1LK5A

Structure of the d-ribose-5-phosphate isomerase from pyrococcus horikoshii
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
229
structure length
229
Chain Sequence
b'MNVEEMKKIAAKEALKFIEDDMVIGLGTGSTTAYFIKLLGEKLKRGEISDIVGVPTSYQAKLLAIEHDIPIASLDQVDAIDVAVDGADEVDPNLNLIKGRGAALTMEKIIEYRAGTFIVLVDERKLVDYLCQKMPVPIEVIPQAWKAIIEELSIFNAKAELRMGVNKDGPVITDNGNFIIDAKFPRIDDPLDMEIELNTIPGVIENGIFADIADIVIVGTREGVKKLER'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-Ribose-5-Phosphate Isomerase
publication title A hyperthermostable D-ribose-5-phosphate isomerase from Pyrococcus horikoshii characterization and three-dimensional structure.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Isomerase
total genus 76
structure length 229
sequence length 229
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2002-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lk5A02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lk5A01
3OC6A 2GNPA 2RI1A 2QMWA 3TUZC 4L50A 4LUBA 3ENQA 1PBTA 5HJ5A 2P9CA 3KWMA 1UJ6A 2WU1A 2BKVA 4TM7A 1HORA 2LQJA 4R9NA 3BXGA 5IT0A 4L4YA 3BXHA 2PC6A 2DT9A 2DTJA 1CD5A 4M8LA 1KS2A 2P9GA 3DHWC 3ICOA 1LK7A 3TUIC 2KO1A 3KV1A 3IBWA 4R7TA 3CEDA 1YGYA 1VL1A 3W7BA 1FS5A 1O8BA 1ZPVA 4L5JA 3ENVA 2R5FA 2F1FA 4GMKA 3MTJA 3DDNA 3ENWA 3NRBA 4L51A 1Y89A 2ZHOA 3HHEA 3IXQA 3OBIA 5T41A 2QSWA 3AAWB 3DHXA 3L7OA 3MWBA 4GO7X 2CDQA 2PA3A 2QRRA 1HOTA 4GO5X 2RI0A 3MAHA 3CSSA 1FQOA 2JOQA 2RQKA 3LHIA 2H9ZA 2J0XA 4PWUA 2OKGA 3E15A 2I9SA 3NWPA 2LVWA 3AB2B 1PSDA 3LUYA 5JJBA 3OFGA 3OFEA 4TM8A 3OFHA 3EFBA 1LKZA 5IS2A 1M0SA 1YBAA 4GO1A 4OQPA 1SC6A 2NYIA 2F8MA 1U8SA 3TUJC 3OFFA 3EB9A 3S1TA 1DEAA 3AB4B 5FIIA 1FS6A 4IO1A 5IT4A 2MDAA 1JT9A 2QMXA 1FSFA 2J0EA 4OQQA 3K5PA 1UJ5A 3BXFA 2J0WA 2FGCA 3HN6A 3U7JA 1NE7A 3O1LA 1LK5A 3N0VA 3TX2A 2RE1A 3P96A 3UW1A 3E7FA 4L5IA 4L4ZA 3CH7A 3BXEA 1RWUA 1Y7PA 3LOUA 4NMLA 1UJ4A 1FRZA 3NZEA 3DC2A 4X84A 2JHEA 2O0MA 2P9EA 3LWDA 2RQMA 1XTZA 2BKXA 2W48A
chains in the Genus database with same CATH superfamily
2GLUA 3MPUB 4PG7A 4H9GA 5IC4A 3Q8UA 1OWNA 1T3LA 5BSFA 3B5JA 4BVKA 4XIYA 2R6FA 1SCAA 4PO1A 4E5NA 3Q2TC 4L8FA 4IHJA 1V37A 4M9QA 5JNLA 3Q5GA 5WRFA 4HNAA 4UVGA 3KS9A 4B71A 3QPCA 4L02A 1NR5A 2RHQB 5ALLA 2EJUA 3IE1A 1YRBA 3ZNPA 4I1RA 2QN7A 4PXEA 4XGIA 4CFSA 2X0KA 5SZKB 3HCOA 1CQIA 2DWQA 3TTTA 1TZKA 2HNYA 4L0DA 3FEXB 4ENVA 4UOQA 1OY6A 3CJ3A 5ERGB 6AT1B 1RAAA 4R3UC 1KPGA 4XQEA 3S29A 2P91A 5DWVA 3LFHA 1V8BA 5TSDA 2Q4EA 5IK2D 4DX7A 2QBYA 3LLMA 2HS0A 4Y2VA 3B51X 3S1LA 1L7AA 1HETA 1BHJA 3LMKA 1YZLA 2QUAA 3GLHB 3HNRA 3H11B 3RVJA 3AHJA 4B5KA 1ZNXA 2F1RA 2GZ2A 2JFUA 1QE1A 1O6FA 4YASA 1ADGA 4C78A 4F4UA 2YRWA 4P3XA 3VAIA 3PDCA 2FZKA 2FMIA 2ZJFA 1UEKA 2XMMA 3IDOA 5CDGA 4MS4A 1G8MA 3X2SA 1FMTA 3T9BA 3OQMA 2O8CB 3V5RA 4OUDA 4RKEA 1Y1LA 4GEKA 3V8NA 4L51A 3E0XA 3CIMA 1RDRA 4ZJZA 2EKZA 4WVLA 5EKDA 2DNZA 2Y1IA 4BX2A 1FXLA 1CDOA 4JK3A 5LR6A 1QKJA 1O4WA 2ATCA 2NQPA 3VAZA 2E5JA 2I4TA 1ECJA 3KPJA 1EBFA 3PJDA 2PZ8A 2HA6A 2Y8WA 4J6EA 1G5HA 1E79D 1SZPA 3L04A 1K27A 4OI4A 3I01M 1EDEA 1QYXA 2ZKIA 3OLBA 3D0QA 2CDAA 5CCEA 4ALLA 4KQXA 7FDRA 3MAAC 1LFPA 2F1OA 2FP4A 4AQDA 3TX2A 4OZJA 3RHSA 3UW1A 4DV2B 3KJFA 3JZMA 2HQ1A 1S3SA 1P9LA 1I3MA 1Y63A 2VI5A 3BXZA 5IWCA 4RGQA 1ESZA 3WK4A 2R1UA 1OFUA 4S0ZA 4DANA 3U09A 4XSVA 1B7YB 3H2GA 2GNKA 3KEGA 1FJHA 1RHRB 2AN9A 4WSOA 4DUGD 1PAUA 4YJ3A 1I51B 4C7BA 5T4EA 2BGUA 2GWHA 3IP9A 1E79A 3WDLA 1G1AA 3QBVA 4X8HA 1TDJA 3L6CA 3I28A 2IE8A 2B5JB 3K73O 4LDAA 2SKEA 3ZZMA 2XGPA 5B0BA 5LJ3Y 3VZQA 1QG2A 3WYDA 3HUFA 1UBGA 1SIWB 4A8WA 1ILEA 5L7WA 4BTVA 4V0SA 2FUKA 4KFBA 4W63A 1QD1A 2NPOA 2MQNA 4F67A 4QNNA 1K8QA 3PB3A 4U9RA 4N5NA 5HNKA 3HN7A 2DRDA 4HNHA 1HLWA 5EGYA 1J0EA 1J5PA 4IJVA 4PR3A 4AZSA 3OTIA 1CJSA 3DP9A 3ER9A 3VNQA 2R4TA 3KWJA 1ZHFA 1GNRA 4OM7A 3G5MA 3CEPB 4B8YA 3LLSA 4D42A 2OESA 1X7XB 2YNFB 4IG3A 3AZOA 2DG2A 3HR4A 4X90A 4YY3B 2RMKA 3DDKA 5KAPA 2NUAA 2ZSKA 4WYWA 1IKXB 1ZCFA 2B3TB 1PZEA 2C2NA 2JIDA 3TLXA 4EYGA 2LQ5A 4F36A 4L2IA 1JQLB 4ECZA 1XZAA 4PAQA 1ROFA 4TN2A 3GNQA 4RMIA 5KFQA 3WYFA 4ML3A 3IALA 1YCGA 4DUZF 4WFJA 3OVBA 1JPVA 3GYNA 4RUBA 5ETSA 3KR9A 3UD3P 2QMYA 1LBIA 2PEZA 3G9TA 1V9CA 3N7AA 3HXQA 3MQ4A 4PSUA 1DQPA 1PJSA 4I81A 3VNBA 2GARA 1TF7A 3HCBA 4TY9A 3E1SA 2V6MA 4BFSA 2N4DA 1ACMB 3K5LA 3UJ3X 4ITVA 3DEJA 2GRAA 2H9YA 3BK7A 2HT6A 2I9SA 3DOEA 4DXAA 1JE0A 3RC7A 3T1NA 4CO4A 1VQPS 3LVFO 1XZEA 3A4LA 3BH7B 1UA0A 2CXRA 1D2RA 2RJ3A 1XEZA 3PCTA 2ZPAA 3JW8A 5HKKD 3R7NB 3O4RA 1KYVA 1REQB 3MS4A 1XRLA 3SNHA 1QDUA 1T8TA 4HSGA 1IJEB 4EU0A 3IQWA 1ZZEA 1YJ8A 3D7MA 1RT2B 2CSXA 3OR2A 3JYHA 1RSZA 2B4VA 1T0TV 4CLXA 2QTFA 4LPKA 2GCOA 4MDEA 1IEQA 4GC5A 4QEZA 4ERNA 2RKIA 1PJ5A 2X5OA 2OFXA 4IIJB 4WQMA 1UMJA 3UK0A 1Y6FA 4I4NA 3OIWA 2IYEA 3DZKA 4LF7B 2A2CA 3SZGA 2WSSD 4Q4AB 5HKKA 4R2HA 2O19A 4M5HA 5CXQA 5CT9A 3ZBQA 2M0GB 1M54A 2H1LA 3G0IA 4HGNA 4OKNA 1VIMA 2WUVA 1RHKB 2VVTA 4F72A 1Q77A 3NIDB 4AMYA 4QEDA 1KA9H 4BEJA 4M89A 3HYNA 4Q16A 2IYAA 2W9BA 2SCUB 4HNGA 1HUQA 1T0HB 3ERCA 1KO1A 4A8KA 4HZUB 3E51A 2XB2A 4JUCA 4W82A 4O6VA 1RYZA 4MAKA 1RTKA 3BB5A 5HQJA 4PHCA 3C4JA 1PJCA 4WZBB 1D6MA 3KPUA 1YJNS 3D6FB 1YL7A 4KREA 4XPZA 3ZXYA 4DB4A 3SFZA 2UXCF 4NULA 1X8DA 4N5MA 1SL0A 5J2UA 3AHGA 4NZ7A 2ZT5A 1S9HA 3NAMA 2H1IA 3TSCA 2EGUA 1OMOA 3IR5B 1LF0A 2VTKA 3Q23A 1CUVA 1U7PA 4RMNA 4ZN6A 5G3YA 1KTIA 2UP1A 5LOVB 2X0EA 5CM2Z 1POXA 1MXHA 2IZZA 4YJ2A 4TRRA 1TQ4A 2SXLA 1Q81T 4N8OA 1X7VA 3CYFA 1VLQA 3ND8A 4ZPVR 3P9NA 3WS7A 3A1FA 2I2BA 1OX4B 1T4CB 2NVWA 2GPWA 4Q9HA 1L7EA 4P6VF 3PQ6A 4K1LA 5IJAA 4HNSA 1JJIA 4L08A 1OIAA 3U3RA 2J08A 1EHCA 4KUGA 1CUCA 2RK4A 4GI1A 4BRZA 3BQ0A 1HWYA 1X1AA 4HWRA 5K8NA 1WNEA 1AK9A 3G0DA 4BCCA 4ZGGA 2A9FA 3FPFA 2C0QA 3OTOB 4FVMA 1NRJB 4OXXA 2B99A 1E4OA 1HTTA 2K1RA 2ADFA 5T67A 1H0HB 1YMQA 3P97A 3HB5X 4ZAWA 1PJBA 1CF4A 4M6WB 4NH4A 2O7VA 3SJ7A 3CE8A 1V8DA 4OX9B 2OAEA 1JFFB 5E3RA 2BDUA 3IEUA 4ZOEA 1GK8A 2RGNC 1MBZA 4J03A 1E3WA 3DOFA 4QUGA 5L45A 1GGEA 3HCWA 4WWSA 4JI1B 1MO6A 2HXSA 2E4ZA 1YVDA 2JC3A 4GI7A 2X5XA 3CBQA 3CJ5A 2C7GA 2A84A 2K2WA 1HT3A 3Q22A 4ZU1X 1QIIA 5FWDA 1KEPA 1L2TA 3MM5B 4LDPA 3V6MA 1J42A 3PF8A 2B8WA 3NBAA 5FNVA 2H16A 1S72S 3D3EA 2GZSA 1ONBA 1VB5A 3LHDA 3QPVA 2X22A 1N5OX 3VV2A 1PI3A 3LX5A 1G8PA 3OG9A 3IP6A 5SZIA 1H2YA 2DZDA 2NXJA 1M2WA 3VVUA 1WDTA 1VIAA 1YB6A 4CQLA 4OSEA 4EO6A 3AF4A 3WB1A 2RGYA 3FROA 3UF0A 3S7ZA 3LK7A 3X2FA 2OAGA 4KR2A 3GFOA 3LHKA 4EHIA 5DCUA 4UT4A 3IQFA 4JODA 1KDRA 1Y7LA 3ZS9A 4ZZ1A 4QEKA 3NWPA 1NUTA 4JI0F 2DGXA 4EB6A 4QKQA 2Q0XA 1MCZA 3KUXA 2OIHA 5KOYA 3D6TB 5DM60 2JGEA 3F78A 4MUGA 1ICIA 5J23A 1YE8A 1Y8QB 3CVKA 4DT1B 2NU6A 2XDYA 4IGAA 3CWCA 2YH0A 4CIOA 1HDYA 3NLLA 1O57A 3SC2B 5GONA 5E95A 4E7PA 3LGSA 3BR9A 3C7DB 4PC2A 4EG3A 3U13A 3MOZA 5HZGA 3CZ5A 2OT3B 3MWKA 1JQ5A 1KZ1A 1WXGA 3EOZA 3NW9A 4KPEC 4M49A 1JJFA 4NZ0A 1EQ0A 2QYTA 4I8XA 5JJLA 5LMNF 1WCIB 4WXOA 1RLIA 2RFLA 1VE1A 1TFYA 1A7JA 4M0PA 2HIQA 5CW2A 1AGYA 1Z4KA 3QXJA 3OCUA 2CLMB 1W47A 2I6SA 4NLYA 2FWBA 5AH0A 3AIIA 1QU2A 4NZOA 3Q86A 1DO8A 1Q0UA 4QU0A 5CT8A 3HV0A 1KFCB 2E49A 1GV0A 3NTQA 4KGVB 3KAJA 4NABA 3O9VA 1XV5A 4PXYA 4UDXX 4X4RA 1CUYA 4FFPA 3GLFE 4QIHA 3E8OA 2UYOA 1NBOA 3QOYA 4HDQB 1NKBA 4L5BA 2XVZA 3IOEA 4C7OB 1IXRC 2H3HA 3A4YA 4TS4A 1HDIA 4IJWA 1RXWA 3CJQA 1MHPA 4JSTA 3FDSA 4RLHA 4PYAA 1SVKA 4YB1P 4DSUA 3K94A 4NS4A 2J5BA 2C8KA 2CL7X 5JH7A 2ZK7A 2VAXA 5DM4A 5T7BA 3UVEA 1SUDA 3RT9A 2PVPA 3GWZA 4I4CA 4IX9A 4JP1A 1DAFA 1HH4A 1FF9A 3HLYA 4PQEA 4MK4A 1Z1ZA 3NMRA 3X1ZA 3PEYA 3OTDA 4CKCB 3Q1LA 4XPEA 1SIUA 2F3RA 1W4LA 3E82A 2JKZA 1T10A 1W4BA 4LFBJ 1RYDA 2IVYA 3W1YC 1N2BA 4JZYA 2P5TB 2BMJA 2JJ4D 3UAWA 4AICA 3ADDA 4NICA 2GVDC 5IUJC 2B34A 1Q53A 3PJEA 1U3TA 4G1IA 4JJFA 4DR7J 5EWMA 1EM8A 1K86A 3ACDA 4R8VA 4CF7A 3G79A 5FL7D 3B7PA 3B6MA 3GA5A 5ARDA 5CYMB 4NEYA 3ZDAA 1AQIA 2FB0A 5U4QA 2AFHE 1WB9A 5AJHA 3QF7A 4O4GB 4R0NA 3OZIA 3EUEA 1BCRA 4RLFA 3MRXA 4TZTA 1CIVA 2PWZA 4HRVA 3ON5A 2RI1A 4NSNA 2NYAA 3W2FA 5K8CA 3LF0A 4TMTA 4QYSA 5IVIA 2NU9A 4IP0A 2I55A 4M8LA 4QUIA 4Q3BA 1HA3A 3LTNC 3WMFA 4QU8A 3KD2A 5CLQA 1G5QA 2JHPA 1F6DA 3AHDA 1UVJA 3FC9A 5FL7A 4GX1A 3BJZA 1BKYA 3BO4A 3RV3A 1SU7A 4MRMA 4FCTA 1T91A 3CKKA 3IN5A 4MV0A 3AVYA 2JCXA 1OV4A 1UM8A 1ONOA 4ER5A 1KK0A 3T3MB 4URYR 1DJNA 1RJFA 4GRSA 3N8HA 3BZUA 5DX8A 4HWSA 5EVCA 2RJOA 4G5QA 4P71A 1A0OA 3KQYA 5B37A 3VAYA 2A78A 1DBVO 4FUQA 4Z8XA 1Y3BE 1FNDA 3R0JA 4MGHA 4I46A 3S8MA 3D1QA 1QF7A 2GI4A 4HT7A 1OIVA 1RMQA 4KB7A 2PUVA 4UTPA 1U9JA 4UQLA 1M8KA 3MZ0A 4ECWA 1Z6ZA 4YMLA 1SVLA 1QVZA 4QUAA 1JHAA 4ZVRA 4I67A 4TSKA 4YDQA 2ZRDA 3VAMA 5EKSA 1NMQA 4ENRA 1NVWQ 2IP2A 2PRKA 3RVMA 3BHJA 1V8FA 2OA0A 1E2NA 1O97C 1LWEB 1NVVR 1I6WA 3IS3A 4P2BA 2YVQA 2OV2A 2HTFA 2NSHA 3AW8A 1FFXB 3QU9A 4MUIA 4L3NA 1GTJ1 3T1AA 1E1YA 2H1RA 1S1VA 4EBEA 1POWA 5BWNA 2H7CA 5L3VA 2XULA 1S9GA 2BVZA 2W2NA 2PQ2A 1TK8A 5CFZA 2AI3A 3QOFA 3ETOA 4NCGA 1U0HC 3K0JA 2HQIA 3V1LA 1MN7A 4JC0A 3VZPA 2A8YA 1SVNA 1G6BA 1N5QA 4O25A 2QP3A 5TPZA 3HHKA 5J4VA 2O8FA 2G0NA 3PNOA 1WPQA 4O4IA 4E2FB 4MUEA 4HI1A 5LB2A 1SCJB 2QTRA 4FHZA 1N33F 1EFTA 1LNSA 5JSQA 3F5MA 4FI3F 4ZHRB 2FLNA 1SUAA 4HTIA 5IDYA 1Q0LA 1Z75A 2WR8A 2RKBA 3ZWWA 1T9TA 3T0GA 4ADSG 2V03A 4AJ2A 2XMUA 3H13A 3K9GA 1N7JA 2GM9A 5CX1B 3VDNB 1LS1A 1XLTC 3ZK8A 3DDZX 1E20A 2ZJ0A 4A8JA 1FA0A 1SXJC 2VJCA 2I9PA 2W4PA 4QGAA 4B48A 3UWDA 2O07A 2QTTA 4MYHA 4YI3A 4WXMA 3JALB 3IAHA 3VSBA 5BVHA 1WELA 4Q3EA 4YCCA 2HLUA 1XNHA 4F45A 2WABA 4P3NA 1UDWA 4DRXB 1ZAVA 4Q4HB 3ZE8A 1X7YB 5ETRA 2XQVA 3N6RA 3G88A 2W9AA 4A6XA 2JLQA 4IFVA 4PGMA 4J4TA 2GTHA 4L8GA 2Z58B 1KI9A 1GYRA 3DMNA 5KQPA 4TUYA 3WL7A 4FC7A 3KB6A 1G3MA 1RKQA 4R6XA 4RSMA 4OFWA 4WL0A 4RTKA 3AF6A 1URRA 3GOQA 3H2LA 1PG5A 2YDXA 1T9UA 2NADA 1CULC 1UOQA 2VONA 3BF8A 4E2ZA 4K9NA 3KLFA 4MS3A 2XVXA 1JXVA 4KQ9A 4OV6A 3F1LA 1HNIB 3QEKA 4Y2QA 1NH7A 4XKJA 1CJKC 1ELOA 1JB0C 3UWMA 1SNYA 3FYSA 2AIRA 2ZD1B 4II2A 5HQLA 3PQ8A 5A76A 3NM5A 1PFGA 1EXVA 1GM5A 2WTMA 5CA5A 4NYIR 3DBHB 1XVTA 4EZ9A 2HZVA 3UJAA 3EPLA 3RH0A 4I4LA 3H4DA 3PYXA 1CDEA 2HD4A 2TSYB 1ODIA 3GUYA 1IHUA 1JX4A 4HKQA 3MUOA 4PYNA 6FD1A 4D8YA 3EK2A 2BMBA 4YP0A 1FFSA 2NSBA 1H3NA 2OC4A 4DM3A 3EQ9A 4ZP6A 1QKKA 1TFRA 3AL3A 1GILA 2YV2A 2DLCX 4NECA 5ITHA 5LP6A 1AV6A 4P34A 4DNPA 1M1ZA 2PL5A 2ZAIA 3R7SA 4PZ9A 2A57A 5MF6A 4F4FA 1CEZA 4JU8A 5T3UA 4ZJPA 3PYEA 4TM7A 3P45A 3O8QB 1P8AA 1WF3A 1INLA 5AW9A 2M8HA 1GGKA 4JGGA 2XOXA 3KUCA 2ZIXB 1EFKA 3VSAA 3D0OA 4RA9B 3SXUB 3H4IA 4ZS6A 3H8WA 4M53A 4PONA 4N82A 3E58A 4ZVKA 1RAHA 2JEFA 4DLNA 2IXDA 2ZJ4A 4CR8A 1TLFA 5LMUF 1ZK2A 4URQU 3BGIA 1EYZA 2DBRA 2VJLA 4BFXA 4UOFA 5C24A 4GO1A 4EK2A 1Y1SA 3ZCPA 1XVAA 3NT2A 5AXKA 3BSOA 3EUNA 2EI5A 4WHMA 4MIYA 2FN4A 2XADA 1A8UA 5ALGA 3QGGA 2A33A 4WNIA 1SUFA 3RODA 1S2IA 4G97A 1JPJA 1X4FA 2GGPB 1MAWA 1TJPB 2ALZA 1H66A 3C3PA 3GIWA 4KC0A 2QSYA 3L0SA 4GPBA 4C20A 2OMOA 1SKAA 2NM0A 5FBZA 1A8QA 5JNUA 2FLOA 1AC5A 4ZDKA 1VP3A 2WOMA 2NNWB 4UXHA 4MROA 2M98A 1KBRA 4KHPF 3BH0A 3M9WA 3EQ7A 1NQ5A 2P78A 3ME5A 5CM8B 4RZQA 5JRDS 2JLEA 3AWIA 1UBUS 4MAMA 2QAJA 3ZWKA 1IB6A 3VNVA 5A5EA 2DR5A 5GGYA 3DXBA 4ANEA 4JFAA 1RRFA 3DBLA 4DAEA 3ZDCA 2A5YB 1VQ4S 1CSJA 4M5GA 3W9HA 4BMPB 2POQX 2Y2UA 5KMGB 3GRYA 2P9YA 1Y6GA 1YJUA 3LBFA 5THXA 4RD4A 4GD3Q 5F52A 4AO6A 4KR3A 1BMFD 2P3QA 3UO8B 3RU7A 4X6LA 3JVDA 1KKMA 3LXUX 2Z8ZA 2J48A 4ZAYA 3H8VA 1UT6A 4JI4J 4J0JA 2C2GA 3A6LA 2IH2A 4LSNA 1WU8A 3E9MA 4P7FA 2H48B 4ZCPA 4F7DA 1YA6A 3I9NA 2FYXA 4DNQA 3J7YI 2REOA 3IUJA 3UN5A 1N6OA 2CF5A 4YRAA 2W25A 1UAWA 4R01A 1W46A 4X4VA 4ONEA 4BC9A 4DEXA 3QIPA 3QLUC 1QAOA 3R77A 4BWYA 4B7AA 4L8YA 2PO7A 4DMUB 4KV8B 4D4IA 4YDRA 4YRGA 3K2EA 3WMGA 3FHOA 3VYRB 4F3MA 4MRRA 5GPBA 3CX3A 3GONA 4NMHA 4M46A 1K7XB 4LI3X 4CI0B 4BNTA 3UMVA 1M3SA 1XCPA 3I9KA 3MTKA 1G0NA 2JC0A 3KLBA 3VI3B 3KQUA 4C8OA 2COKA 3BIOA 3B9RA 3BSAA 2PX6A 1Y6JA 2R1ZA 4RXTA 5JO9A 2OZVA 4D9BA 2VK4A 3FDZA 4GVPA 4WFXA 3WLKX 2QIFA 4KTTE 1THZA 2FPWA 3HPOA 4V02A 1XTVA 2WJ6A 3R1LA 1SBYA 2GHWA 5FJJA 4CFZA 2YC4C 1FD8A 2EBWA 2V7XA 4IG9A 5HZKA 2V58A 3MPWA 4OQ4A 1U81A 5IDWA 2F43A 2CQ1A 3FSIA 1BS2A 3TZBA 2WVHA 2YBVA 2BBWA 5DO9A 4EG0A 4B3RF 3VOSA 3UA3A 5FAKA 3KXDA 3I73A 3TPZA 1EAYC 1QRDA 3LQQA 4GSKA 1PJ3A 3IBSA 3P2IA 1DC3A 5DTJA 1UQTA 1USKA 3WLPA 2W9CA 1K2VN 5SY9A 3MM7B 4C0BA 4I99A 1KMHA 3BRCA 4MW4A 4JDUA 3VPSA 1QO9A 1JFTA 3L0DA 2YWWA 4MJ3A 5FLKA 3LSYA 2JFGA 5AJ3F 2H7XA 3KSZO 2Q28A 4RA6A 1HBOB 3WHKA 3FI9A 2V4UA 2F62A 1RBYA 2ZBDA 3JQRA 5EJEA 4DV1J 1IEXA 3H5AA 3CV3A 5IV4A 3PKZA 5HIIA 3PD7A 4JI5B 1XQ6A 1B64A 4IOLA 5AVVA 2Z95A 2NTYC 5K20A 4R8RA 4E2YA 1U5BB 1EXNA 3GRFA 3DW3X 5FLXA 3IVMA 3RIYA 2PBRA 4FGJA 1E1NA 2WICA 4UCFA 4OI3A 2EIHA 1GKYA 3W2EA 4GH5A 1MC4A 3NTUA 2QI9C 2LR0A 5IVPA 1A2OA 4HYKA 4YJFA 3TXAA 4B7XA 3DEAA 1JLAB 3DM5A 4NV0A 3IUEA 3IEKA 4IIXA 1EVZA 2J6IA 4OX9Y 3KQQA 2Y1RI 4ZYZA 1XN4A 1NLMA 1NQTA 1E7RA 1Z4QA 2Z9DA 3MHPA 1UP1A 4M36A 5LXTF 5L9XA 2RDMA 3OSNA 2C7QA 2HADA 4WJKB 2HMAA 4KQFA 3QFWA 1GAEO 3UUGA 4CL3A 3I0RA 4EY8A 4BU1A 1II8B 3UFCX 4B4WA 2WJVA 3CX6A 1LSSA 1GTRA 2IHNA 3RVQA 4FFSA 2DPYA 4I2VA 5I47A 3QEMA 1RHMA 1RAEB 3ZCUA 1QE0A 1S6PA 2WIKA 1XTRA 4I8DA 4OQLA 2H57A 4DG1B 3QLVA 4BNHA 3M3DA 3ND5A 1QHGA 1JMVA 3C3CA 3VHRA 3D8BA 3ET5A 3CD5A 1I9GA 3HFZB 3ULKA 1CW2B 2X8JA 3DOOA 3PO4A 1ORDA 1VQ6S 4M8NE 4OFZA 4X65J 3P9CA 1VECA 5CCLA 4CPDA 2YS7A 5C8YA 3A4NA 5I3UB 3OY7A 1GL6A 5L53A 4JP3A 2QENA 4YT5A 3O9ZA 4LSGA 4AY3A 4D2IA 3PW5A 5MFZA 5G0TA 4K6OA 1EIWA 1JLKA 2QL9B 4O08A 2X8AA 3H20A 1DFHA 4CW7A 2A5GA 4P0PB 5BORA 2GTIA 3I37X 2QORA 1SXHA 2DPLA 2LXIA 2P2GA 1CF9A 2X0NA 5KEIA 4RW6A 1U7OA 3DDOA 2AOTB 3ZIDA 5EIEA 2XXJA 3ZEAA 4NYZA 5JMWA 4H31A 4RJLA 3M6VA 4X7MA 2I6WA 3O5AA 5JYDA 2JJMA 3Q5DA 3ZE1B 4H4KC 3HVUA 3L8DA 1Q57A 4H7PA 2XMVA 1RMTA 1Z3CA 3IH5A 4DCTA 3R0QA 5SY4A 4TMYA 2VNJA 3EH1A 4DWVA 4IH7A 2L69A 2O23A 2AC4A 1VL8A 4DQVA 1QP7A 1ODSA 3SLGA 2FW7A 4K2AA 4KKOA 2Q1LA 3G0CA 3V46A 3I4LA 3VZRA 1N32J 1C9YA 4C5BA 2P3SA 1VRWA 1B26A 4F5YA 4CEJB 3IJPA 4CHTA 2IBSA 4XR4A 4O4LA 3ANXA 2UUPA 1L8QA 4PHHA 2RQKA 2IEIA 2VXBA 1BXNA 4C6SA 1B76A 4TWIA 1OZHA 5EKUA 3CF0A 1MB9A 4Z9FA 4NFYA 1XJ5A 3F3YA 4CN9A 3BMXA 1ULBA 3VKWA 1N6NA 2ZRAA 5KU7A 3CRNA 2BN4A 1Y0HA 3BDEA 5C31A 4RU2A 4KQCA 3LAKA 2PGJA 2PKXA 2QZPA 4ACBA 2OORC 3CLTD 5EMLA 1WDMA 5ICEA 3FYDA 5KG4A 1H0RA 2MSEB 1A4XA 2W2OA 2X1HA 4OHMA 2VNAA 4CLKA 3BD7A 4FYXA 3G2PA 3VJMA 4K4WA 4ZQFA 4BO6A 1Y98A 3QT5A 3R24A 1E96A 3RS3A 4UY85 1AK2A 5GAEU 3IIKA 1SOUA 1ZN8A 5HRUA 1OPXA 3SHWA 2BJEA 5B09A 1M90T 4R31A 2AB0A 5K3EA 2QR2A 1RQNA 4UM9D 5D6OA 4DADA 3JQBC 2HBZA 5A3VA 4DUYJ 4BOYA 3PG5A 4AMUA 1K89A 1TKTB 1R0XA 5BYKA 1I6JA 3T7JA 3L05A 2HQFA 4PQUA 1N25A 3J7AN 3WGZA 3DCAA 3T5HA 4NVRA 2OYRA 5BOSB 4GO5X 3NASA 1B6RA 4IYJA 4FSHA 1JG1A 1R0LA 3ZDFA 3QUSA 5EXDA 4EAQA 1YBVA 5EHHA 4ZVQB 2Q5IA 3UHPA 4R8SA 2GKSA 2F3TA 2L9NA 2A30A 1BA2A 3E2IA 3WICA 2D9PA 1XEXA 1DMRA 2P4EA 4PW0A 2MDAA 3K2BA 4BQNA 4KX3A 2VSNA 4TT8A 4NBWA 4BLOA 3GVPA 3PIRA 3KJXA 1C1DA 2R5WA 2CDRA 1NV8A 4GWGA 4BGVA 3QGPA 4RF5A 4QU9A 5TQ2B 3SBOA 4DCUA 3AP1A 3IMQJ 5HROB 1CX9B 4ZAGA 2B4QA 1L5VA 2Q1YA 3MCUA 1Q95A 5EJ8A 5P8WA 3MXOA 1UVNA 4JQZA 1R4NA 1REGX 2QA1A 4U7CA 5BRJA 4LDQA 4PLFA 4EAAA 5B3KA 2HIGA 3M6LA 1X1TA 4TKMA 1D9ZA 2VKTA 3HGTA 4LRQA 1Z0AA 3IDZA 5KG3A 3W6NA 2WHRA 3QWFA 2VXYA 2AXNA 2NO1A 3A13A 1T05A 3O75A 3ZHXA 1ZA1B 3CNEA 3DVSX 2ZI5A 3QZUA 3T3DA 4FOPA 3CXRA 5F8GA 3OW2R 1J70A 1U6IA 4Y2GA 2EG9A 3DJYA 2W22A 1T4GA 4ELUA 1X4BA 1E3JA 3RVOA 2R4UA 1KFEB 4KO3S 4OYMA 4JR2A 4OGLA 4BEBA 4NI2B 5E0OA 2IU4A 2ZS7A 1WMFA 3CPSA 3QUCA 721PA 3UATA 1BQ4A 1P0QA 1R0SA 1XRRA 1UKUA 5KTSA 4BQIA 1EFRD 3VU9B 4F7WA 2R5NA 1XWWA 1QZZA 2NUTA 1C0UA 4TSFD 5KYYA 3KJEA 1CUHA 4L4SA 1A5AB 5BWOA 2CGEA 4CKZA 1SUQA 3IPRA 1NUSA 1T6BY 1EDDA 5KFEA 1AA9A 3K6SB 3TDNA 1OI7A 1NMEA 1R5OA 2YQZA 1FDAA 1FRXA 1Y9JA 2GMJA 2AXQA 3EFOB 2KLBA 4F56A 4UU1A 4RUAA 1PT9A 5DNCA 3AQPA 3AHIA 3E9RA 5I9LA 4Y9UA 4LVOP 1ZRMA 1NT4A 4MVJI 4BIIA 4I55F 5TGTA 3JPWA 5MN5A 3AFOA 4DCJA 2P77A 2C5AA 5B64A 4D5GA 4TSFA 3SR3A 4R68A 2OB1A 2HMWA 4KTVE 3R8FA 1RCUA 4POAA 1MG5A 1ZJ4A 4MK9A 4P4GA 5EN1A 2OAUA 4WVFA 2UVPB 3LP2A 3NATA 2Y1JA 3TBKA 5DT2A 1HE2A 4RW4A 1WC3A 1G19A 1T3TA 3F9IA 3VR5H 1P4JA 2QVGA 4AUKA 2CWXA 2R6ZA 3L8MA 1G5PA 1GZVA 5BYJA 1LW0A 2G82A 4ER8A 1FDSA 4IFYB 3HACA 1QTIA 2DYAA 1S1UB 3QT8A 1SXJB 3R7BB 1EEHA 1XR3A 2W8KA 3KJQA 5DOVA 1K75A 5BWMA 4HFRA 3SSNA 4HGPA 1SKRA 4CCYB 3G8DA 4O3FA 1JSRA 2W37A 1Z7GA 2RIRA 1PNOA 3O1JC 1XR6A 5EXTA 1DVRA 3SP1A 3I0SA 1IAVA 1F12A 5I01A 4IOMA 4JI6B 2ACMA 2NO4A 2OPQB 2WFAA 4NE7A 1VLZA 2PO4A 1B99A 3AJ9A 1V1MB 4U1RA 4OXIA 4YGYA 3QFSA 1JK9B 1E64A 4PSVA 5ICMA 4J37A 1ADFA 4C7KA 2GS9A 3L6EA 3QI2A 4I5DA 2BGLA 3EVZA 5C37A 1RCOB 5DDQC 1VS3A 3CIOA 2HU7A 3BWYA 2IBKA 1OI2A 3V42A 4DR2F 5ILGA 4YP3A 1GG2A 3NZEA 4LMBA 1HE5A 1CCWA 3V7WA 1XTZA 2QT9A 4PBSA 1W4AA 1CJKB 4M9RA 3TCXB 4LOKA 2CPIA 3PHGA 4Y7CA 5GVRA 4DBQA 2VHCA 4UZFA 4XCQA 2V1UA 1KEEA 4JU9A 3EFEA 4H4OB 5GZ3A 1R15A 2KO1A 4A0SA 4BFLA 7YASA 3W8NA 1RKXA 2ZI4A 2UZAA 4KWCA 2R48A 4TWBA 4EKGA 4DMCA 1PLJA 1MDBA 2ODBA 3DDNA 1IB0A 2YQ4A 3RO7A 4DM4A 3HSJA 3OM8A 2CJWA 3UKOA 1IKWB 3FAZA 2XO6A 3Q7SA 4AIRA 3S2GA 1TYCA 2JHFA 3H9CA 1EK0A 4D57A 4MV8A 1KP2A 1IBCA 4RLQA 4LY9A 3LV8A 2QRPA 1N1DA 5JO0A 5AE1A 4XLZA 1TUEA 4BV9A 4KQIA 4BS2A 4B80A 2EW9A 3JWHA 4X71A 3TW0A 2FRVA 3O8OA 4R2JA 1HYBA 3PT5A 4JOSA 2SKDA 1WV0A 5JD5A 2G0TA 4EPWA 3FVTA 4BV8A 3OV7A 2OI2A 1YZGA 4I3GA 5JQGF 1Z2CA 3EARA 1E99A 1YVPA 1B8NA 3QV2A 4ACAA 3NXZA 2B5OA 1OUMA 1XEWX 5FPSA 1U02A 5CPBA 3SYNA 1KORA 1EUDA 2HZBA 1ODLA 2GN8A 4CO2A 2F67A 3ISNC 4IZHA 3HCFA 1FDTA 1YQQA 1YJRA 2WCXA 3P4XA 5F1YA 1FF2A 4KQ6A 3LWLA 4PFJA 1QO7A 2HKIA 2XKKA 1TL5A 1JIUA 5D0HA 1RU3A 4I6EA 4QUKA 2I7DA 4DJEC 2JC1A 5TNXA 1GG8A 4UAJA 3EXG2 3GL9A 1EKXA 1I94F 3GIMA 3FWHA 1MXFA 2ECPA 3E7WA 3RYIA 4OEHA 3OM0A 5FIIA 3G2JA 2PXXA 3KSAC 1BFUA 1Y5NB 3GCXP 3N2ZB 3EVAA 4Z7OB 1WB4A 3UJ7A 2P0YA 5BSMA 5E6RA 3DFMA 3B53X 3W0LB 3H9BA 3WYNA 4QWEA 3BDPA 4CQMB 3LTOA 3WC2A 1FXWA 5H16A 2ADMA 2ZI3A 3QAUA 3UQSA 2PBZA 1D1PA 4KPFC 1X31C 2DY0A 2OPPA 4ICIA 1AQJA 4S1NA 3RRMA 1UW4A 2WMYA 4X64B 2QZ4A 1ZWLA 3DNFA 2EX1A 5CQGA 4DZDA 3AM1A 1Z18A 1RLMA 3M33A 1F0YA 3DHVA 5DYYA 3TNJA 1GNTA 1HKHA 2R6AA 1VPWA 4C2MA 4XGKA 3RS9A 4J07A 2Z83A 1WPGA 1G38A 5DP1A 1R0RE 4FVTA 2YHUA 4ZT2A 1SAYA 1KYXA 5ALIA 3IUMA 2BMEA 4LV6A 2JX2A 1JIQA 5F3ZA 3B5IA 3L06A 1J8FA 5K6RA 4PXAA 1RWKB 1C1XB 3UN3A 3SF8A 3IS9A 4QGGA 5CA0F 1B15A 3X1DA 2P4UA 4P93A 4UW2A 1D0IA 1G59A 1EAMA 4PS1A 4FM9A 2YWXA 1KVKA 3TRIA 4IF4A 2QW1A 4XGNA 2BFMA 5JRZA 2PX5A 4A0QA 3S1AA 5IK2A 3BGRB 2ON6A 3KE8A 2RB7A 2FJVA 4B0OA 2WU1A 3BAZA 4YMGA 3CVJA 3D8RA 5IT0A 4AKSA 5EUMA 4MJXA 5AVRA 3UV7A 2XBMA 4BKMA 2IM1A 3OPYI 1RQLA 3NGLA 2RGBA 2ZULA 3KYLA 4ENTA 4GLFA 4KH0B 2BFFA 5AM3A 3Q8LA 3DRYA 5A2GA 2ZJ5A 2WJ3A 2Q6TA 3L8HA 2KLHA 4RXUA 1JIJA 3CNQP 1C3LA 2MINB 5GVSA 1GT8A 1RKBA 4UJ5A 2CNNA 3EVCA 4BRSA 3K4HA 3P71T 1L5ZA 2B8QA 3UYLA 1O6XA 3LZCA 3CVXA 4AM8A 1VC2A 1FX0A 4R41A 3JVVA 1E4EA 3FGZA 3L2OB 1HT0A 4L1KA 5AM1A 1FSGA 1PS0A 1JVSA 3FI0A 5DNAA 3JATA 3K2IA 3WDOA 1K7CA 5LQKA 1G5IA 4L3WA 4FPIA 4PSAA 1SJRA 3A3NB 2QN6A 2YBDA 1WPRA 5FPQA 3OZUA 1X94A 1OTYA 3PPWA 3LGXA 1PGZA 4HO1X 1S4MA 2JIQA 3MIZA 1E60A 1TVEA 1FMCA 1JKHA 4GKAA 3KX2A 4IJ6A 5EZQA 3DVAB 5ALDA 5AW3A 4TWJA 3N7UA 1ATZA 3BE5A 3TX6A 1U8XX 3PC8C 2I6XA 2MZTA 2GA7A 1KONA 2DH9A 4J9SA 2B8NA 3ELUA 4D3SA 4YMSA 3G5UA 1K6MA 4DUGA 1IWOA 1PS8A 4X93A 1YRYE 2B3DA 1QH1B 3Q12A 5L3RA 1UXIA 1FDVA 1QIKA 3EQ2A 1TOAA 4LS3A 2MSWA 5FKJA 2SHKA 3L1KA 3VAHA 4JEHA 4DB2A 3OQHA 4YRCA 3KZKA 2EYUA 2Z57A 4MCAA 2MKHA 3SSSA 1D1UA 2CQ2A 2I38A 1G21B 3HSSA 3S55A 1KDOA 3OHMA 1EX1A 1BD6A 4E2XA 5EQDA 3L7NA 1O87A 3EZ6A 4X54A 4LXQA 1U9CA 1JI0A 1W8DA 1VI5A 1NFFA 5P21A 4LHVA 4UDYX 1JA0A 4WNYA 4O2LA 1WDDA 4Y6PA 3DBVO 4C06A 1PV2A 1EZZA 2PYIA 4IH6A 1X7GA 2QQ5A 3ITEA 2UUCJ 3K5HA 3MBKA 1W88B 1N8TA 3EODA 2JHAA 3PGMA 2CPXA 1S2NA 2WIJA 4RNMA 3P2YA 4XWYA 4BGUA 2R3VA 4ABTA 2NSLA 3K57A 2PA3A 3QJ5A 2JGJA 2BC9A 1E4VA 2XT6A 2Z4RA 5ICGA 4LF4B 3L7JA 4OJKA 2QQFA 3SSQA 3PYGA 3W2VA 5CK4A 1V95A 4E0BA 4LJRA 1E32A 1KBOA 3BYRA 1E7QA 4JMPA 2G6TA 4PICA 2F4FA 1L3UA 4RKRA 1ZUIA 4OLHA 1Z6PA 3WLQA 2WNIA 3SEFA 4NI5A 3C41J 2VP0A 4ETIA 1OGJA 1B4DA 3BMCA 4EARA 1IIRA 5HP1A 4RY8A 3MR6A 5IQ6A 2EC5A 3HA3A 3Q24A 2ZUDA 3CG0A 1ZNQO 4IGIA 1H2EA 1KK3A 2HNDB 3E0QA 4MWDA 2RHCA 2R6CA 3BDIA 3D1JA 1AKRA 3EGDB 2Q1XA 1ODKA 4ZI2A 5BV0A 1EWQA 4RABA 3A37A 1WKVA 4EI7A 1SQGA 1N5LA 3SS9X 4YP1A 3MJVA 3SMVA 3QU7A 3HG7A 3ETJA 1R7RA 3H16A 2DNHA 1J8QA 4DREA 3BBCA 1M6YA 1U1FA 3LGAA 1OB2A 1E8MA 3HO1A 3A6EA 4F3KA 3A1NA 2VYCA 4NG5A 4ZHQF 1B2LA 1ZTWA 3NGTA 3JQAD 2XYHB 4NBSA 1HL6A 1XXHB 1E4YA 2WSSA 3SQLA 1WMSA 5CTJA 4IIDA 2CFIA 4YFYA 3TAMB 4DMFA 3EXIA 4DKXA 1M1NA 1ZISA 2OHXA 1Q12A 4PYOA 3ETLA 1Y3CE 3UK6A 4WLUA 2DHDA 1ZI9A 3ICQB 1ETHA 3ROMA 3NG1A 2YY3A 1T2DA 3U48A 3OPKA 1I6KA 1GTZA 1Q44A 1VBZA 4C4WA 3A7EA 4HDMB 3NKVA 4EYEA 2Q2WA 1LJUA 2OZLB 4EM6A 2IRUA 3WL3A 1SD5A 2MU1A 4DR4B 5FI1B 4ID3A 1UP4A 1CTQA 3RAQA 4MB0A 4HN9A 3JQAA 2Z6AA 4I8IA 1I6LA 4PUOB 5K45A 2PEHA 1C1CB 3L6RA 2U2FA 5HM6A 2BW0A 1XNQF 1F60B 3DNCA 5BN3B 1NI4A 2Q5CA 2DKNA 4I2QA 3UOWA 2VYQA 3Q4GA 3OP1A 3LI2A 4YBZA 3Q8RB 3VKHA 1VKRA 1PDOA 2V5VA 1TVMA 1UH5A 2C83A 3I6BA 5BYQA 2ZH7A 1FNOA 4F6CA 4M4SA 2Z56A 1G60A 4EPVA 3RS2A 2QLJA 3IP7A 4M1YA 3RWBA 1U2QA 4K3VA 4XIGS 3VTIA 3HYCA 5C1IA 4R25A 4ARVA 1PL8A 4KQMA 2R87A 5FWAA 2QIPA 2IM2A 4UDNA 2NZXA 3E8MA 4DIEA 2IW3A 3RTCA 3PNBA 4QWBA 5CUQA 3SFVA 2ZKLA 4IMRA 2ZTSA 4RV5A 2WDZA 5A5GA 1OXTA 4REQB 2VNIA 4WXPA 3VFDA 3IP0A 2GFIA 5BV1A 3BRQA 4HWGA 4Y65A 3GWGA 3OT4A 4IBOA 1XERA 3U7IA 1RYEA 2DT9A 5CU7A 2XYPA 3KUHA 1AT1A 1Z4PX 3HXOA 1WXQA 4EHDA 2HEGA 1T8UA 1HOXA 2Q66A 4B87A 3JYTA 1AVTA 2O8VA 1B3BA 4HN2A 2IS1A 2FW0A 1S1XB 1XNRF 4ELTA 4B7ZA 1WMDA 4ZA2A 2E4XA 1U49A 4RSRA 1MJNA 4P32A 3PW2A 4HMQA 1ESMA 2HPZA 3QTBA 1BW9A 3KOYA 3ILLA 3VNSA 3WLRA 2VG6A 1YT5A 1UKZA 3NHUA 4B7UA 4M0EA 4RL4A 1XR7A 4GBED 4C2AA 1KSJA 4BNVA 5BOVA 2HNAA 2EP5A 2YJGA 3B2EA 5EUQB 2AOVA 4TWZA 3DRPA 4OI0A 3KK1A 3EZUA 4HDNB 3PEEA 4Y2RA 4IRUB 2LZ0A 2PTGA 3FGNA 2BOVA 1W2HA 2YFHA 2YXPX 3B85A 4WFQA 5DIZA 3ENQA 1GUBA 2BZ1A 3EWGA 2GNOA 3H59A 1EE9A 4B9VA 4GMDA 3TLEA 5EZYF 3RYFA 4QPJC 4QXQA 4O8CA 2P9GA 4C8YA 1STOA 1PV1A 4E21A 1H4SA 2C4VA 3PQ4A 4UMEA 4KIFA 4JUAA 4G1PA 3UO0A 2MZSA 2XYGB 2FSGA 4S0XA 3ZGVA 5C1PA 3EGEA 5J58A 4RZ3A 1KH1A 2H65B 1MB2A 1TADA 5TMEA 1MWQA 4B9TA 4BLWA 1PGPA 1U8AA 2H3EA 4K05A 5CYOA 3IR6A 3Q7RA 4JBXA 2P7IA 4FMDF 4JDPA 3W2GA 1V6HA 1OGIA 2EK6A 5MGBA 3H2ZA 4RE5A 4B1FA 1OXSC 1XWIA 2RB5A 3GMSA 1PF7E 3BGVA 2VT3A 1T5TA 3TX0A 3WXBA 1T4MA 4UUQA 2XNJA 1KBZA 2C5HA 4CT5A 3D6MB 4EFLA 2C29D 4KNYA 4P38A 1E18A 1NVBA 4FDVA 4ND3A 3OL7A 3AERB 2HHTA 1XK7A 1MIHA 3PSHA 3FGOA 1S0UA 3N6NA 4KH1B 3NKLA 3NQ41 4ZYUA 4NE9A 5K4AA 1HDOA 1FT8A 1B1AA 4B7CA 4OXRA 1B0UA 3MWBA 5F73A 1Q6ZA 2R97A 5DGXA 3PLRA 1TNDA 3HS3A 3F41A 1N5YA 5JZSA 2KXHA 4D4MA 2AGPA 4H1TA 1F5SA 4JC4A 4AJEA 3QPBA 4I2NA 2A7QA 4LOAA 2D5BA 1NPKA 5F3RA 4M1WA 2C1EA 1NC3A 3RNOA 4TLBA 2UZ1B 3KLOA 4EFDA 3WKDA 1XMSA 3OFSA 2QZ8A 2G4BA 1K4YA 2ZDHA 3WWZA 2JW5A 3D5QA 4PTLA 4NXMB 5AM0A 2HO5A 4B6SA 1R37A 3C8HA 3DEZA 1UINA 3RVRA 3CMCO 1XF1A 1GPH1 3CT6A 1RWXB 3P2OA 3OOJA 4KHRA 4JLJA 1QXSA 3E2PA 2XUDA 4G1VA 4DQPA 3GJ7A 3WC4A 2WBRA 1PCXA 1KJ9A 3U0VA 3WLHA 3TFOA 5GAHI 3IQZA 3QTLA 1BQNA 2HZCA 4H3HB 4CG2A 3CZMA 1UPFA 4CKYA 2NTEA 5HW0A 1DWOA 3UHJA 1Q91A 4AI6A 2DNOA 4DR1B 4BFYA 4N41A 3UT5A 5I45A 3SNKA 3EPIA 3CX8A 4F9GA 4GL4A 3K5OA 4M21A 3SQXA 4YHHF 1F0KA 3OLWA 2GR9A 1OBOA 3H9UA 1AYEA 4E09A 1DWPA 2HHVA 2RCNA 1FWLA 3AB4B 1PNQA 2W7OA 3E8SA 2RBEA 4I5GA 3TSZA 5K8UA 4DV3F 5AQ1A 1HYSA 5DTMA 3VO2A 3N8KA 5ETPA 4YPOA 5K6AC 5G3ZA 4ED0A 4IRMA 4NMXB 2Q6LA 4BP9A 4I6AA 4XDHA 2HHHB 2HF9A 2PZBA 3O8NA 3CZQA 2IU0A 2C59A 2RHDA 2AN3A 5FX2A 1ZJ5A 1KI6B 2FEMA 1SUPA 4J3FA 3ZU2A 1SG0A 4L78A 4KQKA 1SCNE 4HNQA 3EF0A 1GA4A 4NCNA 3H5WA 3L9XA 2WONA 2VBGA 2IHVA 4Y0FA 3BRSA 1Q82T 2IHKA 4LFCB 4COKA 4DNFA 3MFHA 3WR5A 3OPMA 5LLTA 3NBPB 5JI2E 3HKWA 5JJBA 5B4TA 3VDRA 1ZRSA 3TIFA 1ABEA 2VTBB 4BCAA 2GOYA 1D7AA 1FX1A 1GFSA 4RW0A 1FS6A 1USIA 3LW7A 1X7ZB 2KFNA 1XPRA 2NP6A 3S0JA 2HK2A 1PFVA 2ZQYA 4DTIA 1PQPA 1U48A 2ZYUX 1T8WA 1VKNA 1SD2A 3E7FA 1TRKA 3R9XA 2JAUA 3GB9A 4BVHA 3IAAA 7GPBA 1DAOA 3D4NA 5AJZA 2YNHA 5LIRA 1JR4A 2KTQA 1DAHA 1N3BA 3DDSA 1HR0B 3HWRA 4OATA 5EHIA 3AOEC 1KAMA 4G1CA 4MP8A 2JRLA 5LU9A 2WZBA 3KLHB 4LYFA 3EJWA 4YCSA 1KNXA 1FFHA 1KY5A 3KHSA 2PJDA 2MYPA 3MWEA 5L3SA 1JNXX 4NRTA 2EGHA 3PGXA 4S1OA 5JADA 2J5KA 4Q05A 1HOTA 3M1IA 4C0OC 2GD6A 4C5CA 3A05A 3SEZA 1ZAXA 1DTWB 4FF4A 1SK8A 4E5UA 1JH8A 2IU6A 3IAFA 4JR0A 5A5FA 3QZ7A 5ILOA 1YITS 1V6SA 5G0RA 2DT8A 4YLGA 1QYCA 4DKJA 4DY4A 2R11A 4LZZA 2RRNA 5EL0A 1IVZA 4D3GA 2VWQA 3RYLA 1U1IA 1H2HA 3W9BA 1OFVA 2AN5A 4G0OA 4DU8A 3I2FA 5K8PA 1TZBA 4M3NA 1UVKA 4YGXB 2F8EX 3PXGa 4X91A 3HZEA 4F3TA 3KR1A 4M37A 3MURP 3QA3E 2FZWA 1AFIA 2DFPA 2UUBJ 5HMYA 3SJZA 3HBAA 1OYDA 2CEAA 1IDOA 1DIGA 3O8DA 2B9VA 4E03A 2V5AA 5FTNA 3FJ2A 1VL2A 3D6HB 5DHPA 4NPHA 2P79A 2VQFJ 2IH5A 1C7QA 2OOKA 2V2ZA 5AXAA 3PV8A 3UFXA 3VKFA 3NRCA 5DGTA 6REQB 4ON9A 3D3WA 5CCDA 1XDDA 4I4TF 4MW1A 2PU5A 1UEIA 4A91A 2ZSIA 5K8VA 3VQSA 4F8JA 1A95A 3V8QA 1OAOA 3S2FA 1C4OA 4QATA 3R3VA 2H6EA 5HL7Q 4YCMA 1GLNA 3TCNA 1IFXA 2HB6A 3POTB 2ZJQQ 1Y7HA 3D1VA 1GADO 3CXUA 5EQJB 4Z0HO 4BY9E 4C2BA 4QO8A 3TXYA 4KNWA 1GEGA 2WIAA 1TYEB 1I6MA 1YD7A 2PZLA 2Q99A 1UF9A 2APOA 5CB4B 2P27A 4XE5A 4DIOA 1WNTA 1H72C 2H63A 1KEKA 5D6GA 1U6FA 2IC3B 3IDFA 2WWFA 1RQXA 4G0QA 4MLDA 1A9TA 5K6TA 3BWMA 2I99A 1RTZA 1FDDA 1EQAA 4B3JA 1RHUA 4MVJE 5BN4A 3Q88A 1RP5A 5KT7A 1OF1A 1QK4A 4MR9B 1YJAA 1TYZA 3MTGA 1SM4A 4JI2J 4XI9A 1JIVA 3TAHA 1GZUA 2VD3A 4EBBA 4YT2A 4E22A 2FEXA 1GPMA 2HTEA 1PLKA 1RAFB 4LBWA 3W04A 2HSJA 3ZDDA 4B46A 1LDEA 4JVSB 3AJAA 2IHBA 1RKUA 2HHUA 1QC5A 4QXRA 3CNOA 3ZGLA 4DR7F 1LLFA 5ETTA 1L8LA 2WU0A 4P82A 2VPXA 2B0GA 3QHPA 4Q00A 4IRCA 5TMPA 1US8B 3PK0A 2QRVA 3NWGA 2FPIA 3M8YA 4YP9A 2X15A 3PXEA 5AUPB 3V1KA 2HK9A 4AULA 3G6VA 3RB8A 3CCWA 3MRSA 1NU6A 2CC2A 4LYAA 2GXSA 4Q8FA 5KTOA 3DB2A 1JKJA 1OY1A 3S2YA 2O54A 1GSOA 3IKJA 1DT3A 3ETCA 1SG6A 4WV3A 3REFA 2FFHA 5HAOA 4A5SA 1IBKB 4Q9JA 2IYLD 1EHIA 2PZAA 2CXUA 4W9MC 2D0OB 5BV2P 3RGWS 2RAPA 5IC6A 3I04A 1RWNA 2IEZA 4L6IA 1YASA 5HQMA 1WHTA 1E9CA 4HGRA 3QLHB 3UBTA 4AZ0A 5FWYB 5AW1A 3T3OA 3EYWA 1CR2A 3C66A 4J7CA 1O95D 1A98A 1ZZNA 3QPIA 1X92A 1RABB 1LI7A 5KOWA 2HNKA 1G7SA 1KI1A 1ONPA 4MVJF 4AD6A 4GQBA 1YBAA 4ZVEA 5C7OO 3TYXA 4PG4A 2V69A 3WMWA 3SF0A 1P6UA 2O1EA 4QU7A 3OIDA 2DR9A 2BE9B 3KT8A 1OXMA 5FLXU 1N5JA 4M1EA 4RMGA 4JLMA 3QFHA 2G25A 1Q2XA 5M2QA 4Y2SA 1IMJA 3MYRA 1JSCA 2H5IA 3I1JA 2P6RA 1HBUA 2WBMA 2XHCA 3JXOA 4X3CA 2GKGA 2XAAA 4GFDA 1NZDA 7MDHA 3RRZA 3FNRA 1FDRA 1GKIA 3K31A 4F2SA 3ZJVA 2XMPA 2OL4A 1LWFB 1O9GA 1EUYA 1O95A 4FIZA 3TOZA 1EQ2A 2P9JA 3SIPA 2DFVA 2GUWA 4TV8B 1HBNA 3E3OA 2ILVA 4FOSA 2F8SA 3UH1A 3GJ3A 3QP9A 1NYLA 1D9FA 3TDKA 4C88A 2LV8A 1WQ3A 4XGQA 4P4UA 3ZV6A 3T5GA 1OX5A 5I8ZA 5F12A 5BV7A 4G3IA 2Q41A 3PFGA 4B4DA 4ZGWA 1H8HD 4V0LA 3T1HF 2HA2A 5K0NA 3HVTB 5HIAA 2O8EA 4C0SA 4BRUA 2ZYHA 1BEZA 1NBME 4FW9A 4Z53A 3M30A 1TYBE 3WJ1A 3D54D 3ZXXA 5DMHA 1M9NA 4NE2A 4G36A 3UG6A 4OQPA 4NAUA 2VZ0A 2GK3A 2DQSA 5AMXA 2C42A 3CT4A 4CU2A 4LJ9A 3HJBA 1CEXA 3PQEA 3ZZRA 2GN4A 3EGOA 3IBFB 1XP5A 1HEIA 3S5UA 2NSYA 1H8ED 4AN1A 1ATIA 1SQSA 2V2KA 3PDIA 2JIPA 3FB1A 3UCUP 3RSQA 5CBPA 2JWNA 3M3HA 2MDTA 1A2KC 4G4SP 5HF6A 4QNMA 3GLGE 2CNLA 1LOUA 1H8HA 1I01A 1VJ0A 2QLBA 3OM9A 4MRVA 5CDFE 2C2BA 2OGSA 2NZCA 4OI1A 1ILWA 3BXOA 3WLEA 3ELDA 2CYYA 4LTMA 4C4AA 2GMHA 1BMFA 2I65A 2ONYA 4YYZA 1MU2B 2XS7A 3BQMB 5CH5A 2I5JA 3D54A 1Z5PA 5L40A 2UVUA 3DDUA 2LYVA 1GOTA 2FVCA 2ZJZA 2CUNA 1YZHA 4H4MB 1I2BA 4HNTA 5BSVA 3ASZA 3C8YA 3W5DA 1AS2A 1SKYE 4CYUB 4BMSA 1U3VA 3EIHA 5A4IS 2XKJE 1IKVA 1FNXH 2FD2A 5J40A 1JNYA 1H8EA 3M6MD 5FADA 1J4AA 2DKOA 1FCAA 2B9XA 1ISRA 3GLIE 3I58A 4L5AA 3P5SA 5HKBA 3M81A 2A35A 3NGRA 3BICA 4P0TA 3I9V9 3AFHA 2QV6A 4LC1A 2RC5A 3L4SO 1UBHS 3SICE 2ZC3A 2ZWIA 3FBBA 3MT8A 3UCGA 5I7OA 4EX6A 3VF0B 3T19A 2ZSHA 2D59A 1N9KA 3BWVA 4GUDA 3HBLA 4KVGA 3OOEA 1ZYQA 2YW2A 3T7CA 5HX7A 3RB0A 4R1PA 4YAFA 5J5CA 5LZ9A 2RIPA 3OLZA 8ATCA 3VPCA 2J0QD 3K3PA 5BPFA 1DKOA 1C3VA 1YE5A 1HO3A 1RM5A 3FNHA 3TZQA 2XCAA 3B1VA 3U17A 2H52A 2DULA 1BX0A 3PEHA 3LUAA 2OELA 2UXBB 5JVHQ 2YFQA 4KWTA 3SXPA 1YRHA 2XQJA 3I9V1 1UP6A 2J9YB 1NLZA 1TM3E 2WKWA 1NKTA 5CK5A 5F3TA 2P6NA 2C2RA 2Y3IA 1JG7A 4MVJP 1BQXA 2A7XA 2XS2A 1VL6A 4H6VA 1GPUA 1FKOB 4K0KJ 1DXYA 2EZ8A 1GZ5A 4D4HA 3WJ2A 2J0QA 4ES2A 1BE4A 1J8DA 3Q40A 1RTIB 4TWRA 2C22A 4B3SF 5B58C 3TXXA 4BQSA 4LF8F 5KQGA 1JLEB 4ER6A 4U7GA 1JR6A 1E2KA 3FMIA 3MSCA 2EEPA 2I3DA 5D8HB 4USIA 1DBPA 4WBNA 2IUFA 1X6VA 4JBCA 1N77A 1U1GA 4L0QA 4I9NA 2BSAA 2QFIA 1G6HA 2PH7A 5IW8A 5JE8A 3ZG6A 1Y5LB 3IGVA 1PWHA 3SAJA 1WZUA 2GM4A 2J8AA 2G77B 3P9XA 5K0FA 3LL4A 1L5RA 1Y3DE 5DJ5A 3CD7A 2F3UA 4JBGA 2BSQA 4G4JA 4K28A 3VGVA 4KAIA 5BYAA 3AJ2A 2P9TA 2Y6VA 1RHQB 2GAAA 3VBCA 2O5RA 3F1KA 4BVGA 4IDEA 2GEJA 2HHPA 4O5OA 3O4IA 3FZGA 3LCCA 3BZWA 4CMIB 2OFWA 2FJXA 5KYWB 1RE1B 4IZIA 2YHAA 3D7LA 4DR5B 3PYMA 5KKCA 1ZSYA 2VUHB 4MI1A 1CUSA 1TIKA 3HHLD 1GAWA 5LNK1 3MUFA 2IUEA 5AUQA 3ZZZA 3A2KA 2GXAA 5DX1A 2QG6A 3RVPA 1B73A 4Y2TA 4YMUA 2QUKA 4DLKA 3CH4B 3HVAA 1JHMA 1RYBA 2ID8A 2W4IA 4N8NA 5F5NA 4JLBA 4QC2A 1TEHA 1QGYA 1S96A 2B4YA 2I4IA 3KDPA 2J9EA 2FWRA 2CLSA 3KTFA 3LPLA 3AD9C 2GRJA 1GQRA 1W1WA 3BWXA 5EWEA 3TSAA 3OZXA 5B0GA 3BM5A 1VHWA 3A8IA 1IZ9A 1T5HX 4QG3A 4Q82A 3HHLA 1DRJA 4MR8B 4ZPTR 2YJ4A 1H73A 3QELA 1D0VA 3WFZA 1U8EA 2BX6A 2W2XA 4D9GA 5H59A 3AR2A 3FPBA 4OLOA 3DWIA 4EO9A 5B2EA 3WK8A 2LCWA 2FB9A 4UOZA 4ZRDA 3BKXA 3MUNA 2AHOB 4G5HA 3GK3A 4JL8A 3AEQA 1TL3A 4ID5A 2F4VJ 3GP5A 1A7AA 1NYQA 1FYFA 4V0RA 3TW4A 1HHSA 2QMHA 1J5XA 3LWBA 3RJ5A 3H1AA 1PGOA 1DJ0A 2V7TA 4CLLA 2CG8A 2WUGA 2XM3A 1VHLA 5KSPA 1O5JA 3CJ4A 2Q6IA 1U0SY 3PWZA 4B9NA 3RM3A 4L3VA 3DEHA 2G76A 3OTHA 3D5EA 1QG4A 3FX2A 1GPDG 1J8VA 5DI3A 1OWXA 3ZCXA 1WG8A 3DBRB 3PKMA 3DMHA 4D26A 1HXHA 4CLEA 1OO0B 4KRFA 1M1KT 2ZUSA 1MRSA 1A97A 4OK6A 4RELA 2ONZA 1CWUA 2ZXFA 3WYGA 3AZQA 4EG4A 4WKYA 1S2OA 4JL6A 1ZBTA 2LCFA 4G1EB 2HG4A 1G41A 1F6WA 3I2IA 3OETA 4JYMA 1DBQA 3F7NA 2TMKA 4E0DA 4YROA 4CLPA 1NRXA 4RD0A 4EQ6B 2JGIA 4FMCB 1PEAA 4JI3F 2NVUA 4LBVA 2ONCA 2HW8A 5EIHA 5DRYA 1MC1A 4H17A 1T0IA 3TZCA 3UN2A 3NOQA 1CS4A 2I3ZA 4N5SA 3FMBA 1CZNA 3ZOZA 1UC9A 1Z5ZA 2E4WA 4FCWA 1DIBA 2QRZA 1YRLA 4C2TA 2IHUA 1XK6A 4P4SA 3RT7A 2MZRA 2IGTA 2GHPA 4ZVNA 6YASA 1M5VC 4UATA 5K51A 2CQGA 1NZ8A 1EBUA 3VMMA 1HMYA 1G20E 1OHHD 1KR5A 3PDHA 3I9V6 1VM6A 2P65A 2PZMA 4GE3A 1W7WA 1U3FA 4XDDA 1O4VA 4YB6A 2VN8A 2FZGB 4W92B 2GPBA 3N9IA 1GT91 3S2ZA 3IESA 4K81B 2DGQA 4X1OA 5LSOA 1LFDB 1D6JA 2VJMB 2G04A 4YRFA 1XFAA 5D78A 2FVRA 5COQA 1LW7A 3NVKI 2IFXA 3SQNA 4PO3X 1YRAA 2VA9A 4FCVA 4RW9B 1TJ4A 1W0CA 1A69A 1OHHA 4V38A 4I08A 3MHTA 1QKIA 3F8SA 3PCRB 1RM4A 3MM8A 1I36A 5D2CA 5GQSA 5EIFA 4R5PB 4HD8A 1X2BA 4ZTZB 4LZJA 1WKCA 4EI2A 3TQCA 1VG8A 2VDPB 3R2DJ 1D2NA 2BKUA 2P30A 1QHYA 1JUDA 5BR8B 5HZMA 5HE9A 2WTUA 5KINB 1XXLA 4LRFA 4LOIA 1BC6A 4B3MF 2G9UA 4PNPA 2HHXA 1TL7C 4QVIA 3NALA 5ES4B 4DIMA 4MYSA 3KWLA 3CDWA 1SBCA 2JCBA 4KWHA 4XXHA 3VM6A 3MJHA 3C6UA 3S3TA 4CTMA 1X80B 1E6LA 3D8NA 3IM8A 2IRYA 4KXNA 2GASA 2I2YA 1T9VA 1Q0SA 4LF5J 2C03A 2ZH4A 3I8SA 5EE3A 1R8SA 1WCXA 2HKEA 4TY8B 5LNK6 3F7OA 2BEJA 5L1JA 3NDRA 4RDCA 4IDNA 4EKEA 4ZCSA 5IZCA 3X1MA 4QIWD 3OFGA 8RUCA 2B8JA 1DEXA 3VPXA 2W4QA 1F9EA 3C6QA 3CUNA 1IXYA 1Y1TA 2BYCA 4PYRA 3FOAA 4E5KA 1RXOB 3DJFA 3SKVA 1F9AA 1TL1A 2KXNB 2BANB 4CNYA 3D9BA 1XMQF 4RSHA 4HI0E 3FD8A 4EW2A 4QYRA 1QZUA 1XZQA 3KPWA 2Y1LA 3RYHA 2XTJP 5D01A 4RNFA 2PL3A 2XE6A 4PLWA 4GI2A 2C3YA 2PH3A 1CS0A 4M5MA 4GMHA 1FERA 3AEUB 4KDFA 4RKUC 4YB5A 4YRPA 3UHAA 2ILZA 1QFJA 3I2YX 4Z49A 3JAMY 1AQYA 1WDKA 1WG4A 3WJAA 3NNNA 3TSYA 1X9GA 2CJKA 1LBHA 3A6JA 3CFYA 1EFRA 3GR6A 3A6GA 2DHEA 3TR0A 4TTPA 1ORHA 1I1GA 4M1MA 3VYTB 3FFWA 3QK7A 4CWBA 3W8RA 2H00A 4GVXA 4U96A 1DZIA 1M5OC 4EVRA 2HWHA 6PFKA 5LQJA 3EFBA 4CM2A 1BS9A 1KZGB 2AJTA 2TMGA 1B0AA 5DI9A 4DV0F 2JIZD 1LDGA 1ZNZA 1PKUA 1WJ9A 1JZQA 2BDEA 3ZHCA 3WNVA 4MWCA 3PHTA 2GJFA 3VGTA 5JD6A 4FOOA 2QSZA 1ZUWA 2W43A 1MW9X 4P84A 1Y8CA 3RC3A 1TEXA 4B2PA 4Y2AA 1YULA 1FYVA 1P5FA 2FEOA 3ZKWA 1YBTA 3BBFA 3VYWA 2EWWA 4I56A 3IHTA 3BXHA 1OROA 1P1HA 5B57C 3O1HB 1NP6A 2O3DA 4BNZA 3JQ7B 1KPHA 4BDSA 3PF9A 3BERA 4DCMA 1N32F 4F38A 2OGWA 5KFRA 1UUFA 2JIZA 4PAAA 4MWSA 1IUPA 1YI1A 3EDCA 1A9XB 1F2TA 3ZFVA 4GO7X 3IEXA 2IIVA 4RC9A 2L9DA 4DXLA 2RT3A 2HL6A 5AVQA 1P18A 3I5UA 4NYOA 2VLIA 2YXEA 5KG7A 4HZGA 4BZQA 3FKSD 1K8AT 1ULTA 1V43A 1PK8A 5J59A 4C4RA 3HXPA 3VKUA 5B12A 2FHMA 3TF5A 2VJNA 2IPLA 3WBKA 3IT3A 2CPDA 2ACWA 4X66F 1FYXA 5I4CA 3QKWA 1TXGA 5FOVA 5FF9A 2NP7A 2HH9A 4BL5A 4NJOA 3A9TA 2Y67A 1FSSA 3ADBA 5JD3A 4HDCA 4GI5A 1VSVA 4FBMA 4KAAA 4QPTA 4GYYA 5MLCV 2H18A 4TKVB 3PACA 4DYDA 3FKSA 4G5YA 2R7QA 1OU0A 2IYWA 2X76A 2JA1A 2A92A 5LOQA 3NRBA 2BY4A 3UKJA 4IHAA 4KVAA 4RGVA 4B31A 3LQ1A 3VTFA 3WB2A 4JJKA 1WC6A 1BRTA 4G0ZA 3GOHA 1RWPA 4EO4A 1NMXA 2O6HA 4OQXA 1Z28A 4F1JA 2FDXA 2YVLA 5CH3A 1X7WB 3M2UB 1NLKL 3HGMA 1W0KD 3HZGA 1W52X 1L5GB 2R8GA 2WBLC 1XHFA 5JCPA 3GBVA 3IX7A 2JPDA 4EZIA 3A9UA 1NXTA 1Q4RA 1QAIA 5CAEB 1LC3A 3HVKA 3SKYA 3E3XA 4JLNA 4JYAJ 3MD1A 2XLKA 1I4DD 2II6A 3NEKA 4PG8A 3BXEA 4RNNA 3TLAA 1MD9A 5ALMA 4ZYTA 2W7AA 7ADHA 1UEXC 2ZGVA 3FRYA 3ZBUA 1J90A 2HA4A 3EE3A 5IYZB 3M0EA 2KJVA 3FFAA 4QDJA 3PVSA 1W0KA 4IIGA 3IT0A 3JQ8A 5JW6A 1IMOA 1Q7RA 1VPLA 3QJYA 2YMPA 1V2HE 3DAFA 1T5OA 3GC6A 5HIMA 2RDIA 1WACA 1ENPA 3VDMA 3D3QA 3JR3A 3OHBA 2ALJA 5ILQA 4CR6A 1IM2A 1QLJA 4ZAXA 4WZZA 2OPRA 3QXSA 5IWAJ 1LPPA 1Q5PA 4UM7A 5M2PA 1OWMA 5IV3A 3H9JA 1FK8A 2EXXA 3A2NA 3B3AA 1XZBA 5FWXB 4BEWA 2O2HA 4IVQA 4ND8A 2VDWA 1F2UA 4LGVA 3U1BA 4IIEA 3E4CA 4YK7A 1RZMA 3M5CA 1X5PA 1FE4A 2PIAA 5SY6A 3FYUA 1N36B 4FB5A 1CJTA 1Z4JA 4NAHA 1BJTA 1DAKA 3L7PA 4NXNJ 1H9BA 1NK0A 4BMNA 1AU9A 1WHXA 4WJBA 2VWPA 4HGYA 4IS2A 2ZVQX 1M1HA 4IJUA 4UFPA 4XFKA 4TYNA 2WWXA 4CKXA 5D0GA 1YWGO 2W9XA 4I1YA 4UXJA 5JAUA 3OCJA 2KI5A 3PRDA 2BFDA 1Z17A 3ILVA 3JZIA 3LH2S 2FUG1 2Q0SA 2FHJD 4I1SA 4V2IA 4JI8J 2ZBFA 4DGQA 3SYMA 1MMFB 4TLQA 1K3TA 3WFJA 4BBPA 4I9FA 1REVA 1TKXB 2J0UB 1V8OA 3LW8A 1RYMA 2HFJA 3TW8A 3SEAA 1HNWF 3KZMA 1V8ZA 1NBIA 3ONFA 4FWBA 3P0FA 3DOKA 2UVQA 5G0VA 2FHSA 4PWZA 3BIJA 1U0LA 5L38A 4BKOA 2Y0SD 2H0QA 4K87A 1J1IA 1GGHA 2OV1A 4MP6A 1PFWA 3G82A 2V97A 5D1NA 2M7SA 3P32A 5A8KA 1RWUA 1Z5VA 1P4RA 2BFOA 5AO9A 4HC4A 1RC8A 1HQKA 3RVDA 5DDOC 1JJHA 1RQ2A 4TYMA 2E5GA 4X8MA 2DY9A 1U8CB 1YZKA 2HZ7A 3T5PA 1R0CB 3KUEA 5I5GA 5DEIA 1YS6A 2XKAA 4FPXA 4Y18A 2HCRA 4DA9A 1ZITA 3DGPA 2BFPA 3QFTA 5KFAA 3ENVA 1KKHA 4LCJA 2R8PA 4ZK2A 1QVWA 4R2IA 1VL5A 2Z2LA 1DC7A 4X4NA 4ZJYA 2VBIA 3H90A 2XWBF 4NOKA 3BDVA 4J0GA 1LBTA 3QKRA 3KNAA 4DJFC 4TROA 4NL4H 2HUNA 1R3NA 2ZM6F 3D7KA 2H8GA 3C4VA 5EMJA 1SEVA 4M7WA 4K6CA 2AFIE 3VR3D 4LFAB 2JAWA 2J6TA 3ZZ0A 1NAHA 1PZHA 3OQIA 1URNA 1JU9A 3PQ5A 4GSYA 3KQNA 4EI9A 3J81U 1RJ9B 2IK8A 5B7GA 1Y82A 3H98A 1HQDA 5THKA 3MJRA 3LNCA 2IPOB 1XL1A 3KYJB 4WXRA 3TOVA 3URMA 4MX8A 3M32B 4GP6A 1K2WA 3GUVA 4K7JA 5HMXA 1SCIA 3GEPA 1WI6A 4ZEOA 1JQDA 4DQIA 3N0XA 1UWBB 2VJOA 4ZCLA 1G8SA 2ZXEA 3KYBA 1X9SA 1BX1A 4WJLA 2NT3A 4J5OA 2OCAA 1TPYA 3VR3A 4L9SA 1ZN2A 2R8XA 4DVGA 4RLSA 4D46A 3CJKA 1SKWA 1RRGA 1HG1A 2AFHA 3CEMA 2OQIA 3NMUF 4G86A 4KOAA 3TIXB 1ODCA 4J43A 4Q7QA 2V4JB 4C3OB 4L85A 1PSDA 5FNZA 4K2HA 3B1KA 2YWCA 3H42B 2D7SA 5JSHA 1QYWA 4F3YA 5JZ9A 1TD1A 4B83A 1BC5A 1CV2A 3T1YJ 1W581 4KIAA 1RBMA 2J9GA 4H4EA 4HKTA 3HR7A 3QWAA 2FK7A 1ZP6A 1K8XB 421PA 4ZEWA 3LP8A 1SIOA 2VCEA 4KLZA 1TJNA 3AU8A 4NCIA 5E1BA 2O7SA 1C1BA 1EEXB 1BYIA 2YYZA 2DF8A 3FPKA 1KLMA 1A9PA 3KJIA 1XVVA 1LQTA 2C5EA 3EZFA 1RT3B 3ZGXA 3CC7S 3RW7A 3AKDA 3MM6A 2L42A 2OBYA 1HQEA 3O44A 1Q1NA 5C34B 3KUUA 4OLBA 4D9HA 1P1JA 2RDJA 3NYIA 4U7JA 2M2BA 3MMCB 3IMKA 1NKCA 4HOYA 4ES3A 3OLCX 1Q11A 3DHEA 3SYKA 2AYMA 4D98A 4I6WA 2N7CA 1LVGA 4EZ6A 3CDUA 1YJXA 4KYZA 1QUPA 5IHXA 3W9JA 2RF2B 3H5LA 3CVWA 3W5ZA 2ODTX 3PR4A 2RMLA 5FWNA 3UEOA 3OJEA 3SDEB 1VRCA 3PFKA 5F78A 1JSLA 3TIIA 3CCMS 3BN7A 4EMBA 4X95A 1PCAA 3NIFB 1M6VB 3JQEA 1IKYA 5A7HA 5H82A 4KYVA 1GKUB 6CHYA 3BZQA 3CCRS 1OSDA 2NTJA 4WD3A 4D41A 5A0YA 2DTXA 2AD9A 4OAPA 3B2NA 2CHVA 4WNAA 2E9RX 4ZVSB 2R8ZA 3D31A 1ZDMA 2CVIA 3H3JA 2ZYVX 1DDGA 3DLEB 2H8KA 4XLTA 3MTQA 1GQQA 4MSUA 1QH8A 2XDQA 1P7VA 1ZA2B 2PQ0A 2K3IA 3GHYA 3TL6A 4MHTA 4DFJA 5IP5A 2O2SA 1FDOA 4YLEA 3VR1A 3OBIA 2WQ7A 2V6AA 4RY0A 2CJXA 5K8TA 5DXJA 2XGJA 2PGOA 1UM9B 5C7LO 4NENB 4UUNA 4Q7MB 4E4TA 4BC0A 2BFWA 3IMCA 2IXTA 3GMTA 3RUPA 4AU1A 4LF6J 1XZLA 3E2MA 4W5HA 1X19A 2IX9A 4IEIA 4PIMA 3EW7A 1JR3E 2KG1A 3P7MA 3B5EA 4LSMA 2XUHA 3WG9A 1F48A 1VCIA 3J81A 2Z04A 1V0JA 3K0FA 4XRGA 5F8LA 3X1KA 5H9EK 3KOZA 4F2WA 4LF1A 2Q5FA 2P0EA 5F35A 1HD1A 2GD0A 3F6RA 3G1UA 3IPLA 5K7SA 3RVNA 3DZ8A 4P80A 4TMWA 3AB8A 2BQRA 4HAWA 4IHKA 4RU9A 4P2MA 2Q0QA 4YO8A 3PRHA 2C2OA 4D8XA 1P3DA 4FKYA 1Q16A 3KRTA 2WTEA 4OL9A 5ITZA 4MVJD 2C4UA 3FCXA 1PJ7A 5DLGA 2Q6VA 1T0BA 1LEHA 2IMOA 1FWKA 1Z25A 1NF3A 2CXXA 4AP5A 3DE4X 4L3OA 2HUPA 1G7CA 1PVVA 3BK1A 1E89A 3KBOA 4ILEA 5I7WA 4I9UA 1EG7A 5DH9A 5LC1A 1WQ1R 4OHXA 4FGSA 3SJCA 4RETA 1XMOJ 3FFIB 2P40A 3UWOA 3S01A 1W6UA 5JPDA 3WLAA 4BO9A 1YZUA 4I50F 1MFZA 3QEJA 4NCXA 1RJEA 2BT4A 4P3OA 5K4HA 4P74A 4GC6A 3QE9Y 1UMBB 2A1TS 1N9GB 4IDCA 3N87A 3N0VA 4ZLNA 4G0XA 3ESQA 1CE8A 1Z06A 4DSLA 5DZSA 1X39A 1IZ8A 4C11A 3M8RA 2PUCA 5LL6d 2FV8A 2ZWVA 3IEVA 4V1CA 3AWDA 5IEJA 2OZPA 4HL9A 4H6WA 4UFNA 4CCHA 5KNDH 1EKSA 3U9LA 1CQXA 4W1SA 3BRWD 3GTYX 1GYPA 3BPDA 2JKVA 2JGAA 1FVFA 1NNEA 3BKUA 4EWTA 3WOVA 4MS1A 2W6QA 4WU3A 2X2OA 1BD3A 1Q95G 1KARA 1JLBA 3TZWA 5GV8A 4HDKA 2KHZA 1QWSA 1YDLA 1HL3A 1QORA 4FZRA 3K20A 2R7UA 5JMTA 2MTBA 3I0NA 3MRTA 4B4VA 2KT3A 3TQFA 3GJSA 1XC9A 1TL7B 5IH3A 4TNOA 4K6GA 5DHUA 5JJIA 3V2UA 1NW4A 3CH5A 3IE2A 4X62J 3H17A 3V34A 3BRWA 5I4MA 5DDIP 3NS7A 1UBRS 4RCYA 2VKZG 4V03A 2OPSA 3B7WA 1NE7A 4M55A 2O2YA 1T25A 3K2QA 3TKAA 4OZ3A 2ILYA 1I3KA 2V7VA 1L7VC 4PIPA 4MK8A 3QMPA 1BQMB 4BMCA 1NOIA 4IDPA 2PT5A 4OYRA 3ISTA 3DFEA 1KHTA 4O2BF 4RW7A 2X4LA 5E7IA 3CGWA 3D68A 1VHIA 2BRLA 2UYGA 5KYGA 1UZUA 2WYHA 3GFYA 5BSUA 3P4YA 1PEDA 2FC8A 2WD7B 1LJLA 1CB0A 1JHDA 1PGNA 1FJGB 1E6EA 2X3DA 1ZPVA 2KT2A 1Q14A 1YBMA 2Q5OA 4AAYA 2G1DA 2OECA 2OY0A 2WMNB 2JD2A 4HFMA 4MVYA 1NNUA 5B6IA 4C3LA 3KZVA 1YS9A 2QRLA 3WLIA 5DM1A 1SBTA 3T5DA 7ABPA 2RHRA 5JIBA 4K9QA 2B36A 3WO1A 3COYA 5C2GA 3OIUA 2O2IA 2Z98A 4LGMA 1EDZA 5T4FA 1KDPA 1N7GA 1OPIA 3DE7X 3HJRA 3K70B 4TTIA 3T4XA 3QVWA 4MV5A 3QE4A 4WLNA 4HK4A 3LVBA 1VHTA 1GZ4A 2BJWA 1QR6A 3FNNA 4DX8H 1L4MA 3UVJB 4ZIRA 3CC2S 2EJWA 1L3IA 4KXVA 3KFVA 1CJVB 5I7AA 4NBVA 3AUFA 1YRTA 2QUBA 2J6UA 3MN1A 2XNKA 5BURA 4M9ZA 1G0OA 2W8LA 1JLGA 1CRWG 3WX8A 2NZVG 1LH0A 2J6CA 3MECA 1M2EA 1JLHA 3V1YA 4RK5A 1SIBE 3FCCA 1U7TA 3B1XA 4KR0A 1MEEA 5TGDA 2BGNA 2B7CB 3K89A 4J7AA 5FBHA 3NC4A 5C51B 4QW8A 2UYYA 1GXTA 2XE8A 1L3TA 4C87A 1DJQA 2WOOA 1FTQA 3JARB 2BBEA 1AUQA 3BMQB 2VAMA 4LIRA 1PQYA 1VKHA 2BKNA 3GQCA 4RFSA 1F9HA 3CH6A 3WX0A 5DHTA 3SXLA 4USVA 3ISZA 4UBNA 5AKYA 3G8BA 4ZQCB 4OK5A 4U2CA 4QOGA 3DBOB 4RWWA 2ET6A 5CYJA 1ZK3A 2IY8A 1N0WA 4YMTA 1DC4A 1G6OA 1ODFA 1C0EA 2R8JA 4QFCA 4DL7A 4B3TJ 2DPMA 3OLYA 3GPAA 2VPTA 3W3AD 3B1YA 4FINA 3TIGA 2QVBA 2CFSA 1TUGA 1N5DA 5A6VA 1KJWA 1C3OB 3RUBL 4TVAB 3DWFA 3MCOA 3GF4A 2XMRA 3ZS8A 5L1KA 1Y5IB 1LPOA 1O5IA 2PY6A 3M2VB 4KR7A 1T1JA 5FBWB 5FTMA 5HWSA 2IZ7A 1T8SA 2LVBA 1N3LA 5A7FA 2WI8A 5TQ0B 1V1RA 4WTOB 1UMDA 1K0FA 3I09A 1UK8A 1N2OA 3IBWA 2J7PD 2QG4A 4H60A 2Z30A 1G42A 2KW5A 5IXUA 1L5FA 2F1FA 4ZV7A 2VJUA 4K5RA 3HLUA 3HCDA 2Q8QA 4UF4A 1WZNA 4A8QA 1XKQA 5FTLA 2Z2YA 4WADA 4BS9A 4O1MA 5L6MB 2DE0X 1U2DA 4NNJA 1UIRA 5LXTA 4IEFB 4D8UA 4Q9KA 1MQAA 3U7QA 4RHEA 3EHDA 3Q15C 3FTFA 1YHNA 4HGZA 5A8WB 4NCJA 4DMZA 1KMNA 1UPUA 2BHNA 3ZNQA 2UKDA 4FOLA 1AHPA 2RONA 4KGZA 1U3DA 3CLRD 2BUAA 3INTA 2VIHA 2Z2ZA 2IYIA 3PCOB 3O6VA 3TOSA 3NNHA 2I6UA 3R2JA 4JNCA 3IJ5A 2RAUA 1NK5A 1RZRD 4TYQA 2DM6A 1X0PA 5KPJA 4OYYA 1HQUA 1MRZA 4DL5A 2DU8A 1QS0B 5G1NA 3QU4A 3SCZA 3RFFA 5ADHA 2R96A 1VC0A 1JQEA 1UFQA 1CQJB 2D13A 4CLRA 5HJYA 4G89A 5KFFA 4N5DA 1NNDA 1RWWA 1COWD 5EQFA 1W34A 1PNTA 2HSZA 4GVLA 2VJPA 3GVIA 4NK4A 2J0SD 3PR1A 1PT6A 5KX5F 3ZTYA 3IIEA 1EHWA 3U40A 3EZXA 3UPTA 4ZN1A 1E6YB 2O2JA 2CV0A 5EAIA 2HPHA 3DLBA 2DRIA 4P8RA 4N0EA 3HP6A 4MI3A 4YJKA 5F8NA 1YJQA 4BTEA 1RZRA 4ND1A 3EM1A 4G07A 4IDFA 4LRDA 5C5JA 1WW3A 4DLWA 2NUPB 2QA5A 5DBHX 2ZU0C 3ICWA 1HFKA 5LUAA 5C2CA 3ZX4A 1HK7A 2QMUA 5IBPA 1U2SA 3NC0C 1L5OA 1YNSA 2I29A 1EFVA 2ZIZA 4J2TA 1U98A 3GWCA 2J0VA 1NJZA 3NOOA 4ZO8A 4ZLPA 2J0SA 2Q3MA 2AEFA 2KM1A 3DLJA 1ZOSA 3UWSA 2JEZA 4S2UA 1XQYA 2KG0A 5KFXA 3QVKA 1IIBA 2V63A 4EHNA 1K92A 3KHLA 1S8FA 2OSRA 1CBKA 4HAZA 3DW1X 4GWLA 5KQSA 2D69A 2XIQA 1EJ2A 2HRZA 4WK3A 4OOEA 2C58A 1XE3A 4HLQB 4FVCA 2DMRA 3CEJA 1JQAA 4HLDA 2XTJA 221PA 1G7RA 2OFFA 3C45A 1FMFA 2O8DB 3NYQA 3G8TA 5REQB 1MX5A 1FMLA 2BQ3A 4XTTA 5BT8A 1I9CA 5ETVA 4QPDA 4OHRA 1S4QA 1AM4D 4LVOA 1R2QA 1WVGA 3CC8A 2ZOGA 3MUMP 2H1WA 4JXKA 4Y2UA 1S9EA 3P9YA 2EFHB 3PD1A 1XYYA 1GITA 2ERRA 3R9IA 1JLMA 4YV7A 1WI8A 3PI6A 1UBFA 2W42A 1U8YA 2BJ9A 5KG0A 1MV8A 2ZYIA 2WTFA 3C97A 3KQPA 1UMKA 4WZAB 3N8NA 3NKYA 1DXQA 1XMXA 1Y8RA 1XTPA 2BJDA 4QBTA 3JASA 2MQ8A 3NP7A 4BPBA 1WSDA 5K9FA 3OWOA 5D1HA 2W4DA 2B78A 1DFDA 5E5NA 2OHHA 5DHFA 1VFJA 3PC4A 4BQQA 2IEDA 1K6JA 3KJVA 3P9KA 3UUWA 5LPNA 1H9AA 4O23A 4DPTA 2XT0A 3A1EA 3OE5A 3DF7A