA 1L6XA 2B5IB 2OL3H 5E1HB 3SGKC 4AG4H 3ISWA 1ZS8B 4LLYB 2DQJH 4PJEE 3WE6A 5DHVH 2RFXB 3VWKB 2G9HA 4NQDB 4PGJA 1G7PB 1MI5E 1DBJL 2YD4A 3BN9C 4UDTB 2CRYA 2FB4H 3WFHB 4OB5H 1BD2D 4HK0A 4WGWB 5GGRA 2DMCA 5DVNA 2X89D 1T83A 3JV6A 3G6JF 3UXFA 5A1AA 2G2RB 2A9NH 4HLZH 2W91A 4PJ7A 1BQLH 1URLA 4QT5A 4O02H 1JTPA 1VFUA 1OAQH 2E6JA 4HDIA 1FFPB 5IWLA 1S7QA 3GUTB 1UZ6E 4FQ2L 4U4BA 2GCYB 1W2KT 2WWMC 3IDGA 4O02L 4X4XA 4A2MA 4EIGB 2N1KA 4P5TB 1L7TH 4LLUA 5F7DB 5T3ZH 4X83A 1TVBA 4ZTOH 1NMCB 3U30B 4H26B 2DJUA 2P8LA 4IIQC 2BHUA 2J2ZA 1N26A 1PX3A 2ARWA 1KNOA 5CJQH 3TBSB 5HDQL 5E2UH 4WUKH 4CVWA 4N8PA 2AJXL 4GAYA 4GW4A 1P9MC 5JO5B 3OKOB 4BH8A 4OGYL 1KCVL 2D03H 3FQWA 3QDHA 2WUCH 1DBMH 2BJMH 1QSFB 1CFSA 4UAOC 5SWSA 5FECA 1ZT1A 1IKNA 1BMGA 2E9IA 5C07B 4PGBA 3BO8B 3SE4A 1S7XA 3V0WL 1BIIA 1SBBA 2H1PH 2I9LA 4GRLA 5E6YA 4G3YL 3O3DB 1NFIB 3HR6A 1ZS8A 4JFHD 2JJUA 2YS4A 1A1OB 4L8SC 5BJTA 3MNVA 4GLRI 1XCQB 5DUBB 5ACZB 2WUCL 4NNPH 1KLGA 5GGSY 3KYNB 3AREC 5EWIH 2AXFB 1KIUA 3EJYD 3GJFH 5C8JB 4OI9A 1D9KD 4U0RC 4YHLH 4ONFL 3I6LD 3IXTA 1A0QL 4X8JB 2F54E 5CEZE 1S5HB 3MCLH 1H5BA 3MRJA 2GSIA 4PLKD 5T1MB 5C09E 5KBNC 2ZUYA 1F45A 2OCFD 3IRZA 4S0SD 3TIEA 1EJOH 3RWCA 4FXGA 4H26A 3ULUH 5FO9A 2FB4L 1T20A 4WNQA 1H3TA 4CW1A 4DFHA 1T22A 3QXDB 1L4IA 1X5GA 1VHPA 5I66B 3IU3A 5IK3B 1LP9A 5IEHB 2Q8BL 4OI8A 2NY5H 1HHGB 1EA9C 1KJMB 2DI8A 1QBAA 4K3GA 3O2VL 3P4MB 2QEJA 1MJJA 2DLEA 4MCYA 1FNHA 2J8UB 2NW3B 2VR4A 4Z7NE 4XXDB 4LSUH 3A67L 3MRNA 3NCBB 1IAKB 1W0WA 4Y4HB 4UTBL 5F7NC 3CGTA 2R1XA 1RSFA 5EG6C 4O2EB 1U58B 1ES0B 4GXVL 2GITA 3RUGF 1T6VN 3R06A 4PP2B 5CP3A 4XI5D 4KUZL 3MJGX 3ZDZF 4YBLB 3VH8A 4DTGL 3W0WB 1T03H 1D5ZA 1CDYA 2AV7B 3DX6B 3MV9E 1F58L 1MCOL 2F19L 1SJXA 1JZ5A 4Q97A 1BEYH 4V1DB 4HULB 1RJLB 4KROD 2DLGA 3L6FA 1E27A 1HQRB 1ODAA 2LTQC 4P2QE 1TJHL 2CLVB 3T3PE 1LEGA 3MXWL 3MRLA 4MA8H 5L6YL 2VUYA 2XKNB 1R24B 3HI5H 3PWUB 1U8PA 2APWA 5F7MC 3RWHA 2FWOA 2HVKA 5B4MD 3WLWC 4G7VL 3IKCA 1HWGB 4XCCL 5KSUA 1L7IH 5D9SA 5C2BH 3DBXA 3SDAA 4LRIA 4LIQL 4EDWL 2JIXA 2R8SH 1BOYA 2WBJC 1T20B 3DXAE 4MWFA 5DD1L 1IQWL 4NRYA 3G6JA 4TUKH 3MLXL 5FOJA 5JHDD 5D96C 5C0ND 2EIZB 2EDHA 4OQTL 3KPSA 1GGUA 4YHML 1ZLUH 5EBMA 3C60C 4TVPH 3D87B 4YDVA 5C0JB 2A77H 1NCCL 3G6AA 5DJAA 3D18A 5B38B 5FIEA 1D5IL 5HYIA 1QSEA 2SEBA 5EPMA 1IJ9A 5FB8B 5DO2D 1RZ7L 2CIKA 2EYTA 4JZOA 5KS9F 1JF1A 4I9WD 4LVNC 3U79A 3PP3K 4GMSL 4HXAL 2IAMC 3GHEH 4H1LA 4PY8J 4UIKH 5EBGA 3S88L 5FYLL 4G8IA 4Q58C 4YK4B 3ZKNC 3DVGB 2VISB 3QFJE 2ADGB 3U0WH 2ZUQB 3V6ZB 3IS1X 2EEBA 3EHBD 3W9EB 4AY0A 4M6AA 1ROWA 2E6QA 5FUCE 3AMLA 5KW9H 3EYSH 4OFVA 5CD3B 3KPMB 4UMGA 5SWSD 3EZ8A 3CVIL 4GMTL 5C6WH 4U1NB 4LLUB 2AAVA 2ZOLA 4D0DA 5HTSA 3OJ2C 4GG8A 5MERB 2XKSA 4FZEL 4JQIL 5EC2A 2VLME 3SDXB 4GG6A 5IIEA 3IAPA 4DOHB 3TO2A 5BVJB 1MFCL 5CHNB 2DIAA 5D9SB 5ERWB 4J4PA 3TESA 2VERN 3OXRB 2E7LA 4LVOB 2D2OA 4L8BA 4HX1B 3IB4A 2Z31B 2GFBA 5AWNH 3GKWL 3FMGH 3O3UN 4PJ8D 1DQJB 1RD6A 4NQVA 1KFAH 1HYSC 2B8OT 4Z7WB 4MD0A 1DQQB 4D9LH 1DUZA 5CD5D 1JWUA 2NX5A 5GISL 4E0RA 2QADD 2EE9A 3OAYK 6FABL 4XRCB 2ADIB 3ZL4L 5GS1B 3KLAB 3Q6GL 3O0RH 3GMLA 5F88B 1G7JB 35C8H 4Z18A 5IHBA 5DC9B 1OAYL 3O6ML 1XCTB 1KB5A 3O2DA 3OL2A 4RMWA 3U2SA 1U36A 3KS0J 3H42L 4OD1L 43C9B 4BZ2H 4PRPB 1N5YL 3GM8A 5DFVD 1YEGH 2XTJC 1MCIA 5IHZA 4OD1H 4OKVA 4YNYA 4K71C 3NN8A 3ELAT 2YRZA 4CU8A 3LN5B 1QRKA 4PJXA 3VA2C 4ZSOE 3QEQE 1A3RH 1NC4D 2VLJB 3F58H 3G6JE 3MR9B 4HW6A 2QTEA 4NQXA 2QQLH 4JN2B 3HAEA 1AR1D 1MY7A 3GRWA 3MRIB 4V2CB 1KCLA 1UC6A 1T7YA 2HLFC 4XWOC 2F15A 3HC3L 2CXGA 3E3QC 5IFJA 4W4NA 1KIPB 1GC1H 3RU8L 3RPIB 1NGYA 3VXTB 3VWJA 1REIA 4P57A 3CDGB 1VFBA 3C87A 5JOFB 2X6MA 1UCTA 3MYJB 1T1WB 4WCYH 5E1AA 3LVEA 5EU6A 4NN6C 3HTLX 4X7TB 1UG9A 5HDBE 3MLTA 4OGAC 2Q3AA 1E4XI 5CIPB 4FXKB 4KK9C 4G8GA 5FKPA 5I19H 1CG9B 5CKAA 1AC6A 1MFCH 2XY2A 5F1SA 5DJZA 1CR9H 3NFNA 3Q1SL 2YPLB 4LSTH 4XVSL 4M3KB 4ZPTB 4ZUTB 3LKOB 4E0RB 5TE6L 3C5SB 3I6LE 2I26N 4ISVB 3FONA 2AV7A 4I1NB 1M6OA 2C1PA 2YXMA 2D3VA 1XCTA 4RRPA 1KPVB 1P84K 2PXYA 3VFSA 3OKNB 3STZA 3FRPG 4MZ3A 4YAQB 4JPIA 1INEL 3IFNL 3ZT5A 5I17B 1AFVH 4HC1H 1ZVSA 1LVEA 1WSST 4R90H 3S96A 3IVKB 4DUXA 1HKLL 5LAXB 4ZXBC 1A7PL 3MRLB 2Q3ZA 4RGOH 1HH9A 2MPAL 3LN5A 5LWYL 4WFGE 3DGCR 4X6DE 5INCA 3ZYOA 2XKUA 1CT8A 2AJZB 4GBXC 5TDPA 3ROLA 1KYOK 5I18H 4UNTA 3MNZA 2LAAA 4WU7A 3BWUC 2DRUA 5E99L 5IBLD 4P3CH 2OTWB 2A73A 1JCKA 4HWEL 4P4RA 5ID1A 4C56B 4NBXB 4MJIE 2UUDH 1SM3L 1J1XH 2X4RB 1L6ZA 1A0QH 2L7JA 2HJFB 3PDOB 3X12B 5BXFA 1FL3A 4EDWH 1ERNA 4EZMA 1MCRA 5KZCD 3CSPA 5DHYA 3KXFD 5I1LB 4NZTH 4HWBL 2V9QA 3KG5A 3QH3B 4X9BA 5CBEB 4NUJB 5CILL 1CFNB 3DROB 3T09A 1KCKA 4H1LB 3HCVA 4PJXE 3QB7C 4NGHL 1G9NH 5FYKE 3QCVL 1YEJL 1TDQA 1X5YA 4L3CA 1MFAL 3IU4H 3L7FB 4YDKL 1HSBA 1Y18A 5FDYA 3NPSC 3R1GH 4NP4L 1IEBA 1FGNL 2F19H 3PDDA 4OZ4A 1BQHB 4PJEA 3V2AR 3LIZL 2ATKA 2WBJD 3DXAD 2XG4A 5D2LF 2NY0C 4KUZH 5A2IH 3UCRA 4U7MA 5D71H 3UJTH 1YEIH 4LKXA 4NFCA 4MJ6A 2NR6C 3TO2B 3O41B 2V6HA 4LHUG 3T3PF 2Z4QA 1PJ9A 2D31A 4JFZH 3N9GH 4Z6AT 1I1FA 3BZEB 4DGIH 1PKQE 2AJ3B 4NNXB 1F6LL 5EOCJ 3SHSA 5E5MB 5B39G 3TVMB 4Q7DA 4X6DB 4NNYB 4XP5L 2Q8BH 3QFDA 1ZT4A 4OF0A 4K8RH 2XTJD 3Q48A 4PGDB 3SDXF 4FP8L 3S35H 1BLNA 1H8OA 1KYOJ 2X4RA 3S4SA 3VXOB 3VD4A 4FP8H 2P5WB 4QRPE 3LQAL 4YHOH 2BSRA 4WJ5A 4LSSH 1ZLWK 3L9RB 4XP9L 4YX2L 1MREH 2BOCA 4U1GC 4ZAKA 1F6AA 1FV1A 2XWTB 4IEFB 4Q6IC 1ZXQA 4XNQA 5CLWA 2WW8A 3FKUS 3T4AB 1KCUL 2YEZA 3MRJB 3KLSA 4NHCL 1CDUA 1I8MB 5C3LD 43C9A 2HT2D 2YMXH 3L5XL 4FXLA 3QUML 1CXHA 3EYOB 1CYGA 2P48B 3G04B 1DLHA 4JPKH 4GW5B 2R1WA 3ULVH 4OGAD 5E9DD 5IQ7H 4XPGH 4P4KD 1AIFB 2IH1B 5D1QD 1J87A 4N0FA 4ELKB 2R56L 1Y0LB 4N0CC 5IEHA 1J8HB 5HYJB 1G1CA 3V0AC 3C8DA 4UT6H 3MRIA 4LDOB 4OGXH 1CGSH 2C7UB 1FN4A 3RWEB 3ARFC 5IVZA 1QO3B 5E94A 3QIUC 3CUPA 5F72S 4GQ9H 3RVUC 4LEOB 1U58A 2NY6C 4NM4L 1KENH 3GSRB 4NN5C 4HS6A 4I48B 5ICXA 3VH8B 4Y2DB 1FO0A 2OXGA 3P30L 4XC1L 1AQKL 3OKEB 3CFJB 4NHCH 4OCSH 2D7OA 3H7LA 1CXIA 3ZDXF 1T7XA 5J12C 1ED3A 5KANG 5CSGA 3MJ9L 3T0BA 5CJXC 1CICD 2RR3A 1L0YA 2PTTA 1EO8L 1YPZB 1PG7W 3DURB 3SCMD 2FH6A 3L5WA 1Q1JH 3FONB 2XICA 1OWRM 5IBTL 2DKSA 5E5UB 3KR3L 5B39B 4RMRA 3W2DL 1C1EL 3ARQA 1M7IB 1ZA6A 3DMMB 3HG1E 4ZODA 5MI0C 3MGTA 3B4NA 4PJBB 4J1UB 3MBED 2BDNH 2VSDA 3PABB 1TJIH 1SMOA 3SY0A 2VAAA 3HE7A 4XBEL 3UROR 2M1KA 4UTAH 5BW7A 4JM2A 3FT3B 1AHWC 4HC1L 1AFVL 1P7KA 3MLRH 3BDBA 4PGEB 2J8UF 4ZS7L 3WIIH 1G7IA 5KVEH 4UB0H 4YIQB 4DEPC 4HIXH 4DKDC 2HLAB 4MQSB 1A6ZB 5E2TL 1RVFL 2DL9A 1M05B 5HPMB 1FL5B 5ICYB 3CSBA 2E8ZA 5C2UB 5ID1B 3KWWB 5EZOL 5JNYB 1V3JA 4I18A 3FOLA 4LSVL 1X5ZA 1MELA 3DVGA 1ZLSL 4YC2C 5E95B 2ADGA 2AJYL 3T1FA 1JZ4A 5GS3A 3BKJL 4U1KA 4DKFH 1SVCP 2HKFH 4K94H 5C0IB 4LLMB 1CS6A 1QD0A 3MBEC 3MJ9A 2JKXA 4HLJA 5BV7L 5I1CL 2X5PA 4QHUA 5ESVA 4JJ5A 1WK0A 4M1GL 4LNRA 1IGTB 1JUFA 1R3LA 4FQ1H 2F58H 5KANI 3GBLA 2E8YA 3RWCB 4ODVL 3EOTH 2LU3A 1CK0H 4AIZA 3T0EB 4K7FA 15C8H 2HT4C 3QDJB 4ZSOA 4DEPB 5EUOA 3VFMB 3DMMA 1EHLL 4U1LA 1PLGL 2EE3A 1BQHA 3OX8B 3MFGB 1AQDA 1JGVL 1IC5H 3INUH 2HA1A 2VAAB 1BWMA 5HI5D 4ZYKA 4F7EB 3X3GL 3MGOB 3MOBL 1N5YH 1AC0A 1D6EA 3CLEH 3DHJA 1FP5A 4NBYB 2D7NA 2MHAA 3DLQR 3MRBA 3SE9L 1TZHA 2OL3B 3V4UH 1KXTB 4PRNB 2F53B 1S3KH 2FR4A 4F37F 2AJUL 1M05A 4Z78A 1HI6B 2ENSA 4Y4HD 4DUVA 2C4FU 3NMEA 5AAWA 2AQ1A 2DKUA 5ANMB 1RJLA 2X70A 2IF7A 1E27B 2FD6L 4XWGH 3FB8B 1OAKL 5D1QC 1LDPH 4KKCD 4JFPA 1AD9A 3NCJH 4FQQB 4RFNC 5GHWL 2Q87A 4UNUA 2Z92B 5E7FA 3WJLC 1N64L 4QRTA 1NMBL 4OLUH 2IG2H 1E4JA 2BMKB 5F3BA 4WWKB 3IKCB 4I2XB 3BD3A 3O6FC 3K4ZA 3E8UL 3QUZA 3TFKD 4PJ9A 3BGMB 4Q6IB 5GGTH 3ORJA 1YPZF 1UJ3C 5E8DL 1JPTL 2I9TA 2B2XL 1INQA 1DBAL 2NXZC 5KVFH 4EDXA 4UQ3A 1M71A 2DD8L 4U1LB 4UZGA 5E0QA 5JHLH 4BYHA 2BNQD 1FSKB 5DZLA 4PR5B 3QULB 1GC1L 1R5VA 3CMGA 3KPSB 4WENB 5GGSA 5CEZH 2Y1VA 3VGGA 5IBUB 3P77B 4N68A 2Q7YB 3C9NB 3B6SB 3G6DH 3LRHA 4JFQA 4DZBA 4FXKA 3SJVA 2YPLD 5DEFA 4FQXD 1KC5L 1ADQA 1UCBH 1QRNB 4R4NC 4DZ8A 1W72A 1HK6A 3GHEL 5AZEH 1OGAB 4XNZB 4GMSH 2GTWB 3BDXA 1UA6H 3RGVD 1RUPL 2MNUA 4ZO9A 3RL1A 3MBEA 1RJYB 1DR9A 1HH6B 5F1OB 2D7MA 5EO1A 3SPVB 3TZVD 4X6FB 1ZK9A 2X4OB 2JCCA 4I4WB 4QHLA 4RA3A 2BSTA 2V9TA 4OLYH 4CMMA 1JHKH 2NXYB 3VDBA 1MAJA 2A83A 3CLEL 4JKWA 4R97B 6FABH 1FH5H 4P9HC 4XPHL 4ZOBA 5C08A 4DQOL 5IMOB 4GG8B 4OTXH 5ANME 5DSCA 5D7IB 4UDUB 3CVHA 3FO9A 3O11A 4JQXA 5GGUA 5T1KA 3VI4E 3S5LA 4CVXB 1KJVA 4OCLC 1EHLH 2C3VB 3BZFB 3KNBB 4LVEA 4MNGB 3QO0A 5B8CA 4OFYA 5DS8A 4OCNC 4NZJA 2FYYA 3DHMA 4FQIH 4Q6IA 1R5IA 2NY2C 3SY0B 4ZPVA 4GRMB 3QBTB 3OXSA 4YJZL 4HD9A 4XNZC 3NAAL 2X7LA 1JZ7A 2X1XR 3CSYB 1D5BA 3BSZH 5DMIL 4LLDB 4O2CB 3V7MA 1CGUA 2ICCA 3GO1H 3L3GA 4YWGH 1KTDB 4WEMB 3V6OE 5D70H 1GAFL 1CVRA 1MEXH 1HEZA 1IEAA 3IXAA 1QBLL 4EN3B 4XRCA 2V7NB 2NW2B 4PJHA 5DT1L 1RZFH 4FFZL 5ICZB 1BVZA 1OAKH 2MOVA 3VGBA 4PB9H 5LVEA 3RZWA 1PBYA 5F96H 3ARFA 2GSGB 2PW1A 2JTDA 3QUXC 3VCLA 3V5DA 4P3WA 2A74B 5FA4A 1J0KA 4DAGH 1W72L 5IB3A 1Z9SA 3TM6A 4MAYB 3BZ4B 1NL0L 2QSCH 1HSBB 1Y18B 1UB6B 1XGUA 3CDCA 2YA1A 1A6AB 4Z7NF 3OTTA 3EBAA 1P69B 4JRYB 4TSBL 3H9HA 1P4LB 4M7ZB 1UXWB 2HG5B 4RAVA 4O5LH 3M8OL 3RZCD 6CGTA 3O11B 1GZPB 5D4QA 5DMJB 3M17A 2DM2A 3BT2L 2WINB 5CBAB 4LEXL 3BIBX 2ZSWA 2GYSA 4NZUH 3VFMA 4Y5VB 1CD8A 3QZWB 2FECL 4P57B 1IEHA 4U6VL 1U93B 3MCKA 4FQXC 3MLWH 5TDNB 4NZRH 1OP5H 1NMCC 4IJ3C 2BNUB 4M43H 4LCUB 5HHNA 3O45B 3CVHL 4K07A 5KAQF 4JO1H 1Q1JL 5FGRA 2ICEA 3QXUA 3VG9C 4G7YL 5JA9A 5KSVB 3QO1A 3JVGA 3B83A 4NC1E 5ITBL 4Z7UA 4NN5B 4JO4H 3S35X 1VGKB 4ZUVB 5H8DA 1NAKL 3QIBB 4XBGB 2YPLA 1FCCA 3LEVH 3SKJH 3P0YL 3VXMA 2F8XC 3WSQL 5JMRA 2WM0A 4PV8A 4FRWA 3PL6C 4LRNL 2PYFA 1F4XH 1X5LA 2VABA 3DO7B 3VGDA 3DYOA 5C08E 5DMGD 4OGXL 1ZHNA 2PKDA 4UV7H 1WCQA 2FEEL 2BSSB 2YA2A 5JZ7D 1TQCC 5GRUH 4HJJH 1CN4A 4HF5H 5HYSB 3ZMRA 4MCZA 2BNQA 3F12B 5DJ2B 1G7PA 1RUAL 3HNVL 3TGXA 1HH9B 5IMKB 2YKLH 5GSVA 3KPPA 3QQ9C 4M48H 2YN5A 3QRGH 5C0AE 1K85A 5EOQL 1P4LA 3U0TA 1N6QH 5IB4B 4LSUL 1GGBL 4U1SB 4JFFB 1WIUA 1I7UA 1DE4B 3BX7C 4M6OH 3IDGB 1WITA 3MFFB 4KY1H 3QUMH 3TIDA 3OKDA 3BI9X 5HHOE 4Y5VA 1GYAA 4WO4D 2HWZH 4JG1H 5CJBA 3P9WB 4PJHE 1G9MH 2BCKA 4NUGH 4MZ2A 1CFVL 1C1EH 3P4NB 3WD5H 2GTZA 3IJYA 1JHLL 2F53E 4EI6B 2JJVA 2VZSA 4RDQF 2DQTH 4GKNB 4K8RL 5K9OB 2AJVL 3TPUB 3SOBL 2XRAH 4OZFA 3W5NA 2W0FA 5ALCH 3IT8D 5I71B 3QUXA 2GTWA 1DN0A 4HPOL 3ES6B 1DBKL 2KH2B 3VH8G 3WFEL 2VABB 5JW3H 1RJYA 3ILPA 2DB8A 1K2DA 2VLJD 4KVCH 2GUOA 5CGYD 3D85B 5HHXH 2UWEF 4B7LA 3EOBB 1M7IA 2BNRA 1XR8B 2ITDA 1IEBB 1BFTA 3PGFL 2VLKB 3JZ7A 1MHEB 2DWEB 4NQSB 5ECJE 3F7QA 1H8NA 4NN7C 4D8PA 3CFDA 3D69A 4QOKD 1EGJH 3WV0A 4PYHA 3GSUA 3SKMB 1AGFA 1EPFA 2VLRE 3ILQD 1X4XA 2XG5A 2R56H 1ZV5A 1T5WA 3CXDL 3QEHB 4PGEA 1WZ1H 2A0LC 1TETL 4Z7UE 5C92A 2VKWA 5IHUL 4XH2A 5TE4L 2XNAB 2FYYB 2YPLE 4KV5F 1P4BL 3ULVL 4NO5A 3SGKA 5I71C 4RMQA 3FFCB 4NWTH 1CZ8L 4GAGH 2DQUL 5ICYA 5ISZA 1CGWA 5TF0A 1S9KC 5DD0H 3KYMB 3TN0C 1BLNB 3P0YH 3L3GB 3FOLB 4YQXH 1FRGH 4EI6A 2YBRB 3FTGA 2A9ML 3FO1B 1TCMA 5IUSA 1I85C 4XP9H 3V4PL 4Z9KB 3UBXI 1GGTA 3VMOA 4ELMA 2APFA 2UWEB 1WT5C 3QXTA 4YHYC 1RZ8B 3QIWB 2AERT 3NIGF 5FYKL 2EDJA 1G7QA 32C2A 5T5NG 4HV8B 5F9AC 3GBNL 2Y06L 4F15B 4NKMB 1FC2D 2A74A 3K3QA 4K8RD 4DN4L 1A7RL 2GITB 4G9FE 5L0QB 4NRZA 2EH7H 2NZ9D 1CCZA 2C3XA 3TT3H 3LS5H 4HS3A 4DW2H 1JI2A 1FZMA 1S9VB 2BNRB 4XAKE 3K8LA 2QHRH 4XI5C 2ZG2A 3L3KB 5EIIA 4P2RA 4NM8L 4Z7OE 4R2GB 4A6YH 5CCKH 4PV9B 3LQAC 4NKOB 2E27H 4JQVA 4TUJB 1QFPA 1MHPL 1CGXA 1YEEL 4HH9B 2ORBH 1RAMA 3MGOA 3MLYL 1X5FA 4HQQH 1D6EB 5HI3C 2DL2A 1MCHA 2WINA 1EUUA 3HS0A 1N3NB 4GRWE 1FDLH 3OAUH 1CD1A 2P7TA 4HUXB 1CDCA 2OL3A 2AGJL 5I1HH 2FWOB 1OF2B 1RZKH 4X9GA 3DUHA 1I1AD 5HVFB 1MIEH 4LASH 1MCJA 4Q9QL 3HI1A 2LQRA 2VLLB 5B8CC 5KSAC 4Z7VE 5KSVA 3NAAH 2B39A 4Z7UB 1SBSH 4HFWB 5L88L 4MA1B 3QRFM 1U2CA 4YBLC 4YWGL 4NRYB 1A9BB 3D25A 1B9ZA 1MCDA 3FO1A 3BSZL 5IVXA 4Y19D 3BPLC 1AD9B 2PO6B 3GI8L 1RIHH 1ZVYA 1ORQA 3VFOB 4KTDH 3DV6B 1RZ8A 2QKIA 1YDPB 3LEYH 4FQIL 3OKMB 2GW5A 1AGEA 2C5DC 1A7BA 3SEPA 1FNEB 3GIZH 1QSEB 4WWKA 3PL6B 2GY5A 4PY7B 5FB8A 2ZPKL 4YXLL 1GRWA 5BZWB 3BGMA 2YK1H 4D2NA 4O4YH 3TO4D 1NAMB 4IDJL 5KOMC 5E99H 2KDGA 3BPCB 4RA0C 3CDFA 1JWMB 1GH7A 1ITCA 2CLZA 5E6IB 2V2XA 3FFCD 2VO5A 4JM2B 1JE6A 3W9EA 3GMQB 5D1XB 1SEBA 3QULA 5I75C 1OGTB 4R0LB 2ENYA 2WBJB 1AKJA 1NC2B 4FN0A 4HUWB 4PJCA 3ULUE 4HH9A 4N0CD 5L2KB 5CSZB 5EZLA 2NY0D 2WWKO 4TVPD 4MA1C 4M03A 1JRHI 4Z8FL 5MERA 1KCRL 1CD1B 2I24N 4ELME 4FXGB 2VE6B 35C8L 1RMFL 5FO8B 2IMNA 4WTZA 5DJXA 1XGYL 5DD3H 3GIZL 1LP9B 2H9GB 3SO5A 3OXRA 4PTUA 3P0GB 3UTSD 2Y6SD 5FO7A 5C0IA 3HB3C 4HX1A 1YMHB 5D2LE 5CEZL 5EC1A 1N2RA 3N1PC 1RU9H 3GKWH 2NMSA 4PRIB 1TXKA 3RVVC 1OWWA 2XQBL 2QV2A 3IJHA 3QQ9D 5D6DA 5L88H 1SBSL 4KRPD 3IAGC 5T1KB 3GI9L 1AHWA 2W07A 4LSDA 1EUTA 3T0EA 3S5LB 4CVXA 3PQYE 3MRCA 2COQA 1XR8A 1X5AA 5GHWH 5KOVC 3FT4A 5DD3L 1T0MA 1IT9H 5DUPL 2AGJH 5GIRB 5DVLA 4Z7WE 5F3HB 5KTEH 2XXCB 4MNQA 1MRCH 1XMWA 4G9DB 1MCBA 2Z8SA 1DVFB 3DOSA 1I3GH 4UT9L 4FOMA 4GAJL 5IWLC 5GPRA 1AR1C 4FQPA 1YYML 3L3DA 2FEEI 4MD5B 1EEUA 1U92B 4UIKL 3S88H 1NC2A 1U8PB 4WUUB 1B2WH 3TP4A 1FE8L 4XMKH 3F7VA 5I76B 2ATPA 2OS7A 4BA8A 1IGYA 4S1RH 1ZGLM 3HFMH 3I3EA 4QTHA 1FNSL 5GGRY 4OJFH 3UYPA 3V4UL 1IAII 1QPPA 3QCUL 4TULL 4IDJH 1QVOA 1J18A 1GJIA 3FB8A 4PJAA 1IFHL 4JZNA 1JGVH 2VLJE 3EYVA 2UUDK 3C8KA 3FN0H 3RVWD 1NCCH 2KZ1B 3PWPD 2MQ0A 3F7PC 3L5JA 4ELMB 15C8L 5FO7B 3VU2A 4AEEA 3EYUH 2H6PB 3OQ3B 1PG7L 4MNHA 1IKNC 3TH3T 5JOPE 3RZCC 1K8DB 5K9KB 4G8GB 5FKPB 2ZPKH 2SEBB 2HH0H 4GRWF 1CQKA 2HTLC 5ENWA 1AGCB 4X5XB 2HFFA 4ZDHB 4OD2A 4FFVC 2RHEA 1YZZA 4NQED 5E9DA 4X5WB 4BQBA 3BKJH 3FZUD 5D2NE 5T1KD 5GS0H 1A6PA 5CBAA 5F7DA 5C0AA 2LTQB 1RJZA 3OAYH 4HK3N 3UTZB 1RZKL 1MNUH 4PV9A 1WZ1L 1BBJB 4NKOA 3R0MA 3TC9A 5DFVC 5JXEC 5I17A 1YEKH 1ZLWH 1JN6A 2EE2A 5EOTA 4P3DB 3SDYL 4PD4J 1OP3H 4DGVL 5I16A 3QIBA 4XBGA 4I13B 5F9DC 4HIXL 2VTFA 4Y5XA 5F6IB 1IAIM 1NBZB 4X9IA 4A6YL 3HUJA 2WBWB 4PJDF 5I76A 1QKZL 3C2AH 3MBEB 5JDSB 3HI1B 3TO4B 3U0WL 3HI6H 1Q9LB 4HQQL 1JNJA 3HZKB 3RVVD 5JIPA 2VR5A 1JNNH 5C7XH 1RULH 3T0EE 1U8NB 5IT2H 3QG7L 3LKRA 3GSQA 5IW1A 2QHLA 4HPOH 3O4LA 4HIJB 4MB5A 5CJXA 1EJOL 1HYSD 3NCEB 2AJVH 4YBHA 3D2UD 3B3IA 4BUGA 4D0BA 3N50A 3BJLA 1FVEB 1MCQA 2FECI 1D6VL 2MCPL 1XIWC 1UJ3B 5DGRA 3KPLA 3SDCB 1NJ9B 3HUJF 4WO4B 3RIFK 1HHHB 3V6FB 1MFEH 5FHBH 4FHBD 4EUPA 2Y25A 5IJVB 1LO4H 5ITFB 5KSBA 2PCPB 5J3HC 4IRZH 4YQXL 2ARJB 1J0IA 4ONFH 5EOQH 3VA6A 3U1SL 3ZKMD 1YUHB 5C86A 1MLCA 4JKMA 5L6YH 2BNQE 4RAHA 4NQXB 1KN2L 1OL0A 3BKCH 3ZHKA 5B21A 3P9MA 5IVNA 3FT2B 1RUAH 2NW3A 3BIKA 3EYQD 3QXAA 5FYJE 4C4KO 3THMH 2WWMD 1H9VA 2YD8A 1HCFX 1FG2B 4HF5L 4YHYB 4G5ZL 1P84J 4XHJC 3MYJA 4PYGA 5FA4B 3Q3GA 5I8KL 4F8TA 1T03L 1KJ3L 3E0GA 1F8TH 4Y4FD 4QHKI 5EU7C 4HAFA 3LN4B 1YJDL 4HUVA 4O2FB 2DDQL 1WEJL 4JFYB 1IAIL 4E41E 2BY3A 4R97C 3U1SH 1G6RH 2YUWA 1O7SA 2NTSP 3CX5K 4EQ3A 2VH5L 1PEZA 3QIWD 2ERJB 5L8JB 2DOCA 5BMFL 4XPAH 4M1CC 1S7QB 2W59A 1VFMA 3D69B 2GCYA 3M17B 2P5WA 4LSPL 1QEWA 1ZLUK 1JV5A 1HXYA 3IRPX 3MRCB 2ZCKL 3GRWH 3VJ6B 4KQ3L 3TWCH 3FT4B 4DUWA 4U6HB 4ZAKB 2FJFB 1S9XA 1WFNA 1ZLVK 4UILH 4PLJD 4ZOEA 1UQSA 4JVUA 5KSUB 5BRZD 2XPGB 3UO1L 5CEXA 2N56A 4JZJB 3VRLE 1KEGH 3ARDA 3U7WH 2JIXB 3S3JA 4K7PH 4IS6A 1KN4H 1LDSA 5KN5A 3QJFB 5DFTA 3WNKA 1ORSB 5INCB 1HCVA 2R39A 3HPJA 2CD0A 3TBTA 2EIZA 4PUBL 5DRZB 4HIEB 1AXSA 1S7XB 1TZGL 1N0XL 2OTPA 3OZ9L 5L8LB 1T89C 3QUYA 4ODSL 3MZGB 3G6AB 5DJAB 2J8UE 2LV4A 4HJGA 2A73B 1H8SA 3LPGA 2BNQB 4KWUA 4DGYH 4KK5C 1XGQA 2DQEH 3MRHB 5CGTA 4I3SH 2OL3L 4LBEB 5EA0L 5EULV 2WUBH 3DARA 5JW4N 1S9YA 3Q6FA 3BVNA 3GSRA 4HC1A 4R4FL 5IB5A 2IGFH 4LGPB 1QSFE 3RVUD 3TA3A 2XZCH 3LN4A 4FQXA 5ESAB 1FL3B 2J6EH 3PQYB 2BK8A 4O2FA 1WAAA 3JXAA 4Y2DD 1BOGB 2XZQH 3HC4H 4XGZB 4W6WB 2WLZA 5A16A 3QH3A 5KSBE 5M95B 1U3YA 5TPWL 4LSQH 3J7HA 5IR1B 1YEJH 4QOKA 1YPZA 1R3KB 2IPTH 3MV9A 1KN2H 1SJVA 5CLTA 4AL8L 4OLWL 3U6RB 3KHOA 3VJ6A 3ULVE 3F5WB 2RJMA 2IFFL 5DR5H 1MJ7L 1VERA 1BQSA 4JLRA 1IVLA 5J1AB 3MRGA 1C08A 4LVOC 4MQ7B 1BQUA 1IGMH 1W8OA 1F11B 3T0EC 3VGAC 3OHXB 2O26U 2AXGB 2XY1A 5K9OA 1LQSR 4J3XA 3LV3A 4QYOA 4JO1L 3BT2H 3DIFA 3GJFB 2PO6C 4JFEA 4JY5H 3TCLA 2CGRH 5KN5B 4HWZB 2OBGA 2Z31A 4OZFG 1SM3H 2IAND 3E6FA 4KI5D 4KHXL 3UC0L 3RWFB 1MQKL 3IFLH 1N59B 5FF6B 4JRYE 3GMNA 2VDRL 3NCMA 5E00B 5KG9A 3ME0A 1FFNB 1BVLB 3M8OH 43CAB 3K1KC 4U1HB 9CGTA 1ETZB 1T0PB 4J2XA 3WE6B 1ZT4B 3RX7A 3RY5A 2OTUB 1XGQB 2OK0L 1T3FA 5IW1B 2E7LC 1MHEA 2DWEA 4JCMA 3VXQA 3S4SB 1IM3A 5HHPB 4JPVH 1A7QH 1MRFH 4MLSA 3BP4A 3ZDZE 1JYXA 3PQYA 4JJHA 1BD2A 1LGVA 4FMFA 4WI8A 3Q5YA 2D9QB 1A14H 3SQOH 1T5WB 1MFNA 3QEHA 5BVPH 4RNRA 4B53A 3QDAA 2BOCB 1MIMH 1ZTXL 3ZLQC 5IW6B 5CINH 4PJFF 3S9DB 1NJ9A 2R9HC 3K4AA 4J23A 3VFPB 3RAJL 5JHLL 3PWLA 4GKOA 2AABH 5ESVB 3DBXB 1TPXC 2E7BA 1BAFL 2R69L 2J7LA 5JW5A 5TGBB 2VE6A 1YYLL 2B0SH 1NSNH 3UJJH 3WN5C 5F7UA 4K7FB 5FO8A 4WO4C 4Y1AE 3RY6C 3L7EA 2GKIA 1XGTB 4X4MA 5EOCH 2DQIH 5FM5O 4BKLA 2AI0L 4LLWA 4U1JB 1OAXH 4KJWC 4LPWA 3VDCA 5JQHC 3GSOB 1NDGA 2A6JB 5JXEA 1CLOL 5HGDA 1QSFA 1XF4A 2NZIA 2DBLH 3W81A 5IMMA 4WY7L 1T4KB 3QXAB 4EBQH 3QHFL 1A3RL 1RMFH 3BH8B 1UZ8B 4M9PA 3OF6D 3Q3GB 3WUWB 2A1WH 3LKPA 4MJID 3TT1L 2HKHL 4DQOH 5FOBB 1FH5L 4XPHH 5MEND 4TRPL 3JUYA 2AJUH 3MUZ1 5BS0E 5SX5H 1M6OB 4I77H 5DRNB 4UU9A 1INDL 3BIAX 2YR3A 5C71A 3T8XA 3BP7B 5I73C 1MJUL 3BP4B 4MNQD 3NIDF 3S5LG 1EZVY 3MV7B 4ODHH 4PS4H 2IQ9H 5IBUG 3DURA 5I1AB 3EAKA 5C0BE 4F9LA 1MJUH 1X5KA 2HTKD 1FE8H 1FLRH 5FYKD 4JFEE 3SDAC 4D9LL 2YK1L 4NRXB 5AZEL 4HJ0C 4I8DA 5FUOH 3PWLB 1PEWA 2EECA 2A0LD 3V6BR 1MH5B 3HPLA 3WNPA 4JREB 1PW3A 1QFUH 4ZQKB 2DD8H 1CK0L 1YY9C 1U8LA 4KMTH 4OLXH 1RK1B 1S7RA 1FO0H 3E1F1 4KAQH 1MRCL 4LCWD 1I1RA 3GSVA 4KQ4L 5HPOA 2GFBB 3C60A 3QWRA 4RCAA 2X1PA 3SKOA 4BM7A 5I66A 5DEZA 2VZVA 4M7JL 1G9NC 1EEYA 4QKXB 5I1IH 2DAVA 4PG2C 5DJCA 1YDPA 3BRGC 5BXFB 3BHBB 5D6CA 4L5FH 4DVRH 5EFIA 4ZOAA 5EOCL 2ZCHL 3PL6A 3NCJL 3BWAB 4O2EA 2FBOJ 4GS7B 4NPYB 1EXUB 3E6HA 4YE4H 4N1EA 1I9RL 3LKPB 4WRLA 3W0WA 1A14L 2W60B 1A7NL 5FYLD 3B9AA 2CQVA 4H5SB 3BEWA 4LPUA 1YEEH 3QXVA 1S3KL 5C0EB 2R0WL 2CRMA 2DTMH 4LCCB 1QFWM 1VADB 4M5YL 5F70A 2DF3A 5CSZA 1T04A 4X4XB 1NUDA 5I1AA 3S97C 3R8QA 1T1XB 3ALPA 3B8SA 3LDBC 3KPSD 3RIAF 3F5WA 3PG2A 3RA7H 1QBMH 1UKQA 2W9DH 4Y5XB 1AE6H 1NBZA 3MV7E 5DRXA 1UYWH 4KTEL 1QRND 2I25N 1RK1A 1S7RB 4LFHD 4W81A 4P5KB 4M7KH 2AK4E 4X6DA 5I8OH 3G6JB 4POYA 4UINH 3VGHA 4MNGE 3QHFH 3CZJA 5BS0A 3GJEB 3CPLB 3CX5J 3MJ9H 4AENB 3FAXA 3QIUA 4N8CH 1YEFL 1ZHLB 1IGIL 4YGVA 5MHSE 3UTOA 3T3MF 4OZIF 4EN3A 2DQUH 3SGDH 5EFIB 2XWJB 4MA8L 4M02A 5D7SH 1FZJB 3O8XD 4D0BB 3FHAA 3NZ8A 4TOYL 3ARBA 5K59E 2B1AL 2B7DT 2MWCA 3EO9H 3H9SE 1T0MB 5F89A 1A47A 3BZDA 1QYGH 1NLBL 4YZFF 4I0PB 4G8GD 2R69H 1I8MA 4NO0A 4Q9QH 4L8SB 3VXUB 4IDLA 3U9PL 1I8KB 4Y4FA 1IKFL 4JRXD 3P11L 4E9LA 3D39A 4ZFGH 4QRUB 5F1NB 3T77B 1KPRB 3FFCE 1NBYA 3AB0C 5DK2A 3S98A 4AM0A 2ZOLB 4D0DB 2HFTA 3VWJC 1U8IB 3DV4A 4JM2F 4F7MA 5FKAA 4K7PY 4XCNB 5CJOL 1X5JA 2GQHA 4HSQA 1GPOL 5DDHA 5T3XE 1CLYL 2V2WA 5D72H 3H7BA 1MCSA 2OTWA 5E94B 5KVEL 4CU7A 2VXQH 3EYVB 1WBXB 3HE7C 1UM4H 4EIZC 4D0CA 2JE8A 3TN0A 3ULVF 4ZXBD 1Q9KB 2DQHH 1OOAA 4X6CB 4P5KA 2F5AL 3S37H 2KPNA 2YUVA 3KXFA 3MV01 2HJLA 3DETC 4KKBC 5IBTH 3ZZ1A 3UO1H 3QO1B 3GJEA 1S8DB 1A7OH 3SGEI 1K4CB 1NANH 1KN4L 1G7MB 1MWAB 4P5MB 3S35L 2VXSH 4HKZB 3RZCA 1HDMA 4KQ3H 3TWCL 3ZTJG 1DSFH 1G6VK 2ICWB 4LLVB 3LHPH 3EO1A 5D1QB 1KSRA 1NCDH 2FX8H 4WW2A 4J6RL 3RIAK 4UU9B 3CXHJ 4LCWB 3MUY1 1EHNA 1EAJA 3MNWA 1HQRA 4MXVE 4I0PA 3NTCL 5DD0L 3QP3A 2ZKHL 1S7TA 3TH4T 1DANU 4M48L 2E5EA 5C08B 1I7RB 3BRDA 4PD4K 1NUFA 2WZPD 4YNYB 5F9OL 2H1PL 2NY4B 4A6YB 4WHYH 1YEHL 1JPSH 2NXZB 4Q2ZB 2V17L 3MZTA 3QA3A 4ZFOL 4MNGA 4QNPE 1YEHH 4OD3H 4HIEA 4P46A 1MUJA 4UV7L 3T0VA 3W9DA 1QNZH 3QQ4B 2AJ3A 3KYKH 4JPKL 4OLZH 4P2YA 1OB1B 2CK2A 2IAMD 4M1DH 4LBEA 1VFAA 4P2OB 5I8CB 2IJ0C 3JTSB 1NAKH 2HT3D 3VXOA 1LHZA 3CXHK 3F8UB 5BS0D 3TA3B 3GSNH 3KXFB 4R6UA 3OPZH 3ULUF 5D5ME 2X4UA 1KPUB 1CL7H 2LU7A 2EIDA 4Z0BL 2BVUA 1J0JA 4MJ4A 3CVHH 4PJHB 5DQDL 3MC0A 3MV8B 1FFPA 1GZQA 4N9OB 3GUTA 1G7MA 4L4TB 1T5XA 2JB5L 2VXVL 1EXUA 3E6HB 4HKZA 4XPFH 4G6FB 1B88A 1DFBL 4J8RB 1NUNB 1WWWX 4LSSL 4JJ5B 4HHAA 4GXUM 4GH7B 4HFUL 2EDWA 1XIWA 4P4KA 1A1MA 3T4YB 1IMHC 3EDJA 3D85A 1J1PH 5LXGH 4XP4L 3PP4L 4WHTB 5CD3A 1SJHA 5EUOB 3LMJL 4X8XA 2YZ8A 2G75B 2OSLB 4NQSA 1TVHB 4HXBH 4I5BB 4HCRA 4RGOL 4ALAH 1FIGL 5GJTH 1RUQL 5EC2B 5FA3B 3NABH 4JFZL 4H20H 3BIKB 4G8FA 1IAOA 4WW1A 4PJ7E 2VLKE 3LOWA 1ZT1B 3SBWA 3BO8A 2PYEB 3REVB 5E00A 5KG9B 4JHAH 1YJDH 4PRNA 5IROC 3DUSA 1LE9B 4XCFL 4F33A 1BIHA 4H25A 3VE0A 4PJDA 2AKRA 3VFNB 1NQBA 3TEUA 4AEFA 4RFNB 3AREB 1FVCB 3OKEA 3PJSB 3MNVB 4NP4H 1XF5B 3IDNB 3AM8A 2LAGB 4JDVA 1GAFH 1QHOA 3D39D 3OB0K 5AYUL 3T0ED 2HMIC 5E70A 5DFWH 2P4AB 4JFFD 1WWCA 1F4YL 4JFDA 4F58L 5TQ2H 3LRGA 2QSQA 4EKXA 4P9HL 3G5XB 1HQ4B 1KT2B 4WI3A 4HV8A 5HYSA 1NDMA 3K2UL 4FMKA 4R26L 2IPUG 1QFWL 5FCSH 4J1UA 4LK4A 4X9HA 3DECA 3T65B 5EO9A 2EC9U 4R7NB 1NCAL 4NZRL 2HH0L 1FZKB 1EO7A 5DD5L 5IEKB 3JV5A 4U2YA 5LCVH 1S7VA 4WFFD 3FO0L 5DRZA 3DRTA 3SCMC 4WW2F 1KB9J 3ZSSA 4P3CL 4G42A 3LKNA 4RIRB 5TH2B 4O9HL 4XX1G 3OR7A 4CBPA 5EUOE 1IM9B 3CIQA 3HS0B 1QRNA 1S9WB 3U83A 3KWWA 2M26A 3QG7H 5JNYA 4Y2OA 1GC1C 4LPCA 2EDLA 4QHNB 1ES0A 1S9YB 2R0WH 1I1CA 3UTSE 3QCTL 3JV6B 5FYJD 3FB6A 4PJ7B 1VEPA 3BPOB 1CG9A 2P45B 3NFPB 1OCWL 1UM5L 1S8DA 5GZOD 3C09B 3SE3C 1QACA 5ETUA 4PJGE 1HE7A 2Z8VC 3DTXA 4BQ8A 4MA3B 3Q1SH 4JAMB 4ERSL 4LL9A 3K7UA 2Z31D 25C8L 5TE6H 5EZJB 4S2SB 2ESVA 5DHVB 4HG4K 4PLKC 4OLVL 5IV2A 3QUMA 4S1DD 1HQ4A 5L7XH 3CMOL 4OV6F 1FNEA 4M9OA 4WHDA 3VFSB 1Z5LA 4IRJB 2OI9C 4LCYA 4QRRB 2ZCHH 1WISA 2G5BA 4N0UB 1YNKL 1U8LB 4N90E 1T1ZB 2P49B 3QDGA 3REWB 2F74A 1N0LA 2NY6B 2VDNL 3V52H 3C60B 1FZKA 5IEKA 1A8JH 4Q2ZA 1LO0H 5DWUL 1N59A 3V8OA 4WHCA 3ARXA 3DETD 2PF6A 1I3RA 3FQTB 3QI9D 1Y6KR 2XFXA 4I18C 3GMRB 5JW4Q 3HKFA 4ODHL 5HGBB 1V7NL 4R9HA 3MRMA 5I8CA 3B2UC 3S34H 1WICA 1FFOA 1NEZB 5DJXB 4QRPB 3RWIA 3WIFB 1MHHB 4L4VB 3QQNA 1OP3K 3MREA 3N1MC 2XWBB 1DQTA 1JJUA 2R15A 4TQEH 1IL1A 1J05B 2NY5C 4QNPF 1EGJA 1UFUA 5GISH 5GRYA 3O6KL 4L29A 3RI5F 5TE7L 3MRPA 1XGUB 1R3JA 3IDUA 3DXAA 5EN2A 4IRSC 3DROA 2BMKA 3HCVB 5F3BB 2X9WA 5D1ZD 3ESUF 4BSJA 4WY7H 5J6HA 4RX4A 2GAZB 5CSBA 4PRID 1U8MB 4FQCL 5MEOA 5AG8A 4UT9H 3GBMH 3MGAA 4F37K 1FCGA 4XCCH 4PJBA 3WKMH 3BPNB 1CI5A 3PABA 5I74C 2VITA 5FYKU 4XVUC 4L8BB 3K8KA 1FAIL 1F4YH 4LAQH 1DQLH 5EBWB 3UPCA 3W0WE 3NH7H 2R4RH 3CPLA 4N5EC 3VGEA 4KKBD 4RWHA 5GS1C 3VXMB 3O3AA 4JB9H 3UBXB 4XNXL 4WUUA 1A6ZA 4FZEH 4QTIL 2FO4B 2XFXB 3KXFE 4KI5E 3I02B 1MCOH 3S36X 5BVPL 1MPAL 2AKRB 4OZHF 3JSSA 3DX7B 3MLZH 1H0DA 4HT1L 5LGHL 2R2HA 4M3JA 1U2HA 5D96B 1G7JA 2FZ3A 4HWNA 3VRJB 3BGAA 4Y16A 5E8NB 3TCXA 1VKXA 3ARSA 4GXVH 3CDYA 3S4SG 5JTWA 2JK5B 1WWAX 1CFQA 1N4XH 1SYVA 4U6YB 5B3JF 3VD9A 1WTGT 4GG6E 1MCLA 2VDPH 3IKKA 3MODH 2DTSA 3F6IA 1XF1A 3GMOA 1AI1H 4FABL 1FHGA 1LEGB 1OGAE 2Z9TA 4WU5A 3DV6A 5JA8B 4KUCF 1FNLA 3UTPE 2YZ1A 3ZKXB 2O5XL 2K9UA 4MLIA 2VXUL 5ABDE 1A21A 1NBYB 3P0VH 3MR9A 5K9QG 3ZYIA 2GAZA 2E6PA 4U1SA 3HE6C 2EEAA 3A6OA 3FQNA 2F54D 5CEZD 2R1WB 4ZPVB 1WZLA 3VI4F 3AS1A 5FDWB 4GAFB 4KHXH 4G6FD 5C2BL 3GMQA 2YD2A 1AQDB 2JB5H 1HINL 2GJ6B 3PGCA 3P4NA 1R3IH 5DTFA 1CDGA 4XAWH 4ZUUB 4YHLL 2XTJE 5DUMH 3LEYL 4CUCA 2E7MA 4BELD 1J0YA 1CL7L 1OW0A 2AEPL 5EWIL 4AL8H 4DN3H 1S9WA 3NFNB 3OAZK 5M7QA 1T80A 3X13A 3LKQB 3ARZA 3LKOA 3V8CA 3WJJC 5D5MA 4Y2DA 2ICWA 2UY6A 2UVEA 3DX7A 3KYOA 1F3DH 2RGSA 2W60A 2FGWL 2NY7L 4H5SA 4UBDC 4WI7A 4BZYA 4D3CL 1QNZL 5DK0B 4RQQB 5EBLB 3MUGA 4MAYA 4UV4L 2PXYB 1ED3B 1JNHA 5I1HL 2PN5A 2EKJA 5MENE 3CZFB 3WO4C 2VC2H 2Y6SC 4JGJA 1DUYA 3AMKA 3RWGA 1BREA 4HMCA 4UNVA 4ZS6C 4JFPB 2BFVH 1Q94A 4NO0D 4KDWA 2BP3A 2Y07H 3LEXA 2BHYA 3IETA 5HGAA 4H0IA 4M4RA 2VDKL 5KVDL 5J12B 5EU6E 5IV2B 2W9LA 1GZPA 3KPQB 1J8HD 4P2QD 4KRPC 1ZHKA 1OY3B 4GBXD 4ZS7H 1C16A 5F7HA 4TNVK 3BUYB 4XAKD 5F3HA 4UIMA 4KVCL 3DVIA 3RNKB 3SDDC 1KEGL 1A7RH 4WTXA 1KLUA 1WBYA 5ITFA 1F3JA 3ARGD 1R5VB 2ZNXA 1VB9A 1V3KA 3MOAH 4ZUVA 5JHDB 1S7UA 1Z9LA 4Z77B 1HHIA 2NY3B 4U1MA 1K6QL 2W0LA 5HHOA 4DVBB 2PXYC 5DHYB 2EE6A 3EUUA 3CNKA 5ELIA 3KLAA 5GSRA 4CRPA 4H88H 1JPGA 1G7HA 4I0KA 3I75A 4JANB 4O51A 2FBJH 1QPXA 4G43B 3S8WA 2ED8A 2CDFA 3ARBC 4PRBB 4XX1E 2O61B 5GRWA 3CC5B 1IAIH 5JR1L 1MSPA 4PRDB 1LE5A 4IHOB 1GGIH 4NNPL 3DMMD 2H2PD 1SEQL 4LLMA 3L7FA 3H3KA 5I8KH 1LP9F 1HXMA 1PZ5B 4QRUA 2VDOL 5F1NA 1KPRA 1EVTC 3NA9H 3QRGL 2DDQH 5FCUH 1AGCA 4X5XA 4YDKH 1LO2H 4AH2A 4HJJL 3MJ7B 3VXUD 3U7YH 1MQ8A 2ADJA 3GIVB 2WV3A 4AIZB 3GB7B 4CN1A 1KJVB 3TYFA 2Q86A 1J7VR 4NT6A 3TVMC 1U3HC 1RJZB 4KKAC 5F1IA 3QXWA 2WNGA 3KPSE 1QYGL 3WS3A 4Y4KC 1IILE 5HHXL 4X6EA 2OMBA 2OR7A 4JO4L 1T0NB 2PUQT 4X99B 1KIRA 4K8RC 4QRQA 4NHUA 3QFDB 1JHTA 3TJEH 3PV6B 5DO2C 3VXNB 1EFXD 1KTLA 1QRNE 4LU5L 5E2UL 1I3VA 1L7TL 2OZ4A 3ZE1E 3VFTB 3IDJA 2CKBB 1CE6A 4JQVC 5E8EA 2ARJQ 3QUXB 2AK4D 3HNSH 1MAMH 3BESR 5ITBH 7FABH 4ZTOL 1NGXA 1MREL 5IVXB 1LO4L 4J6RH 3JUZA 4JCLA 4MAYC 4U7SA 4PTTA 1NCDL 2FX8L 5IG7B 2DI9A 3D3VB 1SJEA 1JK8A 3SJVD 1FG9C 1GHFH 4M7KL 3L9RA 4R4BB 1RQ5A 5JUEL 3I75B 1J5OL 2VXSL 4KTYA 1AGDA 2UZXB 3STZB 3OR6A 4NJ9H 1TZIA 4RISL 2AXHA 1U8HB 1E28B 1CD9B 1XF3A 2VLKA 5GQBA 4ZAKC 3IVKA 3GMOB 1E4XH 4IIQA 4EQ2A 2MPAH 3O4LB 4HKBA 4HIJA 1I3UA 2CUIA 2ZOKA 5FM4A 1AIFA 1L9NA 4MHHI 1GGBH 1IC7L 1WZMA 1WFOA 4R90L 1MOEA 1P7QA 2PR4L 3KPRB 3VW3L 1J8HA 4JO2L 2G60L 3DRQB 5I1GH 3LKNB 3GGWA 4LLQA 5D7JD 3OR7B 5KJRH 1D7FA 1KUMA 3MV9B 1AY1H 3STBA 4EUPB 1MPAH 3W39A 4XNUH 1LD9A 4NJAL 4XVJL 3SE4C 3QDME 4LEOA 4ZFGL 4ORZC 4TTDC 4G6MH 2D0HA 2Q76A 3O45A 2K3TA 4KJYA 4JHWH 5DD6B 4PG9B 4DOHE 4DZBB 3LCYA 2X4QB 3OKOA 4HUUB 2FX7L 3L3HB 2BZDA 3BH9A 3UYRL 3EOAA 1NKOA 4AIOA 5LQBH 5EC1B 1TQBC 3WSQH 4Z7QF 2FX9H 3GFUA 4KK5D 4JAMA 3GK8L 1MCNA 2OYPA 3UTPD 3KYOB 4G7YH 5ILTL 4KJQC 5BV7B 5B39A 5KAQG 1X6LA 1AGDB 2VDQH 4OF5A 3IS0X 1EH9A 3VRIB 1C5CH 3MJ8A 4EUPH 4MHHG 1BJMA 4KMQA 4GKSA 5C09B 4KROB 3MGTB 5DHXB 1UYWL 3Q5TA 4XZUB 5JOPD 4I3RH 4K2UL 4P4KC 3RKPA 2ATKB 4HGMA 4BZ1H 2BERA 3IETB 5HGAB 1RZIB 2K7PA 4L4TE 1XCQA 5D7LA 2ZP0T 1PKQB 5DMKB 4LKXB 5I1KH 2FATL 4CADB 4U1IB 4NQEE 2PYED 3CU7A 2ED9A 1NMAH 1IAOB 4WW1B 2W65A 4FTVB 4NKIL 2CSPA 5D6DC 4M6ML 3T0WA 4JFFA 4DK6A 1JMXA 4KRLB 3AXLA 1Q72L 1OM3H 1INDH 5DVOA 5J57B 4PJGA 3QFJB 4S1RL 1HOCB 2WIIA 1MCEA 3QEQB 5GJSL 4FABH 5I1JL 2XPGA 3MTRA 3CLFL 5AZ2L 4ETQB 3DPBA 5FGBA 3T2OA 1N4XL 4ZUSA 3TA3C 2P42B 4AEIL 4N1HB 3QXDA 4JZNB 1G6RA 5I30H 4BKLB 4NWUH 5AG9A 3G6DL 4PJHF 3H9SB 4JFDB 1JPGB 5C6TH 1JPTH 4QTIH 5E7BA 1NDGB 4JDZA 5GGTL 5E08H 4Y8DC 1TTFA 4Z95L 4NO2B 2YEZB 3GO1L 2EYSB 1IGFL 3AY4C 4XCEB 3K1DA 4XBPB 1J8HE 1NSNL 3PXJA 4KZDL 3FO2B 5EU4B 4GW5A 3EIFA 5BOPA 3BOVA 3BZ4A 5F1KC 3SBWC 3VWKC 2C26A 4HZLA 5L9DH 4XCYA 2QBWA 2V5TA 4NQTA 3H2WA 3K8MA 4ZUWA 3B43A 5A16B 1NMBH 4IOFD 3GBML 2CJUL 4FNLL 5SWQA 2VUOA 5E4EC 3C5ZD 1AGFB 3TV3H 2MKWA 3FRUA 2Q6WB 4HZAA 3RDTD 4NT6B 4PRPD 4RZCB 4ODWB 4PS4L 2NXYD 1UKSA 1IARB 5AZ2H 5DRWB 4DJMA 4MQ7A 4ODBD 3I02A 5GJSH 1NMAL 4GO6B 5ID0B 4F7PB 4GW4B 2FSEB 3GSXB 4FQJL 3KYMA 2ZG3A 1NBVL 4KKLD 3S34L 2J6EA 2EDQA 2VL5B 5FHAH 2UV3A 3EW3B 2H3NA 2HFGL 1AD0B 3U4EA 2VJXA 3HG1B 4P46D 3MOBH 2VWEC 1YMMA 3WLBB 1I7ZA 3W5MA 3QIBC 5C0RH 1NCAH 2UZIL 2ZSVA 3ABZA 1CLOH 1UXSB 4XPTL 1Z9OA 1GXEA 3BHBA 1YEDA 1ZEAL 1IC5L 3TBVB 2F58L 1G7QB 4YXLH 5D6CB 4UI2A 1PGRB 1L7IL 4KZEH 2D7TH 4G8GE 2EDOA 4MCZB 3BWAA 1X44A 1XF3B 3PWPB 4P5TD 3AFLA 4MNQB 5EU4A 4U0QB 2HKFL 4K94L 4MA7H 4WO4A 3IGAA 4WTZG 4CL7A 1KBGL 1MCFA 2VISA 2AI0H 3CFIC 3QEQD 1MHCA 2EZ0D 2LABA 3WKNA 1MIEL 4Z7VB 4RNRB 4LCIL 1T7WA 5E9DE 1QG3A 4DKFL 2EYRB 5I2IA 3FQTA 4LCCA 5TFSH 3BAEL 2ICWI 3H9YA 4Q9BA 3V7AE 2FX7H 1PY9A 3QSKB 2Q20A 4PJ5A 3UTTD 1VEOA 2I60L 3CVIH 4GMTH 4ODWA 3PL6D 1JYVA 1LDPL 3VFVB 3ZSTA 2R0ZH 2BVOA 4AEIH 1DQDL 1YQVH 1P7HL 1VSCA 4JO2H 4L9LB 4JDTL 4BQ6A 2EKSB 4FQHB 3RL1B 5T5FL 5H37G 3MREB 5J89A 1T21A 2R0LL 3WN5B 1RI8A 3CFKB 4NCC1 1FIGH 1RUML 1JNHB 3MLPA 3IDIB 2J1KA 4JKLA 2E9WA 3CZFA 1JNLH 2XN9A 3MRNB 1IC7H 2A83B 1P5VA 3QUYC 4RISH 2EO1A 4PJIF 5CWSA 3ILPB 4WEBH 4XBEH 4OD2B 3MO1A 5IMOA 3ZKMC 2A77L 5I1KL 4URTB 3ZDYE 1ZHLA 5I8EB 3R06B 3ULUL 3ZDXE 5JUEH 2CGRL 3AU1A 4YGVB 2BVPB 4R96B 4YDIL 5FOBA 1YY8B 4JKKA 3RL2A 2CUMA 3L1OH 3ULSB 3K46A 3CH8A 5CUSL 3ZYZA 2RAMA 3VI3F 2NNAA 4RBPH 3WNMA 1TIUA 3UTZA 1IGML 2Y36H 5C9KA 3V4VH 4PIRF 5EU5B 2CDEB 2H26B 2Y4SA 4HUKB 4WDIA 5SWZE 4QF1A 4OCYH 4L3ED 3QT2A 3WL9B 4LSPH 2MTPA 1EIBA 3GSNL 3QDMB 1FNAA 3NN8B 4MS8C 5IB1A 2EYRA 4Z77A 2QQKL 4PJXB 4N0YL 4NM4H 2FLBT 1G6RL 2V5SA 3D5OF 2B5IC 1TETH 2HVKB 4PJGB 3T77A 3GDBA 4LDEB 3ROOA 1Q9OA 1KEMH 3EDDA 1WGOA 3ZT7A 3JWDC 1CIUA 4LMQI 4QY8A 3DSNA 5FV1L 4LFHG 3QI9C 4JN2A 1YMME 1G7HB 3OGOE 5FM8A 1CLCA 4APQA 5D7IF 1KTKE 5DVMA 4PPTA 1FZOB 5ANMA 5BRZA 4JHZA 1QLFB 1U8OB 2OLDA 4JREC 4PJ8C 2WQ8A 3JTTB 1KXQE 4OFKA 4XVJH 1JPSL 5JOFA 4PP1C 4X80H 3ZHDA 2OI9B 3TN0B 2XZCL 3BVNB 4PTUB 3C6LD 4OSUH 3GMMA 4BK4A 4JDZB 4JRYD 3ARGB 2ZJSL 5C0CE 1U3ZA 2BRQA 3OKLA 4LQ1A 2E9JA 2YD3A 4A2LA 3VW3H 1T6WA 4X6BA 4H20L 4NKMA 1QA9B 4PJ9B 4ZPTA 1SY6L 3KPLB 5IFHL 1I4FA 2VLRD 5MEQB 3O2VH 5HY9B 3ZE2F 4C57C 2AJSL 1TJIL 5JR1H 3V6FA 1YY8A 3RL2B 4K7PX 2ADFL 1DSFL 3HC0B 3ULSA 3G5ZA 4GBXA 4FTVE 3WXVH 1K3ZA 1NFKA 4ZUWB 1B0RA 1V3LA 3VG9B 5ALBL 1QZ1A 4G6JL 3MRFB 3DUUA 2P43B 3EFDH 3RVXD 3TFKC 1OAQL 3H6JA 4H88L 2OJZL 1U8KA 2JJTC 1OTTC 4Q0XL 4NHUB 4LPTA 1E6JH 3QUKA 3NCYP 5JPMA 2VLKD 2R2BB 4Z7WF 2YOCA 1T1XA 1HKFA 3SGDI 1F5WA 3MLVH 4F3FB 1OHQA 3BISA 1U9KA 3H3BC 3WFCH 3RWFA 3QQ3B 2ZCKH 4DCQA 2PYFB 2D0FA 4LF3B 1RULL 4Y1AD 1A2YA 1A22B 4RBPK 5BW7C 3ZTNH 5TDPB 3ROLB 2EH8L 1MLBA 4RQQA 5EBLA 4X7SL 5IGXL 1DANT 2ID5A 3HI6L 1NFIA 3OKKA 3VFUA 4LIQE 5D2NB 3WS6A 2DM3A 3CAFA 3MLUH 2IADA 5E8OB 3VFWA 1QFHA 1YMMB 3WLBA 2MSPA 4RGNB 1YC7A 3B9KB 4UV4H 4DGVH 3ARGA 2BVTA 4QRRE 1ACYL 3OKLB 5I74B 2AXFA 3SGJC 4G5ZH 1CU4H 2P8MB 3BP5B 5C8JA 2FO1A 1C16B 4NGHH 2AEIT 2J3SA 1U6AH 3UAJD 5FXCH 5DJDB 4ONHB 2YPKA 1QA9A 1DE4A 4S0TD 3IU4L 2VQ1A 5AAMA 5C0CB 1S5HA 2P24B 3ULVC 2D7QA 1HHJB 3Q5OA 3C09C 2NXZD 1W0VB 1RK0A 4GBXB 3UTQA 3TIEB 1KLUB 1WBYB 2R1YB 5CFHA 4N0YH 3FL7A 4CKVX 3SKNA 3U48A 4TPRH 5DZNA 1L0QA 3QI9A 5D1ZA 1LEIA 5JOEA 1YPZE 1XGTA 4F9LC 1ORSA 5EZLB 3NCCB 5D1XC 5IK3A 3HR5B 4Y4HC 1KJ2B 5ISZE 1XFPA 4YDIH 3HN3A 4HLZG 3C6SA 1NGZA 4M43L 4B7IA 4F3FA 2VB5A 4KJQD 4L4VE 4KKCC 5CUSH 5F21B 5EUKB 1FPTL 4JY4B 4JRXA 1IAKA 1NGYB 1W0WB 4MJ5B 4MMXC 3O9WC 1CTOA 2R1XB 5AEAA 3MRHA 1K2DB 5DZOA 5IT2L 2APXA 3RDTB 5MEPB 3CFKA 5C1MB 3RA7L 4PRHB 2YXFA 4LQFL 3VXSD 3MBXH 5E5MA 3VFNA 3B8YA 3HMWH 1HKLH 1BZ7B 1ZWIB 2NXYC 1G0DA 2YUZA 5DA4A 1IZKA 5D7KD 3QR2A 4JRYA 3MQIA 4JDTH 4YXHH 3GHBH 5CWSB 4ESKA 4QWWD 1K4CA 2KUTA 1YEIL 2A6IA 3C5JB 4P5MA 5CEYA 1A1NB 5KS9A 1YYMH 1QLRA 2RBLA 2YD9A 5D7LD 3RX5A 2BSRB 2ZSWB 4R2GC 4Y16D 4G80B 1RHHB 5SX5K 1FVEA 4EI5D 1SYSA 3O2WL 1X7QA 4XT1C 3QZWG 5GIRA 5FYLE 1C08B 2VQ1B 4G9DA 3IDYC 2XYCA 3SDDB 4X99A 4NKDA 5F71A 4D3CH 2CDEA 3QWQB 3HPLB 3SDYH 5HHVH 2YSSB 4KJPC 5I19L 3NCYS 3PWNA 1ZGLP 4BSVB 4J4PD 1WFTA 3DIFB 4MA7L 2IANA 3A0OA 4ETYA 1MFDH 4R7NA 1SMAA 1CR9L 4LCIH 1LEKA 1C7TA 4AJ0A 3QEGH 1T89A 3T0DA 4OZGB 3E6FB 2VLMD 1PSKH 2GY7B 3UBXG 2R23A 1D5MA 2I07A 4I0PD 5BZDB 1NCUA 2AEPH 1J10A 1WQVT 4YPGB 5GGQH 4XNYH 3TBWB 1PG7H 1VESA 2X05A 1CWVA 1X9QA 2JCCE 4GRLB 3ARRA 3C5ZA 5I15L 2ZUWA 4LLAA 4NQEA 5L2JB 3V7AG 1WCBA 2Y7QA 3F58L 2EC9T 4KVNH 4P2OA 5TJWK 5EO0B 4LGRB 2F9BT 3PQYD 2KBGA 2ZG1A 4OTXL 2JIXD 1NEZG 1N8ZA 1TQBB 2ITCB 4PJ8B 1NGWA 3TNNA 3NPZB 2NY2B 1MJ8L 5LGJA 1A6WL 1IFHH 4HEME 3U0TB 4NZDA 3UMTA 4X6BB 1KTRL 5C3TA 1JBJA 5C0EA 2VXUH 3DRQA 1NCWH 1VADA 4YHIB 1DEEB 1MJ8H 4X5WA 2AEWA 3HFML 1X5IA 2X09A 1NC4A 1AI1L 2NYYD 5EZJA 1EEZA 5C0BB 1GIGH 4P4KB 1S9XB 2A1WL 2X40A 4J3TA 1H3VA 4YHZL 1KG0A 3EJZD 3PGDB 4PJCE 4TSCH 2GTZB 4UQ2B 4KKAD 3ZDYF 5J8OA 4PGCB 2EDFA 3NIFF 4BH7A 2X9YA 5JORA 1FYTD 4JRXE 4HUUA 2DI7A 4TSAL 1KCSL 4WFED 5GS0C 4LLWB 2DQCH 1TVHA 4M00A 3BH9B 1FJ1B 1S5IL 3GSNA 4G9FA 2MCG1 3STLB 5HGDB 1JGLL 1J8KA 2GK0A