1LK5A

Structure of the d-ribose-5-phosphate isomerase from pyrococcus horikoshii
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
229
structure length
229
Chain Sequence
MNVEEMKKIAAKEALKFIEDDMVIGLGTGSTTAYFIKLLGEKLKRGEISDIVGVPTSYQAKLLAIEHDIPIASLDQVDAIDVAVDGADEVDPNLNLIKGRGAALTMEKIIEYRAGTFIVLVDERKLVDYLCQKMPVPIEVIPQAWKAIIEELSIFNAKAELRMGVNKDGPVITDNGNFIIDAKFPRIDDPLDMEIELNTIPGVIENGIFADIADIVIVGTREGVKKLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A hyperthermostable D-ribose-5-phosphate isomerase from Pyrococcus horikoshii characterization and three-dimensional structure.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Isomerase
molecule keywords D-Ribose-5-Phosphate Isomerase
total genus 76
structure length 229
sequence length 229
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2002-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lk5A02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lk5A01
3EB9A 2H9ZA 3AB4B 2RQKA 5FIIA 3LWDA 4R9NA 4GMKA 3OFGA 2QMWA 1Y89A 4R7TA 3K5PA 1M0SA 1LK7A 1JT9A 2RI0A 4GO7X 4L51A 5IT4A 3TUJC 3ENWA 1HORA 4L4YA 4TM8A 3N0VA 1HOTA 4L50A 1U8SA 1Y7PA 3L7OA 3CSSA 1FSFA 3ENQA 2ZHOA 3S1TA 3CH7A 1YGYA 3OFHA 2MDAA 4LUBA 2I9SA 1LKZA 2QMXA 3E7FA 3KV1A 2P9GA 3HHEA 3ENVA 1FRZA 4TM7A 3TUIC 2BKVA 3BXFA 3NWPA 4GO5X 2FGCA 2WU1A 1ZPVA 3CEDA 3IBWA 1FS5A 5IS2A 2R5FA 2JHEA 2J0EA 3OFFA 1SC6A 3OBIA 3TUZC 3TX2A 1PBTA 3LUYA 3NZEA 3P96A 2BKXA 3DHXA 1FS6A 5IT0A 1O8BA 1KS2A 4L4ZA 1UJ6A 3UW1A 2LQJA 1RWUA 4NMLA 2RI1A 3AAWB 1YBAA 4OQPA 3NRBA 3DDNA 1XTZA 2NYIA 4L5JA 2PA3A 4IO1A 2OKGA 2KO1A 2RE1A 2CDQA 3OFEA 2P9CA 3MTJA 3ICOA 3W7BA 2JOQA 2F8MA 3HN6A 3AB2B 3IXQA 2DT9A 2PC6A 2P9EA 2LVWA 1CD5A 3EFBA 2W48A 2O0MA 2J0WA 1LK5A 4X84A 4L5IA 3OC6A 3BXGA 3KWMA 1FQOA 2DTJA 2QRRA 1PSDA 4M8LA 2F1FA 3DC2A 3U7JA 2J0XA 1DEAA 3E15A 5JJBA 3LOUA 2QSWA 1VL1A 3LHIA 2GNPA 4OQQA 1UJ5A 5T41A 2RQMA 3MWBA 3O1LA 4PWUA 3BXEA 5HJ5A 4GO1A 3BXHA 1NE7A 3MAHA 1UJ4A 3DHWC
chains in the Genus database with same CATH superfamily
4BXOA 5JCOC 1S8NA 2CPXA 4RNHA 4N0PA 3ZIDA 2Y1CA 1X7ZB 4Q6WA 2CD7A 7REQA 3BE5A 1EVYA 4ZLPA 4CMGA 4A0RA 4DLEA 2R84A 1V39A 1ZBTA 3AXTA 4CH1A 3S2GA 4AS1A 3QWBA 4J4TA 4AG3A 1RI4A 5AI6A 2XDAA 1ZUNB 2CDRA 4IFVA 1SZPA 3OD2A 2JCXA 4N5IX 3PFEA 4YO7A 4Q9HA 1E1YA 1G8JA 3FFBA 1KVIA 2OEMA 3BSYA 5BSMA 2XWPA 4BVEA 2N9UA 4Z4EA 4QYXA 4UCFA 2QTFA 3I92A 4D98A 4IILA 5I3PA 1YV9A 3I5XA 5AHWA 1SIBE 5DNAA 2CW5A 4QATA 5HE9A 3A1NA 2Z83A 3VNAA 4A92A 1MVLA 2PH1A 3W1WA 2ASEA 3WAGA 2F8SA 3EPHA 3VGPA 5DK4A 1YRYE 5AJUA 5ERXA 3A4MA 1PIWA 2ZR0A 4JXZA 3M49A 2EVWX 2N3ZA 2F9LA 2EOAA 2BFWA 1NK5A 4N3AA 5FL3A 1TU3A 4B2YA 4AXBA 3NYIA 4IHAA 2HC9A 3UJHA 1H4VB 3EEBA 5IWAB 3WWOA 1N2OA 3J81j 4JSYA 2QL5A 2PT7A 3W8FA 2A9JA 2V8HA 2RH8A 4PLPA 1GHTA 3HCRA 4KDEA 1C3VA 2OXIA 1BMFD 4DLUA 4Z1OA 5ES4B 1ZAVA 1QHIA 5ELMA 2BFMA 3UAWA 1BS2A 2O8CB 2GBGA 2OO3A 1UEUA 3F73A 3H5NA 2C2OA 3I6BA 2CJQA 3WAKA 2FEAA 2HU2A 2XLCA 4OGWA 1PO7A 4DQQA 3WLKX 2QG6A 2PZKA 4PYLA 4IKEA 3AF3A 3ZY5A 1TU0B 1KJ8A 2G67A 3HA2A 1XRPA 1Y63A 1YDGA 3OZIA 1UPFA 2ZTMA 1EUDB 2CHGA 4LDJA 4NG4A 2I6QA 2JKZA 2LPMA 5I7AA 3QT5A 1P0MA 2VP0A 2NYHA 4O02B 3QF4A 3OLXA 2CLKB 4U8YA 2A4MA 3HZEA 4K26A 4UDOA 4M5DB 4CODB 1PQUA 4LVNP 3VYUB 4LSZA 1KZ6A 4YROA 5EJ8A 1YA4A 2HNYB 3QW2A 2Z43A 1N4DA 4QDXA 2ZRCA 4LE2A 5KMGA 2K2PA 1WOOA 3ELBA 5LCXA 4GDMA 3L0BA 2PI4A 1AZTA 2XH8A 5DM70 4I4BA 4UDXX 2QRPA 3OLVA 3L2OB 1LKZA 1O97D 3FPFA 2OFPA 1XFAA 4FEYA 3QBJA 4EMTA 1C3LA 5KC9A 5E2IA 1FSGA 2C4KA 3U61B 1R12A 2V7WA 1KKUA 3F8SA 4K8RA 2UU9F 4P22A 4EB6B 1S4FA 1ZM9A 4TVSA 3PNQA 3G0HA 2RH3A 1VB5A 2ATIA 2HGSA 3QVWA 1Q21A 3WRWA 3MGKA 2BC9A 3GGGA 4XRRA 4WZ6A 1OX4A 1NM2A 1GPYA 5EE0A 4AS3A 2GZRA 3L43A 4QFCA 2V59A 4F60A 1H2UX 1LEOA 4L3NA 3EGDB 2ZU0C 3OUUA 4ZVPA 4D3ZA 1RGVA 2HGMA 1Z4LA 4MIKA 4D0SA 4LRUA 2DR9A 4WCFA 2RONA 4PZCA 4KR0B 5KYXA 3RIYA 1T8RA 4CTMA 4JLWA 3S6JA 4CU5A 4GC7A 2ZQ5A 4XZ3A 1L5WA 4KUGA 3ZE6A 4FVCA 4OAPA 2CWWA 2VKQA 2QMWA 2XXAB 3IVRA 3PITA 4CIVA 4ZK7M 3KMSA 4S12A 5J5AA 1CJSA 2VA3A 2VDMB 3C16C 2NTVA 1WEYA 4USVA 3H1TA 1B8PA 1EUQA 4X63A 3BXFA 2X9GA 1WSWA 3LQ4A 4P4NA 2RB7A 1U8FO 2PX2A 1Q57A 4ZT2A 3EEOA 5BR8F 1JTVA 1IHUA 4R31A 2ZH4A 2CNNB 1H9CA 4RK0A 2I7DA 2PIIA 3UWDA 3SFVA 4YDXA 4HLUC 5H1YA 4YR0A 2EJUA 3DDNA 1S6UA 4TWAA 3SYLA 1QSSA 4IS2A 5CB8A 1Z06A 1DMSA 3IR6B 5HJ7A 5HBMA 4MVJM 3DV0A 3A9RA 3EPKA 4YDQA 2ZXUA 1TL1A 1GO2A 4MCIA 2C54A 2GVZB 4MX8A 2JCBA 5A4KA 3B6KA 4RHTA 4OJKA 2IPMA 3E2EA 3VO9A 3OEYA 3FGVA 5BNWA 4XD2A 3P27A 1VOMA 1CC7A 3M6AA 3L7PA 2HFSA 3QSGA 4JYZA 2W11A 4JBXA 4M1SA 3ZQKA 4U7GA 1Z8DA 4P9SA 3EZLA 1C2PA 1I6WA 3CLSD 1YIDA 5GV8A 2JRCA 3QIVA 1Y81A 4LF4J 2FCRA 4LXUA 1J1ZA 1LJUA 3BD6A 4YMGA 1XD2B 1N5OX 4KE8A 3A2NA 3H5UA 4UOZA 2HIQA 1B0PA 1NIJA 3EA4A 2WKRA 3AF0A 2GZ3A 4X66J 2KHDA 1VHJA 5K3OA 1Z3CA 3I64A 2N46A 4XYBA 4OV6B 3FHCB 1X1EA 1SXJC 3CNOA 2D13A 5J2TF 1WKBA 4EJFA 1DC3A 3BTSA 2E66A 3DT9A 3UAOA 2RS8A 3M8ZA 2DB1A 4E14A 3OT9A 2LVBA 3V4FA 4KLRA 3QKSA 4B48A 1G0NA 4DQKA 4OZ1A 4OJGA 5KTYA 4ZP7A 1AKVA 1GYQA 5E9WA 5T4EA 1G41A 1KHHA 4JBGA 1RM3A 2O2GA 1P7ZA 3AU9A 3F6PA 1XP8A 4L4UA 4Y6LA 1UMCA 1G7RA 3ZYZA 4P5EA 3IAM9 3ZHQA 3B6IA 3Q5GA 5HF8A 4QOSA 2B8PA 3VU8A 5DDOC 1M72A 3HLUA 1JV2B 2CVQA 2VRWA 1IJEB 2I4IA 2TMKA 4ZKAA 2FC8A 2KLHA 4JOCA 4AL7A 1QGUA 3JTPA 2YV1A 1H6AA 2MT9A 4D02A 4BE4A 3LUBA 4E07A 2VRBA 3HNRA 2AQ4A 1T24A 3V4IB 2R8KA 1KZGB 2VJAA 4TTPA 1JLRA 1A98A 3QXHA 2C2MB 3P9YA 3DZKA 2I7CA 1RK8A 3S28A 3T06B 1NVKA 3O7WA 3T7SA 1WF1A 1E6MA 5JWOA 3T1YB 2VZ8A 4IMPA 1E3DA 3L6RA 2JH8A 2ZC4A 3G0CA 4PHHA 3GVCA 2BE2B 1DRUA 1PDVA 1BSVA 1V9SA 4A4JA 3CVOA 1JHPA 5KTNA 4UTZA 1OC4A 1I3KA 1SBHA 3V46A 3U3XA 1M1NA 3B2QA 2FSFA 3KYDB 3GD7A 2ZYSA 5IKPA 2RGYA 1YJNS 2SKDA 1ZR4A 5FADA 3R09A 2GERA 2OMOA 4BTVA 4QWCA 1AKTA 5TGZA 3B54A 2RAVA 4JDPA 2J7KA 1KBRA 4HDNB 2IJFA 1D3WA 4N7MA 5A4DA 5DSTA 1RFGE 4U2GA 4L0QA 1WW8A 1JFRA 3PXGA 3RT7A 3H97A 5T6BA 1RZUA 3M4JA 1TL7C 2V4ZA 1PSZA 5BNIA 3S8YA 4IIGA 3HSSA 3I1JA 1P4GA 3DM2A 1DIRA 2IYAA 2GNKA 3S1AB 2QIOA 1E8NA 3KK0A 1LD3A 1E9BA 1T0BA 2GRJA 3BXOA 3UD3P 4S04A 1V3UA 4TMFA 1WXHA 1QC5B 2ERCA 1ZMRA 4K6GA 2NMVA 4Z7YA 2AOVA 3EVBA 4FB4A 2R87A 2XODA 1KH1A 3RDPA 4PQYA 2PUWA 4BUJA 3H11B 1PT8A 3IMEA 4PQEA 4ALMA 4AM8A 2F48A 3D81A 3DWFA 4UPVA 4NLGA 4E2FB 3X44A 5D0GA 5GPBA 5LUAA 2REQA 1PR0A 1SCJB 3PIOQ 4R9RA 3G0OA 3R5TA 3RRHA 3AT1A 3R6WA 2W2OP 1ISPA 1IE3A 3WNQA 1GPH1 2FYTA 1EEHA 4OJNA 3DDCA 3KALA 3O92A 3DGEC 3OQJA 1HXHA 3DVQX 1SXJB 1JT9A 5KVVA 4UMFA 1HFJA 1PR2A 3VYTB 4GP6A 2IITA 1T3NA 2GIFA 4F4WA 3DOOA 4Q5IA 2ZDQA 2GCNA 3X1YA 4RNMA 1Z5WA 1GLNA 3TXXA 1E3QA 1L7EA 1GSIA 4QJ5A 4G5XA 5AUQA 1F12A 3MCSA 1GT8A 2R5FA 4O29A 3H8WA 1ZZEA 3JASA 2QYTA 5KDLA 5HLFB 5ETLA 3NBPB 5D1NA 1G20E 1FRFS 4TRJA 1PAUB 1GGFA 1SXJE 4X00A 3I58A 3DMTA 3H1GA 2Z5VA 2Z3WA 3HDYA 3KL2A 4F2RA 1IEXA 4YHHB 1WB4A 1TA9A 2KZMA 1B1AA 2R6JA 2ZEJA 4GM4A 3PENA 3Q5DA 421PA 4DBVO 1KERA 3QT7A 3C1TA 3FRZA 3RBXA 1KJQA 2I5JA 3K57A 1PEKE 4PYMA 5AXNA 4PO8A 5LU8A 1T9WA 2DEUA 1NG9A 3KEMA 3ITEA 5G3ZA 3TB4A 5KFXA 2HB6A 3T95A 2J3QA 4XEHA 1VC0A 3P45B 3OUYA 2VSNA 3U37A 3OOEA 3QKTA 4XVCA 3N2IA 2B7LA 2G7MC 1WL8A 5GADU 1B14A 2PX4A 4KQWA 2IMOA 4URGA 3FHTA 2R7WA 1M1NB 3SIPB 1EP4A 2BHLA 1KA9H 4MS3A 1VLOA 4I6GA 3ABQB 3HVJA 3EGZA 4LQ9A 2A6OA 3CVXA 2FSGA 2JASA 3ND8A 2ZIXB 4V2UA 1ATZA 1JZSA 1VOTA 1YE8A 3TQIA 2XMZA 5DGXA 4I5EA 4F4DA 1EINA 3KLHA 1E2DA 4GRAA 4YB5A 3BYZA 4INPA 3G7UA 2EC5A 3ZNJ1 1EUCB 2W90A 4Q34A 4ZAFA 1RLDA 4FLEA 2B78A 4O3MA 2FW8A 5ALEA 3IAM1 2WV9A 4W9MC 2E29A 4YT4A 1S3FA 5ERYA 2AMJA 4YFVA 2R8BA 4C7KA 2XCLA 2ECQA 3RPEA 4NA2A 1Z1ZA 1S2GA 2BGLA 4ECAA 2ZVQX 2ZH5A 3JYNA 4L7QA 1Q11A 1LWEB 5AE1A 3T1OA 1SCJA 1PJTA 2ZIFA 1TQ8A 1ZI8A 3CEPB 4IDBA 2VL7A 1LDMA 4C7BA 4R81A 5E41A 1IN4A 1QDLB 1N32B 3ZXYA 4B3IA 3Q98A 1EFKA 2WEKA 4FKMA 1IULA 4IJ5A 2I1QA 1ZD2P 1Q22A 2DU8A 3IQIX 2QLBA 3JWPA 3T5JA 1LBTA 1YZUA 2A1UA 2WTXA 4OQYA 1DIGA 3MUOA 4TV9B 1VL2A 3QU4A 3DO5A 4O4GB 1GUZA 5J2UB 1PNVA 4LIWA 4DFJA 4WXOA 4PWDA 9LDBA 2JIMA 4O3NA 4NDZA 4UAVA 3P52A 4WV3A 1ZYUA 3BGRA 2XNQA 4PWZA 1Q1KA 5C5DA 4PC3A 1HQEB 1E4OA 2XZPA 1JMKC 1D7OA 2C22A 2H29A 3P19A 3VTKA 3TDMA 3AIKA 2RUSA 2H5EA 1SGWA 5A7HA 1ZVJA 1AOXA 1I9CA 3SJCA 1QUPA 2PO7A 3EMVA 3GPCA 3N5CA 4JT8A 1VJWA 3E27A 5FUQA 3TI9A 4MVYA 2BSQA 2CMHA 2JIQA 3DL0A 2RGNC 2ZI9A 4URUR 2XGPA 4R8SA 2PUGA 2R66A 4J07A 1SKUA 4PC7A 2PX8A 4GP9A 3TGLA 3SFUA 3IBSA 1JLAB 2FW0A 2EK1A 3V8BA 2Q5EA 2RU9A 3KS9A 3QBTA 1UT8A 1PJZA 1UZUA 3WK5A 4AY2A 4J0GA 2XITA 4G1VA 4PX9A 4PRYA 3VV2A 4J3FA 1J7KA 4DQPA 1G42A 5B09A 3F1LA 2EC0A 2P0YA 1Y8ZA 4KSBA 3FFXA 4Z3DA 3CZ5A 4LFCJ 1GA6A 5ALZA 2WAAA 5DLQC 5LP6B 3R5JA 1U0HA 2FVPA 2C1XA 5JY1A 1AS3A 1U1FA 5REQA 1HFWA 4OBWA 1XNHA 4L22A 4XUEA 2YJNA 3UBTA 5DO2A 4K9NA 3FXAA 4RA6B 2B4QA 2XNRA 3VAJA 2AE1A 1BMTA 2X1MA 4HSGA 3E2PA 2V5AA 3AESB 2V5VA 4C14A 2X1BA 1P2FA 5KSYA 5L3QA 1NHWA 2H3EA 2DNQA 3LWDA 3ZU6A 4F6RB 1KEPA 3U81A 1FE8A 1XZCA 2B4TO 1RTZA 3HK2A 1OMOA 1S4EA 1JQEA 3GHYA 3LUCA 3Q5EA 4O4LB 4BP9A 3N7UA 1UFWA 2Y05A 1IBKF 1Y6RA 2QZSA 4HNRA 3N2GA 2G0IA 3VH4A 3WGMA 4XVUA 4EBCA 3CH5A 3EFHA 1JU4A 2FX3A 5C1BA 2P2LA 3GV7B 5EKTA 3T94A 4V0LA 4B3XA 4YP5A 3RFTA 1ZH0A 2XE6A 3RGWS 3A3NB 4FI3C 1XPOA 1BGVA 2VG7B 1YL5A 1R4AA 2L18A 1GU0A 2NZXA 5LC1A 5ETRA 3IAEA 2MPUA 2WJAA 4DCJA 4EUVA 3CC8A 3E35A 2HVDA 4CF6A 5DCWA 5LQAA 2WYHA 1QS0B 4TX1A 5CD9A 4J9UE 1DDIA 1GNQA 1WPRA 4X4OA 2DXIA 3EIEA 1EHCA 3CIOA 3WIDA 1P9NA 5FP0A 4ECSA 3CG0A 1U1GA 1D8TA 4MCJA 2EG5A 1E58A 2FWBA 4JI2B 1CHNA 1HQEA 1M2JA 1RWOB 4KODA 4GKJB 1V5IB 1JQLB 5BWBA 4YAUA 2QSFA 3W9BA 2WOJA 3USES 3H5SA 1XT6A 3IBFB 3QBEA 5B4TA 3IMQJ 4D9BA 2IEDA 1M5UA 1N88A 2L17A 3H2YA 3OVBA 3QBVA 3EQ2A 1X7VA 4UEOA 1V43A 2CPFA 1IKYB 3QITA 1FXRA 1E2IA 4TOIA 2YW2A 3I3OA 3PHCA 2WVBA 3DLGA 3HC7A 1GPAA 1SPBS 1W0CA 1E4EA 2XOKD 1FDBA 4UHDA 3NGRA 3D6TB 3EFOB 1PJAA 2Q50A 1JLLB 4RZXA 3QQ5A 5L45A 3QVGB 3OURA 2B61A 1F4PA 3QZ8A 3GJRB 4PAWA 5DEIA 4OHYA 1L9KA 1JGTA 4I5GA 1LNQA 1WG1A 1EVIA 4BPRA 2RG1A 2I2FA 4YJFA 3A36A 2B69A 5EESA 4FK8A 4F3OA 1M6NA 3FCYA 4P93A 3LY7A 2GA7A 3LW8A 3DU6A 1OWOA 4FD2A 1L4YA 2JGAA 4QBUA 1CQWA 3BRWD 4RKEA 3K9CA 3MT9A 3NRCA 4OUKX 2IIHA 3OTGA 3IJRA 3LU1A 4QTZA 1YSCA 3IIIA 1CF4A 3FFWA 3ZK9A 2PUEA 4GGPA 1SHJA 4WFQA 1OFGA 1QF6A 4COOA 1S1UA 4BFVA 1EP9A 2LWIA 1ISSA 3LLSA 2R8RA 1RHMA 2FZVA 4P74A 3M0EA 2WYOA 3MM8B 3DHNA 3P4XA 2AN1A 5HXAA 1IHOA 4DCOB 1SCUA 1BOOA 2B3TA 4QPPA 4BHQA 5CLQA 3ZBUA 4LSNB 2DKFA 3LC2O 5HQ3B 3KLEB 2NNWB 3ULHA 1ZJJA 4JB3A 3C3WA 5LZ5A 4MEBA 3ESRA 5ADWA 2QAGA 2W2XA 1ZA1A 4E09A 2YZ2A 3QLVA 1P3JA 2Q6TA 1NEEA 3JSRA 4M7RA 2YJTD 4HT7A 2R47A 2WPNA 4RETA 3P0JA 5E4YA 2AYXA 1BZYA 5T14A 3OZFA 4J76A 2ZB7A 2R4FA 4NPCA 1DCFA 2FAXA 5T57A 3UGTA 3SD7A 1N5SA 1A9QA 1JWAB 4ZGGA 5T8KA 2AL7A 3MR5A 3NWBA 4IJMA 3QX9A 2B4AA 4R5HA 1DUIA 3E7PA 4XTTA 4X4TA 1XDGA 1Y9EA 3V7WA 3PWSA 4G89A 3M9WA 1UK6A 1CEQA 4R1UA 4P4SA 2ZOSA 2WWVD 1NK0A 1GVNB 2QU7A 4N6NA 4WXHA 4X92A 4WEQA 1N2GA 4B31A 2LQ5A 5EJ5A 3KQNA 2L9WA 3ADPA 3A25A 2WLTA 5LD2C 4QBGB 2UUPA 4JL8A 1RCFA 2O8EA 3ZTOA 1NJGA 1A69A 1GZHB 4PG6A 1DTTB 2H4YA 2RAFA 1B23P 3CMES 4GBGA 3VZHA 4BL5A 2CNNA 2FI1A 3GWZA 3CR3C 1N4AA 3QVOA 4I4LA 1EARA 1QJHA 3TZLA 2WM8A 4QM6A 4XVRA 5DN6D 2GDZA 4ARZB 1HO3A 3PKIA 1H2AS 2HA3A 3N6NA 2Q4TA 1J25A 3ZV4A 4R0JA 1QG6A 3JTNA 3AZOA 3D7MA 1DG3A 1QPGA 3CPWR 5DG9A 3A37A 3A6LA 4RA9B 3C43A 5D1HA 2JFHA 1Z4UA 3K70B 4R1PA 4P7JA 4XLZA 2A7QA 2R25B 4DSLA 1YR2A 3KLIA 1HTTA 1CFZA 3VBEA 4YAKA 3FVYA 1E0JA 2PGJA 5DULA 1IBLJ 4KIFA 3ZEIA 3G82A 4PSKA 3L3CA 5IS2A 2OZLB 1RT6B 2G28A 2WTEA 3G8DA 4G0UA 1ZOLA 2LE0A 3B3GA 2BGJA 4X3PA 1LY1A 3TDKA 2VA9A 5F35A 3PX3A 5BWMA 2ZB8A 1GFIA 4P7BA 4Y0AA 2VNIA 4FONA 3TZ6A 1JEEA 3KQQA 2XMRA 3IRVA 4P3NA 4P7KA 2HIMA 3U9SA 1PKEA 2FJAB 3K0SA 2MZRA 2RIRA 2FJPA 3U39A 2HCRA 3MECB 3RTBA 2FSVC 4TQSA 1PR5A 3DFIA 2JHGA 4MJXA 4L15A 1J00A 2ATCB 4E2ZA 3VRHA 1AK1A 3UJPA 3ZWNA 4UOHA 2HLDD 3IERA 5HTOA 1XDBA 4QTXA 1XRMA 1J5PA 4WMLA 2OTCA 1X86B 3HWX1 3VZRA 1KYZA 4MR9A 4AZ3B 2PXCA 1XO1A 2DO0A 5BQ3A 4NYOA 3FI9A 3P2IA 1F6BA 4IY1A 4URZR 3UN3A 1KS2A 3PFFA 1REQA 2HYDA 1NWCA 1J39A 3EW9A 3Q3IA 1RWUA 1K2VN 4ZQBA 3AKEA 4E12A 1NOKA 2DOKA 4I1TA 4FW8A 5ER9A 1SK9A 4YO8A 2FFBA 3OFEA 4PEOA 2PD1A 2Q6OA 2Y0BA 2WTMA 1FXSA 1FFSA 2A0KA 4ED2A 5D3MB 1N52B 3UT5A 3ZJUA 4YJDA 3GBPA 1UANA 2B1JA 4YYZA 5EKXA 4M63A 1W7WA 1A9PA 2CJPA 1DEOA 3T34A 3ET4A 3IR7B 2IXAA 1NSYA 4OL9A 4X4RA 4WZAE 4C30A 1DO2A 2YQ1A 2C3OA 2XKAA 3ESZA 4NWIA 1THMA 3H1AA 2HZVA 1F2UB 2SBTA 3NALA 1WY7A 2HHTA 2AOWA 3UNGC 5BSUA 2FPXA 3IS3A 3CISA 3R9LA 4HHHA 1PE0A 4UBIA 2BZ2A 4P10A 4UUMA 1XZGA 5B2FA 4L51A 2QJWA 3AJRA 1SKRA 1G2OA 1ZUD1 5JQGF 4R1SA 1LW0A 4OB8A 1XYGA 5JNRA 1X1RA 1NGSA 2HMWA 3VR5D 3EISA 1X94A 2HTEA 1F8FA 4LWPA 3RRYA 4DU8A 3LKVA 5JSYA 1GX6A 1VE6A 2XBMA 4CWAA 3G82B 5CDUA 1C9JA 2DWOA 4Z4HA 4X8MA 2P5TB 7ABPA 4MINA 2B4VA 3IWLA 3TZHA 821PA 2WNHA 5KTTA 1VSVA 1E66A 1IZ0A 2RRBA 1GG2A 1YS2X 1IQUA 2DVMA 4TXNA 4K2AA 2XWJI 4ESHA 4NA3A 1NM5C 1K5HA 2PKCA 1MENA 3OA2A 1S2IA 3KAKA 4HV4A 4R16A 1LPNA 3Q6IA 4CQLA 4DY4A 1WVMA 2O2XA 4YLEA 3TQOA 3NMUF 5HVHA 3NHLA 3OU2A 3PI7A 1S7IA 3S40A 2DPMA 3PRHA 1QCZA 3KHSA 4JT2A 2V8DA 3CZPA 1U7DA 1HBMA 1SIZA 3AT1B 1P9YA 3VJRA 1N5MA 4E5UA 1MN6A 2BOPA 3IAUA 1CZOA 4R6WA 5KX5A 3H2IA 3KPJA 1FRXA 3N76A 2H17A 2U1AA 4XM2A 1TFRA 2BFBA 4GDFA 2AI2A 1QVAA 1TUBB 3AW8A 4P4GA 4RKQA 4CXMA 1E2LA 1K6JA 2CQ1A 5FPQA 3DV9A 1B1CA 2QN1A 2Q1XA 3VZPA 1QQAA 1HPZA 5E3CA 4U7HA 4E5DA 3K96A 4LCEA 2LRHA 1YZ3A 3ORQA 1JPVA 3W4KA 2NXEA 3SLGA 1AQIA 3ZGVA 4V1CB 4KR0A 3V2IA 4GNRA 1UP7A 5KOIA 4GEKA 5DG7A 3OR2B 1L3TA 3T7CA 3K0HA 4JD5A 1KYVA 5JFTA 5LUBA 1ZPWX 5FV4A 5CFOA 1O95A 4W4MA 1R8QA 3VC7A 3F7TA 3WY9A 4FGSA 3G59A 3R7SB 1HQCA 1XYVA 2IIBA 2ZJ8A 4BIIA 3C15C 2IOFA 1PT7A 3JB9k 3RSQA 4AJ2A 2ZIUB 4Q9AA 1ZCJA 3FNGA 1G3OA 3DJFA 3AJDA 4ZLLA 3C8DA 2W6CX 3PQ7A 1LRLA 3ASYA 5FYQA 1US8A 4IR1A 4GMGA 1E6VB 2XM3A 4QULA 1KJWA 1CUDA 4KLZA 3SQWA 5A0YB 2PZBA 3KUUA 3DE3X 1IY9A 1MNQA 4WOKA 1Y9AA 1U2GC 1U48A 4A0QA 4TYYA 4YJKA 5DKFA 3AEQA 3TOXA 2DHSA 3IQZA 4EKIA 3HWRA 2H7VA 4OZ3A 3CCQS 1X15A 1U4SA 3BL6A 5CXQA 2ZD1A 1R5NA 2VP3A 1JQGA 1Q95A 2W2LA 1X19A 4RW7B 1T2FA 2E1MC 4UJ3A 2QTRA 1DJMA 5A6WA 3BERA 4CLWA 4X0EA 1C29B 3H5RA 4A46A 4KBFA 1OWPA 1QQ5A 4LOKA 2X8JB 1QORA 1FDAA 5L1KA 2YKMB 4ADSG 2PZMA 3C8UA 4JYAB 5KFBA 4DYDA 1OQAA 3GJ5A 4W82A 1Y1LA 3EYWA 3GLVA 1VHTA 3Q89A 2RQCA 3HZHA 5F7ZA 1I4DD 1KSHA 4N6OA 3MBKA 4N9WA 2X6TA 5FFFA 3L8EA 4AY3A 2ACYA 3ML1A 4EZ9A 1AYEA 2Z2YB 3GV5B 4UQGA 1VYUA 2IZ6A 2KMLA 2HO4A 1QE3A 2C5AA 2IELA 4LRTB 4C20A 5F5LA 1MHTA 1RAHB 1HL7A 4P3PA 4CCYA 2VWPA 1A77A 3IBCA 1KOGA 4U2EA 4TQGA 3A7DA 1JW9B 4DYVA 3I0SA 5D84A 3QYYA 5H1SV 3GG1A 8AT1B 1VL5A 3ACDA 3EGVA 2Y1JA 3F90A 5IAKA 3DRSB 4DM3A 1CG6A 3NGMA 5JD5A 4X3CA 3KZMA 5CCLA 1V71A 1ZXBA 4FFLA 2IPOA 2BFAA 4C01A 1JAZA 1SXJA 4X4UA 4LYYA 4DUGA 4GF5A 1YS6A 1T2VA 4FFMA 3KQTA 3NS6A 5EE1A 3EJMA 3MAQA 1T6NA 3JXOA 1XRJA 4A5OA 1YGYA 3CO0P 2GTPA 4XVQA 4PRLA 3K09C 2AP6A 3GJ3A 4NNJA 4XX0A 4Y2XA 2D3ZA 4KQ9A 1GKIA 4R05A 1U4BA 1JFFB 4Z7QB 1EE1A 4HT5A 5CVJA 2NWQA 2FGKA 1CPZA 5KTOA 1UVLA 3JSBA 4K6OA 1K7XB 5IK2A 3MUNA 2ASJA 1GL6A 1ZYQA 2P0AA 1IJFB 3TZBA 2ZS7A 5A0YA 3ANYB 2ZUWA 1CJVB 4UZEA 4L85A 2Q41A 3PYFA 1BWPA 1Z13A 3OI7A 2IH2A 4K8OA 1CTQA 2E85A 4D9FA 4QW9A 1Q7BA 3DNMA 4NOJA 4CKYA 2B9VA 3KU1A 3AUSA 3CX6A 1IBCB 2Q4RA 2WZBA 1FC0A 3IA0A 4EMDA 2CNOB 2DX7A 3TL6A 5KG3A 1XKXA 3OQVA 1O5IA 2AKEA 3NNNA 4MJ7A 1XTPA 4OB6A 4QNMA 2QA1A 4I6WA 4NKRA 5B08A 3CVYA 1BDHA 1XR5A 1V3TA 5FBHA 3CUKA 1J8VA 2L2QA 3WR5A 3OHSX 1Z56C 1S1XB 3B1JA 2LKZA 2GAFA 2VPWA 3FQLA 2GQCA 2NTYC 1AKNA 4LZZA 3CYFA 3N2ZB 1AM4D 3FM9A 1EUDA 4HWRA 3R7LA 2E5GA 4PWYA 3GFFA 5ECWA 4PXDA 3KOAA 1K2WA 2XUPA 1U0BB 2PA8D 4MS4A 4ZI7A 1Q0LA 2JL1A 1RT5A 4RUAA 1HDOA 4G86A 3LWNA 2KWIA 2C2EA 2AJDA 4EM6A 5AW9A 3M8RA 3FMFA 2FSPA 1LRJA 3GFVA 1X7WA 4FBTA 1ULBA 2I5PO 3B12A 1G8PA 5J2QA 3P32A 2B5JB 2AQKA 3KK3B 1W87A 1ZAKA 2O3SA 4DR3F 4MKXA 4OV6A 4O4JB 1ZUHA 2D59A 4KJIA 1U0JA 3F3YA 5IK2D 2G70A 4CM9A 1Y34E 4F26A 4FYHA 2W24A 2R6DA 4PX3A 3DBRA 3WL7A 1N0VC 4FMCB 2ZWVA 4CKCB 1GLVA 10MHA 1H6KX 4W9NA 3QJYA 3K5LA 2ZZTA 1XTZA 2YZNA 2Y8EA 5L3VA 2MLYA 4DNPA 2NZVG 3ZJ5A 1GLGA 2GCEA 4ODIA 4K4UA 2HQBA 1ZRSA 2HQ1A 2OP5A 5DK6A 5LQUA 3WE7A 2QLLA 2XYPA 2A1IA 3LNTA 5H3HA 1J0CA 4IIJF 2NV2B 1LTHR 3PNLA 1TMOA 4HO1X 3T7JA 1WZNA 2Z30A 3NP5A 1P1CA 2G0NA 1SKYE 4XFDA 3HEBA 5LSRA 4I6YA 5EMJA 4WTOA 4UTPA 2FP4A 4C8ZA 4JHXA 1Z35A 3H0EA 2O0LA 3V8PA 2JJ1D 3NETA 2D5IA 3JVUA 4O4IA 1ZHFA 2WD7A 4RFSB 4O4RA 4W99A 4TTAA 3CXRA 3DHXA 3JS5A 3P9NA 1DKLA 2BZ0A 2JDIA 1TZ2A 2JEZA 4Z9AA 4CKEB 5HN0A 2QX4A 4HB3A 1L4HA 4YCSA 3PB3A 2CKMA 5GVSA 4KQ6A 3WMFA 3CUEF 2R3VA 2AXEA 3GFGA 3K94A 1XN9A 4BQSA 4TT3D 2JAOA 3IRXB 5KG5A 1DV2A 5FNZA 4Z7JA 3M89A 5LD2B 2Q5FA 1GU1A 2V9WA 2O6HA 1IN8A 4Y2GA 5A8WB 3ILYA 4NC9A 3RI3A 2QQGA 4HXFB 2JAUA 1KZ1A 1L9XA 4MJLA 3BMCB 3F96A 2X3DA 2RI0A 4ZAGA 4G0YA 5AM4A 4YECA 1AS0A 2J48A 3HDTA 4CIBA 5JISA 4M5DA 3F7NA 4ELVA 3ZZOA 2XQGA 4JSTA 1TYDE 1YHQS 1NL3A 1UEVA 2X0FA 1JLGA 1XZIA 4GKVA 5F41A 1WF3A 3PEYA 4W4TA 4QJIA 4MEJA 4XWGA 3G86A 3HI6A 4J8PA 4ECVA 4PNEA 3STYA 5IUJC 3ANLA 1HRDA 3EARA 1P0IA 1X4HA 2WSLA 2PM8A 1EFDN 2QFJA 1GNLA 3JALA 1R10A 1FUEA 4D9GA 2CXOA 4OYAA 4UFOA 1I7PA 4N7BA 4IO1A 4UULA 4Q7LA 3OR2A 4IAOA 1W36C 4HQNA 2JBAB 1T9GS 5CA0A 3AHGA 2VDHA 4EB6A 1T05A 5IJ0B 4TMXA 3ND6A 4PANA 1RQGA 2CKDA 1DQ9A 2QPAA 4AF6A 3CE8A 5B2ZA 3KOMA 1JIUA 2QSYA 5FDLA 4ZCSA 2G5PA 2J45A 4KB5A 1ES9A 1FHTA 3G2NA 3F67A 1LBSA 3UVEA 3PR4A 4PV7A 1U0SY 3EOZA 3BCUA 1L5OA 1W7AA 1N5LA 4LYJA 2PFKA 2ZPTX 3FZBA 1UVKA 1U7LA 1TP7A 4BNWA 1H65A 4F3TA 3I5AA 3J7YU 3KD2A 3DDWA 2XMVA 3DLHA 3R7SA 3IRUA 4RWZA 2LTAA 5AVVA 2XNDD 2GN8A 2GJSA 3GCWA 2COUA 3WOHA 2W7OA 1J8YF 1Z3IX 3CXCR 2AN9A 3PDIA 4BQQA 2B9YA 1DNPA 3U7GA 3GAAA 2WMYA 2QE5A 1APSA 4Z1MA 4UTVA 5JVDF 4ECRA 2B7CA 4C3ZA 1WBDA 3KYBA 3JD4A 3HSZA 4BLQA 2PU7A 5DT2A 2OXFA 2BE2A 5TEVA 1XQWA 2NUPA 3DNPA 1EGAA 4AO7A 3PNKA 4P2XA 5LQSA 3MOZA 4W1SA 2WKWA 2VNAA 4HR7A 2IY5B 3LP1A 3G87A 4BMVA 3A06A 3IUNA 5K8JB 1ZRNA 1DBQA 3E2IA 4AYBD 1CDDA 1A9SA 3CZRA 3H9BA 2QAGC 2RKIA 3T3GA 3LDAA 1FWKA 2CWXA 3L6BA 3W5ZA 1V47A 1MKYA 3AJ2A 4DA0A 3KAJA 3IFSA 4AFNA 3H87A 2QF7A 3E1GA 5K7SA 4EUNA 3BGDA 2QUHA 1TQDA 1X6VA 1SPXA 4HQLA 1LV7A 3NL0A 5JVDA 4PSVA 3PFGA 1XVUA 5MF6A 2HO5A 2AQIA 1WCWA 5CBPA 5LKAA 1M90T 5H9EJ 2AZDA 1TV6A 1RABA 4HH3C 2IAJA 2C9BA 4RSGA 4GKKJ 1SA0A 3T4XA 5KPDA 1MIOA 4OQEA 4NNOA 1XN4A 4ZVQB 4ITVA 1W5FA 4AWBA 1RTHA 3RGIA 2HFNA 4IG0B 4PS1A 4XGQA 4W5JA 3VR4A 3WHPA 1JJBA 3V2UA 4BZZA 3PNVA 1ZBQA 5L8RC 2KJQA 1Y5IA 1AW0A 3NJ4A 4D8WA 1XJWB 1EEXB 5A9RA 2V8PA 5A0TA 1N1EA 2HWYA 4D9CA 2P6PA 1VQ6S 2E7ZA 1SL1A 1L5FA 3QXSA 4QWBA 5CA0B 4G9GA 1JE1A 3ZZNA 5HANA 4JUBA 4JI8J 3HYTA 5JZMA 2M9KA 3FNHA 2OECA 5ADHA 1A4UA 3L1IA 4MWGA 2JC3A 2HM7A 3CO9A 1ZJ4A 2XUZA 4OFBA 4CNBA 1OB2A 1RP1A 4R9UC 3KQLA 4OLFA 2NP6A 1XU7A 4QRHA 4Q44A 2PEYA 2ORVA 2HGLA 1FQWA 2B43A 4N0MA 2Q4DA 2WT9A 3NWGA 1MZPA 3R7BA 4NYJQ 2OI2A 4L9SA 3SVLA 121PA 2JJ1A 2PZEA 1L5HA 5AW2A 1PYOB 1SAYA 2R7VA 1ORDA 3OCUA 1PG2A 3HF5A 1GN8A 4DR3B 1QVFR 1ODJA 4DMZA 1M0WA 4TL6A 4XAKA 3OC0A 3UJDA 2J5QA 2O48X 1RMYA 3JYLA 4B0OA 4ZWNA 4EA8A 3D5QA 4LV5B 1UWBB 2YNGA 1SKBA 4RLFA 4LBZA 4ZMRA 4JEMA 3FIJA 1WTFA 1J2JA 1YFZA 4KQ2A 3LT2A 3EFOA 1EGHA 3C5VA 1NG1A 1RYDA 5BURA 2EP5A 4B9UA 5AM2A 2D5LA 4KMRA 1Z4JA 4YHBA 4I55B 4HS4A 2SHKA 4EHNA 1K8AT 1N32F 2PO5A 1FWLA 1XMQJ 3CF2A 1F8XA 4AJKA 3CT6A 2V6IA 4YXFA 4WU2A 1Z2PX 1Y5RA 4OIFA 4Q05A 2P3QA 4PIMA 3K31A 3IWNC 3P5SA 3GNSA 2YFQA 1R4MB 4U9UA 2R1VB 1ZW1A 2FSVA 3ENVA 2WFZA 4DC1A 4HQRA 2E7VA 3G02A 1FNCA 4GVBA 2WBLC 3RAPR 1W1WA 1Z0FA 2JLVA 3F5MA 2WONA 2ZT5A 1Z38A 2E44A 2QMUA 1R3NA 4PRKA 1VI5A 3O90A 1E9DA 4IR9A 2WAYA 1FP2A 3IP8A 3EA0A 2CCKA 4CM8A 2QX7A 4TWRA 4Q3EA 4OGLA 3AEZA 3GAFA 1ROFA 3FFAA 2DRAA 2IGBA 4N01A 3U6KA 2FLPA 2QVXX 2FEWB 1V9CA 4FSDA 2X0RA 4FC7A 2W6JD 3DD5A 3CRNA 1VJRA 1HQ2A 1RU3A 4UOEA 4H4KA 3ET6B 3HN2A 4AL4A 4NA1A 2W98A 4DFKA 3EZFA 1X80B 1WC0A 2PI5A 1M2GA 1U1OA 4KG7A 2BRKA 1X4BA 2DNHA 4RVOA 3R74A 2L42A 1JWLA 4FC6A 1MUUA 4AG6A 3R9XA 1Z28A 2C3MA 2XB2D 2IEYA 2WMOB 4P0QB 3ZR4B 5TR9A 1SCDA 4XTCS 4XSHA 2DBQA 4LVNA 3F49S 3DHEA 3V00A 2XKKA 2N3LA 3D2AA 1EP3B 3PHGA 2V6BA 5IYZF 1UXGA 3O44A 4LKRA 1MWZA 2GB4A 3RRGA 2X1LA 4AJOA 2UVPB 3PHTA 4KPCA 1RRMA 2H4JA 4UZBA 1SVIA 4KQKA 4M83A 2HPVA 4LV6A 4YRQA 1PEAA 3WYDA 3U48A 2CQIA 3BH7B 1UWBA 3V1NA 3VAIA 1VZ2A 4Y9SA 4F85A 2AR0A 5AD1A 3ZUPA 3RNLA 2W00A 1ADYA 3K9WA 1K7CA 4OXNA 1RRFA 1W4LA 1T8PA 4XQEA 2WA2A 2CLMB 3AVUA 4PVCA 5C7IO 4EO7A 5C1PA 2IHNA 1L3UA 4GO1A 4N6GA 3C5HA 2YKNB 1MB2A 3UR3C 4RMHA 4IIBA 4J2OA 2JK1A 4EO6A 1TK3A 1LWCA 4AP9A 3KJXA 4S0MA 3FPLA 1C14A 2XDQA 4ELUA 4WXEA 3QYPA 4C87A 4DNOA 1WOPA 4C6SA 3W06A 5EIWA 3SR0A 3DUFB 4K9PA 3VX4A 3CF0A 3JYPA 4P35A 3PGXA 2C97A 3OXGA 3BSSA 1H2RS 2NUUG 1EDDA 1TKBA 1UXKA 1GQ2A 2Q3DA 2E7XA 4XASA 1JHQA 2VUUA 1K9VF 4PLVA 3LT1A 3G1WA 4QLBA 2ILTA 3COWA 4BNUA 2BBEA 5M2UA 3LXRA 5F51A 2ZJ3A 3RSZA 3WX8A 4YREA 4ZHRA 2DGTA 5HZKA 3H0KA 1LPMA 1X8XA 3MFIA 2XYRA 4UMVA 3PX4A 3H13A 1LC0A 3MPUA 2B8WA 1VIDA 2BABA 3T5PA 3H6HA 1NW7A 2AFIB 4JQOA 1RYSA 3NXKA 1ID8A 1GGNA 3PPWA 3V8EA 3AR7A 3M8PA 1NUQA 4BFZA 2YKGA 3Q2SC 1PFQA 4W8HA 3CCFA 1U8CB 4HH1A 2Z6QA 3AM3A 1JBKA 4BAUA 2BJ7A 5CA1F 4GVXA 4Y2VA 2BZ1A 4TLMB 1E2HA 5ESXA 1LWEA 3OZVA 5DXJA 2XZDB 2QVBA 1MN7A 3QLUC 1RAHA 4FXOA 4B3CA 4BATA 5JNUA 3CCJS 1E9EA 2PRIA 3IBWA 3JTMA 1CUJA 5AW3A 4DUZB 3M9MB 3ET6A 4BAZA 1FFXA 2QLNA 4DZ6A 2RJNA 3H2GA 5ULLA 1JB0C 1PG5B 3C98A 4M36A 2XNDA 3DPSA 3PJXA 1P3Y1 5CFPA 3AODA 1GPMA 3H84A 2XS5A 3VPCA 1PD1A 3IP6A 3GVPA 4ZYTA 3QWHA 2XOXA 4NENB 3AVWA 1YZHA 1JX6A 2JIBA 5KT2A 5AHOA 4WFXA 1OC2A 5CB4A 2UXCJ 3HU5A 3F44A 3U7FB 4M8IA 1FK9B 5LOVB 2Y1LB 2V2VA 3A6EA 3FMBA 1GT91 1E4YA 1B8UA 3JQKA 2XB2A 4D8YA 4RFVA 4GKBA 2XNSA 4A23A 3B53X 4D4KA 3ZVMA 4DIBA 1L8OA 3IR7A 1QQ6A 2ZH7A 2XE8A 2XD4A 1UAAA 3MAJA 4PAGA 1RWKB 2ZWMA 4J75A 3DTVB 3TINA 1VJ5A 1LLDA 1E2BA 4RU1A 2IZ1A 1JF8A 4P6QA 4U6PA 1XQ1A 3A1UA 2FR8C 2W6JA 4NICA 3N58A 3VZBA 3O31A 5F64A 1HLGA 4ZJPA 2P9BA 5FUYA 3SZUA 2HPZA 5FPKA 4OSEA 3B1FA 4PSUA 3RTGA 2VJQA 4YR9A 1PJ5A 1L5LA 2QM0A 1T0UA 2Q3FA 2B0CA 3HKCB 4I9GA 1PFVA 3IE1A 1T6YA 3U27A 1KMHA 3FMGA 2BJWA 1Z6GA 4PN3A 1Z29A 4Q9KA 3SG0A 4H7IA 2AYEA 4KGVA 3MERA 1U8AA 1KLMB 1MC5A 2IFXA 4O3FA 4DTCA 1S1XA 3C5EA 1P62B 1O0BA 2WSEC 1AG9A 3VO8A 2KT2A 2Y0CA 3FOCA 1JXEA 3T3OA 1BKDR 2JS7A 4YRCA 4O3RA 2JGDB 4AY5A 4JYCA 2P2SA 2I8LA 1GRNA 1CUEA 1YDEA 3W78A 4D5EA 2VOOA 2VDRB 5LNK6 2GVDB 2AFIE 4TGLA 6PFKA 3M5DA 2NZWA 3CCCA 1WJGA 3X1LB 4LA4A 2NSCA 3J81A 4FCWA 3MUEA 1NPRA 4B3SB 1ONBA 2WWXA 1UKBA 2PWYA 5CITA 2BOAA 2NZ4A 3WIVA 4BCDA 1B0UA 5TVKA 1DQZA 2BBSA 3E2MA 4A47A 1UP4A 1GSOA 5BQ5A 1N0HA 3K17A 3D4JA 3LL7A 1FJGJ 2PUBA 1A2QA 5FLYA 4J0KA 3AR5A 4J4BA 3S5UA 1ZK4A 2GXQA 3ICOA 2A9VA 1WY5A 3KQHA 1SELA 1EHIA 3JVEA 2X40A 1SNYA 5FUMA 1SUAA 1TTPB 2YC4C 4OEHA 1GSHA 1MAWA 1NU6A 4I9UA 2WILA 8AT1A 3UTCA 3IUBA 4MRNA 1VMKA 1GMUA 3ZE9A 3AF5A 2HSEB 2NAFA 3ORFA 1U1IA 1A5TA 1FP4A 3OWOA 5B3JC 4Q12A 4IDFA 5H4HA 3O8OB 5KFCA 1ZD5A 4OXRA 2HCTA 3VFDA 1XNGA 2QUAA 4LHZA 3L82B 1QUEA 5ITZB 4CKCA 1TTHB 1X42A 2Q2QA 5K03A 1KI3A 1ORTA 2IYLD 4ZOBA 4KRFA 3PNPA 4MW0A 3OETA 1BOFA 4N8OA 3KAPA 1FNOA 2GMJA 3VNSA 1OIAA 1F6WA 3W5CA 1HDGO 4B8WA 1TAUA 3IG1A 1R6AA 2GA8A 1A7KA 1KF0A 1T2AA 1W94A 1RQ0A 3PY8A 4QFMA 2AYMA 1EG2A 2P67A 3Q9UA 4YV0A 3BN4A 3T9DA 3ZOZA 4YY3B 2EQBA 5SY9A 3DP7A 4FNAA 3W2VB 1G9TA 2PMWB 1MN9A 2R96A 1QAIA 1WB5A 2EIXA 1RACB 2A0XA 3PM9A 4Z2YA 5FIUA 2NZUG 1NURA 1ONSA 1DKRA 3CURA 3IOMA 4DRXB 1GRVA 4AX8A 1IBCA 5FUBA 3D8UA 2O7VA 4RACA 1JKHB 1S1WA 4WP9A 2X0DA 4ANEA 4TM8A 2BI7A 1XAIA 3EAQA 4L50A 4MWZA 5I9NA 5ITSA 2XVMA 3RTDA 4BVHA 1NYTA 1AE1A 4MIYA 5C5IA 4JVSB 4I1PA 4EYHB 5DV9A 2C20A 3E22B 3B52X 1MAUA 2GRAA 2FKAA 1WS6A 4FMCF 1EK6A 3TTVA 3JWEA 1QZZA 5IM0A 1ZCBA 2YZMA 7AT1B 1XA4A 3CUVA 1SKSA 2FTRA 1NASA 4G4SO 3GJSA 3M30A 3BPDA 1FERA 4MUHA 2FEKA 2QD4A 1BWRA 5EE5B 3GH3A 2CNLA 3EDYA 1YTLA 3HHLC 1LQTA 4QQNA 2VF4X 2A5DA 3G0GA 1NT2A 3C1UA 1KEEA 3T6JA 1P1KA 3L09A 3UV7A 2G77B 2G80A 1RYRA 3ISJA 5MFPA 3ZE1B 4BLTA 2UUBJ 4NPHA 2VJMA 3OIVA 3VTIA 2K7KA 4XYMA 5IP5A 2YIJA 3PD1A 4XCXA 2XNCA 4P9NA 3HCWA 4IJKA 5CGQB 1QOPB 4QEZA 4G1IA 2AZ4A 2VCYA 3ETDA 4WJZA 5IJZA 3LPDA 3LCVB 5AOVA 3D64A 4CLSA 3D6HA 4LF8B 5CK5A 2X77A 2HMIA 1V25A 4BZQA 2X0JA 1P44A 3EZ7A 2HA2A 2LFVA 3LBHA 3DOHA 4HLNA 1OLXA 1Z2DA 3LD9A 4X4SA 2HZCA 4C1NA 1P4JA 2QUJA 1OH8A 4DR5B 2FGCA 1EFRD 1JNZB 1L3IA 5L6MB 3TW8A 3ZZZA 4WERA 3R3WA 4ER6A 2WUGA 3K1AB 5F3ZA 2FWMX 4I8DA 3GYGA 2AYYA 5A9SA 2Z58B 2XRFA 1CRQA 1M76A 2RHMA 3RO7A 3QUCA 3MVEA 3I5YA 4MH8A 2WWFA 2H65B 2VONA 5BRNA 2V6AA 2JLAA 5FTNA 5I3UA 5E2BA 4PAAA 2XS7A 5JSZA 1B8NA 1E1QA 3T1YJ 4V3CA 2E1CA 3M33A 4CLFA 2RGNA 3DOKA 3JQFA 4WCFC 2AWOA 1IR2A 1AV6A 2VG5A 3FI0A 2NNLD 4MLPA 2G9RA 5B7QA 3OT1B 1GN9A 1EP2B 2QOEA 4FZ3A 3HKWA 1ZAWA 3DFZA 1UJ4A 3GFRA 3NTQA 1OZHA 3OIWA 1OZGA 1LK7A 1SK8A 3L8CA 4PXEA 1QTRA 3IMGA 4QWDA 4O2BA 2R11A 5UKDA 4RKUC 4B80A 2Q7XA 4BMZA 1ZIXA 4ZPCA 2DPJA 1APBA 2FJDB 4OXKA 2GO8A 2PUJA 4BWGA 2J1LA 2QEXS 2HRDA 4UEQA 4LCJA 4KUEA 2CL0X 3K8WA 4J7XA 4EVIA 3KTDA 3I2KA 1U9IA 2B6AA 5HGJA 4MK8A 3KJQA 2Z1NA 1ULRA 2CL5A 1W2HA 1SOAA 3MS4A 4YPFA 1GCUA 2XB8A 2VUHB 2GVZA 1YBAA 2Z9DA 1M1YE 3LPYA 1OXMA 1KGDA 2INGX 4M1KA 4GMHA 1XKTA 3WL6A 2HS3A 4UNPA 5JXWA 3LC1O 1R8XA 4O0NA 2VN8A 1NN5A 5LA6A 4C3KA 1SCUB 4QE3A 3VJKA 3RC9A 4XARA 3L7MA 4RZSA 3GBSA 1B0TA 2AN5A 3BL5A 3KUCA 3CPJB 1RPNA 1P91A 1BDIA 4MWBA 3DEIA 3CXUA 2CJ9A 3UB2A 3E7WA 1B93A 3BGWA 2AI1A 3FMPB 1JJ7A 4RE5A 2IUSA 3KTOA 3RJ5A 4JMPA 3ZQ4A 1U5BB 5TVGA 2ZVIA 1F5CA 5DN6A 3SKVA 4GE3A 3T4EA 3VSDA 1Z8NA 2R6CA 4RWXA 1JPJA 4I56A 1A7UA 1JLGB 3ZHUA 2VO1A 4CCAA 1OX5A 1XLTA 3DMJB 1WW2A 2FC9A 4BOYA 5F3WB 2P78A 2F2TA 2V45A 1G291 1W0JA 3CH4B 5EYPA 1VYAA 1KOOA 1SB9A 3TMYA 4OLOA 4QBFA 2DR6A 3JAKB 2JLBA 2RSQA 5MGBA 3MMJA 2QX6A 4Q4JA 3BA1A 5AHRA 2MZSA 2V1XA 3COJA 2C58A 4EPYA 2OCYC 5K5EA 1WXGA 2VAXA 2JEIA 2Y1RI 16PKA 3CM0A 5KU7A 4HNHA 3HFRA 3KIPA 3HVIA 2V5HG 3SOPA 1G2EA 5CXSA 4JELA 1JB1A 3H3FA 3ZKWB 1RYMA 4QPCA 2B6HA 2I4NA 1IEQA 5GZ1A 4TWJA 5JH7F 3GT4A 1JPNA 1USWA 2ONKA 3GG0A 1M1YA 1A7AA 4F4YA 4DMHA 3R0QA 2BGTA 1E3TA 1AX9A 2W4DA 1LWXA 1DXQA 2ZM6B 2VH1A 3AR8A 1GDHA 2BHNA 3P9PA 1L5RA 4EG7A 4FS8A 2W42A 4QG3A 5HUQA 2AW5A 4MUGA 3U2QA 2CDCA 1G1XA 3HJTA 2R7UA 1O0CA 1NM5A 1Q1ZA 4Q37A 4NMWA 1K7YA 2J4FA 3KT0A 1RFLA 1TJ4A 2I6TA 1IIRA 3OL7A 1OPXA 2C95A 3KZNA 2X1VA 4HAWA 1VGYA 4DR5J 2QQ0A 3I04A 3KYDA 1JDUA 5U4QA 3R3HA 3EOBI 1KNXA 3DN9A 1SOMA 3IR5B 1UC4B 1YNOA 2PLFA 4RA9A 3AFGA 5AKEA 3HTXA 2HU7A 4QO7A 3KLGB 1G3UA 1YBHA 2WPDA 4F92B 5JJBA 2V54A 4TY8B 1NW8A 4HTIA 4ANDA 4UFNA 4ZO4A 5JXHA 5FOUA 4FDVA 3HP4A 4CUJA 1KQKA 2X3UA 1SHUX 3OXLA 2CSXA 4GMKA 4B7AA 1P2DA 3GEGA 2ZS9A 5JVDB 3JAWA 4H0NA 1FRLA 1YRXA 2J3IA 4BNZA 4X7BA 4DR7J 3TQSA 2E5JA 3E9ZA 4A0HA 2YVLA 2PL9A 4AZTA 2J07A 4OHFA 3B1YA 4ACAA 1HI9A 3NVKI 4MQ5A 2O2EA 1B41A 4KLCA 2JNJA 3ZTWA 1RQ2A 2XT0A 1Q91A 2VYNA 5KFYA 1H9BA 1C9NA 2NXWA 1YRAA 3VR3A 1XMSA 3ZVKA 1F2VA 1OJ7A 2EEYA 3M32B 3JQEA 4EHLA 1RNLA 2HHPA 4CP5A 3OPQA 1FQOA 1JIHA 4BKPA 1HC7A 2B51A 2VJNA 2J0XA 1RI1A 1JLMA 2R2AA 1M34B 2QSWA 1C3JA 2CJXB 3B89A 3LTNC 4NZ6A 4YJ3A 5BSVA 3K05A 4RF4A 5E5NA 3LHKA 1UMCB 3W3SA 4ARSA 1ZGBA 2LIPA 3D6JA 2VBZA 2OYCA 2CLFB 5JD6A 4WXPA 1U2CA 1XCOA 3DCJA 5IC4A 1U8SA 3MMAB 1TYEB 2Z56B 1E7SA 1NV8A 4JI8F 1PBAA 4BNNA 2FPLA 1YB7A 1XDSA 4KYVA 4BWFB 1TC1A 2DY1A 3N2KB 1Y1PA 5HS6A 4LMAA 3WQPA 4REMA 2PWZA 3PR1A 5E3QA 3BMOB 1JA0A 2HCBA 1FFGA 3G9QA 3KQWA 2G7ZA 4OYMA 1SXIA 2G71A 3TAQA 4WX2B 4FHDA 5C18A 3PO4A 2VG6B 3RR2A 4N8NA 4I68A 2IY8A 4IDQA 1GPWB 2REXB 3ZNOA 1N6PA 2B34A 2YNMC 1Y6QA 1AXQA 1UKAA 1DQPA 2YMMA 1MJGA 1P9WA 2VQEJ 4U4AA 3TJAA 3H8YA 1MG5A 4XOUA 4KIUA 4G5OA 4YJHB 2OV3A 4DJBA 4XDCA 2V6FA 4PHTA 4URVR 3CJ5A 1ZX1A 2C2HA 2NUAA 1J06A 3N1UA 3A1WA 1ZC4A 3BE6A 5JS6A 3T9FA 2UXDB 4O1IA 3WLMA 1WF2A 1T3ZA 1RAEA 4DOMA 2L19A 1CU1A 4NBKA 2YYYA 1L7RA 1VQNS 4XGKA 1KPIA 1UOOA 3QY9A 2VPYB 3UYLA 5BMOA 4K46A 2OP1A 2YHIB 3N8NA 1FJCA 3OUTA 2HJGA 3ZGOA 1J0AA 1NUTA 4D3SA 2QTMA 1NBIA 3G2KA 1PGJA 1C5KA 2R8EA 3O2NA 1VRTA 4RU9A 5T67A 4UBLA 3ZS9A 3HLTA 4GX5A 1GGMA 1YBFA 1XFDA 1K5PA 2V2QA 2O3JA 3OY7A 3PXCX 5K8MA 3EPRA 2PS0A 2RK6A 1YCDA 3UXHA 3JQFC 2FOIA 2I3ZA 2GZ2A 5GOTA 4UCWA 4F25A 3QXXA 4QXPA 3ZU4A 4LDZA 4KXMA 2W6OA 1QHYA 2GASA 5DCUA 1RLIA 1MJHA 4KGDA 1SCNE 2QE6A 3N5BA 1FYXA 1ZA1B 2VAWA 4HXGA 2CFXA 3DNCA 2H1CA 4X62J 1KKMA 1UMDB 3DHVA 4RD4A 3MCTA 1A71A 1NE7A 1H05A 4PO3X 1QTMA 2C03A 3AHJA 5H9FJ 4KLNA 1FJEB 2XEXA 1ZMTA 4BLPA 2P2CA 3GUZA 2ZHAA 3LALA 4KB7A 4KDRA 2ZZMA 1OSNA 4YWJA 1NHUA 4NQRA 2YASA 2OGTA 4R2XA 3HSYA 4F6LA 1VQKS 4DX7A 1Z25A 4KGXA 2AYGA 1UWCA 2VQSA 2Q3BA 5DWVA 4USMA 3BWMA 2ATLA 3BMXA 4JQYA 1M5KC 3LPAA 2XUAA 4C89A 3VTZA 2OCBA 4NMXA 2F3UA 3SVTA 1RKXA 3KLPX 2ZITA 2W8LA 3NJ8A 5B1HA 2BF7A 4GZMA 3UJNA 1PJQA 1VE1A 2Q3HA 5E2QA 1LBHA 1T0HB 3W3AA 1ZKDA 3A3KA 3KUKA 4WYWA 2VP5A 3Q72A 1SXJD 3QVGA 1YQQA 1BLUA 1JJIA 2XRMA 4PZ0A 2ZH9A 1I3CA 2J0QA 5ICFA 3D2BA 1NX6A 3OTOB 4YJFB 1EJ0A 1QHGA 2WP0A 1LC3A 4WLUA 2IH4A 2CQHA 2EFEB 2ZIGA 1ONNA 3JD2A 2PX0A 2C2WA 1T4CA 1F3VA 1B3TA 3BQ1A 2XMAA 2FX5A 1ORWA 1UJCA 2O8FB 1PRYA 4I9NA 4KV7A 1PGNA 4LOLA 1V96A 2RCNA 2ZUVA 3R9IA 4ZDNA 5JXIA 2DNPA 3Q86A 4P5PA 1I7NA 4KR2A 2BI4A 2J5KA 1DHMA 5DDIP 2F40A 1U26A 3TTYA 3N4WA 4ZTUB 4DFPA 5BOVA 1N2SA 3L4EA 2I99A 2IUYA 3GLSA 1G4AE 4PQUB 3MA0A 4PSCA 1VP9A 2HLUA 3ZQUA 5CCBA 3VNVA 3Q12A 5CM2Z 1PT9A 1H94A 1XB2A 5KMGB 1JLFB 3QHPA 3KPWA 2ZI7A 3EWIA 3UKOA 2MY8A 3T1VA 3U7QB 2OEKA 3EQ7A 3NEYA 3W1YC 3PQEA 5FWDA 1KIAA 2UXDJ 4II7A 3ZC4A 4MMYB 4OAQA 3BEOA 1Z0IA 1ZZGA 1CETA 4CRWB 3EE6A 4RTPA 3HJNA 4EHHA 5CLLA 2AC7A 3ANNA 1JIKA 3OESA 1KBQA 4RVGA 1VDMA 1CQIA 3OAAD 2F4VB 1RT1A 4X95A 3IKTA 1FDWA 1K73T 4MGHA 5HUJA 4YP1A 2RGAA 4RDCA 3REQA 5KT3A 1IVZA 5KOXA 3GPIA 1AMOA 2WZCA 3CF4A 4RY0A 4L3KA 2GR9A 3U19A 2HHJA 3ISVA 4BMSA 3M8YA 4ZT6A 5JWHA 1JQDA 1KORA 2YKNA 2KI5A 1QH0A 3FC9A 2UYHA 1LXCA 3B3FA 2HU5A 1M7HA 2BGGA 1IWAA 4RK7A 4KGZA 1OSDA 4I2PA 1ICEA 2UVUA 3GPBA 4F9TA 3UH0A 1SEVA 5AVUA 3ZY6A 5BNFA 3E3OA 1DQAA 3TZXA 1UZHA 2GMHA 3PRJA 5LJ5Y 4DSZA 3O94A 2IS2A 2EARA 5BN4B 1JHXA 4DRXA 3T5HA 3CWCA 2UUBF 1W4ZA 1W76A 3R8YA 3MS2A 2BRUC 5IVKA 2ABYA 4C0AC 1UVMA 3IOEA 5L3RA 2CGEA 3E6AA 5FNVB 3SEZA 3ZC3A 3R6LB 4TV8B 3FUYA 3EX7B 4BJ1A 3W6NA 1JBQA 3DEYX 3LZ6A 5DNYB 3L5KA 3QFTA 5I4CA 2DGVA 3MMSA 1VIXA 5EJIA 3CEHA 4F7WA 4BX0A 4ZO7A 3AVPA 4RXUA 4A3SA 4UUQA 3NC1C 4DUPA 1G64A 2GHRA 3ILHA 4E13A 1LVGA 3WLPA 1VJQA 1R8YA 1HG1A 4WVLA 4F7VA 2ECFA 3LW5C 1E92A 3GUYA 3WSTA 1X9MA 1D09A 2GZMA 4YAJA 3DBIA 4KXLA 5C8YB 1S4QA 1UKYA 3JQGB 3UICA 3PYLA 5A9TA 1WCIB 5C3MA 4WNIA 1F17A 3P2EA 3HBLA 1DVRA 4RCYA 1NNUA 4KW7A 2ZI4A 1YVEI 4F45A 2ZZNA 4HB4A 4CO1A 1A4XA 4ZT3A 5I9TA 1IY8A 2I78A 3HH8A 2PVPA 3EXHA 1D5CA 3T7KA 1MO6A 5BQFA 3RRXA 4DQRA 2O5DA 3NGDA 3NATA 4AUNA 3OJSA 3MAGA 3E01B 4G65A 1MRNA 1ZEMA 2DD8S 3NLCA 5KYYA 1JDTA 4P92A 5AW7A 3HI9A 2WIFA 5KNLA 3C14C 4YCBA 3WYEA 4DDUA 1UXIA 2YL2A 4DLRA 4GOJA 3DXBA 2I4OA 1KQNA 2LQ9A 2PRYA 1BFUA 2F1JA 3KT6A 5CVDA 4GOXA 4DHEA 1NPYA 1DOAA 3CGWA 4FMDB 3D2WA 3CU5A 3M4XA 1PG0A 4IGEA 3JAMA 1CY6A 4HKQA 3R6TA 4OL8A 1BNCA 4A36A 1G66A 2CFTA 3MCAA 2X1HA 2G13A 3FBWA 2CNWD 2C1ZA 2CRLA 5HJEA 1OILA 2QXYA 4AAYA 4NF2A 4NXMJ 2JKVA 3IVCA 4JB0A 3FMWA 3L79A 2VF7A 2RI1A 3FOWA 4ZVSA 2H7CA 3VZCA 5HATA 3LCMA 4HQKA 2W9CB 2SICE 4W63A 3JCZA 1OYDA 1DIBA 4HGPA 2Z0MA 3CCTA 4F50A 1U47A 1H6BA 1DLIA 5KFOA 1YRWA 3TTTA 1TAQA 1QAXA 1Z15A 5GONA 1JT2A 4FHFA 3HLKA 4K5QA 4ZI7F 2PZLA 1GITA 4TMZA 2LCFA 4ZVHA 2JEJA 4D3GA 1WI6A 2H57A 4CKZA 1P5HA 5DM4A 1U9YA 2VCEA 4JGIA 1I0ZA 5LNK1 1KLMA 4RVNA 3Q1KA 1O94C 4S1PA 4BQIA 1ZI9A 5FOTA 2B7BB 2D7JA 2B6AB 1KI1A 2IZ5A 3GQVA 4MUKA 2HEGA 1PV4A 3ENAA 1JKIA 3OIGA 3AQ4A 4DMFA 3PUWA 1O6CA 4PHFA 3REFA 1OCEA 3RU3A 1WULS 3KJVA 4MHTA 3TNJA 5AI0A 1Y3JA 4Z9XA 1R8CA 2CYCA 1UDRA 1TCUA 4BNTA 5IT5A 4HATA 1IFXA 3NPAA 2QX9A 4ZHSA 5JSKA 4FX5A 1HBUA 5CD4A 3HBFA 2VDPB 4O2LA 5FI5A 4CKBA 4C0JA 3LQKA 3M82A 4I2VA 1RPTA 4Q39A 5JYDA 4QR1A 1T94A 2NSHA 1BQ3A 1UJ5A 1UM9B 3ZU3A 1Y5IB 4X20B 3ASVA 2CBZA 5C2JB 1E3IA 2HS0A 3CIMA 5EUCA 5A7GA 3SX0A 5CW2A 2EX4A 5AUPB 1UZMA 4RNNA 1P27B 3GR0A 5ITZA 3KVRA 4EKGA 2BEWA 3BXXA 3KZXA 3RS7A 1U0OC 1UJNA 1K4MA 2JAPA 1PWEA 5C42A 3FF4A 3H7HB 1CY0A 1E9FA 2IVMA 5EVCA 3PR5B 2FJVA 3JTOA 3MAAC 4GYYA 5F2KA 3N28A 3LDUA 3GA5A 4YRFA 1LQ2A 2F63A 2AUTA 4RGQA 2P9QA 4RFLA 3HNPA 3O5TB 1DCMA 1DCTA 1HDRA 4LR9A 1RQPA 4AJ4A 9ABPA 5D00A 4AJIA 4GR9A 1ABFA 3DMFA 3PL1A 1HURA 4MH0R 3F6SA 2BGNA 1DHRA 2IYFA 4CT8A 3P0EA 4B35A 1O95D 3HB5X 2XUFA 4IH6A 1RWNA 1SUPA 4BLWA 4EHAA 3UV3A 3QIDA 1WAMA 1DCKA 3H2BA 4DV0B 2UZ1A 3RS8A 4M3NA 2VPXA 2I2BA 3VV2B 3NXZA 2HBZB 2PKYX 3W2VA 2R6HA 1J0BA 2IJRA 2DIVA 3DZIA 1LBEA 6GPBA 1OYWA 5A0VA 5AJVB 5HVNA 1EFHA 3IE0A 5EIEA 2ZKUA 1YT5A 4KOAA 2RGWA 1CQNA 3WKCA 4KV8A 4TZKA 2Q4OA 2QLTA 2PX3A 3HJGA 1RC8A 5GV7A 2X41A 1JILA 2ENWA 2ZH1A 1SBNE 3ZJ4A 1KVRA 2BANA 3WHIA 1N2BA 1SHLA 3UI3A 4CNYA 1VDHA 1R3DA 2R1UA 2FR1A 4OK3A 5H81A 1K8QA 3A27A 1U0LA 4J9QA 5E0OA 4DQVA 5K0FA 3SEOA 1RTDA 4IHQA 4R98A 3VKVA 4OJQA 2WG2A 2PSHA 2JLCA 5KB3A 1TW2A 2W5UA 4WKCA 2Q8NA 3GR1A 1ZBDA 1KO4A 3RIGA 3OPKA 1VXRA 3MB5A 4DCOA 2GLXA 5ENDA 1D03A 1FKAF 4XGNA 4RABA 3KTFA 4FZJA 3EGEA 2QTZA 1H4SA 4UTRA 2GARA 4Y2MA 4CHTA 2PSJA 1TM5E 1XD8A 5HZGA 4G0MA 1FD8A 2C8LA 2J8SA 3GB0A 2AK3A 2K8GA 4USKA 4OHRA 1YB6A 4JGBA 5CH8A 4RKRA 2ORWA 2GFHA 2WVAA 5I47A 3ZV5A 1NQAO 3ET5A 5ERGB 3PFOA 2XNHA 3BREA 1CLUA 3TI0A 4OQDA 2MJNA 2XCIA 1BVRA 5CURA 2W43A 5C7OO 3RG6A 3DBOB 1ODSA 4OX8A 5CA1A 2Q9CA 2N47A 1OPIA 3OTQA 4Z53A 1WSBA 3D3JA 1RXUA 3L0SA 4OI3A 4JZKA 3TLEA 2A2CA 3FBFA 1C8KA 3NKLA 2ATXA 2ZJQQ 4D8TA 1Q53A 3W8NA 5HF9A 3M6WA 1S5PA 4ZK2A 3NHBA 2P0EA 3E9DA 4JI3B 1I2MA 1E6LA 3R77A 4IIJA 4Z0NA 3VAFA 4II2A 3D4IA 3PL5A 2CLSA 4L0DA 1UF9A 1TECE 3R7BB 3F7MA 3UJBA 5HMWA 2OORA 4HY3A 1L4LA 3U44B 4TKZA 5JUWA 3M83A 4BN0A 2GESA 4HFRA 4YP0A 4Z0PA 2OD7A 5LMCA 1KI8A 1MTOA 1V5FA 1FQKA 4F5ZA 5U9CA 4FU0A 4O3SA 2VDJA 3GU3A 4FKZA 1F3LA 1RT4A 1BJRE 4PPYA 4BS9A 2UZ0A 3EIFA 3PGMA 1XMXA 5DBHX 3THPA 2ZJFA 1TEZA 1N5QA 1TVMA 2VPIA 4Y9UA 5AJ3J 4Q9LA 1RBOB 1DC5A 3WI7A 3ELUA 3BSFA 1UBCA 2B20A 3FSXA 4OHUA 1NW4A 4AXJA 3LT0A 2BH2A 2OR3A 1KAOA 4MRMB 5G0SA 2YXLA 2FFJA 1NDKA 4DS4A 5I48A 5FO0A 1U28A 3CVKA 4A8XA 4NRUA 2F4FA 4GSKA 2H2DA 3QOXA 4GXTA 2JCGA 5HPYB 1YZFA 4ZIRB 2JGDA 3PF8A 3U31A 5C8VA 3C6YA 2ZATA 2E5LJ 1SKAA 1ZMOA 4ZMBA 5DLGA 3HCDA 2Y6UA 1CXZA 2Z2ZA 3B7PA 5K8LA 1U1MA 4FF4A 1LB1B 2QN2A 2LP4A 4XSVA 3ELYA 3NORA 1NONA 5YASA 4ETXA 3BIXA 3IN5A 2YKMA 2JARA 3B85A 1T11A 4RNDB 3FRYA 3UKDA 1QDUA 2HL6A 3K1JA 1S8AA 4B3HA 3RIEA 3WGLA 5DGCA 3A8JA 2M8HA 4YRPA 1WMAA 4ENUA 4L4SA 5TF4A 3WMXA 2ESRA 2WF5A 3G2OA 4C11A 1J07A 3WO0A 4GEGA 2YHAA 1VZ3A 2OGWA 4ES2A 1B26A 3F3KA 3TIXB 4B9VA 3ZQJA 3NGKA 1P1IA 1TYCA 3VR1A 4Q3NA 3D0KA 4FWIB 1KEEB 3UFXB 4JBNA 1E20A 2BW0A 4W98A 3L84A 4DNFA 1G9SA 4MULA 2WFMA 2VHCA 4IHJF 3C7TA 4GMDA 1D5WA 2IF0A 5DTJA 4DJAA 2Z04A 4QXOA 4N49A 2YY5A 1Z08A 5IU6A 2JJYA 4YCCA 3ZKWA 1S0NA 2V7QA 1QV9A 4WINA 4D3XA 1Q84A 4FYDA 5L1JA 1GR1A 3LUDA 5TQJA 2P6UA 2VDLB 3BQ2A 1I3MA 1FXUA 5KFWA 1UZDA 3J81k 2YCBA 3GGOA 5FQNA 3N01A 1EFVA 3O83A 1GARA 3GR6A 4CGZA 4NFYA 4V19X 1RWPB 2DFDA 3W2IA 2UZ3A 3K0CA 4IDEA 3NMAA 1PL6A 1FZQA 2C7QA 3D8RA 2NVUB 3GMSA 2JLUA 3G8QA 1CULB 1QU2A 5LXRA 1DV1A 4X44A 2CLIB 4TVBA 2FLWA 3DOLB 4YRGA 1SXPA 2R68A 5EWGA 1L3VA 2X1GA 1WA5A 1ZESA 3NAMA 4JIMA 1QBGA 2OO5A 4LF9B 5BSEA 4UNQA 1FFWB 3EK2A 4A8YA 2VQ3A 3WZLA 4H6XA 1FFGB 4HUJA 4WADA 2HFOA 1KKHA 3CO0S 4DEZA 2VDIA 3WJAA 3LH2S 2RHLA 3G8BA 4QICA 8RUCA 4G01B 4M38A 1VGVA 3R4CA 2GJ9A 1OBOA 2NO6A 4I99A 2JZCA 2GCPA 1XNRF 1SFRA 1WD6A 2JWNA 1Q0ZA 4NZPA 2CF6A 3T8YA 1QO0D 4ZVFA 4D41A 5DNVA 4KSEB 3ZCXA 5JAZA 2OBMA 3RKUA 2GK7A 4U0KA 2Z09A 5D3QA 2GBPA 6REQA 3UWKA 2LEPA 1CJBA 1PVOA 1ZPDA 3WDMA 5ETJA 5K6AC 3TOVA 3ABRB 5ESWA 2IM3A 5L4NA 4JKOA 2V4JA 4C7JA 2CLLB 4A82A 4DL7A 1B6GA 3OMXA 3QVMA 1NKCA 4POOA 3K35A 2C3PA 1QH1A 3NCRA 1PL0A 6NULA 2C9OA 4L9WA 3KE9A 1W48A 5CBPB 1JXMA 2WF8A 4LT6A 1WOYA 3HKDA 4TUYA 3U62A 1F0KA 1RE0A 4YV7A 4YCDA 4BMPB 5LBTA 4HNAA 3TJZA 3BDAA 4YBZA 3R2JA 1QUVA 5FTKA 3HVWA 4MDFA 3L9WA 5BO5A 1G2IA 2RBEA 3BWYA 4M88A 3U7QA 1V8ZA 2V8VA 2GMLA 2GJFA 4BKMA 2IY9A 1CYDA 3EWGA 2V3WA 1QZ3A 2ZJ6A 5AR1A 5J59A 2W2QP 4XYGA 4JBLA 3T9ZA 5DFAA 2PH7A 2BFBB 4ZQCB 1ULTA 4FZRA 1A1VA 1DJNA 4BV3A 1DEAA 1QK5A 5DLEA 1RCOB 3CLRD 4K81B 1P7CA 4WZMA 3N2YA 2WT4A 4RQTA 3DYVA 4JU9A 5IJXA 1VISA 4C0QC 4RMIA 2W9BB 2DYKA 1QCYA 1WXEA 2AFHB 1NBMD 3G2HA 1AGYA 2AOTB 4RW6A 1I3NA 3G17A 3S27A 5B0FA 5TV2A 1TL3B 3PEHA 1M2OA 3D1JA 3NHAA 2NO5A 5TPZD 4IOAQ 1AFJA 4XX0B 5AVQA 3GZNB 4L1KA 4JJAA 4ZJOA 1VFJA 2QT7A 2VFVA 3VVLA 4YPOA 4LXHA 2EP7A 3BWCA 1ISFA 1P4SA 5B36A 2V50A 1XN1A 4ZVUB 2ZE2B 1PZHA 1SRQA 2RE1A 3L40A 2IU3A 3K9QO 1L5GB 1I0IA 3P5TL 4FFWA 2PUFA 1IPHA 2YWJA 3THWB 1RYBA 1S5ZA 4QOEA 4HRXA 2YNGB 1P6TA 2RIJA 2KJVA 1FVHA 2Z2XA 1SM4A 3WVNA 1I4LD 3IUSA 3LHIA 1H73A 2V8OA 2CMKA 1KKLA 3DKIA 1JYFA 1S3GA 1DRWA 1QFSA 4EY7A 1TKRA 2I7XA 3RV4A 4PCAA 5FO1A 3UPTA 2VBGA 2QNBA 1BWVA 2AA3A 1PYGA 2CXRA 3OKFA 4AQ7A 2GUWA 2WHOA 3RHFA 3SS8A 3UMFA 5IZ4A 1L4GA 4LTDA 1W0KA 2H85A 3CZ4A 1CS4A 1JI0A 2AN4A 1RADB 2ADOA 3TUZC 1KMMA 3B5IA 5A2GA 2IZZA 4DFMA 2MSKA 5JU6A 1P6XA 3ICWA 4JI4B 1Z9BA 1BX1A 3WICA 3X2SA 3ZX5A 5K20B 4R8VA 1S1UB 1CUWA 2O1XA 2EFCB 4JB8B 4F11A 3PTLA 2O3TA 1C8BA 2VJVA 4DDMA 4HDMB 4B76A 2E1RA 3KOUA 4UEJA 4GI2A 2Z2IA 2Z3VA 3QWAA 4ISCA 1I4OA 4PYQA 2DTXA 4MZDA 5E3JA 2JFOA 1CRZA 2H48A 2BYTA 2X22A 5K14A 4TYMA 3S70A 1XKQA 3EVDA 5IDXA 2JLQA 3NS7A 2FH5B 4NXMF 4JV5F 1N34B 2F8TA 3RRFA 5FIIA 5A71A 3RYCA 2EDCA 3W34A 3L46A 4YRIA 1PZMA 1MB9A 3HFKA 2WUEA 3OPNA 3I23A 3G2PA 3IUQA 2COEA 1PUIA 1T5OA 2Z4SA 2CNKA 4LSMA 5BV1A 5IHPA 5THQA 3UCZP 1V2HE 2Q46A 1Y00A 3OPYI 5CH3A 3V6DA 4QWAA 3QK7A 5FFMA 3M32A 1R8PA 3QLVC 2PV7A 4GOOD 3QE2A 3E01A 3EDMA 4PNZA 3ITHA 4P72A 3IQFA 4G97A 3E8SA 5KHLB 3WNZA 4CMBA 2ATVA 2PWBA 1MJNA 1YBUA 2DXEA 4H7HA 2IM2A 5AW1A 1WABA 1J5EF 3H11A 2HWXA 1Y48E 3IPXA 1P7YA 2HRZA 3ZKAA 2KBFA 2JC1A 1TO2E 2WTAA 2QQ5A 4Y2IA 1KK2A 3K5MA 2CK3D 4WASA 3ZIAA 1BDJA 1J99A 3HXQA 2H9YA 2RD5C 4QA9A 2G9NA 1X70A 1U6JA 3MMXA 1I2BA 2QAIA 3QO9A 4MVJE 4BRZA 1P17A 1ADCA 3TCXB 3IC1A 2GAGC 3HZGA 5JSHA 3GEMA 4NXNJ 2PYDA 4PYOA 4M1EA 1S10A 3UYKA 4JP2A 2BKOA 2J7WA 3KK1B 1T8EA 1Q4RA 5U4XA 4BP3A 3A8TA 2JHAA 4DE5A 4V0SA 3MR6A 4HJRA 2O59A 1J9GA 4GR4A 5IUKC 2JHEA 2CNDA 3ZCPA 1TMGE 5KFKA 4QGSA 4G0XA 1ORRA 3DW3X 2FDNA 2ZP1A 4NMLA 4A6XA 1U0HB 1POWA 3ZTSA 1OFUX 5HQ8A 4JYMA 3FVWA 5JW6A 1BA3A 4A6EA 3PLRA 3CNQS 2FQWA 2DGDA 4NX9A 2FKNA 5JUMA 1E3SA 4JL5A 3VU9A 2Y68A 3FSRA 3OR1A 4BO2A 4UBMA 1I2AA 2R44A 4J0IA 1N6OA 3MMNA 2QLXA 1B99A 2DJIA 5CFRA 2J46A 3BJIC 3LTEA 2OXCA 2V1UA 2R8XA 3D1HA 2OD6A 4FMDF 1VIVA 2HMVA 4B6GA 3H3XA 4FPIA 3GJSB 2EFYA 3US5A 2PBLA 2Z6VA 3ZI0A 3QRQA 3MEDB 4IDCA 5KTQA 1RBMA 4H08A 3T0IA 5K5MA 4LDNA 5BYAA 2FCAA 4TRNA 5A2QU 4RTMA 4RTRA 2B37A 4J9LA 1BMQA 2XMCA 3L9XA 5KBYA 4LBIA 2FPOA 3I6MA 2QYSA 2REQB 5DETA 3EVTA 5DIZA 4I50B 1ZS9A 4YQYA 5B7PA 5THKA 1RMTA 2HJ9A 3BB3A 4PAOA 2MGZB 3P2MA 1IQTA 1YOBA 3JVDA 2ZB4A 4S0XA 3I01M 2YWXA 1JYSA 4KO0B 1FXWF 3HBMA 1A5ZA 3C3MA 1YHZA 5KFLA 4E5VA 4DR2F 4YXWD 2TMGA 1E96A 2DHAA 1QLHA 5KYUB 2H9ZA 3EZXA 4B7CA 1LDYA 3QA3E 5ALPA 1ZETA 3ZWOA 5D6GA 1J2EA 2I4RA 2AF6A 2FETA 2UXCF 3ESYA 4GT1A 2ZDHA 4N5LA 3ZGXA 3RWBA 3ORHA 3LA6A 4ZVLA 2IOQA 2J76E 2G0TA 4DZDA 3TANA 2XOEA 3KCQA 4NLLA 4HLBA 5B53A 1KY2A 5BN4A 3D3NA 3PFHA 1P1RA 3DM9B 1HYQA 5J2UA 2RJ3A 4WKGA 4ZAXA 4BAGA 1W0KD 4F3RA 4UUXA 1F1JA 4Y6GB 1MHPA 5HDQA 4LY9A 1M5SA 3H9GA 5HBRA 4FW9A 1SUIA 5FORA 1UDXA 3D6AA 2NUAB 1QG4A 1VRWA 4A6PA 3ZZYA 1GPKA 5E6RB 1KSJA 2F3QA 3I01A 4TN2A 3QTBA 4DJTA 4D3YA 1QSLA 2WJGA 4F2WA 4EFAC 1PGZA 5CYPA 1I14A 4QPJC 4L16A 3L0ZA 3VSEA 4KV8B 1PZGA 2HCJB 1DQNA 4G07A 1HM5A 1PHRA 3DLLQ 4PCQA 4R7TA 5JWRA 3CKYA 4DR4B 4DV4B 3HR4A 4ZDKA 2HF2A 3RWMB 3DKVA 2RC6A 2JVOA 3RREA 5ITVA 3STVA 2H52A 1JAHA 1M3SA 3ZZRA 4B1FA 5I7EA 4N82A 4P73A 3EIHA 2N82B 1JKFA 4HEA6 5BXIA 2FPUA 3ZJYA 5CEEA 2AXPA 5IJWA 5JMOA 3J7ZT 1RJFA 4HOYA 2YCLA 4E2YA 2XSZA 2LR0A 3PQ2A 4DLXA 3E61A 2VIHA 1BCSB 3PUJA 1U24A 5EP1A 3GJTB 3MEKA 3KHRA 2FLOA 5EWJB 3DPUA 2OLJA 3FDXA 5KVQA 1G7CB 1W1IA 4YJ2F 4ZDWA 1VE3A 4E5MA 4ED5A 2D1RA 3DKPA 1GQOA 1H2XA 3MTKA 3K15A 4YCJA 3EXHC 2EZ8A 4RWWA 1XWWA 4R5PB 3GHHA 2ZE8A 2D3WA 2NT3A 3DBLB 1IBSA 4WN9A 2BQ3A 1XP5A 2IV3A 1FP4B 2KT5A 1OIVA 2D5AA 1K7SN 1QC5A 3V34A 3IGVA 3G7NA 1B2LA 1AF7A 3CLVA 2G5CA 2GHQA 3RAGA 4M22A 3ROTA 4S1TA 2YIMA 2EC2A 5J2PB 2W71A 3GP9A 4GOKA 3WLQA 2XCRB 3G8CA 4LKOA 3GA7A 5K3BA 2QV6A 3CC2S 4YRDA 3W61A 1RWMA 2PAFA 3LRXA 5A2QY 2ZRFA 5E9JA 5SZTA 1JB9A 3QUTA 3DKKA 3A6PC 5C7PA 1K6IA 1E1NA 4JBWA 1EMDA 2FRDA 1IN6A 1YB1A 2GBIA 2XB9A 1WXQA 1XNQB 3UNXA 5BXQC 1OASA 2ROGA 2IUFA 5KTSA 2YNFB 2W0MA 2PTHA 1U90A 3K16A 3RIHA 4A1FA 3GCXA 2H2HA 1KR5A 2B4PA 2HA6A 4OD0A 1F6DA 4A8FA 4KH0A 4R69A 3S6EA 1UXJA 1SBZA 2B99A 3PYDA 1B43A 2CLOB 3ZEAA 2FLNA 3W5XA 4ZQIA 4DXDA 2JAWA 4Y2PA 4GPD1 2SNIE 3HXOA 3H8JA 3OLQA 2LA4A 3BKWA 3P0FA 1OKKD 2OWEA 4I4IA 3OQ1A 5ELLA 3E3AA 5AMXA 3JSYA 3IP5A 4A8QA 4NYIQ 3W62A 3ER9A 3I0NA 4PM4A 1ZH6A 1F3OA 3N3BC 4LYGA 3UB4A 5FTWA 1JA9A 1JG6A 2BELA 4EL0A 1YQHA 2HJRA 3LUKA 4Q16A 3AB2B 4MV9A 5TMDA 4UQTA 3NCHA 2QTHA 2A9QA 3REOA 1XMOF 5D0HA 3L3BA 2UUTA <