1LK5A

Structure of the d-ribose-5-phosphate isomerase from pyrococcus horikoshii
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
229
structure length
229
Chain Sequence
MNVEEMKKIAAKEALKFIEDDMVIGLGTGSTTAYFIKLLGEKLKRGEISDIVGVPTSYQAKLLAIEHDIPIASLDQVDAIDVAVDGADEVDPNLNLIKGRGAALTMEKIIEYRAGTFIVLVDERKLVDYLCQKMPVPIEVIPQAWKAIIEELSIFNAKAELRMGVNKDGPVITDNGNFIIDAKFPRIDDPLDMEIELNTIPGVIENGIFADIADIVIVGTREGVKKLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-Ribose-5-Phosphate Isomerase
publication title A hyperthermostable D-ribose-5-phosphate isomerase from Pyrococcus horikoshii characterization and three-dimensional structure.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Isomerase
total genus 76
structure length 229
sequence length 229
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2002-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lk5A02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lk5A01
2W48A 3L7OA 3UW1A 3K5PA 3OFFA 2JOQA 2QSWA 2QMXA 3S1TA 3E7FA 2H9ZA 4OQPA 4OQQA 2R5FA 4X84A 2BKXA 1CD5A 3P96A 2ZHOA 2WU1A 1UJ6A 1O8BA 4GO7X 3CSSA 4NMLA 4IO1A 1FS6A 1M0SA 1HORA 5JJBA 3U7JA 3BXEA 4L5JA 4GMKA 1FRZA 3LUYA 2RI0A 4R9NA 3IXQA 5FIIA 2CDQA 5IS2A 3DHXA 3W7BA 3EB9A 2LQJA 2BKVA 5T41A 2LVWA 3CH7A 4L51A 3BXFA 1PSDA 3O1LA 2I9SA 3TUZC 4LUBA 3AB4B 3BXGA 2DTJA 4GO5X 3E15A 2MDAA 2KO1A 2RQMA 3CEDA 3LHIA 2DT9A 2OKGA 2O0MA 1Y7PA 2P9GA 4TM7A 1KS2A 3MWBA 1U8SA 3HN6A 3NWPA 3DHWC 2J0EA 2F1FA 1NE7A 3NZEA 1DEAA 4L4YA 1JT9A 1LK7A 3OFHA 1SC6A 3KV1A 4L50A 3MTJA 2RE1A 4L4ZA 3OFGA 4TM8A 1FQOA 1RWUA 3LOUA 2RI1A 1ZPVA 1LKZA 1XTZA 2PC6A 5IT0A 2F8MA 4L5IA 1UJ5A 3NRBA 3OC6A 1LK5A 1YBAA 1VL1A 3LWDA 3AAWB 3OFEA 2RQKA 1YGYA 3OBIA 3DC2A 2GNPA 3ENVA 5IT4A 4GO1A 3IBWA 3ENQA 3DDNA 3ENWA 2NYIA 3BXHA 3TX2A 2P9EA 3MAHA 4R7TA 4M8LA 3TUIC 3EFBA 2PA3A 2QRRA 3AB2B 1FSFA 4PWUA 1FS5A 1PBTA 3TUJC 5HJ5A 3N0VA 1Y89A 3HHEA 3KWMA 3ICOA 1HOTA 2FGCA 2J0XA 1UJ4A 2J0WA 2P9CA 2JHEA 2QMWA
chains in the Genus database with same CATH superfamily
5K5MA 3LP5A 3HP1A 2FJBB 3NDPA 4IR1A 1RWMA 1VHQA 2AH5A 4QOJA 3A3NB 3OG9A 3TWOA 1Z2ZA 5EE3A 3DBOB 3NCHA 1YXMA 1XCLA 4DMKA 2A5FA 2C07A 4CMBA 2OM6A 3FD8A 3OQVA 4QSHA 3DFIA 3L7CA 3N74A 2QU8A 4UQOA 2ZYRA 4NCXA 1NBMD 2VA3A 3M6IA 3TCKA 5A03A 2AXNA 1K75A 2J30A 2W2PP 3M2UA 2Y2UA 3KSRA 1VL2A 3AXKA 3HO6A 3E1SA 5TMPA 1E7MA 3GOHA 2W2OA 4HL9A 4LF9B 3Q2OA 3NZEA 2G07A 3OFHA 1P3DA 4RA6B 1E9VA 5JNVA 1XJCA 2ZJRQ 5C46F 5AJVB 3WTBA 4CQMB 1BQ3A 2JCXA 3N70A 4L3WA 1A9ZA 4DEYA 2X42A 2G04A 2W11A 4EFKA 5K3EA 3BK1A 2J7PD 4MV0A 2YPZA 3DZCA 3MA0A 4X63A 2EK6A 4W5QA 4QODA 2DBBA 1CNEA 1YJBA 2WR8A 4NX9A 4OZLA 3W2HA 2PUCA 1Y1LA 5D86A 3DLCA 1T9YA 2XMVA 5ETKA 2DUWA 4OZ5A 2J4CA 4JEMA 4RF5A 1N3IA 3GT7A 1M0SA 4WN9B 5EERA 2C98A 2VZLA 5JC1A 1V11B 4ANCA 3U19A 2IJRA 2A58A 3ND6A 5E9JA 4LRTB 3ZQJA 1YUNA 4JELA 2EC5A 3W4JA 4PWDB 4XPCA 2HEGA 3UATA 1FTWA 5LP6A 2WICA 3J81U 4IINA 1AG9A 1T8UA 5IN5A 4EA7A 1DXHA 2P9YA 5GV8A 4MLDA 3MI7X 3EZNA 2BFBA 1IL0A 4F4IA 2O4UX 1M0TA 5LMNJ 5FL7D 3ZCRA 3AHEA 1NN0A 5HNKA 4K9SA 1AROP 1E6CA 2ZJYA 4JI3B 4X66J 4MXDA 2C7QA 3FNGA 4FFBA 4IILA 2CNOB 3QIAA 4HHEA 1Y42X 1WI8A 1QB7A 4I9FA 2E4XA 2X41A 4YAKA 1T6NA 3I87A 1IOWA 4CKBB 3DR5A 3Q83A 3LV8A 4DBQA 1W96A 2PKQO 3ICPA 4F0JA 1MOQA 2FQQA 2XKAA 1OWMA 4JP5A 3FE2A 1YVPA 2WU1A 4D0GA 1JSXA 1C7RA 1RTTA 4Z8YA 4EUKA 3AZQA 1ZHFA 4OREX 2X7IA 3IP6A 2DFNA 3LKBA 4KPEC 4Y98A 2BFFB 1DKNA 1ZJ6A 5C24B 1H9AA 1JBQA 2FZ5A 4YJHB 3FZGA 1NMYA 5ENVA 3TLAA 2IIPA 2JAUA 4QCLA 4YAFA 3ZWNA 1RMYA 4I2PB 2W9BA 1C0TB 1UOQA 3EGDA 3N7TA 1I3OB 2W4DA 4B48A 1A9TA 1WTBA 5EJ5A 2BR5A 3TNJA 1R0CA 1T15A 3C1OA 2F3SA 4BQPA 2O19A 2KM1A 5DIZA 2JASA 4Q6BA 1VE7A 3F5DA 1Q84A 2YWEA 5D2CA 5IUJC 1JQLB 5A5VA 1EFCA 2O2XA 1BWRA 5C8ZA 1ESEA 4F46A 1NBOA 4X62J 3BR9A 1LBQA 3FBCA 4C30A 4AJ9A 2YKNB 1ZM7A 4E1VA 3OOSA 1FQKA 2QTVB 2OTJS 2H1CA 1UEUA 3CJ2A 1KFDA 3F8SA 2CE7A 3OHBA 1JEOA 2DHXA 2IW3A 3ZHCA 4AJPA 4YAUA 2XDWA 2D0IA 2ZH3A 4R40A 5LXTA 4CT0A 1E3MA 3PRJA 2WZBA 1H6KX 1GTZA 3LUHA 1KZ9A 3H1TA 3DHXA 4I4TF 1WF0A 2B37A 4PZLA 5E38A 3K2EA 1LW2A 2NLOA 4RHUA 2YBVA 5G1NA 2HWYA 2ZPTX 2CBGA 2AJDA 3SR0A 2GHTA 4WLEA 1WXXA 2VPYA 1O6XA 1HRKA 4NEZA 4NATA 4O63O 3V6JA 5B4UA 3BQ0A 4BC7A 4AZTA 3HMKA 4KO1S 3FYSA 4JYZA 3JQGB 3OM1A 5JLJA 2A6OA 3QJPA 1V3VA 2EL7A 3IVCA 2O7NA 1OSCA 5DW0A 2E4AA 3AHHA 1BDBA 5FOUA 3M83A 4OJNA 3HKWA 3U02A 1JLAA 1RAEB 3UW1A 2OTLS 3N8IA 2FRDA 4P7BA 1U2PA 4EK9A 4D41A 2XTMA 3AK4A 2IEYA 2WOMB 3F7OA 1OFIA 2V5AA 3EE3A 2QTTA 4PRLA 4CTKA 2NQPA 1VIOA 4FYKA 3B7PA 2H51A 1LS1A 3TF5A 2H65B 3DGPA 4MSUA 5M34A 1JJIA 2QRZA 2ZYVX 1CQNA 5MDHA 3NVKI 1HQDA 1BC5A 4XUEA 4CCSA 2OMKA 4QGFA 3VAMA 1RPJA 4B47A 1FNOA 5H9FJ 2YKOA 5CEFA 1A5TA 2O3JA 4NLQA 3K20A 3UJ3X 3G2OA 4DV5F 3MM5A 3P6YC 1RJDA 4M1EA 1KQFB 1NUHA 1W0JA 1KC8T 4B17A 3G8SA 3CUNA 1D2CA 4DRZA 3GNTA 1MVLA 4PG6A 2F6RA 2FTRA 1MGOA 2IRXA 2FFJA 5JC8A 2BFPA 2DY1A 3AWIA 4X85A 4LVNP 3ACCA 3BH6A 4PPYA 1EMDA 2VLIA 4XJSA 3E53A 3R97A 4KJIA 4UNPA 2V3CC 3W65A 4LZLA 4XJVA 2NO7A 5HM6A 3Q3EA 3FZBA 1PL7A 1O95A 1S3FA 1ZS9A 2YL2A 2B2NA 2WWRA 1FYDA 5IC4A 1DLOB 1LQ9A 1RDFA 4EI9A 2HQOA 1GFSA 4RK1A 4NLSA 1DIRA 1ZYUA 3JPYA 4GVLA 1RTHB 2E55A 4RHYA 2Q3EA 3WOHA 4XX0A 3BGFA 4OB7A 4C21A 1FI4A 1QZXA 2DGQA 3MEDB 2AJBA 3JWHA 4D4IA 3N01A 3KLHA 1Q6ZA 4OYYA 3KKNA 3EXHC 1RQ7A 5AK0A 3ZDDA 2O7VA 5E4JA 1EDBA 3P7MA 3KJZA 1QSYA 1VKHA 4MQ6A 4RNDB 5B64A 1CRLA 1EGMB 3VJMA 2GEJA 4MVJE 3D3BJ 1VOMA 3EOBI 3BWVA 1TI7A 3NDBB 1IRXA 4EY5A 3V7YA 1E2PA 3URKA 3N6RA 4H9GA 3H5VA 4V3BA 2D8AA 2JGKA 4FJ1A 4QOEA 4TU8A 1GPBA 5FLXA 2IVZA 3BXOA 1K5PA 2CDAA 3B70A 3TJRA 1J6UA 4HHUA 4NJEA 2CE2X 4B6FA 1IR0A 1NNLA 4J0IA 1Q1KA 1NVBA 3RVPA 3LUPA 4RNNA 1TTHB 4HQ0A 3SJBA 5CVUA 3GLFB 4R2HA 5IOLA 3ESDA 3V9PA 3WLAA 3ELBA 2F1IA 2DXEA 3CCSS 2ZSKA 1NDQA 1NWCA 1VRTB 4CKCA 1IM4A 3IRWP 2FHJD 1XEXA 2XVMA 3TZ6A 3WLFA 1PU2A 3DBLA 3VPDA 4RDHA 1V2GA 5I7WA 3QWHA 2NXEA 4C97A 3AM5A 3LUAA 2HX1A 4KPFC 3RYHB 3I0SB 1R4NA 3Q3HA 1ZSVA 5HF6A 2ZRCA 1KWKA 4R9VA 1JWBB 5AQ1A 1NJZA 2R3SA 4HLUC 2MY7A 2ZKTA 5BSEA 3V6LA 2VJMA 4MDFA 5FHQA 3O9MA 1DTQA 5LMUB 3FPAA 5MN6A 4QWEA 1QUVA 4YV1A 3BAZA 2XMJA 3KFXA 1P75A 4F21A 2O5EA 1ZIYA 2YY6A 5CIYA 4ETXA 2AUNA 5HEKA 5L9AA 1XQ1A 4YDDB 4GE0A 2R60A 3OF3A 4EDHA 4M0PA 3ICEA 3JZMA 1SXPA 5J2NB 5G0SA 4FYDA 4W8GA 2ZRDA 3EXCX 5JY1A 2W9XA 2O54A 3UQZA 1M5UA 3I9V1 5HILA 5K7SA 1L8OA 4A1OA 3TZKA 2LV8A 3GMSA 2GBIA 3LUJA 1T8WA 3JYPA 2LRHA 4AXXA 2AKWB 2CNWA 4OYWA 4X65J 2QDXA 1KQGA 1NW4A 3VH3A 1WPGA 5DLPA 4LMBA 3ZNPA 3R8CA 2GA9A 3DI6A 1BQNB 2UYCA 2C2OA 3R8YA 1A95A 1V4BA 3KLGB 3OIDA 4ZOSA 4LRAA 1S77D 2BFEB 4Z2AA 1UKAA 2V4UA 3OUZA 2DP4E 3H2IA 4NU5A 2GBPA 4C8MA 4WTYA 1NVGA 1LLUA 3PXUA 4QX6A 3AA9A 4FR2A 4B75A 4Z9FA 5FXMA 2EWVA 5EXPA 3NNNA 2HHSA 1X7ZA 4AL6A 4IDQA 4XM0A 3AF6A 2XT0A 2HMAA 1SC6A 1AMUA 1F60B 2PS9A 4UF4A 2PEBA 4LF7F 2CDRB 1TA9A 1V8FA 4BRSA 2QVBA 2CSUA 5I7FA 1W76A 1LW6E 2O5DA 3FCYA 5TGTA 1EM8A 4DMUB 3R9WA 4ENVA 4PAWA 4B4WA 3T5DA 3TLGB 1QE5A 3UK2A 3GJSB 3M81A 3VYVA 5A0TA 1XU7A 3UWKA 1S8FA 3L09A 2JCYA 5CRIA 1E59A 3PY8A 2OXIA 1RRFA 2B0CA 1CJUB 1BJRE 3FDZB 1J1IA 3EUAA 1GPAA 2RGRA 3AQIA 3D2WA 2I5JB 4MMOA 3T5PA 2JFVA 4DVJA 3G2KA 4U39A 1Y8AA 5C8DA 4EAQA 1YZNA 1RCUA 4QZVA 1TD9A 1X5OA 2QYOA 3FJYA 3E23A 4PCUA 1G21E 2WFLA 4ZJLA 5I3UA 3BF7A 2MPUA 2WF8A 4Q45A 4LYHA 3V4IA 1RLCL 4PLYA 1VJGA 4HFRA 5F8JA 4E5YA 1NONA 1QYIA 4C8KA 1HDCA 3L7AA 4CMEC 4NFSA 3EFOA 5CYQB 1J5EF 2WBRA 4LS3A 4Q01A 2QMQA 1E1CB 3UJHA 3QMPA 2JKZA 3P4UB 3M9XA 3KYLA 5HA5A 2IWRA 2Q9BA 5KU1A 3W5BA 4B3RJ 3CNNA 3IBWA 3BX1A 1H5QA 4F56A 3P0RA 4QASA 1YZGA 3D0OA 1X7XB 1VRQC 1FUUA 2ACVA 1Q86T 3OF5A 3KVNA 1OYOA 1XFAA 4MNTA 1R12A 5G0UA 5HHTA 1LV5A 3NC1C 3OE7D 4XM2A 3R7SA 2XCQA 4AKIA 4ILKA 4H6WA 3ISNC 1JP7A 1HIYA 2X0DA 3K05A 1CQJA 2PFFB 2Q49A 3HEBA 5JCOC 1BKDR 5K8TA 1GSOA 4PCLA 3G71S 4TS3A 2FPIA 3DMPA 4LSWA 3Q8VA 2WA1A 5F2OA 3BVPA 3OZAA 4MZXA 2GYYA 1KO7A 3NHAA 2FPHX 4DV7J 2NZJA 2I91A 3JQCA 3T5BA 2VTDA 3KTOA 1SELA 2JARA 2H5IB 2VG5B 3BPDA 2VTKA 4AJ1A 1UA0A 1QGYA 1HBUA 1U4NA 4KK4A 4DR3J 1JEEA 4M98A 3QQ5A 4Y1EA 2ANCA 4S1VA 4BASA 5F9NA 3TSZA 2ZB7A 1U1GA 4HLDA 4DEZA 2JS7A 1X38A 3FCXA 1JI0A 3SSQA 5IUNC 1SG9A 1YOBA 2EKZA 1JFRA 2Y1EA 2HIGA 2IEGA 3A14A 1HNWJ 2E5LF 2A1IA 5CLIA 1Z8FA 3W6OA 2DNOA 3T41A 1XMOJ 3WJAA 1PKUA 5ENDA 3Q85A 4RTRA 4TWZA 3CTMA 3E27A 2IP1A 4D57A 3CR8A 1RABB 1V9CA 1ZIXA 3JASA 2NTYC 1O0PA 1N52B 5DH9A 1GFWA 2D62A 1Q0HA 5FD8A 4M6WA 3GLTA 3P8ZA 4M5GA 4ILMA 4EKYA 2IOFK 2NUAB 3A1EA 3RG8A 2VF7A 1SHJA 3DM5A 4WFIA 1EHYA 3O8CA 3BGOS 2EKQA 3C3BA 7REQA 5TMEA 5EYPB 4C3UA 4UPDA 2ROPA 3OQ1A 4NXMJ 5FLXY 2HPUA 2CLOB 4LJYA 1J2EA 1I6WA 4X41A 4ZVLA 1F8FA 2F3QA 3UH0A 2ZFHA 1R0AB 1RP7A 2BEUA 4ECEA 3C6UA 1F48A 1RYZA 3W61A 1NC1A 4CLTA 3TTUA 1C7JA 3ZY5A 3AERB 3B3JA 3D6FB 3E01A 3DVAA 3RUEA 4RFSA 2RIRA 3PFIA 3CIMA 4LJ7A 5D0EA 4NG4A 1GAQA 5AJXA 3ZR4B 5DCLA 4JUFA 1XTQA 1AKRA 4OBXA 4PSUA 4HEA9 2QNIA 2RHLA 3BK7A 3FDIA 3LO8A 1FVXA 3HX9A 3A7DA 3JPWA 1S01A 3W5VA 2VH2A 1WCYA 1IBMJ 3JQEA 2YHIB 2WKSA 4Q05A 4M5HA 3DOFA 1C1CA 2R6GA 1DUIA 4ND8B 5C53B 2NMVA 4MWSA 5FA6A 4G24A 5A5GA 4BQOA 3MINB 3I52A 2NVWA 4YDXA 2HMIA 4E31A 2VT3A 2KLBA 1KO4A 3N75A 1LPAB 3CDBA 1D8YA 4TKMA 3K2QA 3FPBA 4WTOA 1QH0A 2CQ3A 5IBRA 4BL5A 2UUTA 2XQFA 3MXTA 3C3CA 4I7FA 3WYAA 4W6ZA 3CNQS 5CCMA 1J06A 3RVSA 1XYGA 2EPIA 3OOEA 3ITEA 5J2UA 4LF4B 1HPLA 2ZBCA 5K8MA 1YL6A 3NCPA 3E5HA 4I0WA 3GZNA 2NV6A 5A9RA 1NSAA 1QHEA 1EFAA 3WGOA 1S7IA 4BNDA 4W9MC 3BEOA 4HR7A 3RS9A 2IPAB 4B3JA 3G2QA 5CYMB 2AN5A 2PU5A 5K4GA 3ISVA 2NPFA 3TSAA 3T06B 2Y2VA 4RJJA 5JYDA 4YMWA 2KZZA 2R9LA 2GSDA 5D3GB 3OQMA 1TNDA 1HL7A 1OT5A 1D04A 4WOKA 1JDTA 3HSKA 3U61B 1FYXA 3FBBA 3EBOA 4MQ4A 3AVPA 4GZLA 2GXAA 3B7WA 1RQGA 4QPTA 5HIAA 2P6TA 3RD5A 2VBWA 3SP1A 5CHCB 3DJYA 4ENUA 2O8NA 2Q07A 1DV1A 3JXOA 2HY7A 4PW0A 4V0NA 2EIXA 2VU5A 1JAXA 4IRCA 2HTFA 3I0RB 4NARA 3CC4S 5FQOA 4DR4F 3TINA 5IG2A 3KHUA 3NEJA 4N6OA 4QJBA 4LF1A 2FJUA 3HY4A 1GGMA 5AICA 4MVJM 2G06A 2AE1A 3GRPA 5H1SV 2OBYA 2F8LA 5FOQA 4KHPJ 3NNAA 4MRRA 5K3BA 3ICWA 1N5JA 2GRUA 2C1ZA 3TQ1A 2Y92A 3U44A 2ZIUB 3PFBA 1ZK2A 4DX5A 4WKNA 3HT3A 3PX6A 5AVRA 4JK3A 4PZEA 3L8ZA 4ZCPA 3GNSA 2WEKA 4D99A 1D9DA 1BROA 1UBFA 2Z9BA 4NLVA 4YR3A 4OXXA 1V4VA 1H4TA 3WWYA 3OOWA 4C1BA 3U7FB 3H19A 1IB0A 4I55B 1RYFA 4ID3A 3AJ8A 4JLPA 3RM3A 1ZH2A 2MKHA 4I5IA 3C3JA 4UNSA 4BTVA 3KCQA 2MGZB 4AZ3B 4LF5F 1TK8A 1OVMA 1F0PA 4NCHA 1CK4A 3LT5A 4NCJA 4V19J 1A5AB 1KHWA 4DRXA 2XNSA 1T5IA 2Q5JA 3IVAA 2YY5A 3QV2A 5KNLA 5J2QA 2MKCA 3DPUA 4WKYA 2X15A 1NJWA 2ZRHA 2FX5A 4OUDB 4JI1F 4IIJB 3UAZA 1QTNA 1CEYA 5BWLA 3C41J 2QLNA 4DXLA 1ID1A 4TKLA 2D1FA 4AJIA 1IOLA 3ETOA 3VTKA 4F2WA 1QTMA 5FFFA 3O8OB 1FE8A 1L5HB 2FSFA 4HVLA 1AK1A 1VDHA 2ZAGA 4YJFA 3HF5A 1EI9A 3AOEC 2QFIA 1B41A 5ICMA 4A8XA 2B61A 3IEXA 4NPCA 2SNIE 3E8XA 3ROXA 4F1KA 4WZAE 4WDQA 1X8JA 3THPA 3D0RA 1P5FA 1R2QA 1SXJB 4FR0A 1CR4A 2H9IA 1SH2A 1T3SA 5BOSA 4Y9RA 5HQLA 1ONPA 2DRBA 1H6CA 3GFYA 1SB9A 3TN7A 1AGPA 3HHDA 1MDBA 4TSFA 1XKTA 1N34F 4R2IA 2IW1A 3VAGA 1PSDA 1J22A 3LO5A 5CA1F 4ER7A 2GM9A 3GJZA 4OPMA 1G63A 2VBFA 4TYQA 1NXQA 1V7ZA 1I6JA 3TOSA 1X4FA 3PJGA 1E7YA 3EUEA 3GONA 3Q8PB 4PZ0A 1N88A 2TMGA 3U3JA 1R9NA 3RB6A 1C7IA 2AFIB 2ZYWX 4XDDA 4XR9A 3MTJA 1JN0A 3UCUP 2BY4A 3QRWA 1M34E 3FPKA 2FDRA 4K6HA 1XZBA 2DNRA 1B0ZA 4E1BA 5CIQA 2JVIA 2QHXA 4KXYA 3S1AA 1KP9A 2N3LA 3KT8A 3LG2A 5I9TA 1LW0A 4NAVA 4ZD6A 2GD6A 4D2IA 3QSIA 2XM3A 4F86A 2FSHA 1Q0NA 3JVVA 1OFGA 1YUBA 3FPFA 4I7EA 1NJ2A 1U7ZA 3KG2A 4P7FA 1G4AE 1YE8A 1OAOC 3GLGB 1POWA 2UUCJ 5BNWA 4N7JA 4LKRA 1E6YA 1DWUA 5AIAA 1QZTA 2C99A 2E5IA 1FVHA 1RC0A 4QPZA 5LFAA 5HBRA 2R2GA 3HNRA 2WNIA 2RS2A 2PMFA 3OUUA 2OC9A 4DB2A 2GN9A 2Z04A 1XWLA 4MYRA 1ZZEA 2QX0A 3W6UA 2ASLA 4QVIA 6ADHA 3HWX1 2W6ID 1OKKA 2GAOA 5IV3A 5I5EA 1N6HA 1CQZA 4P2MA 4NFHA 1CSEE 4DSEA 2K3KA 3GUYA 1U7HA 2BBEA 4MT1A 4LSLA 4Q2LA 2GJKA 5IYZB 1XMQJ 3L8FA 5DXJA 3C45A 3ZU5A 3NOGA 2L9WA 3H11B 3PC8C 4OXYA 2I34A 2AWOA 1AB8A 3KRTA 4RVNA 3JY6A 2B6NA 4IVQA 2XS5A 5EA2A 3RYLA 4R1LA 3GVXA 3RU3A 1D3WA 2V7QA 5A8WA 2IUFA 4UY8T 3I1FA 2HV9A 4ZEWA 2BANA 4KBIA 4FFRA 4RZ3A 3U37A 1UETA 4OSOA 2JVKA 1VHJA 1URPA 4U6NA 2V74B 2ZSEA 1HW8A 3HFVA 1ZA2A 3E9DA 4ZVFA 2J5QA 1V47A 2VQSA 5CXXA 1ZO8A 3BBFA 2WONB 5A7GA 1E79A 3ZW7A 3NWEA 1ISSA 2C3YA 4TMXA 2VDHA 2H48A 4GC6A 4KLZA 3M5PA 4U8HA 1LK0A 3BD6A 1MXHA 3ILVA 5BSGA 4JB3A 3OLWA 1MFZA 4X8MA 2J0VA 3T19A 3EQ6A 1NE7A 3K8WA 1ITZA 1DNPA 1DQ8A 1WDWB 3LOUA 2CDCA 1NKSA 4EZIA 1VIYA 1RBLA 2YYSA 3BIFA 4IIUA 4R84A 2Z5VA 3DDNA 1P1JA 4QHTA 1TCVA 4EHLA 4QIWD 1RKUA 1QIDA 4ARIA 1ZRNA 3F97A 3OR1B 1U0FA 2R47A 2VPWB 2Q5EA 1H0HA 4Q9IA 1E8NA 5ALZA 2ZPUA 1IEXA 3OKPA 3QI7A 2ZUAA 1IKYB 1G3IA 1E6MA 4PVDA 5KOYA 3UPUA 1UF9A 3MPDA 1YZ7A 5ITVA 2AHOA 1P0CA 1YZUA 5C7PA 4KIAA 3MUNA 3R6DA 2DQKA 4KQ1A 4Q0MA 5FFMA 4UTZA 1BDMA 3KQVA 4CQJA 4C7VA 3GB0A 4B9TA 1FA9A 2DETA 2GGSA 4RW4A 3IC1A 4O2BF 2IT1A 3G3EA 5D3MB 4R81A 4YREA 1JXLA 1LQUA 4WFAQ 3ET6B 1DP4A 3KUEA 1IN5A 2IXDA 4JGIA 4N77A 1RPTA 2WUWE 3WKAA 4JLVA 1I14A 1T9GR 2QT0A 2ZSHA 4ZU6X 1BWQA 1E2GA 1XZAA 3OJLA 3LDGA 3H7AA 3W5JA 1YK9A 4NCGB 1O57A 1E9FA 1JTFA 4LISA 5IAGA 6CHYA 4U9UA 4W1PA 2RGAA 4H1WA 4S04A 2KJVA 1Y10A 4OXIA 4ROSA 2UYHA 4CHGA 4D1YA 3SF8A 3FI9A 2NPIA 2OZKA 4B3TJ 4IG4A 5AT1A 4UULA 1IATA 4GOKA 4JJGA 4D3GA 3V1TC 2PY6A 2P0AA 1WNFA 4NFLA 3DMGA 3OECA 3W66A 2HWKA 5BVHA 3U3XA 4I1UA 1BY9A 4EG4A 3W6ZA 4WA7A 3CNHA 4RFLA 4YDRA 2NSJA 4G84A 4C6RA 4N3BA 4DQRA 3L7NA 1S48A 5EX0A 3PXGA 2J5BA 4ED2A 2O2DA 3O5AA 3UV6A 1F3FA 4N47A 3AR8A 3AJDA 1PDVA 1WBDA 1L7XA 5TARA 4XVQA 4M1MA 1A8SA 3GIJA 2X2OA 5F9LA 2IPOA 3K5OA 1DTWA 3OOJA 3ABZA 5M2UA 4TS9A 3O6QA 5CX1A 5IP5A 3UNXA 2CLEB 4B02A 2JIOA 2YV1A 4LQ9A 2ECOA 2ZM6B 2H7YA 2DIUA 4UOEA 3FMGA 4RWZA 3GRYA 5EE1A 2RDIA 1Y48E 1R8QA 2IHKA 2HT1A 1DQRA 2A59A 2EW8A 5LM3A 1R8HA 2HA5A 1G42A 4TKVB 2ZH7A 4JIMA 4WZMA 5ICCA 1RTDB 2MTBA 1TYAE 1U8SA 5KNCD 1CW2B 3QXHA 3VMMA 2JFFA 3R3HA 5CM8B 2DPHA 4AJLA 4YHBA 3GJRB 2AQKA 2J9FB 4OYOA 4ENRA 3WB2A 1R9JA 3VH1A 1U8FO 5FA5A 1SUQA 3OXGA 1U0OC 2VDNB 3H17A 4LQCA 3NIFB 5F64A 1SL1A 3F3SA 4CNZA 3JALB 4W1RA 3LDAA 2G40A 1YF3A 2O3SA 4RJVA 3TBFA 4UUWA 2D2XA 1CR2A 1MV5A 1OY6A 4KN5A 1AQYA 1BU8A 3VRHA 4CFYA 4U2FA 1RTIA 4H35A 4LSNA 1D1TA 3HKBB 3P2JA 3HY3A 3ZC4A 2A18A 5CNIA 3JTPA 2FP4B 2QTNA 4H3KB 2TMKA 5D8DA 4I50A 3P32A 4AYXA 2QX8A 4QATA 1K9MT 3U40A 2DRIA 3OPYA 1R6YA 3UMBA 2CFTA 1BXZA 4P38A 1C2TA 3KWLA 5IANA 2PQMA 2PKCA 4K9QA 1A88A 3QT7A 3VJRA 1DQNA 3BKWA 2QR3A 5JS6A 5K6TA 5AVQA 3N0XA 3IIEA 4F36A 1QCDA 3DEZA 3BO2A 2FZEA 1KFJB 3GLRA 2OTCA 3K2YA 4GR5A 1LSSA 2WB1D 2PRYA 1N2CE 2QZ4A 2AJ4A 1N32B 1X9MA 2AYEA 1TKRA 2VN8A 3D4PA 1B7YB 4BCBA 5D6NA 3U3DA 4PIMA 2UXBF 5DE3A 1V1RA 3HZRA 3OI7A 4Q3KA 8OHMA 4PLVA 3KAPA 1YI8A 4YCMA 2AN3A 3SXLA 1OX4A 1P73A 4L7QA 1OSDA 1JEQB 5F8IA 2RHDA 3FUUA 4CCYA 2MR5A 3QNWB 3EVWA 1S10A 1KDOA 1XE3A 2DWQA 1GR1A 2RONA 5GONA 3N6XA 2UXCF 2IAJA 1F6WA 2JD2A 1XVTA 2HLDA 4FJ0A 5JZVA 3B3QA 3L41A 2PE8A 3WX8A 1LQ2A 4KVZA 3F6CA 5F7OA 2XBLA 2PSFA 1BW9B 1E9BA 1RACA 2O3TA 4AKHA 2HUNA 4RVUA 3K58A 3UY4A 1MRSA 2HNZB 4OI1A 4RL6A 4ZJYA 2QAGC 3N6NA 5DG8A 2BPOA 1BYUA 3FCWA 3HBMA 4GYJA 4BFCA 5C52B 4URHA 3D43A 3JSAA 1CS4B 4BNYA 3DE2X 5H83A 5LMCA 4JWKA 4RV4A 4G4SP 4U7JA 3VPXA 1Y9OA 1GZ5A 4EA6A 4OI6A 2VT7A 4BU0A 4DPLA 4ZIWA 1W36C 3KQNA 1KKHA 3IMFA 3NHJA 5J3JA 1CQWA 5FORA 4JKYA 1LXNA 5LYYA 5LA6B 3B2NA 3FRJA 5AI9A 3N58A 2C2WA 3ZWMA 5CA0A 5A5DA 1CC1S 5BPHA 5F12A 4XLTA 2HFOA 3K5HA 4RNFA 2QAIA 4QXRA 3EXHA 1L3TA 1DJOA 2ONZA 1WCIB 4C4WA 4JI2F 3L1IA 2LLZA 4RPHA 1HLFA 2YNMC 3DB2A 3D1OA 3RJZA 2IELA 4JLWA 1T3HA 3KZVA 1O87A 4KH0A 3GWGA 4HDHA 3RSOA 4HWRA 3W78A 1UVIA 1AS2A 4D7AA 1JSZA 4MB6A 3HT0A 3KK2B 4PEVA 4UTVA 4KFBA 1NVMB 1HNXF 2B8NA 4OA5A 1A2BA 4C0JA 4QPXA 2AA3A 1FNXH 1X80A 4WNAA 4MUFA 1PK7A 4HB0A 1M6EX 2BKPA 1WTAA 2F1OA 1Y63A 4C2MA 3M1VA 4Z4HA 2XHWA 1SD5A 4ZKEA 1YS9A 1JSLA 1L5ZA 1QFXA 3FF1A 2H54A 2DNGA 3A4NA 3KVRA 4PPZA 3H6HA 5T4BA 4REQB 1E3JA 4N56A 2M3DA 3AIOA 3EXG1 5L3SA 2CQ0A 3PKJA 2HGLA 1PFVA 5ALKA 3IV7A 2X4IA 1A4XA 1NX9A 4TQSA 1R6UA 3N76A 3CZ9A 4MGHA 4M9XA 5DG7A 3I45A 1CQIB 2WSMA 3BILA 4ZQCB 3ILXA 1CQXA 4HDSB 1Q6YA 4HEA1 2BUAA 4QICA 5BOVA 1L7PA 1EB9A 1NHUA 1REQB 2X1LA 3T5KA 5B6PA 1NR5A 2WJPA 2ZTLA 1O9HA 3MFQA 1PFYA 4ZTUB 1JG7A 1L5GB 1DXQA 2GJAA 2XMZA 4QBKA 2CBXA 2HA6A 3I62A 1RWXB 4JJ6A 3HYSA 4LFAF 2H2HA 4F92B 4FBLA 2FPUA 5D4PA 1NSPA 3CRQA 5ILQA 1EWKA 4TRJA 2DIVA 1FK9B 5DP2A 4E8UA 5D7BA 4QGAA 1A82A 1C4XA 2C5AA 4Y2GA 4BAGA 3F1LA 1L3IA 5K8OA 4WBXC 2G4BA 1DV2A 4BKQA 3ZCTA 1QE0A 1R8CA 3GFGA 5EEHA 2X9QA 4RANA 4WZBA 1WACA 3K16A 2CXRA 1KO1A 3WRYC 4AMZA 2Z56B 2XMRA 2C7RA 4DCOB 3IDFA 3H5OA 2PWBA 3LGNA 4OB6A 1NURA 4CJXA 1HBOB 5AVZA 1CYEA 3TZWA 3BDIA 1DI0A 4LF8F 3DOKB 4EYKA 3IXQA 4JLOA 4LFBF 3FHLA 1MABA 5A4JA 3J7YU 5DZ6A 3NVMB 1MN6A 3LPLA 3STYA 3FVVA 1I4DD 3KHGA 4Q48A 4FF3A 5HI7A 3OZVA 3AUTA 4DCGA 1G9TA 3QITA 3H2SA 4GKJF 5ICGA 3H16A 3I53A 4OHOA 1Y6FA 2ATCB 1Y8RA 4DL5A 3DCAA 3WWCA 3DS8A 5FP0A 5E6SB 1IKWA 4P36A 4WY2A 2HAEA 1F2TB 5FIUA 2GZOA 5K09A 3ZE0B 2EC2A 4X00A 4YAEA 5I7OA 4XWGA 2QE6A 2PIIA 3AJEA 2RIJA 5GAEU 4TXJA 4Y34A 4NYOA 2GUWA 2VDPB 3T3NA 1VIVA 4YRBA 5AK6A 1P8JA 5EHXA 1UA1A 1G5IA 3M4ZA 2ZR8A 2WJ4A 1BMQB 1WSRA 2DFPA 2Z5LA 3LXXA 4CMEA 3QWUA 2A9FA 3ZBPA 4RPJA 2UZ4A 1N7JA 4CIOA 2XNJA 2BGLA 1JFFB 3HO8A 3H1AA 3KQOA 4J0HA 3UEOA 2BGMA 3GLUA 1RWVA 2NR0A 5HP4A 1CEQA 4UVDA 3GLIA 3KUUA 5CB4B 5IWAJ 2CNKA 1O6FA 4HTIA 4XXHA 2BZGA 3CLSC 2A84A 5F3RA 4BWVA 5IK2D 4WCEQ 2GPAA 4BP1A 3KV1A 1K8XB 1J07A 4YBZA 2FQYA 2R4UA 3PFFA 5DIFA 5U4QA 1RHUB 1JMKC 4OX8A 2WM9B 4BJ1A 1VG9B 3DWIA 1FF2A 5JCOA 1U8XX 5ELMA 1R0LA 3AL3A 2FDCA 1Y7IA 3D7NA 1Z6GA 1XNHA 1DOAA 2CCJA 4R2MA 4C07A 4DIDA 3NHWA 4HVAA 2AYYA 4A23A 1Q7BA 2XAAA 3KTAB 2LCIA 4WE1A 1WP9A 3B2QA 4FBTA 5JNWA 2MMGA 3LUDA 4RLHA 3ZDEA 4DPYA 1JMYA 4RTPA 2IDZA 4A8TA 4K8RB 1R5JA 3ONVA 1RZRA 3BQMB 1QVRA 1JUDA 3PXGa 4ZVPA 3UGJA 5KNDH 2XNQA 5AWFC 1JQKA 5HX7A 2PL5A 5JZSA 2GYVA 1EXMA 1ODLA 4RVFA 4PO1A 1N5QA 2ERXA 4MA4A 3DVQX 1NUTA 1I2MA 2BSAA 1JEYA 3MMBB 2DITA 1PJZA 3IOMA 4KIWA 4EGQA 4GO1A 3ZHOA 2ATIA 4BP9A 2YQ3A 4OL8A 1PT7A 4OL0A 5AKXA 2VDWA 3FYDA 3KDAA 5J43A 3DMJB 4TY8A 2R751 2P9HA 4QAQA 5J1TB 5CT8A 2ZIXA 4WE3A 5B09A 2QS9A 5DLFA 3HDJA 1H8ED 3JYQA 3IS9B 2V03A 1J5EJ 4IQ0A 2ZBRA 1N9GA 1B8PA 2N0SA 4P3KA 4JZYA 4Y6SA 1G18A 3ETLA 4X7MA 3GAAA 1T9DA 2P4UA 4NEGA 2GLTA 4ZREA 1BNCA 2GUGA 2FJVA 5LMZA 4CM9D 5T5QA 5KNBA 4YP0A 2GEFA 4ZVKA 1JIUA 3NHBA 4HACA 1Z4IA 3DL7A 3M9WA 5D3ZA 3ZZZA 1QC5B 1Y9JA 2BOAA 1O5IA 4Q1DA 2BBTA 3EUWA 5KAPA 3HGQA 3DH0A 5I5GA 4JVLA 1VJ0A 1XDSA 1EZ1A 2PVSA 1YU9A 4BIMA 1N4LA 3TZYA 5IT5A 1QK3A 2L69A 4UBKA 4A16A 2NS1B 1O9GA 2OEPA 5ADZA 3WK9A 2JHPA 3R8FA 3E9QA 1YBTA 3QWBA 2ERCA 3T95A 4YNBA 3WC2A 4NYMR 3HUEA 4P22A 3GGJA 4OTZA 4PQGA 2EZUA 4CRJA 2RH3A 5F7XA 1VZ2A 1P60A 2FGKA 3JVDA 5CU7A 4QJ3A 3LRXA 3T9FA 3LY8A 4OJMX 3BQ2A 3WGUA 2FFRA 4DHEA 5JS1A 4J49A 1FP4A 2JHCA 3KJNA 4RD4A 2C2BA 1DX9A 4PM4A 5FULA 2X76A 5AM2A 2CPDA 1GT8A 4N5LA 4ES6A 2A9KA 1H1LB 1XU4A 4TXLA 2PZLA 2I9PA 5DDRC 3MLAA 4IDDA 4U7DA 1GTL1 3TR6A 5M04A 3ITKA 3HGMA 3DLEA 3UWOA 4LJ6A 4U2BA 5F73A 1X1QA 2MSWA 1B1AA 1G41A 3PJDA 2IBMA 5H9EJ 2AJFE 4AJJA 4XVCA 3LJKA 1WP4A 3OL9A 4I2QA 2WJJA 3P45A 1G8JA 2PYDA 1EBUA 3PKIA 4CEJB 3TD2A 4Z4CA 1EBBA 3IP5A 4Q44A 5CM9C 1P45A 4IHQA 4RGBA 4IOCQ 4PLZA 5DT2A 5IVHA 5BQ3A 5JJCA 2VUSA 2B5WA 1SCUA 5F9MA 3UUFA 1KSGA 1TV6B 4CO5A 5HBMB 4UU7A 2A0YA 1EDZA 2ZATA 1Q5PA 1K2VN 3CZ5A 3NWJA 2XMSA 4YCLA 4LBYA 3HKZD 2YIVX 4D0SA 3OJXA 5DLGA 5B1EA 3M8ZA 3NRJA 4LFCB 4EITA 3SBEA 3MPYA 5KOHB 2Q9CA 1EKXA 2NREA 2Z2XA 1G21B 2CJXB 4D9FA 1D4OA 3LKZA 1SH7A 2L42A 4O2AB 4AQDA 4IDGA 2CCKA 4Q15A 4OYMA 1IY9A 1U2TA 1A27A 4DLXA 4DNPA 1NDCA 2FSGA 3B89A 3DZBA 3MT8A 1CIVA 1RAOA 2XMGA 3WIBA 4INPA 3S2IA 1QR2A 2BFMA 5T6BA 1AKNA 4GR9A 5CVVA 4BWGA 3ZX4A 4ZT3A 3ZLVA 1EG2A 3OQNA 4MIKA 1SULA 4G65A 5DI3B 3MCOA 3EVDA 3S8EA 3WYGA 3MJDA 3WS7A 5KG4A 2FD2A 2COKA 2UUAB 5I9MA 4F96A 1PJ4A 1SBYA 3G1TA 3BH0A 1IOZA 1HSZA 1FVQA 1YIDA 4UZSA 1K92A 2D5CA 1UFVA 3O90A 3UAWA 1Z5GA 1QUEA 4RS4A 1QWSA 3GK3A 1T25A 4BRUA 4JB8A 1EUDA 1NIPA 3P9QA 2MQQA 2GT1A 3WMWA 4BNLA 4IEEA 3O0DA 5ESRA 5DGAA 3VAHA 4YR0A 1OGYA 4FDUA 3RYTC 3QVJA 4KV8A 3L6UA 4ETZA 2AK3A 4UE6A 2IRUA 1JDZA 3VAYA 3EG5A 4V03A 2D0OB 5DTEA 4JLMA 3VA7A 1D5WA 3DZDA 1ZJWA 4XYBA 4PAAA 2O6HA 4LTNA 2GB4A 2JBAA 2Y1RI 2AQIA 4L72A 5H0IA 2LCWA 4B71A 4L75A 4EATA 4EKIA 1GYRA 4GOJA 3IM9A 3E4DA 1HE2A 2FX3A 4DSUA 3HN2A 1GRQA 2PRZA 1KDPA 5C7LO 3MS2A 1UJ5A 4KWCA 5B55A 4ZLNA 2NYVA 1H5NA 3D6MA 5F8GA 4GQIA 5JH7F 4OP1A 4C3MA 2YQZA 4YXWA 4G6VB 1R8JA 2AZDA 4MFBA 4J9NA 5ETOA 2FR1A 3OVMA 1K9VF 2DTDA 2IA5A 2AD1A 1TF5A 4OAOA 1U04A 3TPFA 3BS4A 3OLCX 4FLFA 4ZT2A 1U1NA 4RTQA 5AP9A 3RB0A 3SX0A 4RYDA 4D46A 1JHAA 1UK8A 4L9SA 5G4KA 4IS3A 1CNMA 3CJ8A 2BFWA 2P6OA 1N36F 3RWBA 4HPJB 1W2GA 4JI5F 5LZ8A 1A72A 1TM3E 4DR4J 1ZI8A 3CVKA 3ITNA 2RSLA 4CH7A 3R75A 2H0QA 3KHLA 5HCIA 2R6AA 1LVUA 1LV8A 2PG3A 2VT2A 1TZJA 3E15A 1SMKA 4JI8F 1GG5A 1IHOA 5K51A 2Y1DA 3SR4A 3CUKA 4QPPA 4D02A 2AU0A 3MTQA 5TQ0B 3VYTB 5B7QA 5LSAA 2GHPA 5J4LA 2P6PA 3A4YA 3D54A 3N53A 3ER8A 1P5RA 2ODPA 3FWYA 1LI4A 4UCXA 3HBFA 5K0EA 2FA9A 3CO5A 2N47A 4IFVB 3O3OB 1U11A 1KJQA 2WKWA 3JYLA 2Y1FA 3HKEA 4D4LA 2WZQA 3FB4A 4LF5J 1GMUA 1FUIA 4CTJA 1G5RA 3B1WA 3DVSX 2R8OA 2I2XB 1SHKA 2LPMA 3OOHA 4LF9F 2ZS9A 4KGVA 5DCYA 1E6UA 3M8QB 1WAMA 4U2GA 1WXDA 4OX9B 2YV4A 4BS2A 1UFLA 3EZ2A 4C7JA 1YKFA 2D1RA 4IEFB 4RM2A 2V2ZA 4E70A 1PJ6A 3W2VB 5CLJA 1WHSA 1IHDA 4JI1J 4PS1A 2PCJA 2VWHA 4IHJF 4EBEA 3OPVA 2LIPA 3DXFA 1BWVA 5KYGA 1N5YA 2XDQB 3WQPA 2FMUA 2DT8A 1GNPA 4OLPA 3N39C 3FUVA 1CTQA 1WDLA 2JFXA 2KT2A 3FKSA 1ZIDA 3WKDA 2VJNA 4C6SA 3BTSA 1E9RA 4Z1MA 1T4CB 3ZWVA 3BFPA 3F4KA 4MKGA 4DV4B 1AZSB 4IOMA 4KR2A 4DLYA 2FCRA 1WSDA 1PZFA 2BE7D 2A9VA 1LSOA 3LQRA 1YZ3A 2CLLB 4YRAA 3GUHA 1XNJA 5FLXU 4C2UA 1E8DA 2FW9A 1NQUA 4OQEA 2OO4A 4U8YA 4E4RA 1XJ0A 1ZICA 4MR8B 3E03A 5F1OA 4CLRA 2ZJ3A 2YJZA 1D7OA 3MYRA 2ZOFA 1N34J 2AB0A 3QUAA 3AL0C 2NSBA 3CDEA 6AT1B 4GDFA 3ZZNA 2JAQA 2B92A 1HA1A 3N6MA 3AHFA 2XB2D 2CCGA 4R9SA 4DSAA 2AT1B 3PYFA 3RDPA 4F2HA 4S24A 4R8KA 2DHAA 4MHSA 2HEKA 1EK0A 1XRSB 1IJEA 5F98A 2OAUA 1HZJA 2XRYA 1S2DA 2CL6X 1EVQA 1EETB 2O67A 3LX5A 1DUVG 3TOZA 2V8VA 1N54B 1N6PA 2EBEA 4W7IA 3RFTA 1N0WA 2I1QA 1J1UA 1V9LA 3ZXIA 4ZJQA 1NFRA 3D59A 4D9BA 3DBRB 3RSQA 4RA9B 2H06A 1VKJA 4LHEA 1VLJA 2QM3A 1RR6A 4CLOB 1VHLA 5JXWA 1YRBA 2I2DA 3N0TA 1U48A 4DS3A 4CM4A 5KG3A 1Z0IA 5E4FA 2DVIA 2IYEA 2A78A 1AXQA 2ZT6A 1QIHA 2P4HX 5JVDB 3U4MA 5IFLA 3MWDB 1OA0A 5JI3E 5KT2A 1ES9A 4ZPXA 2IBKA 4MRVA 2OV8A 1AGNA 3DT9A 5GMEA 1GARA 5A6VA 2F3JA 3TSWA 1IBCB 1B8NA 1ZMBA 3CNEA 4BNHA 1WCXA 1IZZA 4ZXPA 4ECAA 2DGTA 1F51E 4BO3A 1F2VA 2HRZA 4J0CA 1YL5A 2HQRA 3CZPA 2YHUA 4NK5A 1F8XA 4OJTA 3CJKA 3TO5A 2BGTA 4ZP1A 3QU5A 2D06A 2QQEA 5I9NA 4TYNA 4YP5A 2BCJQ 3V7NA 5DX1A 1AXGA 3MWYW 1CUIA 1CVLA 3TLEA 4MW6A 4BLVA 1OZHA 2Q3LA 4L9RA 2W2PA 2R7VA 1FFEA 3H9BA 5A71A 3U2QA 3I6PA 3VQTA 2MQPA 2NU6B 3NBPA 1D2NA 4W63A 4Y9DA 1E2HA 2GJ4A 3WK7A 1R7RA 1OWOA 4KX5A 2Z2KA 4P75A 2V5UA 4QPDA 4K03A 4L3KA 3UPFA 3UJ9A 4DJBA 4QUDA 3UR0A 4FXWA 3SCKE 1KQKA 2AG1A 4J9UE 1G7SA 3A6PC 2O48X 1K6XA 2KBFA 4JVSB 4JP3A 5GM2A 4Q7EA 4EG1A 3GG2A 3KLOA 2E9SA 1BCSB 1EFVB 1NQAO 3S44A 2CV2A 1NSTA 3HBAA 3B6ZA 3I01A 1C30A 1Q17A 2ZDQA 1NXVA 3OO0A 4IQFA 4B7UA 1Y82A 2GGPB 4WZAB 2ZJ4A 4JOCA 4ASUA 1EX7A 2YQ4A 1JNZB 4C06A 3IEUA 4RW7A 3JXEA 4EFMA 3OV7A 3OQPA 4RY9A 1VLQA 1QHFA 1AN9A 1Y6JA 2ZCVA 3IHLA 1Y8QB 1UDWA 3CVYA 4HX2A 3OIUA 3RARA 4P81A 1DHMA 5JMPA 1HE5A 4JJFA 1T3LA 2IU6A 4GWKA 3C14B 1LD3A 2JHAA 3S4YA 4UHDA 2YXPX 1T1RA 4QUGA 4EG0A 2COEA 4RZIA 4DC1A 4N8EA 3PB3A 1R9MA 1PL6A 3IKTA 2C5FA 4K46A 1M34B 3IOBA 3BL8A 5KG6A 3NRCA 3PIPQ 5BYJA 3ZS9A 1K0TA 4M4SA 3GV8B 5I7AA 4DLPA 2FNAA 5IDWA 1MMDA 3PEWA 1WOYA 2O66A 1XX6A 4ZLLA 4I9NA 2R5NA 3W79A 2NXUA 1R00A 4DPTA 2KT5A 3MVEA 5HN0A 1EXDA 4JLDA 1Z7BA 5KG7A 4DNXA 3LDFA 4Y28C 1LWNA 3DAGA 3BDEA 1XK6A 1L7AA 3MAAC 4UE2A 1L7MA 5DZ7A 2PM8A 4PQUA 3TBHA 3NBYC 4X54A 2J9EA 3PNVA 2CJWB 4ZOCA 1P17A 5D3QA 5CBKA 3MFIA 1YI2S 3UT5A 5KFHA 2GDJA 4GGOA 2AG5A 5FNVA 4NMXA 1VQ5S 3LCRA 3JWJA 1ECBA 2J32A 1VXRA 4DQVA 3I0ZA 3NC4A 3SZ3A 3KXDA 1RE0A 3R9IA 3IRUA 2VG6A 3PWZA 2DGSA 1JLMA 1AKWA 2BUCA 2GIQA 5FWYA 1KSFX 3X1XA 1DLIA 3UM9A 3CVWA 4ZICA 3PQ6A 2G8LA 3EQ2A 4K59A 1OXSC 4R6XA 4OZ2A 2RCYA 4GKVA 4EPRA 2BRLA 1FVOA 2OGWA 1GHTA 2REXB 2DHEA 4DCNA 3WHIA 3PO5A 1YKGA 4YUAA 2O07A 4TUYA 1Y6RA 1T5TA 1SXHA 1JYEA 2HQSA 4K6KA 1U47A 1GPYA 3SJUA 4KV9A 3EMBA 4G3IA 5DBIA 4NLTA 3EY4A 3GRKA 4IOBA 1XERA 2MWMA 3ZWCA 4RUBA 2NU8A 1AB6A 3AVOA 1XCMA 4JQSA 2CW5A 2V94A 3H18A 1YU6A 5THXA 2BFNA 4EJ0A 3IKJA 5C4GB 4ED9A 2Z30B 5TLSA 3KEFA 1Y3IA 5E2AA 4L4ZA 1YQDA 2QY6A 3LANA 4A0GA 4D0RA 3SDEB 1CVIA 5IBQA 3R9XA 2C95A 4KTQA 1UMCA 3DOUA 3EF0A 3GP3A 1U8CB 1M8PA 3DLTA 4L2IB 4P3YA 5KSPA 4W5NA 2I9KA 2OP0A 5J59A 3Q3CA 5J1EA 3F71A 3FH0A 1US8B 5KG0A 3CN7A 3AF1A 1X77A 1HQEB 1T5HX 1EHIA 1U5AA 3DEIA 2C9OA 1E9CA 1S6PB 3CINA 3RB3A 3QE3A 2RK3A 2BONA 5ITWA 5C51B 4X3PA 4KSBA 3NBQA 5SYNA 1A2OA 5HZMA 4R8UA 1GDTA 2I87A 3O1IC 1PYTA 5JZBA 4CIAA 3JSXA 1U5BB 4MICA 3DV9A 4YQWA 4CN8A 1X7HA 2CGEA 2CFOA 3GGCA 5CAEB 4HL6A 4HGNA 1E3QA 2QG6A 3CUEF 5EJ9A 3PCRB 3NASA 1G2QA 4JX9A 1VHTA 4I64A 7FDRA 1KMHB 5EI5A 1WZUA 2SCUB 1N8KA 1NMEB 1E92A 4QGGA 4CUJA 5EJ2A 1HYBA 1OBVA 5IN4A 3MR3A 2OR3A 1DKRA 2DHRA 4K6GA 1ULAA 1QK4A 1XMVA 1KK3A 8ADHA 4NONA 3KSMA 1KAEA 1GRNA 4LVNA 3C1TA 4EHAA 4HCJA 2YNMA 4G4IA 3W6PA 2P5YA 3HL0A 1UBLS 1T8EA 5AW7A 4ISBA 3CJRA 3HVIA 3NR2A 2H1VA 1Y3CE 3DD5A 1GPLA 1CJBA 3O73A 4U3JB 3WMGA 3P9NA 1QR6A 1S1WB 1L9XA 1N0HA 4BU1A 4ZO9A 2PJUA 2UXDF 5TPZD 3H1EA 5FQNA 4JSTA 4J4HA 2BE2B 1NNSA 4EZBA 4Q3AA 2B99A 4LDRA 2E7WA 2JD1A 4NNJA 4GE3A 5EWMB 4RW8A 3GEIA 1B1CA 1YIAA 1X8DA 4EMBA 4EH1A 4YR9A 2DFLA 2LU1A 2XIJA 3RUBL 1PAUB 3OL8A 4JAVC 4CUKA 2I66A 2XDYA 1PVDA 3LO3A 5FUXA 3JQBC 4IM7A 3H40A 3T5CA 4EVRA 3W4KA 2JLGA 2IS4A 1JHOA 1NBEA 1E2NA 4NP6A 3B3FA 1K6IA 2ATEA 4X1KA 2XB4A 2CXTA 4NBSA 3A6DA 4O3NA 1VSUA 1LC0A 1ZSNA 4A03A 4CIDA 3QU2A 2UXCJ 1JU3A 1PCAA 3CH5A 1IEWA 3IPCA 2PX2A 2EJTA 1FTCA 5DNVA 1C41A 3B85A 2G0TA 3EEYA 4K1XA 1UT8A 3PYDA 3FN4A 2DGDA 4X2BA 2IUTA 1NBAA 2F7VA 5IJ0A 1JZSA 2Q6KA 1HY3A 2QMXA 1WUJS 5DI9A 2C4KA 1IBKF 5IJWA 3JQ9C 3NXZA 3EH2A 2J9RA 3CLRC 3RT7A 1RSCA 4FFWA 1TA0A 2FCAA 1JLCA 3DKVA 1M83A 1PNRA 1RHQB 2JKYA 4A8FA 2LQJA 2MSLA 1K8QA 1E4YA 5JD6A 1LDBA 2A6PA 1E20A 3PHIA 4TTPA 3I61A 5F3WB 3M3DA 1FFWB 4M36A 3OWXA 1GNRA 4CQLB 3SPXA 3RRGA 3NI2A 3BREA 3KLFA 1E6KA 2L0XA 3DO6A 3C5WP 1D9FA 3IWNC 3V6HA 3KSZO 2Z95A 6GPBA 2DUMA 4KXNA 3R5DA 2OO5A 1LK5A 4NWBA 4PNEA 1M6VB 4O4IF 5HCUA 1F0KA 1JK9B 2FPGB 1FDRA 5FCDA 4JI2J 1HC7A 1ADGA 3LVRE 2QP9X 4BBYA 1FS5A 2J3EA 4R68A 3KB8A 5DHTA 3DBVO 1NI5A 1V6SA 2ROGA 2Q5HA 5J2PA 4GT1A 1A2KC 2ZRFA 2VH1A 1EK5A 3PDNA 3L7IA 4S0MA 4FLMA 5MFPA 1UM9B 4WXPA 2KVIA 5MF6A 5JFGA 3E9EA 2PZFA 3AETB 2PN6A 2DWOA 3OUYB 4RF3A 1OLSA 3ZW8A 3JQ6A 3OTHA 5K8VA 1UC4B 3MHTA 2WKRA 3T7CA 4B35A 1WPRA 1ORIA 4KE9A 1HNXJ 4L51A 2VNKA 1PRYA 1T4DA 1IDN1 3PGXA 4QOIA 3DFMA 1OY9A 4BQIA 4X20B 4NQRA 2A67A 1YQXA 1WL8A 1EWTA 3HZOA 3V1MA 2HA4A 4KQIA 3NATA 1LC3A 2C7PA 4F3KA 2X5XA 1HNNA 2A9PA 3AY0A 2PKWA 2VDLB 4LJLA 4DL3A 3P5TL 3FVQA 1ZM3A 5FBVB 2ESRA 4TZKA 3L7JA 4RQAA 4OU4A 1TUWA 4BLGA 2QBYA 4RWWA 3OKCA 4AY6A 1UTAA 4YH1A 1H3DA 4ZARA 3A31A 1JLHA 5DYWA 4QIGA 1N2CB 2PX0A 2PZBA 2DBVO 4MIWA 1JB9A 5DNEA 4DAEA 3NYWA 5AM4A 3OE1A 2C2DA 4B9NA 4XLZA 1S1XA 3DV0B 3PFNA 2CJFA 5EWFA 3B1JA 3EXIB 4L27A 2I8LA 3WO1A 4LXTA 4ZQFA 2ZWOA 5IXYA 2D7CA 4J3JA 1SVWA 4R8SA 2J0QD 2CK3D 2CLHB 3WK4A 5AIBA 1CX9B 4PG8A 4Q7KA 4LHSA 4Z2XA 3P5BA 4LFAJ 2REOA 3QVUA 2FWNA 4CL8A 3CS3A 1JQGA 1H3NA 2HW3A 3E3MA 2RE8A 3L4SO 5EKXA 3VSAA 2UVPA 2DAPA 1RAJA 2BSXA 3VTAA 5JSZB 4EG8A 4DE5A 3L7MA 1YI0A 1SK9A 3C1AA 1UL1X 4OXQA 2D59A 1ABBA 1QSGA 2OKGA 2X8BA 3LDUA 3LA0A 1NG1A 3WWEA 4B7AA 5GADI 1CC7A 1RYYA 4OKNA 5K6RA 2AW3A 1GNLA 3FCVA 2VYVA 2QWXA 4GXRA 2EC0A 3I9FA 3HUUA 2BKEA 1Z7EA 2ZH2A 2FWPA 3R6LA 3WL3A 2A5GA 1G1AA 4U0JA 1KO5A 3THYB 1GQRA 3I82A 4H1TA 2Y1LA 4F6LA 4DJJA 3QUQA 1OBHA 4J7UA 4F4FA 4AP6A 2C03A 3JQ7A 1NLYA 3U3OA 2D13A 2G5GX 1HARA 2QRRA 4UFOA 5AKZA 2O14A 4LF8J 4QTZA 5HJXA 4O5OA 1M2HA 1AUOA 1DCMA 3N8HA 2MINB 5ICFA 4BB6A 4LFBJ 1W5TA 1FKOB 3QYFA 2ZBUA 4C89A 4PU0A 1MZPA 1PYOB 3HXLA 3EWNA 1PZXA 3DL0A 4MUEA 3QE4A 2QEQA 2GPJA 1EP4B 3U62A 4NMLA 1UXKA 3TNYA 4GKJJ 2WDZA 4KGZB 5LYJA 1SURA 3LBYA 5T41A 2AOTA 2YUIA 3ZJ5A 3T5TA 2YNFB 4YLEA 1C80A 1AMOA 3OHPA 1CZKA 1UMBA 3PACA 1IQRA 3QKSA 4C8YA 1GPWB 3JRWA 4L6AA 3V8PA 1TTPB 1CVJA 3DGFC 5B7WA 4PHTA 3UENA 3UOAB 5D3KA 3MPVA 1PJQA 5BURA 1KAHA 3M6VA 5HK8A 2PO7A 2ZE5A 3FR7A 3N0WA 2ZYHA 1PYDA 3MD0A 2YICA 4YGXB 5FOXA 4URUR 4FE7A 1ZPWX 2GAHC 5AI4A 1VQLS 4JYPA 4OOFA 4ZIRA 3ZU2A 1FWLA 4DQIA 5CT9A 3L6OO 1QDLB 2VP6A 2QUJA 4DQQA 1RAHB 4JVOA 4HTFA 4HDNA 3CWJA 2E85A 2HFNA 2QO3A 1C4OA 2OCYC 1ZD4A 3RIMA 3MJHA 1KZ4A 5DM0A 1JLEB 3ML1A 2ZI5A 4QGBA 3LP1B 2Y0DA 3R7WA 4DEXA 2XOKD 1IJFA 4HRYA 3WI7A 3AR5A 1E58A 2YOHA 1B8OA 4DMHA 3TIFA 4EHIA 3QUBA 1Q1EA 2IBTA 3K32A 1IQUA 5DNYB 4YJ3B 1NP7A 2IHJA 4H3HB 4HNVA 1MSWD 3E3XA 3K0CC 4WCFB 1IBLB 3RQSA 5G41A 1ID8A 2DUNA 5AW6A 1PILA 2EXUA 2J3IA 3MYYA 4W5TA 1DLJA 2X7XA 3O4JA 3T4PA 5HJYA 1PE0A 3TSCA 4QELA 1QOPB 2VFSA 1TW2A 4KKOA 2PZAA 4C3VA 4FGKA 2YNIA 4EAAA 1IWAA 2ZWVA 1KE2A 4ARZA 1IN8A 1IPHA 1QIEA 4M76B 5TF4A 2BJ1A 1BKYA 3OR2B 3FFTA 1RAGA 4FGSA 4A27A 4E2FA 3MM8A 3NBFA 1C3OA 3W3AA 3UCGA 2XWYA 1U4SA 1XVIA 2P5UA 2QDKA 2R1UA 4YRJA 4F38A 4HN4B 1X13A 4K4UA 1C0UA 2WV7A 4Q4CA 2YH2A 1E5XA 4HVCA 4KWEA 4NYJR 2P9JA 5E4TA 2WINI 4XE5A 1ISGA 5A0YA 3DHNA 1DRZA 5E2QA 2ZETA 2V8PA 2JLWA 3DMNA 4USUA 1XYVA 3R5TA 1NO8A 1XZGA 4MQEB 3JV7A 4CH1A 3DMHA 4OJYA 3PU6A 4B9AA 5LLDA 2ZXUA 2D3OR 1PIEA 4CT8A 5T8KC 3KLIA 4JENA 4I68A 1UFRA 4YR2A 3AO0B 4EJSB 1NQVA 2J0UB 3C8ZA 4KR0B 4L16A 2IYTA 1JNYA 4KGMA 1TCCA 3PE3A 4HPXB 4NZMA 3THXB 1BEUB 3G5UA 3GI1A 2HFVA 4F4CA 1IUKA 1DWOA 2D9OA 2VBCA 1R27B 1ND5A 3A58B 3D6JA 5KBYA 3NS7A 3EA4A 4LQ3A 1WB4A 2AUTA 3FOWA 2PLWA 2A9RA 2YFKA 3T7RA 2B9WA 1ZNQO 1S0MA 4MAFA 3IGFA 2QSWA 1PUXA 2PUTA 3Q7RA 3AD9C 1VGQA 1LY1A 1E4OA 2GMLA 4TYAA 4YPOA 2WHOA 4BQRA 3S2YA 4FU0A 1IEQA 4WF9Q 5GJWC 2CYCA 4J37A 5FDFA 1CXZA 1D2EA 2WWTA 3LCMA 2D54A 2FETA 5KFPA 3L8MA 3DAOA 3RS8A 2VYNA 4I2NA 1LWCB 4EP1A 4QUBA 1M5TA 1Q0ZA 1B99A 4JODA 5FYDA 3TPZA 4NMHA 1WELA 3TEMA 1BX3A 1Y5IB 5DTQA 1Z0SA 4RU2A 4J2TA 2VH5R 4PNPA 2CL0X 1T1EA 4Q4JA 2BXJA 2WP8J 5ETNA 4RH3A 2X0IA 1H65A 3ZY4A 3NP5A 2NZYA 3QT8A 4JQOA 4F3YA 2OPPA 721PA 1F9EB 2HSZA 3PFOA 4P8RA 1G1XA 4YRGA 5JY6A 2O01C 2HHCA 3RW6A 1M10A 1X42A 1PZEA 4GEKA 2E4YA 3HABA 2K5UA 4FEYA 5KDLA 2RHQB 2GH1A 4PTYA 3BGRA 2LDYA 4U8VA 2DFVA 3UW3A 3ZVKA 2QD2A 3MJSA 1YOVA 1G4CA 1YWXA 1AJEA 3L49A 3HJFA 3BSWA 4IG3B 1SVSA 1B0AA 4PYQA 1XZEA 2PJDA 4G5SA 5HQTA 1UWLA 3CIZA 5IYZF 1YJVA 3CULA 4HR2A 1ZK1A 4OXNA 4P0TA 2C78A 4JBIA 5HQ3A 2HBQA 1YAJA 3PNKA 1XVUA 1C4AA 2WFMA 4H6VA 3V1UA 4A46A 1Z82A 4Q19A 3AY7A 3II6X 1DELA 3LGMA 4F8RA 2HZCA 2BT4A 2FZKA 5CD1A 3OTDA 1JKJB 4KIUA 5JQWA 1KA9H 4RKFA 3HN6A 4DRYA 1L3BA 4V1CB 3RC2A 2YMPA 1EFTA 1BFKA 1VECA 1HK7A 1O9BA 3ORHA 2CVIA 3G9ZA 4RKEA 1GDHA 4GRAA 2OA0A 3TVZA 2QLLA 1X4EA 5ISMA 2ZIAA 2Q1LA 3FGNA 4CN9A 4EWTA 1G3QA 1MW7A 4TPKA 3QKIA 1DIHA 2F43B 2PKYX 1OW3B 3RAEC 3P2YA 1F0NA 2HFSA 1DXOA 1TEVA 1BMDA 2BF4A 2KMLA 1TD1A 2Q4OA 5FFNA 1ZMTA 3KQHA 4U63A 3UUGA 4ES3A 3V3TA 4YWJA 2XGGA 2QKYA 4FI3C 5EZYB 1FX4A 4NZ0A 1A71A 1LTHR 1V8PA 4A3SA 4DR5B 1N2BA 1SG6A 3G86A 1Y37A 2M52A 4HNUA 5ALUA 1N5LA 2GERA 2BCGY 5L1LA 3AUKA 3TRHA 4BTEA 4RXUA 1G5FA 5BORA 5H3LA 5EQTA 1VJWA 4IXDA 3MWJA 4WKCA 3Q6IA 1QSSA 1ZW1A 3IR7B 5EHNA 4HMQA 3GEHA 1PR0A 1RMQA 2VP3A 5HJ7A 3CG0A 2RH4A 1LSJA 4JU8A 4FW9A 2PBRA 3IG1A 1CJMA 1WBJB 1AT1A 4B4VA 3FX2A 2FG7C 1THZA 1NHKL 2DR8A 1VMBA 2O1SA 2FHOB 2TECE 2G2ZA 5SZHB 1S1UB 3PXCX 4BFVA 3H2JA 1J27A 4DCTA 1YACA 1E5VA 4JD5A 4KUEA 2Q2WA 2Y6VA 3ORQA 2YY3A 2P6MA 3TUIC 3BULA 5E3JA 4KR9A 4O3MA 3AFGA 1XHLA 2V59A 1I0ZA 2WIGA 2MHNA 2HSDA 2P30A 5B1DA 2BEWB 4C7QA 1QFSA 1U4BA 1GX5A 1J2RA 1QRRA 3MOJB 4UHEA 3KC2A 2D1TA 1GNQA 4ZEXA 4RKQA 1R6BX 3FTPA 1HA3A 3OCXA 3A4MA 3F44A 2AR0A 1HQKA 3D81A 5KYUA 2POKA 4QDOA 3POTB 1S89A 2Q1UA 4MUKA 1ZOIA 4NEHB 1QDUA 2QRGA 4WUTA 5IZHA 1T7PA 3GYNA 1OJLA 5B58T 3ZYZA 4G0XA 5E6RA 3O1HB 2WIAA 4EY4A 4USIA 4RX6A 2WHPA 3DQZA 3ZKAA 1P29A 1DX4A 3UO8B 2RE1A 4L8FA 3FVTA 3QRQA 1N5DA 1XTRA 5KAKA 2F9FA 3B82A 1M9NA 4M54A 4D8XA 4NS4A 3VXKA 3FAKA 1U1PA 1EXNA 1VSTA 3FXAA 2MMYA 2GVDC 1P7YA 2OBMA 4JI5J 3VZSA 4DNOA 5C2JB 4DV5J 3HWRA 2COLA 4X1IB 1EFPB 2PGNA 4EQ6A 4CKEB 1PDWA 4CYUA 4HLUA 5HFNA 1G64A 3N2GB 3FYUB 2PEHA 1XT6A 3K6SB 1KZGB 3Q7IA 4JI8J 1T0TV 2WQ6A 4UU8A 1VFNA 2EARA 1YMUA 4XD7D 2HMSA 1QBGA 4MO2A 3SE0A 4ZQHA 2DPXA 1H1TA 2HK7A 1GZSA 3BWXA 3BO4A 4JEIA 3H8SA 3LYLA 5EWJB 4ZYUA 4A8JB 2CMKA 4DQUA 4Q34A 2ZJ5A 3KKPA 3H20A 3S2UA 4RD1A 2RHWA 2LUOA 2D41A 5AJTA 1II8A 2H63A 1TVRB 5KEIA 4U5XA 4K87A 5AMXA 4MVJI 4D56A 3D7MA 4D9EA 3UCFA 4PGHA 2C3UA 2O2HA 1GN8A 4YJGA 4O44A 1RT3A 4GSLA 5HROA 1M1YE 3KLPX 3Q2TC 2XQGA 4L76A 2ORIA 2ZM5A 3WBJA 4X44A 4C8NA 1G8SA 3EXFA 4BMPB 1JXOA 1XTTA 1HZZC 2JFKA 13PKA 2VBGA 1S3SA 5KB3A 1SC1B 2C8VA 3WYNA 4USWA 3B1YA 2EBWA 2L18A 1AN0A 2W2MP 4LBIA 3C16B 1JZTA 3RPEA 1Z0JA 3GJ3A 2QTFA 3U7HB 3UMRA 2XD4A 4COOA 1K68A 5FIIA 2BELA 4H59A 2Q5LA 2NSYA 1ZOPA 2AF6A 3DRPA 3ZY6A 3NOXA 5EE5B 1T2AA 2JIPA 1EHCA 4BO0A 1DJNA 4LVUA 1DZIA 4KVFA 3TSYA 2BSQA 1F6BA 2HRRA 4B76A 1UK7A 3W5HA 2DXDA 5FOWA 1YA8A 1X4DA 1IXSB 4A6EA 4FOSA 1E6VB 1U2FA 3NHMA 1E2QA 5J2TF 4NYPA 1MAVA 4Q3CA 4LHVA 5I9IA 2CHEA 1GXSA 4B3SF 2VHWA 3VDQA 1OYDA 5EJFA 1Y9DA 1JH8A 1AHNA 4DMLA 3OW2R 5FTNA 4NMWA 2PUFA 3WBKA 1BEZA 3NOVA 4J9VA 3SQDA 1CDOA 5A2GA 3KSDO 3BS9A 2JL9A 4FGLA 2REQB 2HQCA 2XDAA 5D1HA 3G89A 2H4XA 3AHPA 4XEHA 4DUPA 1P1BA 3MEGA 3T1YB 1ACLA 4JMLA 5KDOA 3T5AA 4PO3X 3FHJA 2XE8A 4LCBA 2UAGA 3KUDA 2BHRA 4KE6A 1XZQA 2RB4A 3GT3A 3ITHA 2GF2A 1Z2EA 3QOYA 4MTPA 5TV2A 3AV3A 5ETSA 3A8IA 1WLSA 2M7SA 4ECSA 3CZMA 5A8RA 1XBTA 2VK1A 4TN5A 4YRNA 4GPTA 5GADl 1U8AA 3HMJG 1MXFA 4HAVA 3JD2A 3QA3E 4CKZA 3H1PA 2D2IA 1MMLA 1PBUA 1GKUB 5CLHA 1D1UA 2OY0A 1JQ5A 2NQ8A 3UB2A 1W4RA 5GAGI 1ZAKA 2HVDA 2F8EX 3SBOA 4DDVA 2OT3B 3ZE8A 1W0KA 3TLYA 2YVLA 4LF7J 3E7FA 2YCLA 3MAAA 3H2LA 3H2VE 1YRHA 2NSCA 2R6CA 3ES9A 2ZJQQ 3DW3X 1MWYA 3N87A 3F78A 2RG1A 1GA1A 2BTQB 1OCEA 1P1CA 4MO9A 1ZCZA 1T9WA 2YQ1A 1CJTB 3L0DA 3FMPB 2R7LA 3ND5A 3HLYA 1BQMA 2G25A 4QJIA 2V6GA 1ZXLA 1D5CA 3ZD9A 3QMQA 4TL8A 4DA4A 3WL8A 4I6WA 5DBFA 1RTJA 4ZHQA 1U0GA 4C8ZA 1K5GA 2DTXA 4PSDA 1W85B 3BFJA 1NLKL 1M2EA 4CI9A 1PR6A 4L3NA 4IGKA 3U49A 2XCRB 3Q72A 4GPAA 4QXAA 4ZZ0A 4WRRA 4LBPA 3TJZA 2XBUA 3PJFA 3VAKA 3NMAA 1ZX1A 1NRWA 2N3ZA 4MRPA 4GSKA 4GHWA 4OKIA 1U3FA 2GASA 4MVJH 2YVSA 4DR7B 1BXGA 1MORA 1NPYA 2IXGA 3SSSA 3STUA 1JXQA 4OA8A 3CRMA 3HCBA 1FZQA 3VV3A 4R7ZA 2PKQP 2NX2A 3L4EA 4D4GA 4CCHA 1CD5A 4JA0A 2G3YA 3OIWA 1E6LA 3L1HA 4J07A 3TW4A 2UUBB 3CEAA 2C5EA 1U9CA 4A9AA 3OTOF 3C43A 4BZZA 1EX8A 2R85A 3IV6A 2VHTA 2IA0A 2HSJA 5ECYA 2RDDA 1PFKA 3WGGA 3QM1A 4PO9A 5M3BA 1TELA 2CL7X 1KLNA 2K2QB 4DG9A 1TQ6A 4RK0A 1I7NA 1CZLA 1I30A 3KOYA 5EP3A 3H8JA 3U48A 3PFCA 3W5YA 5CJJA 3CSDA 5A7FA 1D1QA 2QEXS 5EIEA 3I3OA 1SCJA 3GGDA 1PR1A 4QDKA 3E3NA 2X4LA 1UPPA 2B78A 3NMRA 4YAIA 3BSSA 4L08A 5ALNA 4BE9A 5G02A 4G0YA 3I55S 3BHJA 4XASA 3V32A 5HATA 4RHFA 4D3FA 2JI6A 3LXUX 3PDIB 4CLWA 5LT5A 3WKCA 4FUTA 3PQ2A 4LY0A 2W8BB 1WVMA 1ZAVA 5DRKA 2LZ0A 1FX1A 1H8HA 4WP9A 1SCKA 3SDSA 5HLFB 1R3NA 4PY2A 5ALQA 2E5LJ 3T35A 2I3BA 1Q81T 1OC4A 2PFGA 3MGKA 4GRIA 3VR4D 3HO1A 5TQ2B 2J6TA 4LRQA 4DR2F 1NCLA 1SCBA 3BXFA 1GG9A 4CMIB 4QQNA 1QSLA 3DYVA 2K06A 5DTRA 2QG9A 1Y6ZA 1DIAA 4FF1A 1B23P 3SX2A 4BMZA 4U2CA 4F11A 1XDUA 2O2IA 4Q21A 3ZDZB 3KDSE 3EGZA 4XEUA 3DHYA 4HJRA 3IAM9 4NBRA 2RHTA 4G41A 3QH4A 4MJLA 2I6QA 5BSVA 2FY1A 4DZRA 4KJXA 2F8MA 1G9XA 1ZTTA 3LPMA 5JVGQ 2MHCA 2BEFA 3M82A 3BL5A 4XGNA 1JG4A 3GJXC 3T9CA 4ACBA 4ZZIA 3EW7A 3IIIA 3QMMA 3KTQA 3PS9A 3O6VA 4KXLA 2CLMB 3ZWOA 5L1KA 4D79A 3Q9LA 2OE2A 4BLUA 4EABA 4KOAA 2NO5A 2NG1A 1WLYA 1WY7A 3AI1A 2JFPA 1OQAA 3QPVA 5WRFA 3K0FA 1L7BA 3JQBA 3ZLUA 1I51B 4L8LA 1BS2A 3EQZA 1QE1B 1NW8A 4RZUA 1J09A 2ZD1A 3HYRA 2B5VA 3WB9A 3BMNB 1HDRA 3OC0A 1V3QE 4BGIA 4F97A 2QV6A 2DGVA 5D51S 1O2DA 4YAJA 1OX5A 2WB4A 2JCBA 3IODA 2E0IA 5ADWA 1BG6A 3AEUA 1KR4A 3QLHA 2O8DA 3NH6A 3BFVA 1FLAA 1IWBB 3CN9A 4YX9A 4P4UA 3G0HA 1PQWA 3KJFA 3OPNA 3FKJA 1JE0A 1ZN7A 4KQJA 1NVFA 4O3QA 3HHPA 3SC4A 3JQ9A 4M46A 2VHGA 3S3TA 3O8QA 4AG6A 2I8CA 3K96A 4FOTA 4GLBA 3TGWA 4XQCA 1E94E 1UZUA 3A6JA 3NS5A 4RZSA 1M0WA 2EZ4A 4K9LA 5KNCH 3EIXA 2QX6A 3MFYA 4AMGA 2NIPA 4OVKA 1E5TA 2ZWMA 4B9VA 4C98A 4R71A 3EDQB 3WGQA 4L5JA 3VVCA 4ENSA 3PC2A 3IR6A 3C3DA 3TZCA 1QHHB 3Q7QA 1MC5A 4HGRA 1QU2A 1JBEA 3TFWA 3FSGA 3SM9A 4F3CA 5JBQA 3AOEA 1C9NA 5FKJA 4EMSA 4MUNA 2IVMA 3OTWA 1PIWA 1FEHA 4LR9A 1KC3A 3RAPR 4KO2S 4Q5VA 3LY9A 2ZRGA 2ZRNA 5L3ZA 1A9XA 3PCTA 1C9YA 3NNDA 5BSTA 1AZTA 1C1HA 4ZV9A 1RT1B 4CV1A 4FW8A 3CSKA 3LP8A 3GIKA 3JTMA 4R69A 2OMOA 1UXOA 2GZRA 2UU9B 4KWHA 4M87A 1KH1A 5K2OA 2AN4A 5AOVA 3N86A 2UXDJ 2JDIA 5EIXA 1RKBA 3EGWA 1WWKA 1NQTA 2E3JA 4IIGA 1J42A 1HWYA 3ZCXA 5HRUA 3W2IA 2JA1A 2AX0A 1ZA1B 4NZZA 2B9EA 4UAJA 1Z6YA 4YBRA 3WX0A 4UNIA 3MMJA 1IUOA 4B3DA 2I8EA 3MK31 4XGRA 1ESZA 4FYHA 3IBCB 3RS4A 3TRIA 5CAAA 1XXHE 2D9PA 3MM6B 2H85A 3CRNA 4WFZA 1I2AA 5JS8A 5D85A 4ILEA 5IU6A 4ED4A 1G8YA 4U2KA 4DCPB 1K4KA 5AVKA 3T3IA 1J2TA 1OAOA 3DOOA 2OCPA 1AK2A 3HCWA 1OZ0A 4F3RA 1HWKA 2QQ0A 5ESWA 3TO8A 1AV7A 3DMDA 3RFVA 3A11A 3I5BA 1IXYA 4XPIB 2G63A 3D6VA 5A05A 3WL7A 4DLUA 1RBAA 1JXEA 1Z0KA 3FNEA 1QFYA 2D74B 1IBKJ 3MURP 1E3LA 3GA0A 1UUFA 3L0BA 4P54A 5E95A 2PEYA 3LU1A 5FTKA 3HKDA 2J3DA 2VONA 4UM8B 4ESHA 1Y89A 1A04A 1E98A 1TGVA 5DPMA 2CMHA 4I4IA 2YJ6A 1R4ZA 1X4BA 1I0IA 3KKQA 3M4JA 3BGUA 4J29A 4JKIA 1ZZNA 2IL1A 1DKOA 1FJHA 4P08A 3BL6A 4ZHRA 5CH8A 5AW9A 2FWRA 1RRMA 3T1VA 4GOXA 2PD1A 3A6LA 4L9WA 1F2UA 4MI1A 1E2KA 4AY5A 1H2FA 3PC8A 4DCJB 3JTOA 4Y2TA 3LECA 2XI3A 2BBOA 4WU2A 1BX0A 4N39A 4RL1A 3VO8A 4K2HA 3O03A 1NIJA 2JAWA 2WILA 2ID9A 4MYHA 3A6ZA 5IC6B 5FUYA 4UQPA 4Q82A 1VHWA 4DV0B 3FCSB 5K3OA 4FZ3A 1D2RA 2VIHA 2CWXA 3PYMA 4A48A 2OEMA 4RD2A 4DMFA 1EIWA 4QPJC 2ZHBA 3MWKA 2FW6A 1T1JA 3IQIX 2WE7A 4OB8A 4N5MA 3D6UA 1SKUB 1SVMA 2BRKA 3HJHA 3NWRA 1XMSA 4W8HA 3GJ4A 4YT4A 4F04B 3JRXA 1U0RA 3K09C 4CR8A 3UN3A 3V9AA 4NX2A 1WF3A 4UFPA 4OX6A 3M5CA 3ULHA 1VG0B 4F67A 3T7SA 2IKSA 5KT6A 1PC4A 2Q4DA 2X1AA 3PVZA 1XTSA 4JI3F 1ISIA 4YQYA 2HHTA 2CVHA 2B1RA 3C8YA 2OQ2A 1OOEA 2W9AA 1U7DA 2ONJA 1KYWA 3NYIA 4QWBA 1WABA 4AC9A 3K89A 1ND6A 2HAIA 3DDSA 4EOGA 4BLSA 2XWPA 1L5RA 2QIOA 3DFEA 4HWGA 1Z7YA 5THWA 2VA9A 4Y00A 1YDHA 4PC3A 4A15A 3HS3A 4E5DA 4GVBA 1F17A 5JANA 2ZI4A 1HI8A 3RS3A 1EWYA 3IAFA 5K3FB 5FBQB 1A2QA 1DEAA 3AF4A 1RWPB 3HCOA 1ODJA 3GWZA 1SH3A 1JZQA 1DPGA 2PJRA 4BZWA 1RWUA 2E1AA 1EJBA 2HFUA 3C5HA 4N3GA 4ZVTA 5AUOB 4JP8A 1RJEA 2ZSIA 4ZDIA 2EYQA 2LA4A 4AE5A 1TMYA 4XCXA 2R11A 1JXAA 3R2CJ 2EFCB 3OUTA 2VRCD 3BH7A 3FJOA 3IYLW 1RQ0A 2ZVIA 1A5BB 2QGNA 2V9PA 4IPTA 4HKTA 3LALA 2VATA 5GV7A 4ZCLA 1P91A 4M3NA 4ER5A 5EEGA 1UMDA 4OSPA 1QFZA 1ZH5A 4J0QA 3DTTA 4GNKA 2VJBA 1TU3A 2PH5A 2GCPA 1RAFA 2IK8A 2AZ3A 1ADFA 3KZCA 4CLDA 5EUQB 2K7JA 3BICA 4B6RA 9ABPA 3H59A 1RB0A 2BI7A 1WM1A 4E30A 3Q2KA 1M7HA 2GOYA 4N0QA 3UBMA 2RAQA 3UDVA 4E46A 4W1QA 5CT4A 1C9JA 4IG0A 1L1EA 1O7JA 1EJ7L 2CJPA 4G0PA 4EMDA 4DV1B 2CMFA 5B0BA 2ZHAA 4CDIA 1X4CA 4MP6A 1KY5A 4C43A 2FC9A 3RYIB 4TZ0A 3CQ9A 4FDAA 4DDWA 3MBIA 4EYHB 1DBRA 2MR6A 2W24A 4YV2A 1KS9A 2P2GA 3H5NA 1U1QA 2B4RO 3NONA 4A0QA 1XOIA 2F4VB 4NAUA 4HNQA 2EFHB 4HWTA 2WYWA 1VQPS 1W47A 3UHOA 5T8KA 2GBLC 3IDOA 4P83A 2O52A 3N1UA 5LOVB 3E9RA 2JHFA 2RD2A 5HKBA 2LXNA 1SVDA 2H1IA 4BN4A 3CGGA 1V7CA 1MNQA 2FX2A 2G1HA 1K3FA 4GBJA 1O94D 3RU7A 1BC6A 1FFYA 2R7NA 3Q5DA 2UV8A 4PCAA 3GFXA 4IO0A 3FWNA 2CXHA 1DC7A 2CFRA 1UJNA 2JLEA 1T9ZA 2QPAA 1GN9A 5DLYA 2K7ZA 1QIIA 3C2QA 3WJ7A 1YZLA 3PF8A 3D8NA 2YZKA 1S1VB 1HEIA 3FPJA 3C4JA 2HVEA 3H9GA 1JJVA 4HWPA 3TLZA 1S1CA 4NCNA 5AJ3F 3HRKA 2Q0SA 5I7EA 3OQIB 4HSEA 4QR0A 1DKLA 1WMBA 1P1LA 2OO3A 5K14B 4Z7NB 3BKUA 1N7HA 4QG7A 4YRFA 1VJQA 3BHNA 2PGJA 1I4LD 3DO5A 3R3UA 1F8UA 4PQYA 1VI2A 3PA6A 4DNFA 4GS5A 1EE2A 4UTOA 3AT1A 2JBHA 4ID9A 1LRKA 2WG1A 5I3CA 2QGFA 3G82B 3NJ8A 3TIIA 2HNKA 3RVOA 4BMDA 2V3VA 3OETA 4FFVA 5CIWA 3SV3A 3R7BB 2PUEA 3T3FA 4UOCA 1M2GA 1FDWA 2M2BA 1GLNA 3MMCB 1RLIA 2IOYA 5C35A 3HDGA 1BXNA 4YFVA 3C46A 4X64B 1EVYA 4UU0A 3A1NA 3X2EA 2G6BA 1HW9A 1TL3A 2C1EA 3EWIA 4L5IA 3QKTA 3QVKA 4WP8A 3V55A 1KGSA 2EATA 2L08A 1S2NA 4XQ9A 4DBZA 1IPEA 1HUQA 5ETMA 1PD1A 4FYIA 4II7A 4HFNA 1IKXA 1GAWA 4OHUA 4PPGA 4FT2A 2JB9A 1JLGA 3FFIA 2XNDA 3KOWA 1QZZA 1A6LA 2D7SA 1P27B 4LWZA 1KLMA 4FZ5A 4ED5A 3M30B 3ELUA 2LXIA 2QL7A 5KREA 1UBUS 1TVMA 4WI1A 2RJZA 4OQZA 3TXXA 2WA2A 3MT7A 2RHCA 1JFLA 4ZVRB 3UD5A 3Q89A 2QLJA 3ZGZA 1DTTA 1U63A 4ZQGA 1HBMA 4RD0A 4ND4A 4YV7A 1K47A 3KQPA 4LV8B 3D02A 1F3VA 1MIHA 4HH4A 3A0UA 5C37A 4Z4IA 2WVJA 3KSUA 3IL2A 2POQX 3UJBA 5KFWA 1Z34A 2QL9A 2FMHA 3ZU6A 3FZ2A 1O0SA 2R96A 2H4YA 1PD0A 1CZOA 4DR1B 1PGOA 1YZFA 3RT1A 3OX1A 2IPMA 1XGKA 3T38A 5SYAA 4M9RA 1CCWA 1M2VB 1MOZA 5KFUA 2D3ZA 4PWZA 4DLBA 1OX6A 3I9OA 7AT1B 1XVAA 4XTRA 3T5MA 4IXWA 2BFCB 4X1YA 3I9NA 3RHZA 1Q19A 4TQRA 4UTRA 3W5ZA 4HZUB 5FV7A 2ZI6A 2O59A 3VR3A 4HT3B 4ARCA 2QAGA 5LMUF 1WETA 4FYXA 3WYCA 3QUTA 2Q2VA 4GM4A 2V34A 2EG2A 2JOQA