1LK5A

Structure of the d-ribose-5-phosphate isomerase from pyrococcus horikoshii
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
229
structure length
229
Chain Sequence
MNVEEMKKIAAKEALKFIEDDMVIGLGTGSTTAYFIKLLGEKLKRGEISDIVGVPTSYQAKLLAIEHDIPIASLDQVDAIDVAVDGADEVDPNLNLIKGRGAALTMEKIIEYRAGTFIVLVDERKLVDYLCQKMPVPIEVIPQAWKAIIEELSIFNAKAELRMGVNKDGPVITDNGNFIIDAKFPRIDDPLDMEIELNTIPGVIENGIFADIADIVIVGTREGVKKLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A hyperthermostable D-ribose-5-phosphate isomerase from Pyrococcus horikoshii characterization and three-dimensional structure.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Isomerase
molecule keywords D-Ribose-5-Phosphate Isomerase
total genus 76
structure length 229
sequence length 229
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2002-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lk5A02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lk5A01
3AAWB 3EFBA 3IBWA 2BKVA 1KS2A 3BXEA 3TX2A 3BXGA 5HJ5A 3LOUA 1LKZA 2RI0A 3HN6A 5FIIA 5IT0A 4M8LA 2P9GA 3KWMA 3LWDA 3UW1A 1YBAA 2QMXA 2OKGA 3OFGA 3KV1A 1YGYA 4TM8A 3DDNA 4L5JA 4GO1A 2FGCA 1ZPVA 1UJ6A 5T41A 3DHWC 3OFHA 4GO7X 2PA3A 3AB2B 4L50A 5IT4A 3O1LA 3OC6A 4OQPA 1UJ5A 2LQJA 4IO1A 3OFFA 4X84A 3MWBA 1HORA 2BKXA 1FRZA 2RQMA 3OBIA 2RI1A 1SC6A 1UJ4A 2P9EA 3L7OA 3OFEA 3LHIA 2CDQA 1JT9A 5JJBA 3CSSA 2NYIA 2J0EA 1FS5A 3E7FA 1Y7PA 2I9SA 2J0XA 2R5FA 1RWUA 2O0MA 2ZHOA 3NWPA 1O8BA 3S1TA 3TUIC 2F8MA 1FSFA 3HHEA 3E15A 3CH7A 3LUYA 4OQQA 2WU1A 2JHEA 1HOTA 2J0WA 3EB9A 3ENWA 2F1FA 3AB4B 3P96A 3N0VA 2DTJA 1CD5A 2LVWA 4R9NA 1U8SA 1PBTA 3ENVA 1PSDA 1FQOA 4L5IA 3MTJA 3NZEA 2JOQA 1XTZA 3BXFA 1LK5A 5IS2A 3DHXA 1VL1A 2QRRA 2PC6A 2QSWA 4R7TA 3IXQA 2RE1A 2H9ZA 1FS6A 2MDAA 4NMLA 1Y89A 4L4ZA 4LUBA 4GMKA 1DEAA 2QMWA 2DT9A 3BXHA 4GO5X 1NE7A 2KO1A 3W7BA 3TUZC 3ICOA 3CEDA 3TUJC 3NRBA 2GNPA 3DC2A 3ENQA 2W48A 4L51A 1LK7A 2P9CA 1M0SA 2RQKA 4PWUA 4TM7A 4L4YA 3K5PA 3MAHA 3U7JA
chains in the Genus database with same CATH superfamily
3INNA 3GLUA 1IPFA 2UVRA 1KHTA 1FOEB 3KUDA 1XROA 3TD2A 3PDWA 2CWXA 3H2VE 3TQTA 2NZUG 3KQVA 5EIOA 5JZ9A 1JLBB 4BGVA 5EGNA 3D66A 3OFGA 2E5LF 3ZH9B 5CLQA 4PAGA 2YS6A 1C7JA 2LV8A 4Q48A 2EX1A 1FXWF 3HM9A 4QE3A 5BNZA 4GI3A 2QVLA 2DKNA 3I23A 4YRRA 4YR7A 2GJ2A 2AMCB 3E18A 1ZUIA 4NLOA 5JNTA 4OM8A 4UAGA 2LYVA 3AQPA 3L4SO 4HZIA 2OSQA 3KYDB 4ZO6A 3PXBA 2NU9B 2O0LA 1IWGA 5FA5A 2AYGA 2YJ6A 1EHYA 1GZ6A 2DE0X 4KPUA 5CCMA 5IBQA 3HSJA 1GAXA 4QM7A 3NM4A 5AW1A 1ZNXA 3Q2OA 3EIUA 3MAAB 4RD2A 3GRAA 4M88A 4CQLB 2W6IA 2QW8A 3BDIA 5SZTA 2C5FA 2WIBA 3GPBA 4Q7KA 2R85A 3OLCX 2VWHA 4JODA 5F9MA 3ILIA 1Z5VA 2HHUA 4ZI2A 2VICA 4GD3Q 5EIBD 4U7JA 1F2VA 1NXVA 4QXPA 5EFOA 2I1RA 1GV1A 3DYAA 2EBWA 2XA1A 2XHZA 5KFBA 4LXQA 2NREA 2OYCA 3J7A1 4ED5A 1WV1A 1ISPA 1C7RA 4KKOA 1XDUA 5JH7B 2HEKA 3SSRA 4RD0A 1NY5A 3RJZA 1SV5B 3CJSA 4HDKB 3PITA 3CJ5A 3OQPA 1SKUA 5EMHA 5EHXA 1XDDA 4WTYA 3IB3A 3GJ7A 2BGJA 3PLAE 4CV3A 3DE5X 1L4BA 4PHTA 3IQEA 3ZBPA 1KD1T 3QY0A 4X8MA 3IE0A 2RS2A 5AM5A 4G1IA 1EVZA 4EITA 5BR8J 1AQUA 2H3EA 3FZEA 4LMBA 4FGJA 1XK6A 4ZHQA 4ZVUA 1VK8A 1U0HA 3K7EA 3VAIA 3SXJA 2J9DA 2FEPA 3DCYA 4XX0A 1E6VA 3FYSA 4IUCS 3D3QA 4PGGA 3ZK9A 4DJFC 4DG1A 2O4UX 4CKWA 5LMCA 1JR4A 4BIIA 1RKUA 4DFMA 1FPQA 3FYCA 4CQ1A 3ESYA 3LA6A 2OC4A 4PICA 1NUQA 1JQEA 1RDRA 2ODWA 4U6QA 1W1WA 5GAGU 3D6MB 2ZREA 2N0SA 4DQPA 4ESEA 4Z4CA 2Z2YB 5K14A 5BSUA 1D1PA 1DIRA 1AUSL 3VXKA 2JFWA 3RF6A 3A70A 4NU5A 3G71S 3FI9A 5MLCV 3WA6A 1XU9A 2O3QA 2DBZA 2IIHA 1MMDA 2O67A 2JAWA 3D4NA 1XBWA 5IC4A 5IVHA 4JI4F 1NFFA 3WJ2A 3K8QA 1L5OA 5L40A 2GDJA 1FD2A 3CPEA 5H02A 3ZY4A 2FSSA 1H3FA 5K8IA 1I10A 4IS3A 2FOLA 1PHRA 3BWDD 3S29A 5E0KB 4EY4A 1Q19A 2ZATA 5IBCA 2FN4A 1NBOA 4LXUA 4OL9A 2Q5EA 2ZE7A 3K6SA 3HMJG 3DYVA 4J16A 4WBNF 2C7QA 2E44A 3PYEA 1D9AA 2PL1A 5AKKA 2R6ZA 3HPOA 1BJTA 3REFA 1YHNA 5CGZA 3BD6A 2H7CA 1QP4A 4GRSA 4GF5A 1EUQA 4MEBA 4C11A 1M1UA 2BTQB 3JXEA 4CTMA 3TAPA 1K06A 5HK9A 4PN7A 4PZAA 5F52A 1QHHB 1KKHA 3A1UA 3WKDA 4C2UA 2EHJA 1G6KA 1QLHA 4LHSA 1I0IA 3ABSB 1LKZA 1GKLA 4AZ3A 4Z7JA 2ZH7A 1I7SB 5JYBA 4ECQA 4EJSC 2PRYA 2IYVA 2CJWB 1II0A 2Y71A 4CNZA 1MC4A 1J2TA 3DHEA 3SWWA 3RRHA 1KDPA 4IM7A 1ZAXA 2HWYA 3QI2A 1KBOA 1US8B 3ENZA 5EUQB 2XIQA 2V63A 3OXFA 4KV9A 2VVTA 1RWVA 1GQRA 2ZOMA 1FRIA 3KSMA 1ZIOA 1KH2A 2H48B 4RKRA 4QPCA 3LBNA 4IUBS 1H93A 4UMFA 3GGOA 1VLYA 2H4YB 2DNOA 3RFVA 2JFOA 5KNDD 1BX3A 3OQ6A 2ZFUA 3BGSA 5BNTA 1XZLA 4URFA 1N9KA 4ZA1A 4TXSA 5DETA 1NT2A 5HRCA 3O90A 4R5PB 1GNTA 1VBNA 4CLZA 3J81k 5B6PA 2YV4A 2QP4A 1GPUA 1XMSA 3RRZA 3AEKA 4ISCA 4WKPA 2OSBA 2UXDB 1VMIA 3GH3A 3LVBA 4KH1A 4DPTA 3KK2A 4D45A 1UKCA 3NLCA 3PVSA 4LOJA 2GFHA 4QAQA 1R4AA 3I56S 3GLTA 2JFHA 3Q41A 4AS3A 1P91A 4G97A 2W9CA 5C8YF 1R15A 2UXDJ 2E9SA 4MHSA 3R2DJ 4KHPB 4FSXA 1F4LA 3U6BA 1I6LA 5REQB 3UWDA 1YOVA 3WFJA 1DLOA 3R4VA 3C6MA 3QPDA 1IU9A 4P08A 4W9RA 1FFYA 2VHZA 4MMZB 5BR1A 5AVVA 1JLKA 1X1TA 1OH8A 1DWUA 1TKDA 3JASA 1YX2A 1NXSA 4R8VA 4CGZA 2X9LA 3C1UA 2JBAA 4IIDA 3ZZ1A 1K68A 3FWZA 4DQVA 1I2AA 1DHMA 2HGNA 2I9PA 4HV4A 4F1WA 1DDGA 1K97A 3FB1A 3L84A 1DAMA 4Z9XA 4HT5A 1RBLA 1NUSA 3ZZPA 1MMFB 1Y9JA 2W4MA 3W5DA 4C1NA 1K92A 1ADBA 3LLVA 1TQ6A 3SYLA 1Z62A 4CMEC 3DOOA 1ZUD1 4LJLA 1WDTA 2B5VA 4ECYA 4RMHA 4AJHA 5I7UA 3WIEA 1M0EA 2XE4A 3AHFA 3PFCA 5DBFA 1OLUA 4BU1A 3K1AA 5LVAA 3W64A 3TM4A 5K6RA 1SCJB 3T1QA 5DSXA 2GNOA 5IEJA 3T4XA 2I3ZA 3JRNA 5KOHA 3O2IA 2ZH8A 4V24A 4JI1B 4PCUA 4FNHA 1D7OA 1DX9A 4FCCA 1M72A 3C45A 4H7PA 1FTGA 4OHRA 2ZB7A 4NOHA 2QN3A 1HIYA 4LFCB 2OORA 1Y8RA 1UEKA 2DIVA 3VYTB 3UPTA 2PD1A 4NMLA 3H5UA 3ICQB 5E1OA 2RI6A 3RYFB 4C0BA 1ONOA 3NRJA 4L5AA 4USIA 1U1IA 1MQAA 5F41A 4JIMA 5KWSA 3HVTA 1C9DB 2HK6A 4UT4A 2R62A 4MITA 1DT3A 1SIUA 3LD9A 3MAHA 3U7JA 3TI0A 4OIFA 4C21A 3PVCA 1KHVA 3LOQA 2I4IA 2WZ1A 4S1PA 2Q21A 2WFLA 1DFIA 2D0IA 3U13A 2QA5A 4AIIA 2M70A 2F9DA 2BDEA 1EPUA 1DJPA 3TZ6A 1H2VZ 4Q9NA 4JYBA 3UWSA 4EQ6B 2HIGA 4QL3A 3PNMA 4Y6OA 2RK6A 2RRNA 4UZBA 1E2KA 1TZ2A 1VKZA 1G64A 1UZMA 1G17A 5HRUA 4AKSA 1U0SY 2FZWA 1WXHA 3RHFA 3X1YA 4RGBA 3MPUB 1T15A 1HNIA 1J2JA 9ABPA 1JZTA 3P97A 4DR6F 4F38A 5AXCA 5KAKA 5AJHA 4ZHSA 5MDHA 1FLDA 4V0RA 1ZMRA 3UWOA 1IKYA 1EWVA 5C4GB 1YRHA 4RIHA 1X7VA 1E1KA 2AFIA 3PWSA 5H16A 3OT9A 1WCWA 2PY6A 3K6RA 4BAGA 5FLKA 5ETTA 1NLKL 2J0VA 1U1RA 3KZVA 2FVRA 3HKEA 5KKAA 2GHIA 3VR5D 1MB3A 5B3KA 3QQ5A 3H86A 5IP5A 5HLFB 3K6JA 3QRRA 1V1MA 3PIPQ 2GZDA 4MV5A 4OB7A 4X5OA 5CYJA 3HFJA 4P0QB 2LGJA 2X2EA 5CXUA 3AOAA 4DIDA 1UVIA 2H17A 3GG1A 2F1IA 2VL7A 5LJLA 1KIMA 2MKHA 1S02A 2J5AA 3KYCB 2A3JA 1ULRA 2IVFB 4MTLA 1RT2A 3VKHA 4DCOB 2R4TA 3OJEA 3K32A 1ORRA 3ESDA 1CS4A 3GNLA 1MCZA 2H85A 5K8JB 2YNMA 3SSSA 2XUJA 3OZTA 2VWGA 5JASA 4AICA 3Q6MA 2W4QA 2Z5FA 2OFWA 3UN5A 5CT6A 4WPGA 4X20B 5IS2A 1YZ3A 2IUEA 4JKIA 3MELA 2EG2A 3I37X 4U2FA 3DWFA 2RDDA 3EVAA 2CJKA 1DAPA 3W5JA 2J7PD 4P4LA 2BKEA 1LV7A 1ZD2P 1C7ZA 1GGVA 4FLEA 2XWPA 2BE2B 5HNKA 3R8FA 2NU8B 3RB3A 4MWZA 1VJ1A 1O9GA 4IG3B 3W8RA 2GZOA 1ITZA 2BONA 3CA8A 4EW2A 4HL6A 5IDQA 4WZAB 3MQFA 5JEEA 3EXYA 5ARCA 1ZMOA 1QIEA 2BPOA 4OQLA 2O7SA 2ZDHA 1PL6A 2RK3A 1QAJA 2II6A 2WA1A 1K6MA 4REQA 2IYYA 3H7IA 4NPAA 5B1IA 4DV1B 3VI4B 4YCBA 2W6CX 2AYEA 1W7WA 1QV7A 4ZMSA 4BQPA 4BZZA 2P9EA 4XPEA 4ND6A 4D97A 1UZDA 4NU6A 2JI9A 3L4BA 4LJ7A 4DUGA 3AEYA 1R12A 4EVRA 5CG2A 3OLYA 7AT1A 3KU4A 2Y1KA 5FP0A 4DU7A 2HG4A 3I0ZA 3OH8A 4V0MA 5DHFA 1NBME 4K40A 5DX0A 3V1NA 3HJCA 3OIWA 2HCTA 2QRJA 2V34A 4MTPA 2HC9A 3HN7A 2VNAA 1OY8A 1WQ4A 4OL8A 3V4ZA 4W4TA 1IHDA 2WWXA 3FYTA 1M73E 4M38A 5EKUA 4QOSA 1D5WA 3VPBA 4IH6A 4MI6A 1NZFA 2BM8A 4BX9A 3NHZA 1J8FA 3DJFA 2Y9MB 3N6MA 3GFSA 4XCVA 4CIBA 3R7NB 2G5PA 1SK8A 2CQ1A 1PZHA 3BQ2A 3UW3A 2VA3A 1K73T 3DT9A 3CTPA 2LXUA 5FWXB 2EJCA 1UFWA 3MOJB 2AJFE 3G5MA 3V7NA 3OFHA 1GLNA 1TZJA 2ZRFA 3CURA 4IOLA 2R87A 5IQ6A 4JC8A 4UDOA 3L07A 3MOIA 4B3DA 2IP4A 4NMHA 3M70A 3MF4A 2HZAA 4YB5A 3ZXUB 2Q3MA 3LUJA 2OFGX 4CMIA 2K2WA 1KVQA 1BVRA 2JFDA 1PZXA 1XZJA 3G2QA 4JYAB 4B3SF 1A5ZA 5ALUA 1JG3A 1SC3A 1T9UA 4CLWA 3R7SA 1UTAA 2GK6A 3A9RA 3DXSX 5J2TF 3EMDA 3TTUA 1XZ8A 1AE1A 1RTHA 1SVIA 1Q86T 3JVVA 3OZEA 1IKXB 1HMPA 3ETJA 4J2OA 2W58A 3OT5A 3JQ9A 4GL4A 1QRSA 2RD5C 1H0HA 2D5BA 4B43A 5DM7Q 5E7OB 3ZHVA 1JP7A 2OZVA 3GPCA 3PA6A 4YBZA 4FT2A 5AM2A 2C0PA 2WPDA 4DN9A 4ID8A 1R6VA 2PNJA 2WZQA 5JV5A 1VXOA 3UC9A 3FPHA 3QFSA 2QLJA 4KO4S 2OY0A 3OP4A 3ITHA 2WUDA 3ONDA 3QBCA 3T5GA 3DLLQ 2QEQA 4FXWA 2VP0A 2VHTA 1M5VC 5DEOA 4M22A 1MG0A 2AXEA 2JLXA 2PSSA 5AKYA 5SV2A 3RR8A 3IGFA 4YV0A 2OQRA 1O5OA 3L7DA 4NV1A 3WL7A 3MWLA 2J9FB 2HPZA 5FD8A 5A9RA 4G3XA 2C7GA 4LPKA 3PWTA 4FLFA 2BBSA 1E4VA 2V5HG 3FTQA 1WKKA 4TTJA 3BKUA 2JCXA 1CCWA 1RSCA 3U7IA 3OLXA 1QCCA 1MDBA 4I19A 5AWFC 1T03B 4YT4A 5C8YB 1T0PA 4NDAA 2IM3A 3UPFA 3K57A 5EINA 1NRKA 3SDEA 1TC1A 2GHWA 1D09A 3GI1A 3VU1A 4M37A 2B20A 3V7WA 2OILA 2FX2A 4I8IA 1FBNA 1TK5A 4D02A 2A0KA 3KUCA 5CNJA 2AOTB 1MW8X 2FH5B 1DFGA 5I9LA 1HV8A 3VAGA 4GECA 5DG9A 2UYYA 2JI8A 3PBKA 5HE9A 5EWGA 4KQEA 2ZYGA 4IOKA 1UF9A 1RT7B 2DHXA 1VMEA 3RD5A 1DIBA 4JJEA 1FERA 2J85A 2CYYA 2JLEA 4N0QA 1QX4A 1SC1B 4D3HA 2PX6A 1V26A 4C88A 5B1EA 3Q15C 3CEHA 3W7AA 5IMBA 3B9BA 1KAGA 3P9YA 1M1NA 4QAJA 4UNNA 3LHSA 1E2HA 1XPUA 2Q0SA 3G6KA 3W5SA 4PXBA 2P2GA 1EEHA 4LKOA 2ZH5A 2V4UA 1T3SA 3X1LB 5EZ5A 1GL6A 4J94A 4KWCA 1FT8A 2PKWA 2EGHA 3R9LA 2BJ1A 1T8UA 2I7XA 1NVTA 4C0QC 4V3BA 2BGTA 2HI0A 3D54D 1TL7A 5FLEX 1NBHA 2F64A 4XJVA 1UVNA 4WU2A 1U8TA 4G5HA 5IRCD 4YS6A 2AZDA 1U4BA 5T7LB 1KO4A 2YQ5A 3JTNA 3T1OA 5HTKA 1QIMA 4O6VA 5JQGA 4RVHA 1SL0A 1QPBA 2J7UA 1AHHA 3JQAD 4MWCA 3EXEB 4HLUA 2ZH9A 3QGMA 2XQCA 4OYIA 1L7AA 2PYDA 2OT3B 4M0CA 1WVIA 3C14A 2D1FA 3KR0A 1JEJA 2D2EA 1IOVA 1JLQA 4MVJG 1TKTB 4JYAF 4O29A 5AW0A 3S1TA 1WSRA 2GWHA 8AT1A 2VJMA 4DMCA 4Q4DA 3LZCA 5KCMA 1KI2A 3EF1A 5CMLA 3JQPA 1G7SA 1UBNA 4EG7A 4C9DA 4C3KA 4I1OA 4RSRA 2W2XA 4DSOA 4GE3A 4FPIA 3AY0A 2VYND 4KP7A 1Q21A 1XIVA 4WOJA 2H1WA 3RJ9A 2Z30B 2Y66A 5SYNA 1A4IA 2QE7A 3Q9NA 4C1BA 2FJEB 2KJWA 4D9EA 2CJXB 4ED9A 1IONA 1ZVQA 2FMFA 3KSUA 2HK9A 3EY4A 5J2PA 1VRQC 3ZBUA 2B83A 2W6MA 1TVRA 3ML1A 2R7LA 3KLPX 1KFCB 5I7OA 1A9OA 4V1CB 4DA8A 2YWBA 4W9MC 3R5DA 2WTUA 5ER6A 5L7YA 3CUSA 4HZGA 4NXNJ 1LWFA 1NI4B 3W9HA 4Y7CA 2YIDA 4KBIA 4WX2B 1NDKA 1V16B 4Z8YA 2BAGA 2XX3A 4M83A 1TL5A 3QT7A 1L1RA 4BWVA 3N75A 1Q14A 2V97A 3A1EA 1UKEA 4L4RA 4UVGA 1LK5A 1VJQA 2D74B 2ZYDA 4EZIA 4YQZA 1HNWF 1JBQA 5HFJA 4FZRA 3CVVA 1NLUA 1RLUA 4IDGA 5MN5A 5A8WA 1HNXJ 1ORIA 2XBMA 4JASB 4C4XA 4OH1A 2JIBA 2QRHA 1M0TA 2WK1A 1FBTA 4U5XA 3DZJA 1XMPA 4HHHA 4FIZA 2X3YA 1XC7A 1JTVA 3HSDA 2FP4B 3N9UC 1K63A 4KO0A 4MMXB 2RHOA 3JAMA 3MCMA 2Y1CA 3MFYA 2OM6A 2P6OA 1SVWA 3V8EA 1J0CA 1X2EA 5FFFA 1F4VA 1UW4A 1ACMA 5H70A 3OPKA 4UY85 4BFTA 4KLAA 1YQGA 2Y2UA 3O2NA 3SVZA 1HBOB 3C2PA 5HIAA 2HLPA 1S0NA 4RVFA 2GN2A 1DDIA 1WS6A 3ZTOA 1JDPA 1ZK4A 5D2CA 3DAGA 4PFSA 3SZUA 3EZOA 3MEKA 2J3DA 3T6BA 3U2QA 4J2TA 4PSVA 4TS4A 2QN7A 4IIFA 4RS4A 4LECA 2L9WA 3NXKA 4B4VA 2XAAA 2R7TA 3N2EA 3BH0A 3NTRA 2GK3A 3HEBA 5BN3B 1WZNA 3PS9A 1ZICA 1QKIA 3ZE7A 4LGVA 1XN1A 2HHHJ 3ZFVA 1IK6A 3CRQA 2DF8A 1K3TA 2GM4A 3K1ZA 4L4UA 2B6AB 3RBDA 3RU9A 5KTKA 3KNAA 3QTBA 2GIRA 4EX6A 4PHFA 2V6BA 3D59A 4D9FA 1HDXA 4YAJA 4IG3A 2PT6A 1RJEA 3GQVA 2H5LA 1R0WA 3EODA 3IMEA 1OWNA 3HJTA 4BNIA 2Z3VA 3QFFA 3TE6A 1RTKA 3M9XA 4GLBA 1TW2A 1RBOB 2B8WA 1JLAA 2IYAA 3RTDA 5EX3A 4KYTA 2YN2A 3P2EA 1LLFA 2KWIA 1EUDA 3VKWA 3MA0A 4BN4A 1EKRA 3KSDO 1E6EA 1FVFA 4MARA 3C70A 1G2PA 2XKJE 3UVJB 3KLMX 4QGSA 5D77A 2C5HA 2VPYB 4J0QA 4ZIWA 2H4JA 4QT4A 1PCAA 1Q0QA 5DM6Q 1NRIA 4A5OA 4ZDNA 1GN9A 1P72A 1IB0A 4J7UA 1ZWLA 3EGCA 1P7YA 3IWLA 2X76A 2GEBA 4E5VA 3FYHA 1YASA 1RZRD 5CAEA 5JT1A 3L8FA 1U65A 5HFNA 1G4CA 2QLBA 2ZM6F 2IH5A 3EGEA 1VYAA 3ENQA 4C3OB 1VXRA 4RF3A 3VALA 2P9HA 3AUYA 1XCJA 5CCLA 3V7FA 3PDNA 4Z1MA 4CW7A 3MAQA 2H2HA 4KVFA 3KLVA 2FHPA 3MWKA 2CCGA 3BGLA 3MRSA 2WQ7A 4BLTA 3GP3A 2AX3A 2QPAA 3OKCA 4G5OA 3BGOS 2F55A 1T43A 4I3HA 5FV4A 2NACA 2X1HA 4ZYLA 5F5NA 4OYYA 3WGMA 3ISTA 2OJ3A 2OLJA 2AU0A 1EVJA 3K6KA 2HWUA 3TZLA 5K8VA 1GUZA 1HG1A 3JZMA 1UWCA 1XRSB 4ZVOA 3M7VA 2ID8A 1OBFO 4BP1A 1DLOB 5FTMA 2LVWA 2CLHB 2KN4A 2UV8G 1PL7A 3N8HA 1YITS 2B30A 3FPCA 4FZ5A 2NO0A 4DWIA 3DLKA 4PO3X 1GDHA 1WTAA 1Y9OA 2Q3FA 1I13A 2A5JA 2PL5A 4H1WA 3BIWA 4TVAB 2PX3A 3BJIC 4XIIA 4BB6A 4MAFA 2VG5B 2X1LA 4DMHA 2A7XA 3D2LA 1V5EA 3KKKA 3K5PA 1R6AA 1AHIA 4QOFA 4U39A 4PFKA 3R5JA 2COEA 3NASA 1SUBA 3H3JA 3CBQA 3A6ZA 3PICA 1GL3A 2B25A 1VE1A 2CMKA 1W85A 2IU3A 4EUEA 2XD4A 1DQRA 4YALA 1MO4A 4MVJF 3ZHQA 4RL6A 5LJ5Y 2GXQA 2KMLA 2FUG9 4QNNA 2J0EA 4FBMA 1BWEA 3F7OA 4B4UA 4RXMA 3RRKA 4RW8B 4BO8A 3Q3IA 3MQ2A 3I5YA 4BYGA 5BP7A 4O3OA 3DD1A 4ZV9A 3FVVA 1MRSA 2J0QD 1SVMA 4D42A 3WDMA 2A9OA 3BBCA 1ZUWA 2ZBPA 5D3GA 3GVPA 1F9EA 3VGTA 4NCBA 2OB1A 4X65F 3FSRA 4BY9E 5A6SA 1UAAA 4BGEA 4I1RA 4GKKF 1YR7A 1U8EA 1RWMB 1WW2A 4TWRA 4FOSA 5I3QA 1I4WA 4OI1A 2VG7A 4HNUA 3MR2A 2RJNA 3OCUA 4WPAA 2JASA 2NV6A 4A48A 1KGSA 3CW8X 3VR3A 4B6EA 3PQEA 4BQEA 3PNQA 4ZVVA 2KS6A 3HVRA 3AJDA 4FE7A 4BEVA 4A03A 4R6XA 3WGIA 4PQUA 3ZDFA 3I6QA 4RIFA 2XE8A 2OZLB 2EG9A 2H8GA 3ABZA 1XR3A 3A8EA 1X5OA 4ZLPA 1NXTA 3KMSA 3MRXA 1REVA 1UEXC 1CUFA 1JDVA 1T5IA 3TBKA 5AJVB 2CNLB 1WZUA 1E7MA 4QCLA 1SJQA 3NAGA 1OFUA 2P0EA 3TZWA 3DOCA 2XOEA 1HDIA 2C2MA 3WK4A 2V45A 4EW3A 4TLBA 5EGSA 4WJBA 3QWBA 2CXTA 5ELLA 3NEJA 3V42A 1W36C 5C5IA 4BMZA 1WDWB 3U60B 4L5IA 5AM0A 4EGSA 4NPHA 1WC4A 2J6SA 2PZBA 4HVLA 3B9PA 3CB2A 1SVNA 3O8OA 4WLVA 4FBUA 1RCOB 4K9NA 5P8WA 4MKXA 1NW6A 4Q93A 4IFTA 1NZ8A 2D8MA 4FDTA 1T5SA 1V3ZA 3DHNA 3MILA 1HLWA 1YDMA 2JCVA 2AK3A 4CF5A 2XVMA 1YZTA 4DEXA 1W26A 4G37A 5EE0A 4G6ZA 3NGDA 4DUYJ 4H1HA 4K3VA 4NI2A 2BM0A 3UT6A 2IZ6A 2AGQA 2A3NA 4ICIA 1JXQA 3W2TA 2FW9A 4IH5A 3SV4A 4EB3A 3ROGA 2ZCVA 3ZKWB 3NS7B 4P33A 4MGEA 4GQAA 1R31A 2O8BB 3K94A 1GITA 5COAA 1Q7TA 2R8GA 3VRHA 2JGKA 1ONSA 1V25A 1U3TA 3JY6A 5ED0A 4Z0HO 4MQLA 4XB2A 1NLFA 1XV5A 1RI3A 4I50A 3E9NA 4EI8A 1RAEB 3OPMA 2HFZA 2WAYA 2HXYA 2XCUA 3CCLS 5FR2A 2NYUA 5AXLA 4EG6A 2WTEA 3UICA 3H8VA 2BX6A 1TO6A 1KC3A 4ZYUA 3GQBB 1HFKA 1KRPA 1RXCA 1US8A 4FF3A 1PWEA 3BT7A 2X9NA 3KHRA 1AZTA 2RB7A 1HNZJ 1FNCA 2QUHA 1USIA 3WO1A 4I6AA 4EA9A 4HWOA 2YJZA 2IYEA 5BSKA 1M2OB 5JW6A 3GD5A 4G09A 4HFJA 3K4PA 2UXCJ 2QO3A 4KRWA 1AW0A 3SS9X 4FK8A 4GEKA 3V80A 5M2RA 1ZJJA 1CJVC 3RUEA 2BD0A 1S6YA 1Q3TA 2YVQA 4WLUA 3L93A 3M2RB 4M9RA 4V3CA 2VLBA 1NW7A 3OLAA 4AYWA 1QO9A 4CLLA 3H5XA 1M8KA 1NYTA 1ZCJA 2VL1A 1QH1B 5CXSA 4KGXB 3N86A 4WCVA 4M89A 2W8ZA 1MT0A 5KYKA 2CDNA 4ALLA 3KTAA 4C06A 4IRMA 1FDIA 3A32A 1DXQA 2V7QD 1JSXA 2FD2A 3T5BA 3N6VA 1C3EA 1E4YA 3LPCA 1U7WA 1QH9A 3WB2A 2J9CA 4MS3A 1G21E 4BUJA 1SQFA 2CK3A 5E3HA 4GYJA 1DTQA 3U1NA 2KYZA 5CYFA 1GJRA 3WRVA 3EXG1 4HK4A 2X7HA 2MKYA 1CF2O 1SC1A 5HWSA 2VPZB 3C4QA 4Y2IA 2C9OA 4TTIA 3K53A 3IQGX 3W2EA 1GYRA 4DWWA 1N8SA 2VNJA 3CR8A 4W6QA 1FUKA 1L7OA 4L85A 1GK8A 4N7MA 4P92A 2VYVD 4OK6A 3TNDA 4TQUS 1R18A 3MJSA 4N3CA 2X0RA 3E0QA 3TLAA 5CDHA 3MXHP 4OQYA 3OFSA 5C24B 2GNKA 1B8PA 4HBZA 5BSEA 2KRBA 1AUOA 3IO5A 2CQGA 3O4JA 3HO6A 4PAQA 2N75A 1RT5A 5IKPA 3ZZUA 3FLAA 1Q2XA 1JILA 3L7LA 2OXRA 3TIVA 1U28A 3AETA 1BC6A 1XTBA 2SICE 4HADA 4W5OA 3H0KA 1R4NA 4RTMA 4ZU1X 2XMKA 4R83A 4R1OA 2EU8A 3BBBA 2Z04A 3NXZA 1U47A 3I9OA 3CZ4A 1SG6A 5IVPA 3PXGA 3H8YA 5FOQA 3PXGa 3EUAA 4QC2A 1ZIPA 1CZHA 3R8XA 1G0NA 4LBPA 5EN1A 4OX9J 2ZUEA 2PL9A 3RIGA 3TX2A 2PVPA 3PUZA 2B43A 4I5GA 5JISA 2LEAA 3SC3A 4PYOA 3JSRA 4DLKA 3DHWC 2PLWA 2ZHAA 5J2MA 1IHYA 4A3SA 4EX7A 1TZCA 2X7IA 2L17A 4YP0A 4DCMA 1HQCA 3CSSA 1WB9A 3U4HA 2PFDA 2R5FA 4IKOA 3CZQA 1JEEA 3H2LA 2HOQA 4GPAA 2ISCA 2QE5A 1I1NA 1E94E 1ZOSA 4RJVA 4WFYA 3P9CA 4JVSB 1MLAA 4MWOA 4ZREA 4J9KA 1N57A 3BF8A 2Q2WA 4HCJA 3SHVA 1JHUA 3TSAA 2WKRA 2I3DA 1A9ZA 2FEWB 5CB6A 4L3NA 5DDPC 3T6KA 4ZPAA 2J31A 2B8QA 1CY0A 3E9EA 5DZSA 2CUTA 2Q29A 1V8OA 1XRMA 5DG8A 1HT0A 1SCDA 1N5LA 3ZZYA 5K9FA 1AX9A 4AY2A 4KK3A 3CC4S 1CJMA 3KLOA 2BFEB 2BW7A 4DJAA 4QIWD 5JZMA 1JLEA 1KYTA 3IR5A 5CTAA 4RNDB 3NBKA 3GNQA 2XMPA 3GUZA 2ON6A 2VKQA 1A3CA 4REMA 3I0SA 2H4FA 2NVOA 3NEPX 2DNQA 2V58A 1GRVA 1PE0A 3P2OA 2ZM6J 5KFEA 1SQEA 2BMJA 3AX6A 4PGHA 2AOUB 2VF3A 4H4DA 1F48A 1GV0A 1NBEB 4E07A 2IHVA 3D4LA 4HUQA 2ZBGA 3K2EA 4ZO4A 3GV5B 3NDIA 3ROXA 3HJBA 3GZNB 2BZ1A 4KFSA 1NW5A 1B3RA 1NKSA 1PDWA 4NRDA 3WGTA 5F33A 4DIUA 1EDEA 3NBPB 5J2QB 4BUZA 2YMPA 2VDHA 3M9MB 2W7PA 1PD1A 2ESRA 4KWHA 1S5PA 4ZDIA 1SB6A 5KNBA 4Q66C 4TMFA 3DDSA 1O94D 1CC1S 2PUVA 2CPDA 1VE7A 5CVVA 5HJYA 1PD0A 1XBTA 2DT5A 2WILA 1J5EJ 1VHDA 3HB9A 2V69A 4I6WA 2IYNA 2R6HA 1FX1A 4ED3A 4FCVA 2F63A 2I8CA 4L5JA 2H5EA 2V2QA 1NDUA 1CJBA 1WCYA 3V4OA 2X0DA 3E9ZA 4HDSB 4YXFA 1LBSA 2Z9BA 3VQTA 3AL3A 1FX4A 2F00A 5T67A 1DTQB 4X1IB 3JAKA 1BE1A 2C3UA 2Q6BA 1C0TB 2DQKA 2D8AA 2WA2A 1USGA 2Z57B 2VAWA 5EJEA 1WHYA 1IIBA 5D7BA 3MRVA 2F3PA 1SHUX 4KXUA 1TQDA 4LHYA 3INRA 4N1AA 2R96A 4DFDA 4R9UC 3CNBA 2A33A 2OCGA 2VFRA 3U61B 2IRXA 4HFMA 4RXUA 2W83A 1KYZA 1FA0A 2CG4A 3IX7A 3C5WP 4IHAA 3V4FA 4DLPA 4IVPA 4LUCA 5EZYB 3VVBA 2Y1RI 2V0CA 4HH0A 4ZYXA 3EIOA 4RMJA 3KS9A 1WOOA 2AWOA 2PV7A 1XZKA 2LWIA 2FSUA 1FP4B 3ZGZA 3IAS9 1T4MA 4AMUA 1LFWA 4KQIA 1TO2E 2GZSA 2YY6A 5AP9A 3C46A 2ZJ5A 3W1VA 5GQSA 5KNBD 1DL5A 1RABA 2IDJA 4FD2A 4G1MB 4TVBA 1KQ3A 4Q4JB 5IAGA 4CCYA 1GVNB 3KDPA 5LC1A 1KFBB 3QLEA 1FRVA 2BZSA 1KJIA 3H75A 3TRGA 4RWXA 3G0DA 2ZJQQ 2BI8A 1VL5A 3DMHA 5T3UA 3DXYA 4DUZJ 5BWBA 1DE0A 4QM6A 4N56A 1ENYA 1LWFB 2IVYA 2ACEA 4UVDA 4WZBE 5GVSA 1Z17A 3M2VB 1V16A 1CZRA 1DXHA 2IBOA 2GLTA 3KKEA 2QTLA 2YNGB 1YZYA 1Q6ZA 1XZPA 2CLCX 5D84A 3A8TA 2FW8A 5IFMA 1WHWA 2R44A 3FYUA 4JJ8A 4ZYYA 2JLVA 3CUYA 1KFEB 1P17A 3LQFA 1ICIA 4WK4B 2WYOA 4YUXA 3LANA 3DXBA 2FETA 1BHO1 4IAOA 2FLNA 4NLVA 2RQKA 4AZVA 5LA6F 1OBCA 3C8ZA 2FGKA 3TFQA 3WLTA 5AT1A 1OXXK 3C85A 5KJCA 1XCLA 3CRZA 3ZHTA 2CKDA 3US5A 4CM1A 5FJIA 4B35A 1PG0A 3SBOA 1BQXA 2OPBA 1Q0ZA 3A1SA 5B64A 4YWHA 4JJFA 1D4OA 5LMNJ 5LL6P 2PA3A 2WVHA 2GCIA 1VPLA 1GNRA 4XWGA 4BO3A 4RLSA 1KORA 2OA0A 4DUTA 5TF0A 421PA 1E61A 2WWGA 3P5BA 4ELUA 4R1MA 4KB7A 2IODA 3N5FA 2DGWA 3QIAA 4Y2KA 4A36A 1RT2B 4H16A 1XJWA 1E2QA 4UE2A 4R2HA 5FYDA 1W8DA 1WXEA 3FWPA 2ODEA 1HQEA 1IKWA 4ZYZA 3AHPA 1EP4B 1EI9A 4A8SA 4IMIB 1YR2A 3TKLA 2QSYA 3R3HA 4OO3A 2JIQA 5HQ3A 4MKAA 1APBA 1YI1A 4D9GA 4DYVA 3NGLA 3GELA 4KH0A 2V5AA 3RWOA 5C24A 3RU0A 3X0DA 4KO1S 4C29A 5CT4A 3T8YA 4CUZA 3MZ0A 4B84A 2XCIA 2OD2A 1KPHA 3BQ1A 2RGYA 3KLEA 5LXRA 5BQ5A 3F6CA 5IANA 2VFAA 1WCIA 3G23A 3P1JA 3CDAA 2DXFA 2PBZA 2R7KA 3JSMA 1BAPA 2YVLA 1WUHS 2NTJA 2R6FA 1CNFA 5CCXA 4UBKA 5K2OA 3WSTA 3QUBA 1Y5IB 5IM4F 5F51A 5LMUJ 3Q1KA 3E5RA 1SIZA 4LNAA 2HL6A 3MEDA 3EF3A 2Y92A 4IIYA 2LDIA 4BBYA 1BW9A 3PC7A 2P68A 3MM6A 2KLHA 3D5EA 2ZANA 1JQKA 1YRLA 2ZTSA 1Z7YA 3VSBA 4DSTA 1PW7A 1T9GS 1IVNA 3U1LA 4D3ZA 1KI7A 2ZIWB 1MEJA 3L6CA 2YY3A 2V50A 4WKCA 4ESHA 4I46A 1KA9H 4OSPA 4XM2A 3PRBA 2CLKB 4GOXA 3TQHA 5A7GA 3P4UA 1TQ2A 5AJ3F 1WKCA 1AKMA 1MGPA 4AD6A 1OQAA 3QX8A 3CXRA 2R1ZA 4C05A 4DX5A 1KRHA 2J48A 3G2JA 1RQNA 1PR3A 4JI0B 1H9CA 4GE0A 1K1SA 1ZGCA 1GQEA 1D1UA 2NZJA 3NXSA 3HFSA 2ROPA 4F4IA 3UHPA 3T1TA 1PGOA 3VDMA 3V5RA 5GIPE 1LBHA 4B3CA 3BTVA 3KB1A 4Y2RA 3OHMA 1CR6A 4M1KA 3OVBA 4UTRA 4JI5J 3KJEA 4EBFA 3KVVA 2VDVE 1M33A 1JDBC 2VPTA 3W5YA 2LDBA 4TQ9A 3BA6A 4PW0A 3MCOA 4YT5A 2KT5A 3AWIA 1TJ4A 5L38A 3DN9A 3RO7A 4DLTA 1XVTA 4DSNA 3ANSA 4EHDA 3U16A 1ZR2A 4BKMA 3GARA 5KKNB 1XT6A 4CLTA 2MIIA 3SQXA 2V8BA 5F3WB 2QSUA 2DT9A 3OIUA 1NVVR 4LTNA 3USCS 3TBFA 4CV0A 5KZMB 1YR6A 3GOHA 1B43A 1RU3A 4MDFA 4C0JA 3Q7SA 4X4UA 4B3TB 4P7FA 5EKDA 4IQ8A 4FXDA 2QFIA 5JXGA 2PZMA 5TPZA 2AGOA 1QJ4A 4DT1B 2OQ2A 1LBEA 5E3JA 1ZSYA 2VH2A 2VF2A 2ILYA 1W36D 1GPH1 3OQ1A 5EXPA 3EH2A 2Q49A 2E1AA 4Y0AA 3C1OA 2ACMA 2QR2A 2HS0A 1DURA 1RAHA 3R0ZA 1GX6A 3J81j 1M54A 4MDEA 2QM7A 2AUMA 3EIQA 3SHTA 1EA7A 4N8SA 2O8NA 5DDQC 3SMQA 2X5KO 3IDQA 1G9TA 2NUHA 4MGYR 4IJMA 4F3QA 5CIQA 3N9IA 3TIGA 4PQFA 2HSJA 3OCJA 2BZGA 2QUIA 4IJWA 1OR8A 4F5YA 3O2QB 3QPCA 4FGWA 1ZD3A 4NYIQ 3J7AN 3TG2A 1XNJA 1PYOB 4NA2A 2CWWA 3KYIB 3PEVA 1Y1QA 4MGIR 4R9SA 4B2PA 4P4GA 3QF7A 3RVDA 5CVTA 2QD5A 3IBWA 2FLOA 2Z8YM 3HO8A 3QPIA 1C3JA 2QLTA 4XRGA 3H04A 4QZVA 3RJMA 4C6TA 2WJ3A 2OCYC 5BOSB 1LLDA 3PV0A 4P3NA 1YZKA 3SR0A 1TUGA 3W9SA 4NJEA 3OTQA 1LQ9A 2QK4A 1JDJA 9LDTA 3F90A 4RLEA 4ZMMA 5BSMA 1EM8B 4XIGS 1JU3A 3WQPA 3X1MA 1N2SA 1R00A 1SVKA 2XVZA 2UUCB 3SF8B 2Z1DA 3NBMA 3AUJB 3I73A 1UMCA 1HHTP 3M6WA 3OQVA 3TXYA 4TVKA 2AUTA 1V9CA 1IAQA 3CW9A 2V2ZA 4WKNA 2F4VB 2VPIA 1ZMBA 1UQRA 4NXMJ 3PRKE 3ZDBA 3IBFB 1ODCA 2QL6A 3E1SA 4FKZA 5FBQB 4GC6A 4EO7A 2Q07A 4ZS6A 1X9MA 3QENA 3DTVD 1P9OA 1SU4A 4DCSA 2QTHA 3TNVA 2R8JA 1JI0A 2JIZA 3PWKA 3S8YA 3KJFA 3DC2A 1D04A 3U3RA 1KO7A 2R7NA 1BWRA 4HWTA 2C2BA 4Q39A 4EMBA 4M1YA 4C3VA 2FXIA 3PFWO 3KYLA 1XEWY 3TSCA 3QPAA 2PYIA 2KBEA 3Q12A 3G8SA 4BO5A 5H82A 4W6ZA 4K4YA 2GBLA 3QMMA 5LMNB 3RK0A 3KJFB 5G0VA 4F8EA 4CLDA 4DC9A 3CM0A 3HHLA 1U8WA 2PV0A 3AFNA 1OXVA 1YLXA 2ISQA 5JOQA 2BLLA 1ZAWA 4YJ3F 4DLRA 1XRRA 2RSLA 2IJRA 1VPVA 3PEEA 4LSZA 1N56A 3SYZA 1KK2A 1P1KA 4H54A 2Q5LA 3SC2B 1MLDA 3S2EA 3W2IA 1VRVA 3ER9A 2WJYA 4QTZA 2H51B 1JYSA 1WCV1 1F2UB 1OMSA 3FJ1A 3BSAA 4PABA 3R0JA 4LWOA 1H1TA 4A0SA 2DLNA 1TKCA 3CO9A 2BABA 3U7QB 2Z95A 1V7ZA 1V39A 4RBUA 5F7JA 1K9VF 2PUFA 1SVUA 2JFGA 4WCFC 2ZQ5A 4CMJA 1T9KA 2VD3A 3D3WA 2AJTA 1BX1A 3KOZA 3I0SB 1MJGM 1RXIA 1S2OA 1N8TA 2BIFA 1C4WA 1KOFA 1WABA 4BO4A 2Y1JA 2RIPA 4UNRA 1NGSA 4OPMA 5EESA 2D1SA 5HJXA 1GPWB 4OZLA 1C1XA 2HNYB 4KQ1A 4L6AA 1ATIA 5IT0A 4KPFC 5DHUA 3THRA 1YFZA 1QE3A 1LXNA 2TMGA 3SPXA 2C61A 2BSQA 2DLDA 2WV7A 5ELXA 1RQ7A 1ODTC 5EXEA 3LPAA 2EDAA 1AMOA 2LPMA 3AEUB 1IKYB 1N8KA 2EL7A 4CJXA 2B1IA 3JQ7B 1TFUA 3KVNA 4QU9A 5DDRC 2VTKA 1EZZA 3KAPA 1IY8A 3CW2C 4HI1A 5JXIA 4EB8A 4F3OA 1KI6B 1GTEA 1AHNA 4I5IA 5DBIA 1PQUA 1RPNA 3MM6B 5FTLA 3N2YA 1WG4A 3LUGA 1PZMA 1T1RA 1CZUA 4OP1A 1U7UA 2J09A 4CYUA 2Q4TA 5A6PA 4BVAA 3BCHA 3NT2A 4OJMX 5B7PA 3U27A 1JJ7A 1RHJB 1CXZA 2PGJA 2Q0XA 3E1GA 5IF3A 4C7JA 3S27A 4WXHA 3E2PA 1UANA 5LYJB 3SXLA 4DY6A 3R7LA 1H66A 1ZNZA 4F96A 4K03A 3R9WA 5RUBA 4Y1RB 2WJJA 3FRYA 2R7OA 4L8VA 4U7WA 4G4SP 1VB3A 2W9XA 1VFJA 3K0EA 3TW8A 4BVHA 1S1WB 3FPKA 3NQ41 3KKPA 1KARA 4JSYA 2ZQYA 3FUTA 5FULA 4KQ6A 3HMKA 4HDRB 4WLEA 1MAHA 1TK0A 4HN2A 2WVAA 2QX8A 4NOJA 2FHSA 3ZY2A 3KXKA 5DMHA 2PIDA 3R8YA 5ALOA 1RAFB 2G0AA 3AILA 4CR6A 1GHTA 2AD5A 2OWDA 1T0HB 2QQEA 2HSWA 4PAWA 1R3NA 1KJQA 1U0BB 3QX3A 4MKFA 2PEYA 5I3UB 2IM1A 4GKKJ 1FYEA 3TTYA 4EEYA 1X38A 5AW2A 5KOYA 2XUZA 3ACCA 3QZ8A 4IKAA 4K2XA 4J9PA 5JBNA 4UNPA 4C20A 1IJFA 1M8JA 2UZ4A 5A2QU 4C43A 4V39A 3FBTA 3V8QA 5LBIA 1M1YA 4KWEA 2R79A 3JPYA 2RARA 4PFJA 3G7SA 3ITDA 1OV6A 3V8BA 1CUZA 4DF3A 2IUTA 1KMNA 2CCKA 2DVIA 3JVIA 3DU6A 1FFXA 3QTTA 4B87A 1SBQA 3IR7A 2GBLC 4Y2AA 4XQCA 3IPXA 5L4LA 3ELDA 4RZQA 1H38A 1NHGA 4HTAA 3C6TA 1NASA 1ZHHA 4F0JA 4P2BA 1IBMF 2YWFA 5F73A 4XWWA 4AQYF 1SULA 3GZ7A 4WP8A 2Q3EA 4LIWA 3HH8A 2RHRA 4DV3B 1P74A 2LP4A 2C58A 1MENA 1QORA 2AYXA 3CLUD 2ZK7A 4QSMA 4AXIA 2ZT8A 2HJRA 1TCCA 2YV5A 1BH2A 4FOTA 2FQQA 2C0CA 5MF6A 2CQCA 1SCAA 1IQPA 3GAZA 1D8AA 3FH0A 1TJNA 3BM7A 3TLCA 3U7FB 2CMGA 5B1DA 4G41A 1GSOA 2P8JA 4BRWA 4OJQA 3AW8A 4Y2MA 4K26A 3H11A 1MC5A 2WD7B 4OQPA 5CA0A 4TMXA 2M6KA 3WIUA 2J0SD 5DX8A 3LDUA 4UM8B 5KFHA 3A1CA 5JLAA 4RW6B 3I9V6 4QBFA 1S1TA 2QZSA 4IFVB 4JI3F 3EFEA 1TCUA 3LTOA 4IHJA 1FLVA 2H0QA 5TGZA 3CCMS 3JQAA 1VYTA 4MQBA 3HUTA 4G1FA 2JI6A 1Z6YA 3SZRA 5L4NA 4KN9S 4KGKA 2WJ4A 4L8LA 2B4TO 3T7SA 1W76A 2I4OA 2P4HX 3VYUB 1SJ9A 5HANA 3M34A 5T8KA 1R4MA 1AKNA 5A05A 5ESWA 1PJLA 2ZRCA 5CDGA 4YY3J 4XVQA 2POKA 2CPZA 1OXBB 4C11B 1XZMA 2QL9A 2VG5A 1HRKA 1JB0C 3F5SA 3IL2A 1KMHB 5LYJF 3WSVA 3PFKA 4F91B 4CKYA 2RGEA 5HKAA 1G8MA 1JEAA 4YBRA 3D1HA 1QIGA 4YROA 1KRWA 4F1JA 4JMPA 3ETEA 2J7WA 2F48A 4HVZA 4UAVA 2FW1A 4A1FA 4B9SA 3M6VA 4RLFA 3NUGA 4ELVA 1UJ4A 5FKJA 1TM4E 1A50B 2BHSA 4K9KA 3QXXA 2CXSA 3AUUA 3EEFA 3MPWA 4MWBA 4N7JA 4W1PA 3ETMA 1QM5A 1SWVA 4H7KA 2ZI5A 1C0PA 5LN1A 3UNYA 3KZ1E 2HPVA 2X9GA 2UAGA 3DLKB 2C4TA 3MOGA 2MDTA 2XO6A 4QWWA 3MMCA 2NVUB 4CKCB 1DDOA 2WSEC 2KXHA 3NP9A 4GLLA 3ZS9A 4U5QA 3QVXA 5J1NA 2BEFA 5KDDA 4WP3A 1EXWA 4Q4JA 2HLDA 1ESDA 3UHOA 3DTVA 1QO0D 1S77D 4ZDWA 1LSSA 3L5OA 2E9RX 2FV8A 2JBAB 2V4JA 3H5IA 3SHQA 3EMBA 3PX4A 2CF6A 1P5ZB 4RMNA 1ITPA 4E4RA 1A9SA 2QRPA 2OXIA 1MNEA 1SI9A 5A4MS 1FE8A 2REOA 2A0WA 1RYBA 5TRTA 3QRWA 3E6AA 3GRKA 3EH1A 3USES 1IJFB 5A4KA 4FNIA 3AXMA 2F90A 5DM2A 5ETSA 4FFBA 5HVGA 5E6UB 4DHEA 3VQSA 3BL5A 4HXFB 5THKA 3DHVA 1IBMB 2PZ8A 5EJ4A 1DKUA 4RMGA 4LJ8A 2KYRA 2BA9A 2IYPA 3KZNA 3B9QA 3ETDA 2GD1O 4Q9JA 3ZCTA 3EFOB 1R0CA 2J46A 3KAJA 3EQ7A 1SC4B 4OLPA 3NHLA 2VBCA 5TQVA 4PSCA 2CG8A 2FW7A 1KMIY 3GXBA 2O4CA 2QM0A 1QR2A 3ZW8A 5B55A 1TYAE 5IV4A 4YJ3B 3F96A 4EHIA 3BMOA 1Y8QA 2B9EA 1QPZA 3AYZB 1RHRA 1B1CA 1LVUA 4ZJLA 3ZTPA 2HNKA 3QW4B 1OV4A 1QRRA 2Q5IA 5D4OA 3EVTA 1RLMA 4IRKA 4FYWB 1GPBA 3PHLA 5LKRA 1W52X 2VWQA 2R7QA 2LQ8A 3ONFA 2DBBA 1AGPA 4KDRA 3TRDA 4QPDA 2Q5FA 2I91A 4B6GA 3KKLA 3PB3A 5FLXA 2RJOA 1GSAA 5C8ZA 4ZAFA 1SU6A 1KMMA 3NBYC 3ESXA 3D7KA 1PKEA 3KJXA 4D96A 2JJ2A 3O93A 3ND9A 4ROTA 2CVZA 4I3FA 2IK8A 3RRXA 2RAUA 3HR4A 2Q1XA 2DULA 1UMCB 2WZCA 1SH2A 4LW8A 1CUCA 1WMBA 2VJQA 3QWFA 1U8FO 5LP6C 4BFCA 3H42B 4CMHA 4D98A 1BZYA 1QAXA 5DHAA 4Y2CA 1EWKA 2KPOA 1X1QA 4CWAA 2B4PA 3M1LA 2NZ8A 4W8OA 1KS9A 5D3QA 5LNK6 4FX2A 3SHOA 1TZBA 3FNIA 3DL7A 1JQJC 3PGJA 1BLUA 2XB8A 1D9FA 3MJTA 5HVHA 2W7TA 1XKTA 5JADA 1KAMA 5GJVC 2PZGA 2N3LA 5KYVA 1FE0A 5A2QA 4DJBA 3B6IA 2Y1WA 3O8QA 4B3RJ 1NK6A 1SY7A 2O14A 4MUKA 1X4EA 5LMZA 5ISMA 3GA7A 3CIMA 5TPWA 2JVRA 1YBMA 3HCCA 2XULA 4AJIA 3MUTP 4R1UA 2GK7A 2CJQA 3PGA1 2WIFA 4A8OA 4KREA 2C78A 2WC1A 3MEEA 4HLUC 2R751 3ZZZA 2NGRA 3LTNC 1K6EA 3T99A 1SCBA 4RQAA 2XJ9A 4MKGA 3VBEA 3WIOA 3PSHA 2GESA 3GZJA 2G1JA 1Z8FA 4WHMA 4EPWA 1XJCA 2HRUA 4K5RA 4GC7A 1FW8A 4M0UA 1JJHA 5LUBA 3DGFC 1PIEA 2IZ5A 2WG2A 3LFTA 1R9NA 4HQKA 2B4QA 1KKMA 1VMDA 3DCNA 1AQIA 4YHHB 3KBBA 1CRWG 4U1RA 1RR6A 2ZAMA 4OATA 4Y2VA 1I80A 1LNQA 4X66J 4BE9A 1I4TD 2GCNA 2XCLA 3A9SA 4RFLA 2NSLA 3ZZ0A 2EWVA 3RUHA 2YFYA 3BHMA 2DXIA 3EOZA 5SUHA 4FXOA 5NLLA 3NWBA 3A04A 1HL7A 3T7CA 3BD8A 1NDLA 3WLLA 5ETJA 4MA5A 2B6HA 5ABPA 2GQ2A 3POTB 4MVCA 1BQNA 2VP3A 1PKUA 3IAM6 3O4GA 3MM4A 4CPDA 2PI4A 4M49A 2P9ZA 1U7OA 1EP3B 2EYUA 5F0WA 4OBWA 4P81A 3Q8LA 1N34J 4ENWA 2MZ1A 5IVIA 2GX6A 4WACA 4AF8A 2BEVB 3I09A 3O82A 3QBTA 1BGWA 4H6WA 2E7ZA 4AJ1A 3L09A 3B2QA 2BFOA 2MOKA 1SOVA 3HKEB 1IYZA 4X44A 1WG5A 4KGDA 3ZG6A 3A6PC 3VGPA 2PS9A 2OM2A 2GBPA 1C4XA 1Q78A 4KXXA 4DZRA 5C81A 2V4RA 1RYRA 2ZNYA 4EHLA 1HEUA 1B0ZA 1L5RA 2ZIXA 4Q2LA 1FDTA 1WULS 5AD1A 1XAHA 2R8BA 3G8YA 4QFDA 2FUG1 4B9TA 1Z73A 2OR3A 1DUVG 5ADHA 5FO0A 2YDXA 1CY6A 2BMWA 1RT6B 1K8AT 5ECWA 1E5LA 1J49A 4DL5A 3FUUA 3F0NA 1KJJA 3HB5X 1X31C 2XA2A 1V4NA 4FFWA 1JFVA 3U1TA 4JL6A 4M53A 3LO8A 3BEDA 2B4YA 4MW9A 4ZKEA 1QLNA 3FZ2A 1R6YA 2GRJA 2KJVA 1O03A 4L8GA 2LQ5A 1XEFA 2K2PA 1KKUA 2DEIA 3PCRB 5B57C 4TV8F 2A7QA 1OB2A 4BO1A 1I2BA 5I3CA 1XQWA 5F12A 5B58C 2R8OA 2ABWA 1R8PA 4YP6A 4RK6A 5LOVB 4A73A 3T3FA 1SJFA 3VUFA 3N8IA 1C9NA 4LZZA 1L6IA 1RC1A 2CUKA 2RE8A 1PYTA 4KGXA 3DLTA 4Z53A 1N1MA 1F51E 4PZPA 4L4SA 3G82A 1I3MA 1RAFA 2J3HA 2F6RA 2O0JA 2GBFA 3GBSA 3KQPA 4AJKA 1V3SA 1B74A 3RASA 4J9UE 1GNQA 2AZ3A 1S2IA 4FFMA 4TXMA 2WFLB 3WBBA 4B31A 2FQYA 3RB6A 3KTQA 3F4BA 3GG9A 1XRJA 2DTDA 4RW8A 1LQ2A 4DARA 4CM8A 4AB1A 2P6RA 3ZE2B 1GU7A 4TRNA 4QECA 3HLUA 1USKA 4JI8J 4O4HB 3EZFA 5KNCD 4QX6A 4XWTA 1NQWA 3HRKA 2ZHBA 5FD1A 3IP9A 4AM8A 1SD2A 2Z83A 3VC7A 2Q9UA 2XNDD 4D43A 1N36F 2R6GA 4D9IA 1NXOA 4ESVA 3M32B 1S8FA 1T9TA 4K9PA 5JJKA 3VNSA 5JS6A 3AR6A 3K2IA 2FP4A 2VHCA 4L22A 1N77A 3LKDA 4Z4IA 3PJGA 2H31A 2P77A 5AT1B 3RFFA 3GJSA 4OHUA 2AHRA 4ML3A 1OIWA 5FQOA 3TSYA 6PFKA 4C0WA 1OPRA 3TRHA 1X1EA 3K1AB 1TCAA 4JEMA 1P1FA 5BURA 2X1AA 4WFIA 1QYWA 2RH5A 3MLBA 2XUKA 4ZYVA 4IBOA 4J1NA 1K8QA 2XE7A 4HAXA 5AICA 5IC5A 4IV5A 5B37A 1OJ4A 4JN6B 1VSBA 1QGUA 1VQLS 3G5UA 5KTYA 3SE7A 5REQA 1HYSB 4ZRMA 1H65A 2FPHX 1YFJA 3WQHA 4PO1A 1YJ7A 3C19A 4IJ6A 2CVHA 1FNOA 3GCWA 2G0JA 4IH1A 4M7RA 5DTRA 1Q83A 2E4UA 4RW4A 3D3WB 1L3VA 4YIKA 5JYDA 3QG1A 3A6GA 4LG1A 2Q3BA 1UK7A 2IA6A 1L5FA 8ATCB 2INGX 4I6GA 2CL6X 1ZC3A 3BMNA 3DEJA 3T0FA 2EFVA 1WD7A 2P78A 4N40A 1BHSA 4Z2XA 1OYDA 3F9CA 3CCJS 5EP3A 1V41E 1N4LA 2ZSJA 3BS9A 4YX9A 1DVRA 3D4OA 2PXHA 1OSNA 4PLHA 3G6ES 5IJWA 4KO8A 1KVJA 1YBAA 3HLYA 2ATLA 5CM9C 2P2CA 1XZDA 3TDNA 4I1TA 1UVMA 1RQGA 1NBMA 1T34A 3GV7B 1C41A 1ECBA 2CNOA 1UJ5A 3L9XA 4LZJA 4YUYA 1FRZA 1ZCFA 5DP2A 5A4DA 2M32A 3HSKA 3TO8A 1JLLB 1FNMA 2FVYA 1UBRS 2NYIA 1T95A 4ALZA 4CG2A 3FNQA 4UCQA 3OM8A 4I0WA 1HBUB 2WD8A 1PWHA 1VC2A 1JXLA 4BO2A 1RTIB 2FSFA 2LEBA 5JPIA 1GFWB 4BNLA 2QLWA 2Q7OE 3R27A 4KPCA 2HQ3A 2HO4A 4TYMA 1F4PA 4XPIA 3TANA 2VJMB 2BJEA 4EZEA 1D8TA 3AF4A 1HO3A 1Y7HA 2GPNA 2XMRA 3Q0TA 4OHKA 3IERA 1PN3A 4AJOA 3QE0A 4NAVA 2Q6KA 4XASA 4EGQA 4UHKA 4ND2A 2KQUA 5DWVA 4OK5A 2XXJA 3U3ZA 5FIIA 2ACWA 3WLAA 3Q7QA 2FA9A 3IPAA 2JLAA 4IDNA 5HATA 4MVJM 2WG0A 3I0MA 4MICA 1X7YB 3MWDA 4MAAA 4RTJA 5I7VA 4HGOA 4XPZA 3ZD8A 4KHMA 4ZOBA 1FU7A 4YQWA 1U0TA 1Y6FA 2WUWE 3R5GA 2IF2A 3B7GA 3IWXA 2X15A 2DRBA 2DHQA 2MINB 1E1CB 2V94A 1KETA 4RJTA 4NOKA 2BN4A 4S2EA 4WXOA 1IKVB 2Y1LA 1UBHS 3GGPA 4LVCA 1KP3A 4K9DA 1PVOA 4JUIA 2CXEA 4MI3A 1I30A 4DDTA 3CTRA 3UNGC 4EVSA 3EX7B 2MLXA 2QJRA 5KNLA 1VHFA 2RE1A 1E7WA 1DJMA 2GRAA 4RXTA 2ZH1A 2EG5A 3M1YA 2O5EA 1E5TA 3V6HA 4QJIA 1V2GA 1MNQA 1VE3A 2E7XA 2IT1A 1CY4A 5TQ0A 3H9UA 5GONF 2DK2A 1CT9A 1PT5A 1WXQA 3FNGA 3SYNA 3PR2B 3V46A 3T5AA 1RXSA 3VU0A 2LMIA 5ALEA 2HT1A 4M60A 2QW1A 1ETUA 1IY1A 4FFNA 2XS7A 3LWBA 3LK6A 6REQA 3RAXA 3NHKA 1ELOA 3JD0A 4BWGA 4GYKA 3FHCB 2BI7A 5LDDC 2J3QA 3KSRA 1QHIA 2L9DA 4NX2A 5JVDB 1K2VN 3CLTC 2X5XA 2P7IA 5JAMA 5AXMA 3PGVA 1BUXA 4FC6A 1P8GA 4U3JA 4WXRA 4MZXA 2ZP1A 1RYSA 1JHYA 2JVKA 3MUEA 3HS3A 1CUEA 2G1DA 2PMFA 2ORVA 3RV4A 2O1PA 1BDIA 4LSZB 4IX9A 3WBJA 2XAUA 4GX5A 3C5CA 5KFWA 4NRTA 2LZ0A 2XO7A 3HEAA 1FP4A 2WWRA 4XDDA 1A7AA 3RG2A 1KP2A 2RC6A 3KQTA 2P27A 5EDWA 1L4MA 4AROA 1PV2A 4G0OA 1QC5A 3HRIA 4UHBA 4BRSA 1OFUX 4XA8A 1AURA 2EX0A 3HNRA 3OVAA 4S12A 1OSCA 1OZHA 1VRWA 3NHWA 2M8DB 3MT7A 2YIMA 2WQZA 5EQTA 4JYPA 1VIXA 1CEZA 2JEZA 3LGMA 5ALLA 5HP4A 2TYSB 4TL8A 1CUSA 1SB9A 3PZRA 2RQ4A 1S76D 5L45A 3RUDA 2LQ9A 3IGVA 3OJUA 1NH8A 3BKTA 4BFZA 2RCNA 3DOIA 3M8KA 3U3DA 4TXJA 1RCFA 2X6TA 2AOWA 3IV6A 4L2IA 2BI4A 4L0MA 1G8HA 5A71A 4IDBA 5A3QA 1JFSA 3CU5A 3WHPA 1E2MA 1FNBA 3T5TA 1VLOA 3NGKA 4OYXA 3D6UA 1MMNA 3ELUA 1XZHA 1NJZA 4F3NA 5IUKC 5KYXB 3MK31 5C7LO 3PXDA 1S6PB 3WL8A 2OUIA 2BKLA 1KSFX 2QL5B 3KHHA 2HS3A 2A9PA 2H29A 3E58A 1CUYA 4J0GA 2IXDA 1H3EA 1U81A 4E6EA 3HP4A 4XWAA 4YDQA 3FVWA 3BL8A 3GHYA 4FDUA 1MH1A 1NR7A 2WAQD 3GDHA 4MRNA 4M8LA 3Q8QB 4HYKA 4FQ8A 3KQYA 1W94A 5A8KB 2WD7A 1Y98A 2X8JB 3IKJA 3UXMA 1I51A 3OU7A 3K09C 5FRDA 1PLLA 4ZP9A 3T1HJ 1Q79A 5LZ7A 1U04A 5CVEA 3W79A 3OZCA 3V8MA 5EZ6B 3EMTA 4OY3A 2VI5A 4HD8A 3W5AA 1A8IA 1OKKA 1X1CA 3RFXA 2FGJA 2PFGA 4RYDA 3G1TA 4DYDA 4ZT6A 1HOXA 4Q34A 4HL9A 1XTTA 1N0VC 2FQ1A 4QR1A 1XLTC 1DBDA 1R0KA 1ZC4A 5FOXA 3CLRD 3ZIAA 4DV5J 1EVYA 3GEIA 3WK9A 4DQKA 4QPZA 2Q5QA 2DH6A 3LYHA 3BOSA 3VTZA 4YJFB 2JL9A 4X1YB 4D3FA 3STXA 2BDUA 3UJBA 3FCAA 1L5LA 7GPBA 1RRCA 2FF5A 3GLSA 1Y9DA 4MO9A 1LH0A 2WJVA 4R5PA 1YKFA 2NZWA 4RM2A 1J0DA 4YRMA 1PFVA 3NPAA 3FF4A 3H1BA 5JNSA 2I0XA 2NXWA 3GOQA 5L7WA 3DAHA 4AMZA 3BXPA 3O3OB 1JPUA 4ZVSA 4WZZA 2Q1UA 1JBEA 2OO5A 3D6VA 1FTWA 3GGJA 3L7NA 1NL3A 2JJMA 3NIGB 1OLSB 1L8QA 5E6RB 5L3QB 2HAFA 1WPGA 3PRHA 1G2EA 2GCFA 3G0GA 2IEAA 5BPHA 5DXJA 2FVQA 1AB5A 3D3NA 4AG5A 2XSFA 2RH3A 2DX7A 1O8CA 3JVDA 4RK4A 4FC7A 3CY6A 1LBQA 2CKMA 2PL3A 3PUVA 1DKLA 2NVBA 4EGAA 4D0NA 1O3YA 1NSTA 3BD7A 3I8SA 1XMXA 3A4MA 2YYYA 4EFNA 1TV6B 3NYRA 1MABB 1DQPA 1VI5A 1LFAA 1R0CB 1D7AA 2G0TA 2QV7A 4HX9A 4RK7A 3P0JA 4DRXB 3LLMA 4O08A 1DC6A 4O33A 2GIQA 4H31A 1VRTA 4JA2A 4K8RA 5DJ5A 4LBVA 4N8OA 4LRDA 1HA1A 1C4CA 4M5DB 1BVYF 3JAMU 5SY4A 3A25A 3G02A 3ZNQA 2NU7A 4WK0B 1VA4A 2R2TA 3VPFA 4E7OA 1UL3A 4LBIA 2BFDB 1TYEB 2BGGA 1DNPA 1WETA 3SNKA 1Z15A 2GLXA 2OIHA 4OJ3A 2YUTA 3LQ4A 5JNLA 4YCJA 1FFDA 4BVBA 2CJFA 3B6JA 1TR0A 1Y9AA 3HYNA 4LV6A 4MFBB 3VR6H 1H2AS 4I2QB 3AR3A 1OWOA 4MB6A 1YR1A 4TSFA 3AD9C 2NXNA 2H4XA 4C98A 2A4KA 3B52X 5GMDA 3AB4B 1KY3A 1G6BA 1PYOA 4YYEA 3PY8A 5ADWA 4WY8A 4LYAA 3O03A 3IOYA 5C8XA 1EIZA 1M6EX 3QWUA 3CPHA 5HBGA 4RVOA 4YVFA 1MU0A 4KMMA 5L8VA 3MTAA 2IPMA 2A57A 1RHUB 4JUAA 3ZZTA 1XVAA 3VMFA 2P6MA 4ME6A 2B8NA 1Z8HA 2ZJFA 1RAOA 4J0JA 3MJRA 5JNUA 1DJOA 5I7SA 3F4LA 1M1YB 3KPWA 2QV0A 4DL2A 4QJVA 2G1AA 5DYGA 3M5WA 1XU7A 3V00A 1C7FA 1LF0A 3GYBA 3ZW7A 1LJUA 4AO7A 4FJ1A 2R2AA 1E32A 1TPZA 3ZHSA 4C0HA 1QYDA 1Y10A 4MULA 3HT0A 3D6MA 3UUFA 1RZ3A 2PE8A 3IILA 1Y1SA 4KAXA 5GAHI 1BX0A 2FZGB 2LU1A 3DMFA 1FF9A 4O4RA 1ZYUA 3V9PA 3AR2A 4I2VA 1S1TB 2CQ3A 1P4SA 1MG5A 4V0QA 3UA3A 1YU9A 3SAJA 1U11A 3SJ7A 3V6MA 5D3GB 2AN4A 1RJGA 3BERA 3LCVB 4IFIA 1SCNE 4LXHA 3MINB 1GY8A 1CUIA 2YIJA 2QMYA 1Y8RB 3LP2B 3RSHA 4H0NA 2Q4RA 3HP1A 1IVZA 4TKVB 3VR4A 4TSFD 1U0HB 1I0LA 2C5SA 1PGPA 2PC6A 3UZUA 1K7FB 4MYHA 5B0FA 4UXIA 1A6LA 3VJLA 4FVTA 1JKFA 3SQDA 3DOKB 2FJDB 2KZMA 2V6FA 3FMGA 4I55A 1R9MA 1Y7TA 3U3JA 1W35A 2R84A 3GLIB 1L7VC 5CG1A 2HBZB 2N7YA 4X62B 5JLJA 4HR2A 3QW2A 3FOBA 1TT5B 2C2KB 1JHPA 1Z0IA 4G5GA 1VPDA 4RTOA 3ZTWA 2F9MA 4JR2A 4ERNA 1VR6A 7MDHA 2R6JA 1VPEA 4B3IA 4RW6A 1VQ8S 2X0IA 2IE8A 3QT6A 4ICLB 2PGIA 2KRRA 2AMFA 2VIHA 5T6BA 3A9WA 1SVOA 3QQPA 3SQMA 3LY5A 1RHQA 2Y99A 3LBAA 2PMDA 1FYFA 1LXCA 5T14A 4ZJUA 1H4VB 4Z4QA 5FOVA 3KHTA 3UV3A 2OYRA 1GXSA 3IEUA 2G9UA 2B4VA 3N2GA 2Q5HA 3ZWCA 2O7NA 4DN6A 3EC2A 1NOKA 1GXLA 3BTSA 1E2UA 4FYVA 3MN1A 3BGFA 2FPMA 3Q98A 1NIPA 4LF4B 2QD2A 5M2UA 1F0XA 5DNVA 1HT1E 2B2XA 1CYEA 3O9MA 3A4IA 1JVBA 2ZBCA 3K17A 3N6RA 3CN7A 3B1WA 3W77A 4RACA 3H6HA 4UUPA 2WIGA 3ISVA 2W00A 3KK2B 5FEUA 4J03A 5KFKA 3E9MA 1WG8A 1RBMA 3ZUPA 4B3MJ 3U7RA 3BEOA 5K3AA 2I7DA 4FJ2A 3WMEA 4OB6A 1JK9B 1K7EB 4HC4A 4OFWA 3MCVA 1VPWA 1CG6A 2VDJA 3T41A 1SH0A 2XYGA 4ZIRB 3X1ZA 4YJ2A 1IHUA 5HF6A 2XGQA 5P21A 2BEVA 3OEED 4QDJA 4FS8A 5ITZA 3PFNA 3CBGA 3ORSA 1HI9A 4B4KA 1K75A 4PRZA 5JE8A 1INLA 3I30X 1R8YA 3EQ9A 5MN4A 4OYOA 3TCKA 2EVZA 3W7BA 2NO1A 3H83A 1LW2A 2OXTA 4BZQA 2LEPA 1WF1A 2JJ2D 3WTBA 3JQMA 4DLVA 2GJKA 3W8FA 2QYSA 1N7GA 4HB0A 2K7JA 5DLQC 4P74A 5KFFA 4CU2A 1EETA 5DW0A 1EARA 5AVRA 4LDAA 4HAUA 5C7YA 3KT3A 3BSWA 2OAP1 1GM5A 3HZOA 4D2IA 4M4SA 1CPZA 3FMVA 3EG5A 1AMUA 4P71A 1KI4A 2PBRA 3LSYA 3OSUA 3F3MA 1CUVA 3IGNA 2GAIA 3AJ2A 1H2EA 4AP6A 4FLMA 4CR8A 3VZIA 4F7VA 3ZX4A 5ALWA 4JU8A 5BUCA 1KWGA 2P1RA 2WTAA 3GJ6A 1JHOA 4F4DA 2IIVA 5FUQA 2LQBA 3FPBA 4B02A 1E0JA 4UFOA 1D6SA 3L7IA 4YEAA 1NWHA 4RA6A 3HI6A 1RP5A 3GP8A 1TZMA 4KB5A 1VQSA 4OJHA 1KY5A 1GGJA 1GPDG 1SG0A 3ORQA 3FCWA 3BXHA 1RWPB 1C3OB 3FWYA 4TXHA 1Q3HA 1YBVA 1ZHOA 5F5LA 4Q3BA 1SXJA 1X15A 3VNAA 1LVGA 3CJ2A 2QUBA 2V9PA 5BOSA 5ER9A 3ICPA 5B36A 5JC8A 3B7PA 4H3KB 1KMCA 1XNHA 3E61A 2HV8A 3EDMA 2E5HA 4WXYB 5L9XA 1VZ2A 3I1JA 2EZ9A 3IG1B 1QDUA 5CVUA 4FWIB 2NOAA 4C5AA 4V0SA 3RODA 5EA2A 4E6PA 2Y1EA 4BTVA 5L6LB 2GUWA 2BQUA 2DKOA 4X85A 1TQHA 2COLA 3S7ZA 2NV2B 2LIVA 1UL1X 3T34A 3EWSA 2B3TA 1U6JA 2X2PA 1YFLA 4Q3DA 4OQEA 1JL3A 2R7AA 3WAGA 3OUUA 4DRYA 1URNA 4TS3A 3MSCA 4BASA 2C2ZB 2HZ7A 3VPSA 1L3BA 2UXDF 4HRYA 2LU2A 2XLCA 1R9JA 1NK5A 2B9WA 1VHWA 3BWEA 3HRHA 4ZOSA 1EP9A 2F3QA 4U6PA 1N2CA 4YRFA 4G0NA 1E5VA 5KFJA 6CHYA 4YO7A 2VV5A 3UUWA 5C53B 4M5HA 3VZQA 3NTLA 3M33A 1ZEMA 2W2LA 2RGUA 4LNUA 3UB4A 1PV4A 2VAVA 5B0AA 3RG6A 3NGMA 1MNAA 3MGAA 1JWLA 4HH3C 4Q6WA 2RQMA 3GONA 2X22A 1JLCB 1IM5A 1WB6A 2YINC 3GLFB 2RH4A 4L75A 3I34X 1YVFA 5M2PA 5G0SA 3K0BA 5FXMA 2W6JA 2BKOA 3R6LA 1DRJA 2UUWA 5IKMA 4CO5A 3NNNA 2XCAA 2C4KA 3IDAA 2ZPAA 2R4UA 3EVFA 2QT7A 3HCRA 5HE8A 4UOFA 1T35A 4C4YA 2WTXA 3RT9A 5AW7A 2E18A 3DNFA 3EEOA 1QIKA 2H2IA 3IJPA 1KZ6A 4PZYA 1Y82A 3ED5A 3ZGOA 2JHPA 1JKJB 3GB0A 3V2UA 2C2NA 3SF0A 1SELA 1HPZA 2RDJA 4AWXA 4IVQA 5HEKA 1PFYA 2ZJ7A 1HK7A 4EHKA 2DXDA 4HDQB 1OT5A 5DT2A 5AVXA 3NANA 4RESA 2XODA 1QH8B 2UYGA 4UOHA 2XM3A 2IBKA 2ADBA 4TROA 4BNUA 4MJ7A 5BQPA 1EQUA 2EFHB 1TCBA 4GOOD 3LVQE 1DBRA 3R5BA 4B6FA 4Z8XA 4EHAA 4A7PA 2KJQA 4NFHA 2FQXA 5HHTA 1XCMA 1XMOJ 1DKNA 3OFJA 2HB6A 2GJ9A 5KT3A 1CSJA 4N3GA 4N0DA 4MKYA 2ACYA 2WSSD 3L41A 4BVKA 4M8IA 2BMAA 1P2FA 4I14A 4CEIA 5EFZA 3NP7A 2CPFA 1UEUA 1LVHA 3JALB 2JLYA 4HHEA 3DDKA 3C7AA 3N8GA 5I8WA 5LP6B 1EUCA 3RAMA 4UBLA 3MHYA 5TQ0B 1V8FA 1GG2A 1NJFA 1NTOA 4HGRA 1T8WA 4YCSA 4POOA 2DWQA 5G0TA 2ZRQA 1WXDA 2D1RA 4HQOA 3WJ7A 2G77B 3BFKA 2GCPA 4WAUA 1L7RA 2Q5JA 1U2SA 6LDHA 4JX8A 1NDPA 4KO2S 2IDZA 3SQNA 2E55A 2HJGA 1JQ3A 3ESQA 3EY9A 3DKKA 1DWOA 5CFOA 5FTWA 1M74A 1OYVA 1DAEA 5HQJA 5KYWA 2ZI9A 2VHUA 3T1YJ 3PO5A 4UDYX 4GUAA 4DPUA 3C6BA 3AZOA 4G81A 4QVKA 1QCYA 1EWTA 2CDQA 1PQWA 2ZH2A 1PHPA 3V7YA 4L27A 3AUTA 5EJ6A 1THGA 1YSJA 2B8PA 1TV6A 1XEZA 3DUFB 5K0GA 4CEHA 3GLFE 3BSNA 2VO1A 5F9NA 3NTVA 2QRNA 4GMXA 2JVJA 4I9GA 1Z08A 4JMLA 5HS4A 4M54A 4FFPA 4KO3S 1RLDA 5FJ4A 1PCXA 3WO0A 1D4AA 1OAOC 5HGJA 3OL8A 1ORDA 1TVMA 2Y1GA 5DWQA 2HZVA 4JP1A 4QD3A 4ZITA 5AI8A 3O47A 5BNFA 5K8CA 2P9YA 4XCXA 4RIIA 4ASUD 1V45E 3L1KA 3AVXA 3EE3A 3H2KA 2H1SA 1IY2A 4WUVA 3ND6A 2G2OA 4CHTA 2E4YA 5EJ8A 4LNHA 3OFKA 1ZL0A 5JO9A 4XOIA 1C9JA 5KG0A 2XDYA 2ZRHA 5CIYA 3T38A 2VDWB 1JQGA 4BU0A 3RYCB 1JS1X 4H3SA 4GO7X 4WDRA 4Y6LA 3TJZA 4PINA 2LQJA 4JC4A 4OKIA 4OTZA 4JI0F 1P7VA 3BZWA 4D4IA 3RVOA 5JZOA 3MM9A 3UD4P 1D1QA 4HNHA 3FPGA 2QZ8A 3FSXA 3EVBA 3H6KA 3OPYI 3HXQA 4LQ9A 1B0VA 5ALJA 1EFCA 3FHTA 4YMVA 2FN3A 3OL9A 3U31A 4QW9A 1YJQA 1OTHA 1TP7A 1YZUA 3MECB 4M55A 4UBJA 4A47A 3RVKA 1EU1A 4TYAA 4ZQBA 3MERA 5KYYB 4MCIA 1EJ7L 3BDPA 2YN4A 2I99A 3M3PA 1WJ9A 5CLIA 1CQPA 1HURA 4TMVA 2GMWA 4GRDA 2FSHA 5KHOC 2H8KA 1X4BA 3TWOA 1O5TA 5CYGA 3G13A 2B1QA 4KCGA 5BYJA 4WNIA 1ZJ6A 5JFOA 4W5WA 4D8XA 3MGBA 2YKOA 4FEYA 1QVZA 1QDEA 2W6JD 3ONVA 1YSCA 1DAXA 2R9VA 3WHLA 5I45A 1WDKA 3O8WA 1RFGE 1N0IA 4CO4A 1AA1B 3MGKA 3N76A 5CH3A 1J70A 5G40A 3C4VA 4O4HF 3ZOKA 3EGXB 1ZH5A 1J9ZA 2NSCA 1VFPA 4QGBA 5ETOA 4Z54A 3CJ8A 3MM7B 1FS5A 3VFDA 3PJDA 2UZ3A 5JROA 5L1LA 1YJNS 2ZUBA 4BX8A 1FYWA 2DQ4A 4TKTA 3F46A 3VR4D 1VMAA 3GRFA 8AT1B 4MVJA 2W22A 1ISIA 2Z0GA 4UZEA 4E2FB 1X7XB 1FDWA 2W2NP 4C8LA 1IVYA 4CMBA 1XVVA 2DT8A 3L8CA 5F7OA 1Q0HA 1JX6A 3CZAA 3BN3A 4O2LA 4QREA 5CEEA 4UMDA 3OM9A 2JHFA 2GS8A 2VDOB 4PKDB 2C7BA 5KFDA 2HFVA 1RQLA 1KC8T 1RIIA 5DASA 4B08A 1MB4A 4HTIA 5LUAA 2HHQA 3ZDXB 1PVDA 3H2HA 4BWFB 4IFVA 3G6XA 4IMJB 4USUA 2R42A 5EJMA 4LR7A 4L28A 3Q2IA 2WOJA 4DLWA 1Z4LA 4JA0A 4JI6J 3JAWA 3OFVA 5KTTA 2LKZA 4RVUA 4UOQA 4WP9A 1U7TA 3FCOA 3FEZA 1SKSA 1R64A 5D4PA 4JJGA 3SXPA 3Q7PA 4BNMA 1Q5VA 3ZH2A 4FI3C 3C7TA 1WBDA 1KNXA 2QAGC 1HRDA 1LBTA 3DNMA 5SZJA 1G1XA 2V9CA 3A3NB 3OE1A 1E5QA 2JIZD 1BXGA 1WEHA 2QLNA 3HKDA 2LXFA 1JH9A 4Q7LA 3K89A 3ZLUA 4LRUA 2O3SA 2QLBB 5G1OA 4D74A 4MWSA 1X4DA 1SXJE 3CXUA 2O8CA 4FVMA 3J81U 1TZKA 1BNCA 4NEYA 4OM7A 4EY6A 1F20A 4EYQA 1I2DA 4TLDA 3MCNA 3PXCX 1T94A 5BW4A 4O0NA 4N12A 1WQ1R 2H2DA 3K0CA 3UQYS 2WNSA 4C7QA 4DSZA 4QU7A 4LRBA 4CCYB 2EW1A 5JVGQ 1ZIDA 5JJLA 5K0LA 4KR6A 3LUPA 3ZJYA 1WI8A 1MC1A 2J9GA 3DTTA 2PKCA 3ZU5A 1RHQB 1UBLS 3D31A 5DHSA 3KAKA 1J2VA 5C5CA 1PJ8A 1UMDB 2QX0A 5FTKA 4WN9B 3P49B 3HWX1 1QHFA 3AVPA 1IN7A 2BJWA 1B6SA 4F6RA 2MJNA 1FF2A 3UD3P 3WYCA 5K3FA 4PNPA 4TXNA 3DYIA 2XQGA 4OF4A 3ZCXA 3AL0C 2JF0A 1PJ7A 3DCJA 4DLUA 2VDLB 1QOQB 2XQJA 2C9BA 2X1MA 1O54A 4RUBA 3QSYA 2L69A 4J8PA 1HETA 3CE9A 4Z4HA 2ZJ2A 3TW8B 3UJHA 5ICFA 3K5LA 1BU8A 4BX3A 2XYHB 1J0XO 1T9ZA 1XRPA 3Q6IA 1O4VA 4NCXA 3OOSA 1X80A 3IM9A 1WMAA 1H2UX 1NKVA 4ECAA 1NQTA 5HF9A 1TGVA 2XLIA 3TIIA 2Z1NA 2OXCA 3O38A 2WNIA 2HQRA 3HI4A 2A6OA 4ED2A 1PJ2A 2ID4A 2CQHA 9RUBA 2KW5A 4ZVTA 2OAEA 4YJGA 4NC9A 5A2GA 2CXXA 2JC1A 2ZI3A 4RX6A 2AJ8A 3LRXA 4RF2A 1FUIA 3KDSE 5JS7A 3RHTA 4V2UA 1SQSA 3W3AD 5DH9A 4G8BA 3J80A 2C22A 1V5IA 1W85B 3E3XA 1KXZA 3PXEA 4XM1A 3ENNA 3PEWA 4F3RA 2ZUVA 4GGOA 3TZYA 2O23A 1D3AA 1JIXA 2X2OA 2N4DA 3PM9A 4K0KF 3SKVA 3T5PA 4P35A 4MT1A 4CKZA 3WLJA 3FFAA 4ARAA 3MMBA 1DWPA 1FS6A 2JGIA 5EUMA 2QWXA 3EBLA 5TC4A 2DB1A 3KLHA 1YAJA 4Y98A 3AQ4A 2G88A 3NS5A 3VU3A 2H16A 5LP6F 4P7KA 5JAOA 3ONQA 4CDRA 1KGDA 3PGLA 3WQBA 5AJYA 4TTRA 3ADOA 1FFSB 1I3NA 4EKEA 2K3IA 3LBHA 2XNQA 3G1UA 4XFJA 1DBSA 5K1ZA 3MR6A 1XA3A 1U7HA 4Y9UA 1K3UB 4U8YA 2X9QA 3OPYB 1U1KA 4DJEC 4F7WA 4RBVA 2HAEA 3ND8A 3OC0A 3CNNA 1RTDB 2OGZA 3QWAA 3A1TA 5C2GA 3OIYA 5BR8B 1ZA2A 5LZ2A 4BN0A 1HWIA 2CHQA 3CIOA 3T1VA 1NKCA 1Q53A 1HM5A 3F9RA 3LW7A 5DIZA 3HY4A 5D0EA 3AC0A 2CLDX 2JFZA 5LA6A 5E2IA 3P4UB 2B82A 4Y2TA 4N39A 3SCJE 4ND8A 3ILOA 3DNPA 1P6QA 3W6ZA 1TADA 2DR5A 4DL9A 3QMPA 4KUGA 1Z2CA 3NG1A 4GXTA 2LCIA 2XMBA 4KIUA 1EZ4A 3S5JA 3L1UA 2XT0A 4PPZA 5AJXA 2ZUTA 2J9DE 4Z6KA 2JG3A 5ICCA 4WADA 3L8GA 1HC7A 4BV3A 5E6SA 2J0QA 5CP8A 3WGQA 1GZ7A 4P9NA 3GG0A 2DIUA 4LV5B 3IP6A 3PFGA 4AY3A 3IEVA 2YQ4A 2IM2A 3DLBA 4YI3A 1OBHA 3OR2A 4K59A 3V4MA 1BWQA 4K4WA 2YUIA 3L6UA 1RWVB 1K3FA 1IWOA 3HB1A 5D4NA 2IYRA 4NS1A 2YNHB 3LI2A 4IOAQ 1VOTA 5I8PA 4C8YA 1L6RA 3GEDA 3EA0A 3T12A 2CBXA 4RBTA 3OD2A 4XO0A 1O77A 2IXGA 1L3IA 3KXLA 3OZGA 2OPSA 4MLDA 4ECUA 4PXEA 4ZI5A 1E3MA 4B2IA 4U2GA 1UJCA 1U4SA 2GHVC 2WQ6A 1ISGA 2CAJA 4ANEA 3MS4A 1ILEA 3ZNNA 1G2QA 2HU7A 4JWKA 4EGJA 4NPOA 4N4AA 2NAFA 2IOHA 2DBYA 4EKNB 3K8YA 1KONA 2ODPA 3M6UA 3H9CA 2QB5A 3VNVA 5B7NA 2YX1A 3WK5A 1Z8DA 4DADA 4FSHA 2B8JA 2QYTA 1RACA 3RABA 3NTUA 5FPSA 2FPRA 1Z2LA 2PLFA 5UKDA 2HMIB 2HCRA 5HSPA 2UZ0A 3OO1A 4G0UA 4J7CA 3LSTA 5EXTA 4JWTA 4UKDA 5KVCA 3F6EX 4D0LB 4A5SA 3KFVA 2VATA 1QVVA 2A6PA <