1LK5A

Structure of the d-ribose-5-phosphate isomerase from pyrococcus horikoshii
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
229
structure length
229
Chain Sequence
MNVEEMKKIAAKEALKFIEDDMVIGLGTGSTTAYFIKLLGEKLKRGEISDIVGVPTSYQAKLLAIEHDIPIASLDQVDAIDVAVDGADEVDPNLNLIKGRGAALTMEKIIEYRAGTFIVLVDERKLVDYLCQKMPVPIEVIPQAWKAIIEELSIFNAKAELRMGVNKDGPVITDNGNFIIDAKFPRIDDPLDMEIELNTIPGVIENGIFADIADIVIVGTREGVKKLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A hyperthermostable D-ribose-5-phosphate isomerase from Pyrococcus horikoshii characterization and three-dimensional structure.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Isomerase
molecule keywords D-Ribose-5-Phosphate Isomerase
total genus 76
structure length 229
sequence length 229
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2002-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lk5A02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lk5A01
5FIIA 3DC2A 1UJ6A 1YBAA 3W7BA 2NYIA 2LQJA 4GMKA 5IT0A 2JOQA 3K5PA 1JT9A 1NE7A 1UJ4A 2JHEA 1FS5A 3TUJC 2QSWA 4GO5X 3DHWC 2W48A 4TM8A 2ZHOA 3MWBA 3NWPA 4X84A 3BXFA 3OBIA 2RE1A 2BKVA 2DT9A 1M0SA 4TM7A 2R5FA 4OQQA 3BXEA 3AB4B 3LUYA 3TX2A 3NRBA 2OKGA 2H9ZA 1PSDA 4R9NA 3CSSA 2P9EA 3E15A 1FQOA 2O0MA 1CD5A 3UW1A 2J0EA 3LWDA 3KV1A 2CDQA 3OC6A 4LUBA 1O8BA 5IT4A 3IBWA 2J0WA 3AB2B 2RI1A 3DHXA 2RQKA 3P96A 3ENWA 4L50A 2I9SA 3EFBA 4L5IA 1PBTA 3OFGA 3BXHA 5T41A 4IO1A 4M8LA 4R7TA 5HJ5A 1Y7PA 1YGYA 3DDNA 2PC6A 3KWMA 3ENQA 2J0XA 3TUZC 3OFFA 3IXQA 3E7FA 1ZPVA 2RQMA 1UJ5A 4L5JA 3AAWB 4OQPA 3U7JA 3CEDA 3TUIC 2LVWA 3MAHA 1U8SA 3N0VA 2F1FA 4GO7X 3ENVA 1HOTA 3NZEA 1HORA 3HHEA 3L7OA 1VL1A 2DTJA 5JJBA 4L51A 1FSFA 1LKZA 2P9CA 3OFEA 3BXGA 3LHIA 2KO1A 2RI0A 3OFHA 1LK5A 1RWUA 2P9GA 3ICOA 2QRRA 3EB9A 3MTJA 3O1LA 4PWUA 4GO1A 2WU1A 2QMWA 3S1TA 1FRZA 1KS2A 2BKXA 2F8MA 4L4ZA 1LK7A 3LOUA 1FS6A 4L4YA 3CH7A 2MDAA 1SC6A 2FGCA 4NMLA 2QMXA 5IS2A 3HN6A 2PA3A 1XTZA 1Y89A 2GNPA 1DEAA
chains in the Genus database with same CATH superfamily
5EMNA 4WF9Q 2A1TS 2X40A 4M6WA 1JEQA 4JLBA 2QSWA 2Y0SD 1D2NA 4EUEA 1GQYA 1P81A 4FGKA 3BHNA 4G0QA 2VCHA 3PYLA 2M6LA 1DEHA 5IM0B 3WG9A 3CB2A 1IQ0A 4Q48A 4NONA 1G5QA 1NXXA 4N0QA 4C6TA 4RBUA 5LOVB 4LOJA 1D04A 4CLKA 2VT2A 1GZ7A 4KQ2A 1MROA 1W4LA 3PFOA 1KZ9A 1KO7A 1QOZA 3O92A 1OXVA 3AONB 4LSWA 1L5KA 2BH9A 4CGZA 3L8HA 4C2BA 1A5AB 3FPFA 5D4PA 3SM3A 5B3AA 2Y0CA 3ZWDA 3A32A 3KXKA 2ZSBA 5JFOA 2ZRNA 1S2MA 2ODNA 4Z4CA 2G1PA 3M9OB 4PWUA 4M0DA 3NBPA 3WB9A 2VOJA 4A2QA 5ALVA 5C42B 3SSOA 1T24A 2C9YA 1SQSA 1OLXB 3WB1A 4ENSA 2OCIA 3OTEA 1D2CA 4WWSA 1HO3A 1ZOPA 2LMIA 2XNHA 1QFSA 4DM7A 4QM7A 3KJXA 5IWCA 4R54A 2IA6A 5ED0A 1EEHA 3QYAA 2CD9A 4FGZA 2VD3A 1YJXA 3O1JC 3PNMA 2C1ZA 1E1RD 4B6PA 4LHSA 1N92A 2J0QD 3V1NA 4MPPA 3V8BA 1RPZA 3PEEA 5K2MA 1C3LA 1WBBA 4GMHA 2PSZA 2B7BA 3ZWYA 4E03A 3C6XA 2C9ZA 2QX6A 3HSJA 1WEXA 2GN0A 2CFTA 4Z3OA 4D6YA 3D3JA 1RVV1 1M83A 3UJBA 1V37A 1XZNA 5T8KA 2FN8A 2OCAA 5LJ3Y 3A3YA 1LJUA 1OC4A 1NV9A 4I69A 4H3VA 1GTG1 4E94A 1GGKA 3BJRA 5JFGA 3F6EX 5EEGA 4XB1A 4MR7A 2BQ3A 4R2IA 5KNLA 4HGYA 5F0UA 2IUEA 1KY5A 4H1WA 5CA0F 3PEWA 1T8EA 1Q79A 4Y7CA 1K6JA 2XB6A 4DR1J 2ZZKA 1QU3A 5C80A 2KL8A 4RW8B 2I4OA 1JT9A 2FPOA 1Q83A 5HEKA 4G1PA 4S1TA 2CDNA 3F90A 5IV3A 1S48A 5HF5A 3R9XA 1XCMA 4LR7A 2YN2A 2OK8A 1C1CA 4L4RA 5H70A 1RGVA 4X5OA 3TKAA 3GD5A 4LN1A 4LBWA 2CE2X 5MGNA 3GRCA 1OXBB 5AM1A 4NV0A 4BTVA 1ZQ1A 4LDQA 2IX3A 3OO0A 3G8SA 1C9JA 1Z5WA 4RHFA 2VQEB 1H9AA 2V6IA 3KEFA 2REXB 2B4KA 5A9SA 1SUAA 3KTDA 4EPXA 2O6LA 3VHRA 1QIGA 2J9CA 3GLIA 3MM4A 2R00C 1KE2A 2HDWA 3KPUA 3OJOA 2CPZA 3DMDA 4BRUA 1WAMA 5BWBA 1I13A 1H2RS 3E2EA 4PR3A 1J2YA 3OVSA 2JJ8A 1SL2A 1UZHA 2BFAA 4ECRA 1OKKD 4ZVTA 1SAYA 3D8HA 1D09B 3BE6A 3IP3A 1F51E 2IOHA 1D6SA 4UMFA 4EF6A 5TPZA 2Z9DA 3LG2A 1QYDA 4OM8A 4BV3A 3RASA 4FS8A 1IUJA 1XDDA 3B7PA 1CC8A 4CN8A 3WB0A 2ZXUA 1NQUA 1MJ5A 3R3YA 1Y8RA 3DLHA 1Q78A 1COZA 3C3YA 1AUOA 2A9KA 3RTCA 1Y3BE 4AZSA 3JQMA 1QBGA 4IXWA 2DB1A 3OC6A 1SCAA 2EEPA 3TNJA 3N2NA 7REQB 3GEGA 4RTKA 1RISA 1J24A 2G36A 2FK8A 3ZV5A 1NFQA 4I1YA 5EE1A 1HDEA 2ZI4A 2G0CA 3ZZ1A 3PUZA 3ENNA 2CEAA 1Q0TA 4MWGA 1NW3A 2VQFF 2RHMA 4KXUA 4ZJYA 3FYDA 4CQMB 4HMPA 1LSOA 1NIJA 3PGJA 2VFUA 1NASA 3CCBA 2OGWA 1OQAA 4EQZA 2BHNA 2EZTA 1G9XA 3IA0A 2WM3A 3VH4A 3VR3A 1ULRA 2BKXA 1DC4A 4IYRA 3EPJA 3PX6A 4RJJA 3IGFA 2D7CA 2AS0A 3OE1A 4CDNA 4C89A 1K8QA 3UOWA 3TQSA 2ZVSA 1L5FA 1PBNA 4MYHA 2XB8A 3ZWPA 1OX6A 1UODA 2Z1NA 1RXWA 3SEOA 2XJ9A 3BVPA 5CXXA 3F7MA 1BCRB 3RSCA 2K3IA 4WPAA 4RORA 5HRCA 3N5CA 5SY9A 4RPHA 3IQFA 4OYZA 2QE7D 4UDYX 3AY6A 3FSGD 3MBKA 421PA 2J3KA 5E9QA 4OXRA 2OMLA 2BDUA 4QEKA 3C8MA 3N87A 4D9CA 4JI6B 3G2JA 3NGKA 4PO8A 4FFLA 2EI5A 3NUQA 5E1DA 2GRJA 1K8ZB 3CIMA 3H0PA 1UP6A 5K0BA 5KQLA 2TMKA 1B64A 4UAGA 4BLTA 1NJXA 2DRBA 3B51X 2PSHA 5E6RA 1J5OA 4Q44A 4WOCA 4EK2A 4DRXA 3ZFVA 4QA9A 2HGZA 4I56A 5G53C 5AUQA 1JWBB 4HB4A 5D00A 5TC4A 1QUEA 1DTTB 1RHQA 2EYQA 2EZ9A 1OLUB 4R0NA 3GNTA 1JFSA 1A9NB 5JXHA 1X0PA 4PRKA 3C8HA 3ZJUA 3V2UA 1RTTA 4P92A 4Y9SA 3W5BA 1Z82A 1Y8QB 2COKA 2Q9CA 1MIHA 2MMGA 4ZCIA 2VHEA 3K5MA 5EPOA 2EZ4A 3R7DA 5ALMA 1CZUA 1NGSA 4DV5F 2H9YA 2QTBA 3LRPA 3E05A 3BSCA 4FGUA 3RUDA 3W7AA 1FPQA 2FRDA 4BIIA 2E1AA 1PAEX 4JU8A 4XPIA 4DS5A 4Y2IA 4G4JA 2BTEA 4N5NA 5CHYA 1XRSB 1XELA 4YBZA 1BVRA 4XUCA 3C4VA 4A8JC 3FETA 3SX0A 1RJEA 1F1BB 1N8TA 1BFDA 2JHAA 3CPWR 3NG8A 4YRCA 1D6NA 2YMLA 5IZCC 1LPNA 4AMYA 1RWOB 4QTXA 1XTPA 3L8MA 4HB2A 4QPPA 3S2EA 3RVOA 5JVDA 1PT7A 1EVJA 1QANA 4URXR 3IIJA 3ZH9B 5D3MA 4OLOA 4Q4HB 4Q12A 3WGIA 4XH9B 5K6AC 2ODQA 2IYOA 4KPEC 4P4UA 3OP1A 3NWEA 4HWRA 1GCOA 4DEZA 1L3UA 5IPFA 4MPDA 1K9MT 1DJNA 3FOAA 4QFDA 4NJEB 2LD4A 2I2FA 2WVDA 5DM6Q 5IUKC 3TL2A 4MVXA 1EFRD 2Q6LA 1NSAA 4YGXB 3CWQA 4X71A 3BR9A 3WLJA 2I6GA 2QLBB 3UQZA 3CD0A 5CD4A 3LBIA 1SBHA 2F1OA 3KG1A 4P4SA 4Q7KA 1Y7TA 2CHGA 4IZOA 4S12A 2GCFA 1Y6JA 4XRGA 2IYLD 2VH5R 3OP4A 3BAZA 3UKDA 4MHOA 3JD1A 4UC0A 4LWPA 4Q1BA 4QEDA 1TZ0A 2WP0A 1FDSA 1Y8RB 2E37A 1IN5A 3O4VA 4O3NA 1K3TA 1RS0A 2JATA 5HGJA 2VPXB 3PSAA 4TN5A 1J09A 2ADCA 3E48A 4GYWA 1WOPA 2HFSA 1SOAA 2IIBA 1GPWB 4LV8B 2O7NA 4E14A 3KKZA 3K9CA 2MY8A 5BSKA 1N1DA 3ZEIA 4BS2A 3L1IA 1K0VA 4KB5A 5LWQA 2I6SA 2AN9A 2IXTA 5BVHB 5J1PA 4ZDNA 3G2LA 2V6AA 4AYXA 4OZ3A 3B3AA 3NUGA 4GE3A 4EEKA 4MUBA 4B9UA 4GX0A 3P2KA 2F4VJ 4IO1A 2MJUA 2DT8A 3DE6X 2RGGA 1E5DA 2AEMA 5CX1A 4DSOA 1XTSA 1E2UA 3C6UA 4NYZA 1LRJA 4WCFC 5FNVA 4FP9A 2FW8A 4EKIA 1HOTA 1JAYA 4FDVA 4MCIA 1WKCA 1CLFA 1E3IA 5I3ZA 2NXWA 1N6RA 4YECA 3EDRB 3Q3HA 3O4JA 4C8YA 1TK9A 3AQPA 1FUKA 4TMTA 3MVEA 4FOPA 4G37A 3MECA 5M34A 4G09A 4RHYA 1E2NA 5IBRA 1CQIA 3IAM6 3V6DB 1GUBA 1RAHA 3T7JA 1NF3A 1TM5E 2DR9A 1VQYA 1X1QA 4ZD6A 4XXHA 4C9DA 1GPMA 1IZZA 2IJGX 3NJ8A 1ZJ4A 2E29A 2Y3IA 2HS3A 2PHZA 2NU7B 3EGDA 4NLSA 5EFZA 2F65A 1LWEA 1ADGA 2CXOA 5F2KA 3RAMA 2HBRA 3NHZA 1WG4A 3M8QA 4C6HA 2C2KA 4W5JA 2LRHA 3EXFB 1S9HA 4F8EA 3TW6A 8RUCA 4EENA 1Z4QA 3D7SB 3LQVA 4CRWB 1R0BA 3BMXA 3VVLA 3SSQA 4DDUA 1S6QA 4O25A 3T1YB 5M2RA 1L5QA 1S59A 5D0HA 4IIHA 1YHYA 2FQXA 3P52A 2C5LA 3KETA 3DYVA 3DEAA 3D6JA 1MGPA 1RW4A 2BFFA 4FHFA 1HR0F 1T36B 1S1VB 2ZVDA 2ZRPA 1FOEB 1QAXA 1YBTA 2QUHA 4RMIA 4CT0A 3M4YA 1KVJA 1UT6A 4D43A 2G4LA 2K5UA 4EA7A 4A48A 4RW7B 1PT6A 3JZFA 2GNPA 2HYDA 1KK3A 4H77A 4CG1A 2Q1LA 1YWGO 3ITHB 1WY7A 3MQFA 3HI6A 2J45A 4FZ5A 5GY7A 1AK1A 2DT9A 1PR3A 1MNQA 1RM0A 3TAPA 4HS4A 3O9ZA 1CVIA 4G1QA 2N3ZA 3QWPA 4QX6A 1B23P 2EKBA 4H7PA 4D3ZA 1C0EA 4BEWA 3VQSA 4R1NA 1Y82A 3IUYA 5BRJA 1W5EA 4DV6B 4TU8A 4NLPA 1J23A 4QQFA 4Q0MA 5JAMA 1NT4A 5C24B 5FBZA 2B2CA 2UYQA 4AKTA 4NLLA 2Q29A 1WTCA 4I8IA 5AXNA 2GHQA 3RSQA 3PEYA 2PD4A 4K5SA 4MR7B 4B4DA 3AKYA 4TY8B 3HWRA 4L4SA 2PJUA 2EBEA 4K4YA 3QFRA 4YRJA 3DE3X 1QQTA 2VK2A 2A7QA 4FYYB 2VDPB 2WYOA 1JLLA 2BA9A 1G63A 2J46A 3IP1A 3IR7A 3V81A 3GIKA 3CZMA 4UDXX 3CA8A 4J6FA 4I8DA 4RZQA 2FTKE 5ALOA 2CVPA 1PJ3A 2XT0A 5B57C 3HFRA 5HPYB 3ZDXB 4CXMA 4EVQA 4DUYF 1TUWA 3DM2B 3W5SA 4OMFG 4G2TA 1FRNA 1FQOA 4ECUA 1IHUA 4PLZA 4BFWA 1LPMA 4ZLJA 3U27A 4MYCA 3VU8A 1QFZA 1VGQA 2HBZB 1VCTA 1VQ9S 1GKYA 5GGYA 1UC5B 2PV7A 5HP1B 4MP3A 4ANDA 2ASVA 2QK4A 4C76A 4TQUS 2ZT8A 3BCUA 3H99A 3TCKA 4YRTA 3WX4A 2E6UX 4GX2A 3SC2A 4EJMA 2CWXA 3C87A 4ZIRA 2OEPA 3K9NA 1SV5B 2ROEA 2VJVA 1XWWA 5CFQA 2DNNA 2GN4A 4YHHJ 4GP7A 1GSIA 2XNDA 5D0GA 1SUQA 2FFJA 4X1KB 4NJMB 2I29A 4D4KA 1IULA 2OO5C 4G4IA 5BYSA 3BE5A 3AUKA 3L7AA 4C6AA 1A71A 3G02A 2W37A 4G97A 4WK6A 3TUJC 2C98A 4R68A 1QE5A 2XITA 4X64B 5CB8A 2ZVIA 4RJLA 4JOSA 2V98A 1W9HA 4IQ4A 2AGQA 2CNDA 4L8FA 2R7VA 3KPVA 4IV5A 4LNAA 4U00A 1NLKL 4USWA 2D2VA 4UD2A 1WC4A 3QVWA 4CM8B 1L7AA 3L46A 2HG4A 5IJAA 1RLJA 1E6EA 1GDHA 3VVMA 3BCRA 4ZVSA 1WV0A 4I50B 2O7QA 4MKVA 2ECPA 4TV9F 3O5TB 3ASVA 4Z1OA 3H4MA 3P49B 3LP0A 1WKLA 3FNGA 2XQKA 4YMLA 3QFHA 4O4IB 4FCWA 2OY0A 2HPHA 1D0SA 3M3HA 4QGFA 2NZ4A 2QM7A 4QQRA 2PX6A 1NSPA 2G9RA 3QBCA 1ZAXA 5KTPA 1CJSA 2ZI5A 4W5HA 2O3TA 2PCLA 4DN0A 5C2CA 2IGTA 4U7GA 2BW0A 4BZQA 4V1Ak 2OPQA 2XD4A 1EZ1A 4MIBA 1S1UB 5JTTA 3P9PA 1I1NA 3R5JB 5EIFA 3PGVA 2PVPA 5F35A 1WMEA 1W9MA 1LW6E 3F47A 3L7PA 1SCBA 1KMQA 3N8GA 1FNDA 2ZB2A 4JROA 2FN7A 3PC4A 3RK0A 1YB7A 4OHBA 1UM8A 2F3PA 1GJRA 1GNLA 2N46A 1YRBA 4XX0B 2WUWE 4L16A 2PFDA 4B9LA 6Q21A 1U24A 3CCTA 2J3QA 2AA3A 1KEEB 3IDQA 4MVJH 5EIBD 4YJ3B 1VG0B 3Q8PB 2I3AA 4CLDA 3QBDA 4O2BB 4R0VA 1T2AA 3PY8A 3OKAA 2WQ7A 3CCVS 2IXAA 1M1UA 1J8MF 4R2KA 2HNDA 2LCQA 5DIFA 3PRBA 1XNQJ 1UQTA 1TL3B 3FZNA 1DKLA 4YMSA 5AOCA 3AOCA 2HF2A 5A0YB 4H4MB 3ACDA 1PUXA 4FFPA 4AT1A 2Y68A 3WWYA 4ILLA 2VF8A 2OPPB 1S4MA 4PQAA 2ZIGA 5BPFA 4KRGA 3U3MA 1RP5A 4URQU 2OH2A 3AUTA 1RWNA 5CFMA 4ZK2A 3CDUA 3EXYA 1JDZA 2VK1A 1F7VA 4OHWA 2WD8A 2F17A 3V48A 1IN7A 1GPYA 4CW7A 2JBWA 4RDXA 1NYRA 5FF9A 4BJHB 5IARA 2ZOFA 3RT9A 2DWUA 4PXDA 3QFSA 4V1CI 4LBHA 3KYIB 3GSDA 1WB9A 1M2GA 4D96A 3QI7A 3NRBA 4QOSA 3BKXA 3PJEA 1GQFA 1JR3A 1MAAA 2IEBA 1HQ2A 5GMOA 4R7TA 4LK3A 3THXA 3I2HA 2R6JA 2XYHB 3VZQA 1VKNA 1QF9A 2ZUAA 1RAAB 5D1NA 1KFJB 1LZKA 4OB8A 3H2UB 1CF4A 5U4XA 3E6AA 2Y2UA 1FJGB 5F0WA 5CAEB 1ZVQA 3SV4A 3MLAA 4QOGA 2ASLA 3DXSX 4BKOA 3VYUB 2FUCA 4FR2A 1PJAA 2BGLA 5F2OA 3GVPA 3HB7A 4KI7A 5BSTA 4F4FA 3NWGA 1M1GA 3LAKA 3G2MA 1CSEE 1JYFA 3HM2A 1LDNA 4JODA 3NVKI 1CBUA 1VLLA 2WJZB 1L3TA 4OK6A 1M74A 2QA2A 4I68A 5CG1A 2XVMA 1XHLA 4DDFA 5H9EK 1GG8A 3GPDG 5TMBA 2FGKA 5JPDA 1D8ZA 4QW9A 3UD4P 1GY8A 3D3EA 5EMLA 4AXXA 4MIYA 1EKRA 3ROEA 2GMWA 2JFZA 4H31A 2J0EA 2MR6A 3FM9A 4EPTA 2C00A 4DQLA 2BJ9A 2O1XA 3JZMA 1G21E 2C1XA 3T1HF 1BE6A 3R41A 3KJNB 3PFKA 3TQTA 1CTQA 2H1HA 3WZMA 4CLEA 1LQ9A 3QX3A 4ZVRA 4W8HA 3GP9A 4WK3A 2O8CA 1KQ3A 3IAFA 5D8HB 1JIHA 2V7UA 2DHQA 3L7OA 3ICWA 1Y00A 2H48B 1ADFA 4PZDA 1JL3A 2FJDB 3A6ZA 4LJSA 4AYBD 2VFAA 3GJ7A 4BGEA 2XT9A 3QEOA 3K0FB 3GEEA 4JXZA 4ZQFA 2P3QA 3C6TA 2UXDJ 4KRXA 4X41A 3VKUA 4ED8A 1UZNA 1NVFA 2WKWA 1J0BA 3T5JA 2O2ZA 4LKRA 2LEAA 2LEBA 2TMGA 1QK3A 4DZRA 3OL8A 2Z98A 3U37A 2F4NA 1SN7A 1BH2A 2PU5A 3DKRA 3FHTA 1Y1SA 2O8CB 2P9JA 3L41A 1Q19A 3KJZA 1XMQB 5K8PA 2XAUA 2CNWD 1XEWY 3KS9A 3LIIA 1SBTA 4PSVA 1X1DA 2J5RA 3ZO7A 1TAHA 3KP1A 3IO3A 1E9BA 1K4KA 3MZ0A 4XVUA 3JYTB 2ZE5A 3CF6R 3G0IA 3AVYA 4OHMA 3D3WA 3PXEA 2CVOA 1GXTA 4TLLB 3K7EA 1ZTWA 5K8NA 2R8RA 2B4OA 3DYAB 2HT6A 2GVDA 4A91A 4NBWA 3ISTA 3ZXXA 1M75A 1WD7A 2UUTA 2ZRAA 1JDNA 2DC1A 1N2BA 2Q5QA 3C74A 3I8OA 2GCOA 3CVYA 1EFAA 3OI7A 1P5JA 3B6IA 4X3OA 3VKHA 1WNTA 2AUMA 2PYIA 3D1QA 3P0HA 2Z6UA 3ULKA 4N6GA 4RNOA 2W7AA 4U7PB 5DF1A 2DGQA 3C48A 2ZYGA 5G0RB 5DGXA 2WJGA 1T1EA 2QRVB 2MKKA 2EFOA 4GNKA 1VIYA 1LBSA 3OA2A 1TGYA 3RTDA 4Q9LA 4ED9A 1YOVB 2NYRA 2OP1A 5LQSA 3FGPA 3IQDB 2V0NA 3DOKB 4IFEA 3TUZC 5AKXA 4QJIA 1B15A 3U9TA 1FFSA 3DJYA 1NN1A 1UA0A 3H1GA 4I5FA 4DDTA 3M4ZA 5JC8A 1ZD8A 4MKHA 4B4UA 1HNIB 1IN4A 3KXIA 2WHPA 2QP9X 1S72S 4Q7MB 4Q4AA 3GCWP 1YQXA 1VIDA 3ELWA 1NMSA 3UMCA 2BTQA 1UZDA 2ATEA 4GO1A 4PG8A 4RPKA 2TRSB 3AEKB 4XYGA 4OFXA 3U4IA 4OFBA 2R4QA 5BSGA 4UZBA 2EEZA 2ACKA 3TTWA 3EWSA 3LGNA 1UPBA 5AM3A 5B2FA 4HGZA 1XTRA 4B1FA 3FZEA 4DCGA 2ZE2B 4QYZJ 1DQNA 3I56S 1SVNA 1C8KA 3OT5A 5M3BA 3V1MA 4JGBA 4LF2A 5HMMA 2C3PA 5IHPA 3Q6IA 5HIKA 4RZ2A 1U2QA 3EK2A 2XRMA 2O2IA 4P3XA 2SECE 3S55A 2BGGA 4MKXA 1C0IA 2Z09A 4P4SB 5JDCC 5K99A 4TWRA 1WUYA 4MRMB 1Q1BA 4BEVA 1A8UA 4F67A 4QR2A 1NJ1A 1XXHB 1T5DX 3W2IA 1W6RA 1A3CA 1NK4A 2MQQA 4E31A 5AJ3F 3OIUA 2WWTA 2BD0A 3PE3A 4YXFA 3UA4A 1QO7A 4IQMA 4FMDB 1YJTA 3VR5D 1C2YA 3UPFA 3NHKA 4MVCA 4R40A 1HL6A 2FFHA 2ZQZA 3FLMA 2ZH7A 3K4HA 4M1WA 1BQNA 3P8ZA 3CVXA 4BMDA 5DM7Q 4U63A 4DUZJ 3MHYA 3NASA 5DM1A 1FIUA 1MAWA 5K20B 4YLEA 1O5TA 4FYDA 1TKAA 2LFVA 2IY7A 3ELYA 1ABBA 4X8HA 5HMZA 1K5DA 2YW9A 2PMHA 2B0JA 4H7FA 3DE2X 2FA9A 4WRRA 3E8MA 5B0BA 4BLWA 1V45E 3EW9A 5FOSA 3C3AA 1EHWA 3JXOA 4ANFA 2WE7A 3BS4A 3JQ6A 1QTNB 1FX0B 5ERXA 5G0WA 3IBTA 1JDVA 3CKYA 1RU2A 2ZQYA 3NB0A 4DUTA 4USTA 2DHGA 3HB9A 4PQEA 1XDZA 2B8JA 5HI7A 1K8RA 3EXHC 2AOUB 1VGVA 1WCV1 4EY4A 2FFQA 3WVNA 2ZATA 2LBPA 4DV7J 4XGKA 1VYVA 3OLAA 1TU0A 3LQ4A 5K20A 4WNYA 1ZJYA 1X9IA 1DU4A 4HN2A 2AVNA 2PY6A 3D1LA 1GLVA 4B5LA 2JFQA 2WIAA 4I3HA 1JX4A 4O59O 4XX1A 1D9ZA 3QRPA 4YDDB 3M6VA 3ZZZA 2RGAA 3EVNA 4CV0A 2YMQA 1X4AA 1T0BA 1G5IA 1NSFA 4YQFA 5G2OA 3F8TA 4MHSA 1YK0A 1N5IA 1Z33A 2V5AA 2L82A 4WLEA 4IFTA 4Z54A 2XGJA 2AOUA 2NZCA 4B80A 4WDRA 1VJ5A 2JEGA 5KFMA 4Z2XA 4MK4A 1UWCA 3Q3IA 3RS7A 4I67A 2R751 7REQA 1LLFA 4AVYA 2B1QA 2RG7A 3N2KA 3WGHA 4GI7A 1Y6QA 3EPIA 3OIYA 4CLZA 5CH8A 4DA6A 2P5YA 1LK0A 2QVZX 2W4PA 2ZAMA 5T3UA 1WZNA 4DSKA 1V71A 4DLBA 1OILA 4E22A 3BN7A 5ETTA 1W1IA 3DOJA 5CR9A 1EZZB 4QTTB 3PCTA 1N56A 3FDFA 2H9IA 5KTQA 3DL7A 4CLOB 2O50A 2AF4C 2F67A 4P84A 4TS3A 4UEWA 5ILOA 4DZDA 3TRFA 3H59A 1ZOSA 4BUCA 3GIDA 1WVIA 4YAIA 4QZVA 3T7TA 2H2GA 4EFDA 3UT0A 3U40A 3ZTQA 4G67A 5E3IA 1U2RA 1XYVA 4JOUA 1UBCA 2JAWA 2MJLA 3O3OB 1D4ZA 1CZOA 1BMFD 5IS2A 1EX7A 1JSXA 4GG1A 3BF7A 5JYEA 4WSOA 4JLVA 4NDNE 2ZETA 4EM6A 2OG1A 3GLIE 2PD1A 2Y9MB 3EOBI 5DCLA 3QGHA 1U28C 4JLOA 2HEIA 3DDIA 1IBCB 1C9MA 4P7KA 2V6MA 1O95C 2N1MA 3EGEA 1T6ZA 4Y2UA 5JG7A 1PILA 3WYEA 2XI4A 3G85A 2GBLA 4TMYA 5DO9A 1S2DA 1WABA 3AF4A 4BWMA 4OHFA 1JLMA 1FDVA 1T3OA 3VSBA 3B6BA 2FVCA 5M5BA 2RKWA 4PLCA 4MV5A 2BZSA 4D8YA 1S1VA 4IJUA 1U8CB 3I5CA 4FI3C 2XGGA 3V7NA 5JHGB 2RB4A 2XWJI 4XUEA 1CIVA 2JF0A 2G9UA 4S1VA 3RD5A 2DPJA 3DAPA 3FWNA 2IRWA 3OZAA 3VGPA 1QHIA 4G5GA 4CCYA 3LPNA 4BLVA 1GQ2A 3M82A 4X93A 4DLLA 4O3PA 4TY9A 1RU1A 1WU7A 1NBIA 3BUSA 2VH7A 4K4XA 1G5TA 3O6QA 3KWFA 2J3MA 3DEKA 2N7CA 4L22A 3A9WA 1J90A 1F5NA 3CUWA 3H5TA 5I7OA 1SXQA 1IKVB 2F1RA 1TL4A 1YJ8A 3NCPA 1FS4A 3M34A 3VM6A 1A9SA 1YB4A 1S1XA 3IQHX 2ZROA 2VQDA 4JI4B 1OY9A 3C1AA 2ECQA 2W2KB 1U1RA 3QY0A 2DR8A 4KIAA 3ABRB 2ZH8A 4JL6A 3RB6A 5L9XA 3PFIA 5EFOA 2AOTB 3KSAC 1BX1A 3OPQA 5JARA 1H42A 1SWVA 3ZWVA 4KSCA 1NW8A 3DCJA 3G4SS 4RK4A 5KTNA 1T03A 2FEWB 2VRBA 5DO2A 4DSJA 2WONB 4O3SA 1O08A 4M8LA 2PWYA 4U8HA 1K1QA 2W42A 4WKPA 1WUTA 1GK8A 2OEJA 1NY5A 4F0MA 1M72A 1B00A 5JISA 1VG1A 4ZJPA 2DBQA 4HADA 1K44A 4JKIA 4R84A 4F5ZA 1CDEA 2B6NA 3TOVA 5KFNA 3JSXA 4FT4A 2YJGA 3E8XA 4DCNA 1P5FA 3ODPA 3NFYA 5FWXB 3JWHA 1W2WB 2VPIA 5BSVA 3IAM1 1J0EA 2CC2A 4CEHB 2GM5A 4US1R 4ITVA 4OYXA 2ASYA 4LF4F 4ZHQF 5K8OA 2HGMA 3EJWA 3TXAA 2Y8EA 4ZEVA 5B1IA 1YBAA 4N7JA 3UK0A 1FS5A 3UHFA 1EARA 4GPAA 3DXYA 3IM8A 3VXKA 2HQBA 1XJWA 1VB3A 2EG9A 2O66A 4F5YA 1THMA 2CNLB 4LHXA 4IO0A 4E4TA 4JVOA 3Q9UA 2GYVA 2JW5A 3W2EA 3OFKA 2XS5A 2VYQA 4KO2S 4MPTA 4HNTA 2C9OA 5HSPA 1KZ7B 3B70A 2GD0A 2VNJA 2Z4SA 1KP3A 1NIPA 3LA8A 3CR7A 1P4RA 2CUKA 4ZMSA 3RC1A 2PL1A 4PU0A 3DNCA 2QN7A 4X90A 2J9DE 2ZZTA 5DXAA 2XUKA 1NVUQ 4U96A 2YC4C 1KS9A 4YAKA 5EGSA 1Z45A 1AQ6A 1WBJB 4ARZB 4IS2A 1N52B 4QE3A 1DBDA 1V4VA 1BRTA 2QL6A 1KVRA 1AKVA 3TQ1A 1USVA 4MJKA 3JARA 4LECA 1X42A 3FD8A 2RI0A 4J7XA 3RRNA 3DOCA 3O1IC 2AH5A 4ZYZA 1DIRA 3KQHA 1H6BA 2Q2OA 4R2WA 3N7UA 2G28A 2OCKA 3EUEA 3H9CA 3PDNA 4YUDA 4DG1A 2W4MA 2CQ3A 1NDPA 4ISBA 4KE5A 1G6BA 4BC7A 5HCNA 1HL7A 3DUFA 4CI0B 4LZOA 1JDBB 1V1MA 2AI2A 1EWTA 1WDMA 1R0CA 4RWXA 1Z07A 2ZJ1A 1XROA 3CPEA 2IKQA 2Z58B 1WF2A 3T9AA 1EXWA 4B85A 5A5VA 2Z8QA 3MGCA 3C6BA 1EGAA 1NXOA 1VCNA 4IWYA 1ZOLA 2K06A 2CGEA 2NZWA 2FZKA 2BUAA 3NGTA 3KZ1E 1N5DA 3AR8A 1FMFA 2B3TA 3BE8A 4JBWA 2CPDA 2UXBF 4ISCA 4FZ3A 2K7FA 2N3OA 1FP1D 4DKXA 2X1MA 2Q79A 3VSCA 2E1RA 2QJTA 4CKXA 1RABA 2PS1A 2A6OA 3WXMA 5DXJA 3U39A 4B7ZA 5BW4A 4QIEA 4KZKA 1U5BB 3OPKA 4KAXA 1WDTA 4B4WA 1CR2A 1Q3TA 3T0GA 1FDWA 1DC6A 1OASA 4RYDA 4ZP8A 4FEAA 4NZNA 5HRUA 4PZZA 1HG0A 2M6SA 3IDFA 4E5PA 2VPWB 3GCXP 4QXAA 3NBFA 2G07A 2XTAA 1BDJA 4TUYB 2YQ0A 3V9AA 5HSGA 4MW4A 4ANCA 1JTFA 3DGPA 1MTOA 5HJ2A 4MUYA 3P94A 1M8PA 1ZAYA 1OW3B 2SXLA 1CJCA 4FK8A 5EY5B 3ONEA 3O8QB 3M7VA 4XTTA 4ZI7B 4UQGA 1Q17A 1X60A 3V6HA 2WJVA 2JIQA 3K15A 1N2GA 4Z9BA 4OI4A 4OLJA 3FJOA 2I4LA 3ZV3A 4IUCS 5K6AA 4Q47A 3BTSA 4IMJB 1QU2A 4B3OA 5ESRA 1V1JA 2AFVA 2QM8A 4JI5F 2W6MA 3KKLA 2YJ4A 1FXUA 4Q45A 3DKDA 1WQ3A 1VLYA 2X0NA 3Q2IA 4BLGA 3FNRA 4YA6A 2OB1A 3RAEC 2B7BB 2C22A 3T35A 1U1NA 4F06A 2BFFB 1FVOA 4WTYA 4U9IS 2W1BA 1HTWA 2Q5JA 4CETA 3FX2A 3H8SA 3OZXA 1HBMB 3FWYA 2JIOA 3Q88A 2WIKA 3RRBA 4DTCA 1H3NA 1SC4A 1GFWA 1S2IA 3IQXA 3FGOA 1QIMA 4IDOA 2DH6A 3WLFA 3HJRA 1Q95G 2XWQA 3CC8A 2Z30B 3MIZA 4J4BA 4AFNA 3GMSA 5EP3A 5HIAA 3MCTA 2ZJBA 3G89A 4BVFA 4TYQA 2RKIB 1FZTA 4JJ4A 4MW1A 3EIOA 4IJVA 4N0PA 1OUMA 1GTVA 1DL5A 4U5QA 2HWWA 3PCOB 3IV9A 2CKWA 3H42B 3Q5GA 3G9ZA 2WSYB 4EG1A 5A2QY 1Z7GA 3NPMA 4WDQA 2ZRQA 2B5JB 1GWNA 5HJ5A 1FNMA 1Y34E 5KMGB 2VNSA 4UOCA 5KTRA 4JLKA 1HBMA 1DPGA 3V3TA 1GNRA 4AWAA 3KDNA 4TTJA 3T4XA 3RUHA 2SCUA 4GC5A 5K1ZA 1W0CA 2VC1A 5AT1A 2QP4A 5FLXY 1S2NA 3TIVA 3NMAA 3TZWA 3HY6A 1A6LA 2VDHA 4A6PA 5HK9A 4S1PA 1ZK4A 2GFQA 3QWFA 4P2GA 1R8BA 3ZQ4A 4CMCA 3GGGA 3U1BA 2BF4A 3U62A 2R5WA 1X7WB 4PM4A 4AUEA 3OUUA 5JH7B 4RSMA 1XALA 4U2DA 3NBKA 3UH1A 3ZHSA 1W1WA 2Y1RI 4R25A 2OM2A 3G9UA 1LFDB 1MJGM 1AKNA 3WWDA 3NEAA 1SOWA 3SXUA 2NT3A 4IUYA 2XWXA 3F6BX 1RT3B 1C1CB 1S10A 1AB6A 2WU8A 4ID8A 4YR2A 1QJCA 1T9XA 3ETHA 1WL8A 4ZVLA 1RWWB 1A7GE 1V6AA 1N88A 1U2CA 5IK2D 4ZMRA 2WM2A 3KK0A 4LXUA 3BIFA 4DQQA 1ZNQO 5E9AA 1OSNA 1WW8A 2K8GA 2JVOA 4DWJA 4F0JA 4O4LB 1M8GA 1KI1A 3E5MA 4BGIA 3MWEA 1CZRA 1F2GA 4UTOA 4DV2B 4Q2MA 1I7QB 3CVVA 3RDPA 5EE3A 5DJBA 1N5MA 2YNIA 3UDEA 5EWLB 1J4AA 5TJ9A 1NJSA 1ZGCA 4IKOA 4AICA 5ITSA 1QTRA 3MECB 2X5XA 3ROXA 3ZTRA 1A2QA 4DR5F 2YWXA 1P0MA 1OLSB 2YNMA 3HVHA 4ZHSA 5HF9A 5HAOA 1WBDA 2M98A 3DLGB 3FTEA 4U8VA 3TOZA 4OA8A 3WZ2A 1M3SA 5IP5A 1ZGJA 3GG2A 2R8HA 4YRNA 4JT4A 3OZTA 3Q9SA 5A9TA 4PNEA 3QSIA 1UDWA 2XUQA 9ATCA 5KYWA 1GRVA 4UBLA 3UJHA 4BWVA 4LFAJ 3A4MA 4DPOA 3ZLTA 5DJ5A 1SCKA 4HH1A 3OTGA 3K9GA 1A1VA 1SXGA 1WXEA 2RGYA 4O2LA 1NVBA 1A77A 4TLQA 3EZYA 5DLGA 2P2NA 4NU0A 1BUXA 2YQ3A 4BE9A 3JQGB 5D84A 1PS9A 2QLBA 4O4RA 3RAXA 4X1YA 1XJ0A 2XB2A 4Q3DA 4LF7B 2RQMA 4AO6A 3IMEA 3DLIA 5KQRA 5KO2A 5ETVA 2I2YA 2CLMB 1HA3A 3KUEA 4YI5A 3TMKA 3DDOA 3JQBA 5C7PA 1JHMA 1Z2NX 2P5UA 1WXXA 2GUWA 3QZUA 4WBXC 4PTLA 1SZJG 1LTHR 1VHQA 4IG3B 1G19A 5CDFA 1C9KA 2BMFA 3WFZA 1SUSA 3A10A 3CD7A 4YRBA 2XBLA 3ZHUA 3FAKA 1MB3A 2AD9A 2OIHA 1NQ5A 1X87A 8ABPA 1WF6A 1ZEJA 3FTDA 3DTNA 1EB9A 2E4XA 2UXDB 3P9XA 2HHJA 3DRPA 1SHKA 4BYGA 3P1JA 3LLMA 3TX2A 2HIHA 4GYJA 4BNIA 4UNQA 3HCXA 2HZCA 1B76A 5IFMA 4ED6A 1NB7A 2M1ZA 5EZ6B 3IV7A 1OYWA 3FHOA 1IXZA 3OFGA 3PUIA 4HTJA 1NMZA 1BWEA 3ZY3A 2R84A 5F7OA 2FPRA 4FOOA 1X31C 1VQ8S 2YYAA 1TCAA 4DHWA 2AJ4A 1E89A 2QWXA 5JQWA 4UUBA 4AO8A 3RK1A 2V58A 5GMDA 2OO5A 1QRTA 4F8RA 2FEXA 4M0EA 1L7EA 4L8WB 4P3PA 3IB6A 1XTTA 3W65A 1F8UA 2PQ6A 5BYJA 2X6QA 3ESXA 1B74A 1FB5A 1IJFA 5IOLA 3K2YA 1KAEA 4DR1F 4RSHA 1Y3JA 3CONA 5ER9A 4FMBB 3M0EA 1IZ9A 3LLUA 5KREA 4YY3B 3LBAA 2QBYA 2SKDA 4FX2A 2HAEA 2PXHA 5FADA 4X62B 1ZEMA 3TAMA 1UP4A 5K03A 2HS4A 5CD9A 1L3BA 5CLFA 2CLEB 5J2PA 3ZE9A 2A5JA 1RJJA 3DVLA 4EL0A 1JRLA 5KC8A 4R9NA 2ZNYA 2QJRA 1U8YA 3CRZA 1ZIDA 4TMWA 4OYPA 4DR7F 3BZUA 5KSPA 3DU5A 1FKPB 4B48A 1USWA 4MAKA 4CMHA 4LREA 4Y6OA 1Y9EA 4AB1A 5F2EA 2Z4TA 3TLMA 4CMIB 1P18A 3WTBA 1KETA 3GAAA 1PQWA 1AF7A 4EELA 4A36A 4L5BA 3QKRB 4CPDA 1P7YA 2D5LA 4M88A 3ZD9A 2IA0A 4XIIA 3RIGA 3ROTA 3OE4A 3ZIAA 2F1KA 2JX2A 3EF0A 3LBHA 3CNHA 5ULLA 3L1KA 5CTAA 2PX2A 5TMDA 3HCPA 4P6QA 4ETXA 3MFHA 2V7QA 4RMHA 4PYDA 4PW0A 3ZE1B 1Q74A 3DDCA 1RYZA 1OJ7A 5JVDB 3WWZA 4MCAA 4Y0VA 4E2XA 3TWOA 5J2QB 1W59A 3L8CA 1QS0B 3F96A 4OHUA 3WGZA 4YQWA 4IRXA 4IIEA 2ZYVX 3T95A 3LWMA 2PKQP 2PZMA 1KF0A 3JWEA 3DF7A 5DLEA 5ALSA 2IBMA 3PIDA 1NNSA 2AKEA 2PX0A 5EC8A 4R81A 3F5QA 5AUNB 3QZ8A 2OAUA 4ZVSB 1VBZA 1Y4ZA 4FSHA 3HCEA 3IN5A 3QWAA 1Z0UA 1W29A 2JCXA 5KYGA 4RF2A 3MGBA 4ZA1A 5JXSA 2L0XA 3PA8A 1A72A 4XOIA 2PMFA 4B9MA 3V8NA 2KS6A 3U7JA 4E6EA 1CVJA 3GRRA 1NWHA 2OBBA 5TGZA 1KRXA 2J4FA 4GKJB 1SXHA 4K6OA 2IF2A 4IH1A 3GJTB 1UBUS 3TO8A 1SA0B 2Y67A 5KVAA 2BOVA 4YRLA 1X7HA 2WU1A 4RM3A 5AJVB 2NXCA 2PH7A 3H90A 3TS1A 1YSJA 3PKZA 1SVOA 2DCUB 1PG0A 3HBFA 4L0QA 1X7VA 3QPCA 1T2EA 3QNWA 4Q18A 3PPVA 4NCGB 3L0YA 4ZO9A 4BRSA 2WSSD 5E2AA 3RVBA 3NWBA 1KYWA 3ILOA 1FDAA 3JYPA 2OPBA 4RADA 4BASA 4I46A 5DYNA 3S40A 4XA8A 5I8PA 2YKNB 3UJ8A 2FJVA 2DLDA 3C6YA 3QPBA 3P8BB 4CMGA 4KQ9A 3IO5A 5BN1A 4TLBA 3UBMA 4R0MA 2DLNA 1U1CA 3AMVA 2OELA 4S0ZA 4S0XA 2OILA 5EQDA 4QCLA 4G1VA 1JBQA 1LI5A 3R23A 2WF8A 5IBPA 4BECA 2EFQA 4XVRA 1VE1A 1IEVA 2GM3A 1L4HA 4P2BA 5FNZA 5CHEA 1FSFA 4HL6A 1B1CA 1IWAA 1VRUA 4XD7A 1T1JA 1IEWA 3TG8A 1NDCA 4XYEA 1F3VA 3PGXA 2ZAOA 5IF9A 4N5LA 1OTYA 4ZVEA 4DV4F 3LPAA 1KP2A 2IZZA 3L95X 1JLKA 4NIMA 3N5FA 4L8VA 2FLNA 5D6GA 3MMSA 5B12A 3RE1A 4K1LA 1GPKA 4MTLA 1M76A 4C11B 2PPVA 2NSHA 1X1TA 4ER0A 3S2FA 5DI9A 1J9ZA 4KKVA 3LC1O 2YBDA 1DQPA 3SQWA 1T2VA 4FHEA 5D6OA 4BVJA 1IVSA 3U7QB 1J99A 3HULA 2V7GA 1YGYA 5KDDA 3VHQA 2JC1A 4ZT5A 3VR4A 2WAXA 4TWIA 1JA0A 4KFUA 2UZ0A 5DSTA 2G82A 4UT4A 4B2LA 2GVZB 3K5HA 3UZUA 2K2WA 4OGGA 1UKYA 5A5FA 3KZMA 2J9DA 1S89A 4BQEA 2KSQA 2GGPB 4ED3A 3CUVA 1PDVA 3CUUA 1QE1B 2H2DA 4V0KA 1KAGA 4K9LA 2IEZA 2B4PA 2QS9A 1LXNA 1QO0A 5H16A 1XU4A 3MXTA 4N9WA 3IC5A 4IOKA 4MX8A 1QO9A 4UMDA 1DG3A 3K58A 1G64A 1V9CA 4BFUA 1VJRA 5TX7A 3JU3A 2HK8A 4QWMA 5A9RA 5IM4A 3EGVA 4N6OA 2PEHA 1Z74A 4J0QA 5CZXA 3VFDA 1Z68A 4RUCA 5LT5A 3CSSA 1MQ9A 5IJXA 4CM3A 3W8PA 3BRSA 1KWMA 4X7MA 1NSYA 2V65A 5HL7Q 3BKFA 1Z3IX 2QIOA 1JVNA 1QCYA 3OG9A 1ZGZA 4KXXA 1W34A 4C22A 2BCJQ 1ELOA 1S7GA 4WKYA 1NH7A 2VP6A 2CBXA 2RBKA 5B53A 4UF4A 2R7XA 3PHLA 5BR4A 4RELA 4ZYYA 2F43B 1VYTA 3OTIA 1Z7YA 1Y42X 1GRNA 2ZBCA 3E23A 1U99A 3B6EA 5FPQA 1IE3A 4LZJA 2HSWA 3FWPA 2QT7A 2D54A 2P6PA 4JD5A 5KVCA 5FQNA 2F55A 3AG5A 5IXSA 5L7WA 1YJ7A 1DT5A 2ZTUA 5I3QA 1KZ4A 2QX4A 3FBBA 1RIFA 1LPPA 3ZUGA 3IMFA 2LW7A 3EZ7A 3VV3A 2YV5A 2CJPA 3SGLA 1P27B 2W6JA 1F9AA 2Z3ZA 5EX3A 2OI2A 3CM0A 1II8B 4F72A 3MWJA 4X1KA 4L5CA 3SFZA 1W93A 2ZSDA 5C5CA 4AJHA 4FS2A 4DSAA 2IDEA 2B2NA 3S3TA 1NP7A 1IAVA 5BQXA 1X3SA 3ABOB 5DG9A 3M1LA 1X7ZB 3RR7A 5HFJA 2Y1OA 4KPUB 3JATB 1T03B 4DM4A 5C8VA 3AJRA 1LW2B 2QW1A 5JDCA 3DLTA 3L1JA 4DNOA 4W92B 1CNFA 5U1PA 4RL1A 2XCPA 2PE8A 4EBDA 2MIIA 3CMES 2XDWA 2XRYA 4B9EA 4AD8A 2PANA 5EUCA 3AYXB 3BMOA 3DD5A 4RZUA 1NW6A 4PNPA 1ISJA 4IV8A 4TWZA 1C8BA 2RK4A 1I94B 3U4QB 1WPGA 4R7ZA 5GMKa 1G20E 5LP6B 4L28A 4F8YA 4OUDA 4RANA 1Q50A 4YMTA 5KQMA 3QJGA 1Y9ZA 3OW2R 4C7XA 3C5VA 2E5WA 4BFYA 2H18A 5IN4A 5CQGA 4X66J 2WVJA 4JDPA 4LSLA 1M1ZA 1HURA 2LLZA 1EE1A 2OQIA 3CXUA 1U0HB 2IAJB 3GV8B 3HJBA 3KR2A 2QL9A 4K4ZA 3UUWA 4IX9A 3KFXA 4HMOA 1C1XA 4XQCA 1K4MA 1FP4A 3N58A 4C2AA 1ILWA 1FP6A 4YOEA 3P32A 1OH8A 2CVFA 3OQIA 1I32A 1IHYA 3EVDA 1LXJA 1T3ZA 4NBLA 4H7KA 3CY6A 1TQ4A 3E84A 1UVLA 1LB1B 4M9ZA 1OFUA 1Z0AA 1H2UX 5DEOA 3HHLB 2VWGA 5CFZA 3VPHA 3UMGA 2IEYA 4JI3B 1RD4A 4WOJA 1JEJA 3G87A 3OJSA 5TQ2A 1NJ6A 1HQYE 1R16A 1HI8A 2QRUA 3D8UA 2YWRA 1JXVA 4MWBA 5SYAA 4QICA 3QIPB 4NYIR 3H0EA 2XZWA 5FNVF 4QELA 1X4EA 1U4BA 3KLGA 1SOUA 4LF5J 4OYRA 2QL7A 1QPBA 2XMPA 3RU0A 2R6FA 1YJ9S 3AFNA 3ZD8A 4X44A 1GXSA 3W1VA 1U1GA 2IDLA 4YT8A 1V1RB 3TYXA 2V9PA 3W9YA 1GQOA 3MPOA 3LKDA 1XPJA 1RQ0A 5CBPA 2PU7A 3R97A 1ITZA 1BOOA 1DKMA 1W7WA 3UDCA 4BVKA 4NAVA 4IIXA 2QFJA 1OT5A 3LUGA 1YDLA 2VJYA 4B31A 1OXSC 3PM9A 3R6TA 4J1TC 4TKVB 1Q4RA 1AM4D 1QZTA 1EVZA 3DL2A 3SYNA 1R8PA 2XMAA 4ZO6A 2WY2D 2F3RA 4HAIA 1ZD4A 3UYLA 1Z4MA 3A9SA 3AUUA 2QPLA 4QGSA 4NH0A 5EQFA 4XLTA 1Z4LA 4N54A 3Q8WA 4XGQA 4DLXA 3AVUA 1YS7A 5KFGA 1WZUA 3D0KA 1E79A 3QLHB 1GILA 5C35A 3A7DA 4NYOA 1UK9A 4IDFA 4LWOA 1ENYA 1DURA 2M2IA 1C9EA 3DI6B 4ZKAA 4H15A 1FFHA 5FOTA 4Y28C 4WZBB 3O5AA 4CKYA 2A0YA 2ZT5A 4DBZA 1Z83A 2JAPA 3H84A 1KK1A 2VQ6A 1XMOB 3SIRA 5HOQA 4JN6B 4E5VA 1EGMB 3FYUC 1OHHA 3LQ2A 5EJ9A 2QORA 1CLUA 3EQ2A 1M34B 5FUBA 4A0HA 4C08A 2F59A 4YAUA 2O8VA 2PFFB 2YWKA 3CJTA 2XBPA 5LP1A 2E4UA 1W2GA 3O2SB 2ZG6A 1JNZB 4IG4A 4HQ0A 2ID7A 4D5EA 3KK3B 1ZZEA 1TO1E 4IDKA 1TMOA 4GICA 6NULA 1C1HA 3EF3A 4OATA 1P9WA 3MWEB 4WZBA 1TM7E 3EEBA 3Q8UA 5KFJA 4IGEA 2C7QA 3P2JA 1HNZB 2O3SA 3FSJX 3O7WA 5EKXA 2IIQA 4DAOA 1HIYA 2OE2A 3L7UA 2FGOA 3RKUA 4FWTA 1MQSA 2BZGA 4CLPA 1HQUB 5EP4A 3E5RA 4Y6QA 2DZDA 4DR6F 5DP2A 3GUYA 3LCJA 2ZYHA 1SUFA 1KY4A 5BN3B 1F0NA 3IWXA 1N3LA 1YRAA 2KHCA 4ZEWA 3AKDA 2B4RO 4FXWA 2DPLA 4NS1A 4EKYA 1UF9A 4P9SA 2Y6UA 4NOJA 5H3CA 1CJTB 3MOIA 4HC4A 2FX2A 3F1KA 3WGOA 2XWBF 3B82A 3X2EA 3P9RA 1SVDA 1AT1A 4DG8A 1URNA 3TRIA 1KMIY 3G5MA 2Q6KA 5ITVA 3TLKA 1H2HA 2KMLA 4C0AC 1NHKL 4YP3A 1FLDA 3M4JA 2PV0A 1Y1PA 3CVUA 1T8TA 2XOKD 3BB4A 3PQ8A 3SIWA 2JPDA 3X1MA 1PRYA 5KSYA 4W5TA 5B37A 1Q3KA 4RX1A 4UXJA 1Z0FA 1LWCA 5EZYA 1GX6A 3P9QA 2ZWAA 1U8SA 1U6IA 3V32A 3PXUA 5BWNA 1YC5A 1DFIA 1DAHA 3JQKA 1FFWA 4YP7A 1D2MA 4QTUB 821PA 4DQVA 1VIAA 2QOEA 5H0IA 2YDYA 3EZ2A 1Y3IA 6AT1A 3VR5H 1PEYA 2UYYA 4U1RA 3QVGA 4D0LB 1R0ZA 1AK9A 2VR1A 3EUNA 2CQ0A 2FPPA 3I9V9 3V7FA 3ZX4A 4CIVA 1NI4A 1KE1A 2WI8A 1XMOF 2CT8A 1UMDA 5TE9A 2Z58A 1E32A 5SZKB 2VDOB 2JL1A 4CG0A 4U7UD 1ZPWX 1VJQA 5AI6A 4DIOA 4QOFA 4MB0A 2HQ1A 1ESZA 1QHNA 1UMCB 5KOHB 2QRLA 4CO1A 2DTDA 3ONFA 3OZIA 3TM4A 1EP2B 4GI3A 1KYIA 4FZRA 4DV3J 5TXGA 1LWEB 4CMJA 3ZZ0A 4X24A 2V4QA 4WE3A 2MKJA 1R0LA 1ABEA 5B1DA 5CEEA 2M5YA 4AQYJ 1IXRC 2QEQA 3D8RA 3D3KA 1OH6A 2X15A 3BQMB 2JIZA 4GT1A 2ZYAA 2LXNA 1PG2A 3N2ZB 3GUZA 2CUZA 4NL5A 4HQ6A 2QVXX 2J6BA 2VHYA 4MT1A 5C8YA 4P22A 4PYIA 2VP4A 5WRFA 4IY1A 1SXLA 2VBCA 4OPMA 1NZAA 2A1UB 3ND8A 1ESDA 4ID9A 3RT7A 3A25A 4NBTA 2H54B 4TUYA 1G8SA 1U94A 4RNCA 3JQFC 3UJ7A 2U1AA 3H87A 4H1TA 4CO0A 1QGYA 2L9DA 1XVIA 3VGJA 3REQA 3A1DA 4V0MA 4OJ1A 1EHIA 2I5JA 5DX1A 5E6UB 4EI8A 4D0SA 1B73A 3ZXSA 1FC0A 3LYLA 2NV0A 1HGXA 1WULS 1FEHA 3MMAA 4A3SA 2OG2A 4KYUA 2VYVA 4OX7A 1PDWA 4JYCA 1CG6A 4G89A 1UMJA 2RHSB 2QA5A 1IY9A 2W2XA 2WJYA 2QRHA 4TL9A 5FBRB 1OAAA 2B6HA 4QWDA 3PNQA 4Q1FA 2A1UA 1FY2A 3WGJA 1R74A 1LVGA 3IALA 2ZREA 3COSA 1N6OA 3OFEA 3O4RA 1RQPA 3FCHA 1F9FA 3K5OA 4KMMA 4JBHA 4WLVA 4ES1A 4E5DA 1HHSA 4AULA 3I01M 4L74A 3ZLVA 5MGBA 2UUPA 3W9JA 4HDHA 2ZM6F 4C4XA 4P3KA 5BOSA 1W5AA 4YFYA 4EARA 4MS3B 1YDWA 2VJCA 2NQPA 4LE2A 2HRRA 4OHOA 5AVRA 2IS1A 2I2XB 1YUNA 1YJUA 2F3QA 4EGFA 4UE6A 3ZKAA 2UUOA 4EB3A 1ZK0A 3ETNA 4TV8B 2OPHA 4OK3A 4KGDA 2OT3B 2VKRA 2OSBA 2CZVC 1FLAA 1SC1B 2OV4A 4JSRA 3RVLA 4UAUA 2WIGA 4X3PA 1JIIA 5FL7D 1JLQA 4H16A 4MITA 4HHHA 3JQDA 1C7FA 4YHHB 1Z4NA 4HBGA 4ZQEA 2IYWA 3IPRA 2Q1SA 2FSVC 4ED2A 1D8TA 1QKJA 3B3QA 4D42A 4X62J 3PR3A 2K7JA 2JWNA 3PC2A 3VGUA 3GVIA 1FNSA 2QG4A 2MPUA 2AGOA 4YBRA 4X7PA 5I9NA 1ZHOA 4CT8A 2DK2A 4U2KA 5CYOA 1MKYA 1DXYA 4F36A 3LTNC 3ORSA 3NKYA 4QDKA 2DPIA 2WT9A 1T4MA 5IJ9A 1DIOB 1ZH0A 2GT1A 1CB0A 1HNWF 1MHPA 3GCDA 1I3CA 3G8AA 1UC4B 4Z0HO 1U11A 2BHSA 1BE8A 3W2TA 2A0XA 2DH5A 3IP9A 3PUHA 2R62A 2QPAA 1S7CA 3LUJA 1QVGR 1LWCB 5KC9A 1KEZA 1C0TA 1FE4A 4Y6IA 2QUAA 3R4VA 2GERA 1EG7A 4JZYA 4ZDJA 4MW9A 3BFKA 1O9HA 4JHLA 3RG2A 3CQ9A 1LW7A 1OH5A 2QTAA 1WPXA 2HF7A 3KTAB 2UVWA 3NS7B 2JC3A 4YI3A 3DULA 3OZUA 2WHXA 1FCJA 3A4LA 4P3YA 1XP5A 3UWMA 2E5GA 2VF4X 1FJ7A 1NXTA 2CFSA 6LDHA 4Z7JA 4MH8A 2WU3A 5I8ZA 1YI0A 4V0NA 4J0KA 4ZZ0A 1U47A 1IWBB 4FF1A 3ENAA 3KLBA 3PT9A 4NLTA 5FIIA 3BF8A 4PLFA 1QE0A 4LZPA 3RJ5A 3EYAA 4ETZA 4ZHRA 2AJ2A 3M5PA 4W6QA 1NPKA 1TMMA 1H4SA 4DG1B 4HYYA 4M63A 4D99A 1WP4A 3A1SA 3E18A 4QXPA 1HYSB 2WZBA 1WW3A 3ZI7A 3EYZA 3REOA 3IQWA 2BZ0A 4H3SA 4ERNA 2AQHA 3I9JA 3CH5A 4MMYB 3RABA 3GJSB 4ZOSA 1T2NA 3D8SA 1NK7A 1K08A 2C03A 5BSFA 5DX8A 1KBRA 9LDBA 3HDHA 3FPCA 1EFDN 1HE2A 3ZUPA 1NSTA 3R6LB 1KARA 3MEEA 4PO3X 3LGSA 1MDBA 1H2FA 4I2VA 5IU6A 2DO0A 5HIJA 1XD8A 2YL2A 1IXSB 4LKOA 1U1PA 4QLAA 3SYTA 1ZWKA 1ADJA 4PCLA 2QL9B 1RM4A 2GCPA 1JSRA 5KNCD 1CF2O 2VPQA 1ZUIA 3WGQA 2KLHA 2Q50A 3VTIA 2GTIA 2IHZA 1ACMA 1HT3A 2FPXA 1RB0A 1OX5A 2PFSA 2HT1A 3M83A 4FKZA 4BGDA 3JQEA 3DR5A 5FTWA 1MROB 4X84A 2GASA 2LIVA 3G8DA 3AEQA 1A5TA 4L2IA 3ADPA 5TDHA 1NK9A 4B3CA 2CJBA 3UJDA 3MM9B 1I4LD 4LRBA 3LX8A 4I6JA 3HKEB 1DQYA 1JFVA 3STUA 5IV4A 5M2UA 1HEIA 1YH3A 4DCJA 1M67A 2Q6CA 4MI1A 3UWSA 3TR5A 4ZOLA 1Y1KE 1YRHA 1E8DA 3E5HA 1E98A 2VJMA 3PICA 4YLGA 3MM5B 4LY0A 2IP1A 3CLRD 3KKKA 3O8WA 2IV3A 2JLYA 3ZTSA 4ZV7A 5BW8A 3SS9X 4WBNA 2XYPA 3RR8A 4HK4A 1WELA 5CVEA 4C7MA 3HO1A 3U5TA 3W04A 1CUHA 3PQ7A 1ZETA 1YOBA 4LMAA 3MMBA 3T5LA 4V24A 3SCIE 4YP9A 5HDQA 5KFDA 2QLFB 3OMLA 3D3CJ 3SV3A 5KTOA 3B1ZA 1BE1A 3UXYA 4PPFA 2G0JA 1V9OA 2BJDA 5D0EA 2HFJA 3DMRA 3KVOA 2GZAA 2V7EA 1QLWA 1TQ6A 4E8UA 3ZJ5A 4HXYA 1XFDA 1HF3A 4UAJA 2QLLA 1SIZA 4YEDA 3QGGA 5JS8A 2OO4A 4UHHA 3LX4A 1S0VA 4DMZA 4F7VA 1GG9A 4JX8A 2P3LA 3QJJA 5L51A 2GN9A 1ZS6A 2J5KA 4DT1A 4E98A 5L4NA 4EHHA 4CM2A 3OURA 3WAJA 4WXOA 1L1EA 4DX5A 3V6LA 1T9GR 1AZSC 4NKRA 1CRZA 2BKUA 2VIHA 4OZLA 3THWA 4LF9B 2YC2C 1YJNS 2QLFA 3SFTA 2ZIXB 4MJXA 5F9HA 2M6KA 1RKQA 3QT7A 3OCZA 2RUGA 2GHVC 1SUCA 4TU9A 3A3NB 4US0R 2DYAA 4R41A 1CR4A 1ZBTA 1Y7LA 3O94A 5L8RC 2F00A 2CPEA 1U3FA 4C8ZA 1XTUA 3HFSA 2R7AA 4WLOA 5ES3A 1UVKA 3U6BA 1W35A 3FBGA 4U2EA 1HYHA 1OTHA 4DVGA 3CEAA 2G4BA 1XA3A 1YBVA 3QMPA 2V7QD 4N65A 1VXOA 3RYHA 3FTPA 4B6JA 4N7TA 5TQ0B 3PGKA 1J2RA 4PINA 4KXMA 4B3TF 2CLDX 5LU8A 3ZIAD 5HXAA 2CHFA 3OFFA 4ZU1X 4MQUA 4EGAA 2FX5A 2WAOA 1YZLA 4POAA 4P38A 4U2GA 1UW4A 2R25B 4TYBA 1E5TA 1IG0A 3AY7A 3QPVA 3WBZA 3ZBUA 1MU0A 4XQGA 4AJ2A 1CJKC 4H2DA 1WPQA 1LA2A 2P8JA 1RLMA 4COKA 4Q01A 2J5QA 4IXMA 4R6XA 1U09A 4U9RA 3HJUA 2LXIA 3BPDA 1RABB 1NCLA 3L5KA 1OBFO 4AY4A 1IBRA 2ZVPX 5FD8A 4O4HA 4DF4A 4X62F 3L8ZA 5EUMA 2B92A 1N0IA 1CIPA 2A94A 2WJJA 3EPRA 2E87A 4CQLA 1X80A 3VOBA 3VO8A 1TDJA 3KYDA 1XZGA 4OV1A 2VP5A 2VOPA 1PV1A 4V02A 4JUAA 3FNIA 1PD0A 5JEEA 2D1QA 1WJGA 4YAJA 3O8NA 3BZBA 2P4EA 5ALIA 4XR9A 3VZHA 1YKGA 1SHZA 3PXGA 1M8FA 1QYRA 2VQEF 2I6XA 1B43A 4AX8A 2IIPA 2ANBA 1P7PA 3EXCX 3DV0B 4TV9B 1VRTA 4BFXA 4EUNA 1WI6A 5LBUA 4UBJA 2CZGA 1VRWA 1S0NA 1FRMA 3A1UA 1OMSA 1UJCA 2HK7A 5ALNA 3WMRA 4CR7A 1CUYA 5EPUA 5HJYA 4A0GA 5FDFA 1AUPA 1I80A 1T3GA 4Y6PA 2XY6A 1IBKF 4M36A 2HV8A 4H6XA 4DCPB 1HNVB 1A9ZA 2I71A 5A8RA 5FJJA 2QGNA 3RJMB 2EKQA 2VONA 3M9NB 5J43A 3OESA 3H16A 3SQOA 4B71A 4H08A 2GM9A 4BRWA 5TLSA 4C2MA 1IHPA 1UR5A 2N82B 3QRWA 2ZITA 5KOXA 2AD5A 2DGXA 2LXFA 4DPKA 3ON5A 3BB1A 3GEIA 3CT4A 1F3LA 5F3ZA 5IDYA 4RDHA 1UC8A 3OU6A 3IBWA 2C28A 3SC3A 1EFLA 3OQIB 2W2QP 2YWGA 1NU6A 3PGA1 1FUEA 1WDKA 3C4QA 4RW9A 2XMDA 5JH7F 1X86B 4WJLA 2NYVA 2XB2D 3NKLA 1MH9A 1N0VC 4X1YB 2I34A 2ZXFA 5FFNA 2NP6A 3QTTA 2N4CA 3CVJA 2G72A 1LNQA 4B0OA 3IQEA 5KTYA 3P6YC 2R79A 3DT8A 4RL6A 4LFBJ 4WNCA 3K9QO 1P9LA 3NGSA 1REQB 3BD8A 1QR2A 4JT9A 2EWHA 4Z9YA 1L6RA 2XJ4A 1IZ7A 3P71T 3RRXA 1HW9A 4OBWA 3QX8A 2GHTA 4G1UC 1A8IA 2RJZA 3V5RA 1QYCA 3OQPA 4MQFB 4PYKA 4OHCA 3EDOA 5F1OA 3CJ3A 1UQUA 2KFNA 2VO1A 5BV2P 3I9OA 4DUYB 2R7MA 5T14A 2XQIA 3TR6A 1TCCA 4MOWA 1C30A 1SKMA 2AOXA 1JR3E 3LHSA 4BB9A 2BE7A 3ZNPA 4HQLA 3OX4A 3KG2A 1DFDA 4HTIA 2WHPB 3WYBA 2DFVA 2ABYA 2K6GA 5JMTA 4MEAA 2XA2A 1EJ0A 2GVDC 2VVTA 2R6ZA 1JPVA 4FHCA 1QXSA 4DJ5X 1YE8A 2XCLA 2JEZA 1UM9B 3FRYA 2B83A 2ZW9A 4ETWA 4HB3A 3FDSA 2Z83A 3IGVA 3MGAA 4LT6A 5DG7A 3T1NA 1VK3A 5DZSA 1ZDMA 3LP5A 1PZFA 1ETHA 4Z1MA 1N2CB 3RW7A 3KQOA 3JQBC 5AW1A 4KT0C 1OLUA 4DZTA 3R9XB 3PYFA 3LQKA 2V2ZA 1ZZNA 2PUWA 1ST3A 5AKEA 2VSFA 1GL3A 3OZ7A 4FS1A 1G16A 1JQ3A 1KZ6A 4EVIA 3KOAA 3UV7A 2J9ZB 2W01A 3AXTA 1KXJA 1BXRA 3NKFA 1L4EA 2WMDA 4CKWB 4M83A 2AYBA 2GJ8A 3GLIB 3DF9A 4GAEA 3QE9Y 1WHTA 3WZ0A 1SIOA 1OTXA 1VSTA 3KWJA 5LLSA 5F98A 4AU1A 1PNQA 3G86A 1VSBA 2RVJA 2IHKA 3FCEA 3S2YA 2O3DA 2AI1A 2QL5A 1A76A 2ZR9A 3RIYA 3LYUA 1JKIA 1XTKA 4GLOA 2QF7A 3QVJA 4PIMA 3T1YF 1RP1A 3T1TA 3VF0B 3HN6A 3H8JA 2WHRA 3DM9B 3GHHA 4KXFB 1RQNA 1U8EA 5KFKA 2QTTA 1RRKA 1FD2A 4C3LA 4Q19A 1ZOIA 3PDHA 2R7KA 3KJGA 4FPXA 1ZNWA 3T5GA 1RTHA 2RE1A 1ORWA 3T5CA 5KVVA 1TCVA 4BY9E 4BMOB 3IVGA 1PGPA 1O94C 2PGOA 1KIFA 4UU0A 1EVEA 1EFKA 4MUHA 4YDSA 2UZIR 1T9CA 2OUIA 1A2OA 4XB2A 4U6SA 2A5FA 1ADCA 1U0HC 4LGVA 1ST2A 3DOIA 4O3OA 1HFWA 3DZDA 3UXMA 4OXKA 3QEKA 5BUSA 1MABB 1DRZA 3FWZA 3FLAA 2GZ2A 3BIXA 1FNCA 4P34A 1WM1A 5ALQA 4M4SA 1PFUA 3HR8A 4UZSA 2HO5A 5DWVA 3WRVA 5DLYA 1S6OA 4KXLA 4I7FA 1JHUA 3CJ5A 4AG3A 3IB3A 1JBEA 3X44A 4I3GA 2XAAA 3B3FA 4DCOA 3ILSA 3GNLA 3UN3A 5CB0A 1RTHB 3LCRA 4RIFA 3F5DA 4JBLA 4C0OC 3CH7A 3QVTA 1NZDA 3D7LA 4A6DA 3QYYA 4QWAA 3NDPA 5BT9A 4B32A 2WD9A 3COZA 4ECSA 2FHKA 4LX8A 3KB8A 3LOPA 2JHEA 4G8JA 2ZE8A 3THTA 2EDAA 3NM5A 3SU8A 4UATA 3SCLE 1F60A 4CIXA 3KNAA 3GLJA 4WJZA 4Y1FA 1EJBA 1KI9A 4RW9B 3VPBA 1T9YA 3GH3A 4D9MA 3ZQKA 3AETB 3EZXA 3NC4A 3SIPA 1V5GA 1OVGA 3GX1A 1QK4A 2KJQA 4IUBS 3OCCA 1S2OA 1PBTA 5FH9A 1JF8A 4FFVA 4L3WA 4AP6A 2X0IA 4FYXB 1M1YA 4LMBA 3JAMY 1X0FA 1L5SA 3A8IA 3GR6A 4E3ZA 2Z3VA 3OIVA 5EQTA 1EIZA 3BPSP 1BROA 4PLVA 3CPJB 3G5AA 5IN5A 1WCWA 8AT1B 1MF7A 3PNOA 2DPHA 4ZVOB 4JOQA 2BP7B 4G4SP 3VH1A 2V4JA 2ISSD 3IVAA 1Q84A 3W4KA 2XZDA 1CZLA 1LLQA 5E6SB 4G65A 2G17A 4F1WA 5EHIA 1BQXA 2PJDA 5KOIA 4B8WA 4F46A 4Z2YA 2HDHA 1JR3D 3V6MA 5B0EA 3AUXA 3I6YA 2FDNA 1YS9A 4LJYA 3KJVB 3GGJA 3I9V1 2QR2A 3DXFA 4MP6A 3AR9A 4DGSA 2R3VA 4B46A 4GX1A 1SXJD 4MP8A 4JEIA 3JSBA 1P1KA 1IWOA 2O0JA 3QPAA 1K3UB 3UAYA 4QYIA 1F0KA 1BNCA 3FBWA 2RIJA 4XK8C 5KDLA 4BWGA 4CT9A 5LOVA 1NKCA 2GZMA 4B9AA 3GCZA 4BFTA 3SEFA 3A8TA 4HWPA 3W5CA 1F4VA 4FDLA 1RAOA 1BQMA 5EJGA 2QTWA 3I76A 5FA6A 1RRFA 3KR1A 1RKJA 3GWCA 4Q37A 4PSKA 5AHKA 4GEKA 2HXGA 3K0AA 4B3TJ 1XO1A 4PQRA 4DR5J 4Q24A 2IYQA 5HQJA 3PW4A 2VODA 1PWZA 1ZH8A 2EJWA 5A4AA 2JC0A 2DPGA 4O3QA 1YHNA 4CTNA 4C07A 1VFNA 1C0LA 1YQDA 2AWNA 3ILVA 1TUBB 4WA8A 5LIRA 2VFVA 3KHLA 2K4MA 1F4LA 2KM1A 5DQIA 1FSPA 4WFBQ 4QYIB 1XLVA 1WHYA 2X41A 4LQ3A 4AUKA 3EEQA 4X95A 1U2GC 2HL6A 1U2PA 4EYHB 1YO6A 3KSRA 4JLJA 3M5DA 3L6UA 4HAYA 3GWZA 3BWXA 1DTQA 5IBQA 3ZGYA 4YRFA 4Z7OB 1KZHA 3CDAA 1XNRJ 3N3BC 1KLMA 1CPYA 2ZIVB 2BEWA 3I82A 2NYAA 1X4CA 1DX9A 2VWPA 3AEUB 3OEHD 4D8XA 2QHXA 3HQ4O 5G0SA 3O8OB 1X38A 4N77A 1EU1A 2WF7A 1L9KA 4E30A 2ORED 3UD3P 2C7OA 3MR3A 3X1ZA 2CQ4A 4JXKA 3P97A 2J76E 3C6QA 4O2AA 1T5BA 1VQ5S 5DWDA 1HWUA 3G6WA 5DM2A 1I01A 4A92A 4MV0A 4YUAA 3K6RA 1A0OA 2X1HA 1O54A 1Q0HA 1EZ4A 2FPGB 2LEPA 2B8TA 4V0LA 4C0KA 3QIPA 4DBLC 5JANA 5TB5A 1ZL2A 4XSHA 2WTFA 3MQ4A 1RYFA 4B2IA 2BMDA 3QPIA 3PVZA 1CRLA 3UENA 3V4SA 1N3IA 3W05A 5D3ZA 1U5BA 2W98A 3GFOA 2C8LA 3VYRB 3T7AA 2DCLA 2YJZA 2XNSA 1NKVA 2EG1A 1E60A 3IBFA 1HKHA 2OUGA 1JS1X 4RLEA 3UJPA 2N9UA 1U1KA 4BB6A 4PQUB 3Q24A 1U4NA 1J0DA 2VNKA 2HJGA 3R7NA 2KJWA 2I65A 2H4HA 1XMSA 4YUZA 2AJBA 3EXIA 2BQRA 1JLSA 4K4VA 1BEUB 5EE5B 4KPUA 5A8WA 4B3SJ 4P08A 1PFWA 2Z2JA 3Q2SC 3D4OA 4ZKDA 2UAGA 3U7HB 4R1QA 2H17A 1G2EA 3IH5A 2OHJA 1WO8A 4OL0A 3CBQA 2FVQA 2Q6BA 1QB7A 3DFIA 1YJ5A 1LLDA 1CRWG 3IUMA 3ITDA 2B6AB 3KOXA 1V5VA 4YJDA 1Q6YA 1JHXA 4OGKA 2E9RX 3EGZA 2ABWA 4BPRA 2XVAA 3GFVA 4MZXA 3GY0A 1VI6A 1S0MA 3I2YX 4RZRA 3TP2A 3QO9B 5J40A 4FHZA 2XGSA 2NQ2C 4E11A 3ROGA 2XMQA 3EPHA 1CZKA 3DA8A 5AK5A 3NV9A 1XQ6A 2H3EB 1BU8A 2NN3C 1EUYA 4DUZB 2F2TA 1Z47A 2YNHB 4F5EA 3GUUA 3M8ZA 3IA2A 4C4AA 1RWPA 4EECA 4XDHA 3KSUA 3OQVA 2DGUA 1NW7A 5ADVA 1UKZA 5AESA 5GIPE 1FX1A 3M2VB 2QYSA 4UHBA 4YS6A 1QY7A 3E82A 3V46A 1QFJA 4J7AA 3WC4A 1UJ5A 4NZ7A 1FE8A 4WU2A 2W8ZA 2AK3A 4RIGA 2I7DA 4WJKB 2AFIA 4KHRA 5FAXA 3ZIDA 3IIIA 4NWBA 4R2LA 3ZCRA 3UMYA 3O2QB 4RKFA 3EIQA 3IL2A 2YZGA 3V00A 4KTQA 1IY1A 1D07A 3W3AA 4GMDA 2IM3A 3KK1B 5HVFA 4WZAA 4DR5B 1L8QA 5HMYA 2WKPA 1VYAA 1T2FA 2EP8A 1XERA 3OOWA 4EY5A 2R60A 3MPDA 2D5IA 2VRNA 5EE0A 3ZBPA 1SZCA 2ZQ5A 1VSQA 1E9AA 1G18A 3N7TA 2G9QA 4WNAA 1YAHA 3OUZA 2I99A 4FD3A 2VA9A 4UNNA 4MROA 3Q8SB 2GBGA 4KR6A 1RFGE 3E2IA 1ZBQA 4MTPA 3C3XA 2W7TA 4NQRA 4A15A 1KY2A 5K0FA 3KLFA 5F12A 2A1BA 4D9NA 5FI0B 3VZCA 1XMIA 1CJUC 3D0GE 3BK1A 1RT3A 3BGVA 4B7XA 3R7WA 5JQGF 3ZG6A 2XODA 4JI2J 2PEYA 3H2KA 2PGAA 3IJPA 3WYCA 3KLIB 3LLSA 5EKTA 2AV6A 4JI4J 2G0IA 4L7VA 4E7OA 1WC5A 1FDTA 3RB3A 3R0VA 4WT7A 1EFUA 3JQAD 4IBOA 3S1SA 3DOFA 3JWIA 2OEKA 4OZ1A 3ZBQA 2C5HA 1NKEA 1U2EA 3L1VA 3PNVA 3LC0A 2ZDQA 4KPYA 4MMZB 4DWVA 3LBNA 1OQ3A 4GSKA 2VZLA 3EF1A 1TT5B 4USUA 1TLFA 3D67A 4BNJA 4BP8A 2C2ZA 4D44A 4NAHA 3EJMA 3HO8A 1Q53A 1UANA 4P2FA 2FXVA 5TS2A 3DLBA 2YZKA 5JD4A 1INLA 1E59A 4KDFA 3GV5B 5U4QA 3NIDB 5B30A 4HVLA 3SSAA 2VG5B 3A6LA 4I4IA 4EGQA 4RBVA 3RIXA 2X1BA 2XUDA 1QOQB 3DHXA 3L79A 3BSOA 2RHLA 5EUHA 4BX8A 3GRFA 2QRJA 3HY4A 2C57A 1KI6B 3PWSA 2BFWA 2GA9A 4M7OA 2PGIA 1NUSA 5AH0A 2IWHA 3CRRA 3GT4A 4RU1A 3KJQB 2GEFA 4J2OA 1TJYA 2QRNA 3E35A 5L40A 1VRVA 4S2UA 5EJ4A 5JO9A 3BGLA 4FEGA 2P62A 3N75A 3JQ8A 1N78A 2MHCA 2DWQA 3X1KA 2BE2A 5L7TA 3LP8A 2UUBF 3N8KA 4Y3UA 4AZ0A 2UU9B 2VPYB 3RREA 1VQNS 3EM1A 3TKLA 2HHQA 2POCA 2B3DA 2YWCA 2WB4A 2MGZA 5LJIA 2I1QA 4KX5A 5ER6A 3QATA 4I55A 1DKUA 4LMRA 2WWRA 1SKQA 4YO7A 2Z6VA 1J8QA 1JJ2R 2PUGA 1HM5A 1EXDA 3K72B 2AN1A 2Y0BA 3ELUA 2XLBA 2X22A 3PFGA 2YXLA 3IFEA 3KSZO 1UZMA 2QA4G 4NATA 2AMCB 3VU3A 3LKBA 3RTGA 1T9UA 2X58A 1QUPA 3QBJA 1O0BA 4HX5A 5HBRA 4RK7A 2ZJYA 2J0SA 4NCBA 4DQKA 1XRPA 4DN9A 1P9RA 3BEDA 3IQZA 1F2VA 1G2OA 4ZVHA 1ULTA 3R7SB 1EHCA 3E9MA 1RZVA 4FNGA 5BW5A 2DNPA 3NIBA 3UK6A 5CD1A 2W2PA 1RWBA 2ZM5A 2XRFA 3J81k 1T4CB 3I2GA 5F2NA 2OBXA 5A3SA 4BBJA 3ECAA 4PANA 3QVXA 1LDMA 5AXLA 3S2GA 3RV4A 1N34B 5J4LA 4OYMA 4R9UC 4X00A 5J2NA 3HBJA 4CF4A 1EJ7L 4YALA 2G40A 4KGMA 1YBUA 2MDAA 3H8WA 3ILIA 4B0PA 3JTMA 2DNQA 3N70A 3CLUD 3SJUA 4X4PA 1QCCA 1VJGA 1F48A 3UHAA 3V1UA 4RKQA 1F6TA 4HT7A 5M29A 1G6HA 2FG7C 3G0OA 2CADA 1Z39A 4S1OA 2CBZA 3O73A 2R8IA 4TRJA 1TUEA 1HRDA 1OB2A 3JQPA 1AZWA 1Z8NA 3PFBA 3H04A 4NLRA 4MRPA 5KYUB 3VO1A 2AJTA 4M6WB 3SXPA 1ID8A 1ENOA 1BVUA 3UAZA 2BYTA 3VAKA 4Q3OA 3N2LA 4DV1J 1WX1A 2PQ2A 3EFEA 3VC1A 2YWEA 1W96A 2C0PA 4BP1A 3U80A 4LSNA 1ZO8A 2G7MC 2QT1A 2JL9A 5CA1F 1N36J 4BLRA 2DH9A 1Q16A 2LDBA 3E9EA 1IKXB 5EAIA 4KBGA 5KT5A 2A9OA 4KR3A 3GYXB 3OQJA 3IEKA 1XKTA 4ILRA 3HXPA 3WLEA 4D3GA 4YT2A 4UJ5A 4W82A 1VZ3A 3GZ4A 2KKHA 2QMQA 3S2ZA 2VZ0A 1IM8A 4WJBA 3U9SA 4G0ZA 2B25A 3IEXA 1PJTA 4BU1A 4KQFA 4KJZA 2EXXA 1XZMA 4DCUA 4AJJA 4PR0A 4KO0A 1E99A 2EBWA 4A8TA 4WIIA 1DT3A 2XXJA 1KOHA 4HNQA 4LJ5A 4IW3B 3DM2A 4C04A 1SJ9A 2ZJQQ 2AG5A 3HUUA 2KWIA 4N5MA 4PXSA 2JGDA 3KR9A 4HLDA 4II3A 5BN3A 2JDJA 3H5IA 5B7WA 4WIAA 1XQYA 2G08A 4KN9S 2MKYA 1Z4IA 2UUAB 3OT1A 4F85A 1GFZA 4UQPA 1WHTB 4QODA 1YIAA 4FR5A 1Z5PA 2ODWA 2R8JA 2Q1XA 3CMMA 5A3VA 4G0PA 5D2CA 3H5AA 3TUIC 3G5TA 1B16A 4AJ9A 3LH2S 2AZ4A 2QBYB 1MPXA 1WR8A 1E4YA 1LKZA 3LZDA 2CLKB 4J16A 5K0TA 3EIXA 1NF2A 1YFLA 3OTDA 4KDRA 4YDHB 2ZIWB 2CHVA 1Y7HA 5DXFA 2AMYA 4K9KA 3G6VA 2G80A 2R6DA 2XI3A 3DRSB 1WHSA 3AOAA 3DNFA 3X2SA 2AMLA 4Y2RA 3DFMA 4AJKA 2ZEJA 3GJTA 1TVKB 4IZIA 2RI6A 1XJQA 3K9WA 4L07A 1GMWD 2G1DA 2EW2A 3ANTA 3X1JA 4QJ4A 3CWZA 4FXVA 1R5NA 4LQLA 4DMLA 3DE1X 4C0BA 2ZH6A 1ZU4A 2IYAA 4WFJA 3TGLA 4CTMA 4KKOA 3MTGA 4ABYA 4DX8H 2B78A 1R5OA 4KXYA 4C0XA 5L1JA 3QHQA 1I6WA 2PO4A 3AJAA 1FPMA 3QM1A 1X70A 3UW3A 4W1SA 3NOCA 4Q4LA 2YKMA 4FHGA 4F4CA 1ICIA 4XGNA 1QUFA 1ZI9A 2HV9A 1QGAA 3LV8A 4GLJA 1N4AA 1CUIA 2AX4A 3NEYA 2YXPX 3RJZA 2NO9A 1RCOB 4NG4A 2GV1A 2ACWA 5A4IS 4NNOA 5ARBA 2J0UA 2MLYA 5C18A 3AF0A 1DLJA 4M22A 3Q87B 5F8HA 1P6XA 3MJTA 4C0QC 5DULA 4NH4A 1NH8A 1VJ1A 1Y3FE 3U3XA 4L72B 1TA9A 5LD2C 3KMSA 3MGKA 4HDNB 3KPWA 5E8JA 5LXTB 4ZVQB 1YL7A 9ATCB 3LU1A 3VOAA 3RC9A 2QW8A 1F5AA 1ZH2A 4A27A 2HD4A 5AJUA 5I3CA 4GL2A 2Q1TA 3UTCA 1P5HA 1CUGA 1N2CA 4F4JA 2JI4A 4YREA 2Q9AA 3DE7X 2GH1A 2C94A 1TK5A 1TEHA 4J0CA 2BFNA 3STWA 5CCMA 2HHCA 1G21A 4MB2A 3ZU5A 2BFBB 1QSYA 4RX6A 4IDPA 2R44A 2DPMA 3UMFA 4ZU3A 1ZA1B 3E8OA 1HD1A 2P67A 4C5BA 1NPTO 3O8LA 2FJ0A 1R66A 2QQGA 3H5OA 3FIJA 2B5VA 4LJRA 4LJMA 1SXJB 1WWHA 2BIFA 4EFNA 2BM1A 2ENUA 3Q7IA 3ZGNA 3SQDA 2GESA 1GIAA 1QR6A 1G66A 4POOA 3WGVA 4DIUA 1IC6A 1OZHA 2F8MA 3QEMB 4YV2A 3K9BA 4CCAA 3QUQA 2OXRA 1MO6A 3C5WP 2JJ1A 3EFOB 4RGBA 1H1DA 3RV3A 5DM70 2QZZA 3A4NA 3AM5A 3QT8A 4Q3AA 4YJGB 2AEJA 4FZJA 2NCKL 5KI6A 4AJ4A 3EZFA 3DBVO 5A3QA 4HI1A 4BX9A 3DMHA 2W25A 1KJ9A 3OD1A 4ZHRB 4F25A 1SCNE 4E1VA 4BNGA 1QHSA 4DJFC 4Q4JA 1U7WA 2VU5A 4IH6A 5DZ7A 1RYBA 3AW8A 3C7KA 2IFXA 5IJZA 3K05A 4E09A 4YCBA 3TZKA 5DTIA 4OHVA 3QP9A 3FZGA 3UJ9A 4JLSA 1DELA 3PEUA 3TTTA 2VFTA 2CXRA 4GIBA 4RVCA 2BEVA 1IJFB 5D85A 3MWDB 2FSIA 4JBYA 4W1PA 1OX4A 4UAVA 3BH6A 3QW4B 1IBMJ 2R65A 2ZIXA 1T43A 1T8PA 2ZIFA 2IIVA 5DPMA 1ROFA 4ZPVR 3IULA 5ABPA 1YNSA 4Z7YA 1X7DA 3IS9A 3MCVA 2I4TA 3S1TA 1QZZA 2KRBA 5FDLB 5C7OO 5F3DA 1GFWB 3CINA 1NK0A 4NECA 521PA 5GAHU 4B6GA 3JCZA 3HNOA 3HL0A 1UT5A 3KLHA 1T4DA 3BO3A 2Z30A 2F5GA 2VF7A 4KWTA 4Q7JB 1QZXA 2HWTA 1DKOA 1EKXA 4XIJA 4FYHA 5G41A 3QIVA 1FO1A 2HCTA 5DLQC 2D2FA 3KEOA 1TZBA 3DTVB 5JAPA 2JJYA 3DPSA 3B89A 3RBZA 3C85A 4F7DA 2PI4A 3QAEA 3O90A 1FT8A 1DG9A 3WRYA 4PPQA 3JXEA 4QLOA 4B6RA 1UUFA 4M7PA 4TN1A 3JQJA 3EGIA 3FGVA 1VQKS 5C31A 4IOBA 3SLRA 3EDQA 3ZE8A 1H2BA 5FBVB 2PUBA 1P0IA 1N5VA 4B7CA 5L1KA 1QNLA 5IAEA 3QVLA 4LY3A 3ZYCA 1A7JA <