1LK5A

Structure of the d-ribose-5-phosphate isomerase from pyrococcus horikoshii
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
229
structure length
229
Chain Sequence
MNVEEMKKIAAKEALKFIEDDMVIGLGTGSTTAYFIKLLGEKLKRGEISDIVGVPTSYQAKLLAIEHDIPIASLDQVDAIDVAVDGADEVDPNLNLIKGRGAALTMEKIIEYRAGTFIVLVDERKLVDYLCQKMPVPIEVIPQAWKAIIEELSIFNAKAELRMGVNKDGPVITDNGNFIIDAKFPRIDDPLDMEIELNTIPGVIENGIFADIADIVIVGTREGVKKLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-Ribose-5-Phosphate Isomerase
publication title A hyperthermostable D-ribose-5-phosphate isomerase from Pyrococcus horikoshii characterization and three-dimensional structure.
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Isomerase
total genus 76
structure length 229
sequence length 229
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2002-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lk5A02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lk5A01
3CEDA 4NMLA 1FRZA 1PBTA 4GO7X 3OC6A 1Y89A 3CH7A 1UJ4A 3DHWC 5T41A 5JJBA 2R5FA 4GO5X 2QMXA 4L5JA 1XTZA 3TUIC 4OQPA 1PSDA 4R7TA 3ENWA 3U7JA 3OFFA 2OKGA 2FGCA 5IT4A 1RWUA 4LUBA 2KO1A 1ZPVA 3IXQA 3P96A 1HOTA 3ICOA 2RE1A 3EB9A 4L4YA 4PWUA 1HORA 2LVWA 1YBAA 2J0WA 3MTJA 1CD5A 2BKVA 3MWBA 3EFBA 1O8BA 3OFGA 3KV1A 3LHIA 2PC6A 3AB2B 2RQMA 3DC2A 3OBIA 3TUZC 1M0SA 2DTJA 3N0VA 1VL1A 2I9SA 1JT9A 3DDNA 3L7OA 2CDQA 1DEAA 2RI0A 1UJ6A 3KWMA 1SC6A 4M8LA 3TUJC 2PA3A 2W48A 1LK5A 5IS2A 4L51A 4OQQA 3O1LA 3BXGA 4X84A 2J0EA 2QMWA 4L5IA 5FIIA 5HJ5A 2DT9A 2JOQA 5IT0A 3S1TA 2J0XA 2WU1A 3E7FA 2LQJA 3LUYA 2JHEA 3E15A 3IBWA 2BKXA 1YGYA 2P9GA 4IO1A 1NE7A 1KS2A 1LK7A 2RI1A 4L50A 1FS5A 1LKZA 2GNPA 2F1FA 1UJ5A 3LOUA 3MAHA 3CSSA 2RQKA 1FSFA 4TM7A 3K5PA 3OFEA 3BXEA 2O0MA 2P9CA 2F8MA 2P9EA 4L4ZA 4R9NA 3HN6A 2MDAA 3NRBA 2QRRA 3AAWB 2QSWA 3NWPA 3DHXA 3OFHA 2NYIA 3HHEA 3UW1A 4GO1A 3W7BA 3ENQA 1FS6A 3BXFA 3BXHA 4TM8A 1FQOA 3LWDA 1U8SA 2H9ZA 2ZHOA 3NZEA 4GMKA 3AB4B 3TX2A 1Y7PA 3ENVA
chains in the Genus database with same CATH superfamily
4NE9A 4AO6A 4ZTZB 5FPYA 4DQRA 3DOIA 3PFGA 4CGZA 2I55A 3ZGYA 2PBFA 1H69A 4E08A 1GP2A 1I3MA 4RKYA 2KO1A 5EFZA 4QDZA 1T5TA 1JJBA 2W5UA 1N34F 3MHPA 4FGZA 1HZZA 2MQPA 4R01A 4J5OA 2BFAA 3GJQA 2A6MA 4MUBA 2QTLA 5CB4F 1FJ7A 4FQ5A 2MT9A 3V1LA 3H0EA 4AF6A 3FJ2A 1WKKA 3IYLW 3PDUA 1WB5A 1PJ4A 2QZ8A 3GFBA 1F6WA 2NO7A 3FB1A 4MKBA 3ZIDA 4OHZA 2W0MA 4B5KA 2CD9A 5KPJA 3CXCR 4Z1MA 3GRVA 3T5AA 1P2GA 5KYNA 1R0CB 2CEKA 2AVDA 1KO4A 5EJ8A 1ODIA 1BG6A 4O29A 1HL7A 3WBBA 2WMDA 1X5TA 4IKPA 3QVJA 3DCNA 1T35A 4H60A 4B83A 2VA9A 5CLHA 5IVKA 3JALA 4J9OA 4YMGA 5DM1A 4QSHA 4L0MA 5G4KB 4DMLA 5JJIA 3I2HA 3R7NA 4HYEA 3W5ZA 4C78A 2J0UA 2AFIB 1AROP 1FWKA 2QMUA 1XZMA 3N2ZB 2ZJBA 2VYVA 4IR7A 4MI6A 4MHSA 3MWDB 1MR3F 4B3RJ 4RK4A 4WKOA 4V0NA 1P91A 1JDPA 1V8ZA 2CQGA 1GPJA 3ZNUA 3OJUA 3T8YA 3IO5A 4O4GA 3THXB 3CX4A 4FYWA 3LF0A 1GPKA 1JQGA 1FNBA 2B4PA 1H2BA 1XXHA 2CPIA 3AQOA 2LVBA 1PYOA 2E7ZA 4EBBA 4ZJPA 3VNRA 3PX0A 3I2GA 2O14A 4PYMA 1YDEA 4IIBA 5FTMA 3REOA 2F4VJ 4I9NA 2XXJA 3DVAB 3JQDA 3NRBA 1HK7A 1G5QA 1MO5A 1NUPA 1CK4A 3MEQA 3CZMA 2JGMA 2D1QA 2FCRA 2DECA 2QZPA 4JXJA 2R6JA 4UMDA 3MD3A 2CBZA 4DSOA 1DXQA 4BQEA 2XI2A 4WY8A 1AH2A 5KINB 2VFAA 1ZJ6A 1E94E 2WINI 5CYMB 4DBLE 3CJ2A 1VMEA 5LBIA 3TWOA 5KOJA 4TN2A 3SF8B 3W2GA 3PWSA 5CNKA 2W2LA 3SFGA 2MYPA 2G0JA 3NW9A 3RGIA 2GM5A 5C8YB 4PFQA 1EDOA 1JI0A 2EZ4A 2A5GA 3BN4A 3IP5A 3EGEA 2ZE2B 1N32B 3TNFA 4LNAA 4BATA 1UXJA 2J3DA 1VYUA 4UHCA 1U9IA 2VBWA 2ACWA 4MUYA 5DEOA 4CJXA 2B2XA 2PGIA 4GLLA 3MGCA 2OC4A 2YDXA 1L8LA 3JTOA 1BROA 5AJ3F 4WL0A 3OM1A 3ZBTA 2C5EA 1QHSA 3T9FA 3AD7C 1CB0A 3WIVA 3JSMA 4NCHA 4G9EA 4NTZA 4RZIA 2JHFA 1BJTA 1YR6A 4WU3A 3C98A 3I9V9 3U4QB 2QSWA 1JIQA 2BVZA 3IUQA 3N7AA 2JGDA 4LSZB 2BF7A 3LQQA 3AUAA 4ZRNA 1DOAA 3MGKA 1H93A 1QHIA 3BXZA 1PGNA 1QKIA 5I7FA 4GO7X 5AYVA 4XD7A 4R51A 4N3BA 1I2BA 3ILLA 3SSSA 3P94A 1IEWA 3ZZ0A 4F50A 3WHIA 4HDQB 3VSAA 1BXGB 2JGFA 1OI2A 3NRJA 4NAVA 3UQSA 1KFCB 4V0LA 4J9PA 2WD8A 1JMVA 2QLJB 5FNVB 4DV3J 2MDTA 4HT3B 1N5RA 1X2EA 2VOEA 4UOHA 5EUQB 4WK4B 1SD2A 3D8UA 1Q6ZA 3A70A 4XB1A 3TNDA 4JLJA 2WZCA 5ED4A 3M1VB 3QLJA 2FPLA 3BSNA 3PYDA 2NZYA 2VPWA 2PXCA 3K7EA 4NCGB 4LSWA 3HYTA 4JV5B 2OILA 1A5BB 2LA6A 2FPIA 3OAAD 1GU0A 2V8BA 3ZWBA 4DEYA 4X20A 1FDIA 1MEJA 4MLDA 2DB3A 5KT2A 4ZQHA 1KR5A 3PXDA 4KU4A 3IAS1 5C42A 5HVHA 3ISVA 2YFYA 4NOJA 2ZWVA 5DCYA 2Z3WA 4OHWA 4G1FA 1ZI8A 3RS0A 3L1VA 4FEGA 4HH1A 3RS5A 2G1HA 3WNVA 3D8BA 4DM7A 4BLUA 3PR4A 5IKPA 5KMGB 2LKZA 3C74A 3OJLA 1XHFA 1KVUA 1GZ3A 4DCUA 4QWDA 3R3HA 1BSVA 2ZJQQ 1VMIA 3ICEA 1UMJA 3TM4A 2WHYA 4YN3B 3ZNOA 2A9KA 3R44A 4DJTA 3FRYA 1WXFA 1QVRA 1NMQA 3ICPA 4Y9SA 3IQZA 3KYDA 3MMJA 5C1PA 1QAJA 2Z0MA 1CULA 4DSFA 4WNAA 2ZAMA 3O3CA 5JAQA 1O2DA 1T8PA 3O4IA 3G87A 5A8KB 5CXSA 1REGX 5E9JA 1IUPA 3BQ0A 2C8JA 4OSEA 5G1PA 1O87A 1SXIA 3FPGA 2PJRA 3ABZA 3VPCA 3AV0B 1RJFA 4KQFA 3H7AA 4ILKA 5IBQA 3PKYA 1I3NA 3L92A 4BUCA 2DNMA 1DQNA 4AQYJ 2QL7A 3RGWS 4ZKAA 1VQ8S 2PG3A 3EMKA 1DXYA 3U3OA 1Q8BA 4GLFA 2CJWA 4QUEA 4LBPA 2ZUFA 2B1GA 3GJTA 1NBMA 4ISBA 2VR1A 3UAVA 4YS6A 2W7PA 1VG8A 1RP5A 1G98A 3EMDA 4NLXA 2AT1A 1KA9H 2DBRA 5GADl 3K7RA 1GFZA 2J5KA 2YY3A 1WKBA 1P9NA 5KFIA 1XTQA 2QYSA 3SNHA 3C24A 1UTAA 3ZD6A 1MX1A 2VPZA 4F7WA 3GZNB 4DV5F 1EBUA 2V6JA 4CYUA 4N8DA 4P2MA 3TWZA 4A9AA 3MM6A 2D3O1 3SHFA 3L8YA 2ST1A 1G3QA 5DX0A 5BWCA 2CSXA 3ZDCA 4ODIA 5IWCA 2ROPA 5FBRB 2YIJA 2H85A 2WV9A 1GY8A 2OFOA 3BKFA 4XYEA 5B64A 5AM1A 4ZXPA 3MEKA 3PQ2A 2G88A 5AT1B 2X1AA 1QQ7A 4Y1RB 5ALWA 1FSFA 1ZHHA 1IU9A 3TOSA 4FB4A 1U3GA 3CKMA 1N2EA 3QU2A 3CDUA 4C0OC 4TMWA 2GUGA 1AQNA 2IV3A 4UXJA 3OH8A 4FKMA 3CRW1 3UMMA 1NK8A 5ALTA 5TMDA 3KPUA 2XWQA 4MVCA 3C8UA 2XMQA 2DHEA 2BD0A 4I3GA 3VR0A 4N5NA 4IDDA 3MT7A 5KYVA 3IJRA 3PFIA 3JTNA 4KSCA 2HHLA 3A6DA 5KC8A 3LPAA 4X65B 4NESA 1JLKA 1XNHA 1II8B 3CC2S 3AD8C 1NHWA 3M6MD 1Q57A 3L8CA 3MSXA 2LLZA 5CEJA 4J0JA 4R0EA 3JYOA 4PZPA 3GV8B 1HNVB 4UD2A 2PGJA 3OT1A 3DGPA 2JEYA 3N6VA 4V2IA 4YVFA 1XZKA 1X7XA 2QE7A 4G63A 1WXEA 1I24A 4V0KA 1TK0A 4DL4A 4QU8A 1NVMB 4NENB 4IUDS 4M9XA 1CJVA 3MCWA 4E5MA 3KFVA 2JLZA 4DG1A 1OZ0A 2DWQA 2ZWAA 3KZXA 4JI2J 1KY5A 3MWFA 4WKPA 4DBLC 1G3RA 1ZTTA 4CNQA 2GC8A 1NNDA 2ZH2A 3FGZA 2QC3A 5EHGA 3FYUB 3H83A 2RGYA 3OEEA 3CCCA 3QA3E 4HL6A 3KLHA 1N54B 4WNIA 5SZKB 1ODFA 3NP7A 3SR4A 2DLDA 2CY0A 3ZC3A 5EHQA 2C3OA 3FFXA 3WK4A 4NH4A 4I4CA 5JMTA 2A5DA 2ZYUX 4K6OA 5HWSA 4MDEA 3LW5C 4KQHA 4P0PB 4DA8A 4D8WA 5AHKA 3R2JA 3ZOKA 5EIWA 1G18A 4DOMA 4N3GA 4EEYA 1RXUA 3ZO7A 1A96A 1UKEA 3LZDA 5FOQA 3E01B 1J5OA 4ZA2A 1IHPA 4Y2VA 3BXGA 3K0EA 2CQ3A 1H1DA 4MPDA 3IOEA 4MYRA 3R2DJ 2BFMA 3BF7A 5GJCA 1WVMA 4M87A 2ZI3A 4KDRA 1ISFA 1RWXA 1YNSA 3LOUA 3W8RA 5BR8F 5KFQA 4P8RA 3PDIB 4FIZA 1RYDA 3I04M 1XO1A 2B4UA 3CUVA 4FYHA 2VIIA 2JDID 2WF9A 1A2BA 4KQGA 2FWPA 2OBNA 1K75A 2YUTA 2J3QA 5I4IA 1N6LA 2HBQA 3GYXB 1JMYA 3AVOA 3GLHE 2HAEA 1NVVQ 3VX4A 1XTZA 1HA1A 1S1XA 4IIEA 5JSKA 1W1UA 1CEEA 5HF5A 3CDBA 2EFJA 1MOSA 4P7BA 1PEAA 1G21B 3ZWDA 4CM7A 2FUCA 6LDHA 1HGXA 4NBLA 1U65A 4KGZB 4Y1FA 2FZCA 1IONA 2FKNA 1S57A 3LH2S 3EJMA 3CCWA 5DLFA 3D4NA 2XMSA 4H4KA 3QJ5A 4M8LA 2ZSHA 2W98A 1DKQA 3VGPA 4MWCA 1NVXQ 2J45A 4HACA 1X7DA 5C80A 4KQ2A 3SYLA 4CTAB 1VI7A 1Z22A 4D3SA 2H5JB 2ZVIA 4PBTA 1NPKA 5DXAA 4PO1A 5B3KA 1QIHA 2C77A 3B13B 3VU9A 3A6LA 3BAZA 4B3TJ 1J2UA 1TQHA 2GXAA 1B0TA 4ESOA 1MH9A 2BCEA 3LUJA 3SSOA 1UPPA 5KCMA 4V1CB 3A6PC 2OBFA 3ZV3A 1IUOA 5JQGF 5IOLA 3HU5A 1S9FA 3NBMA 1QZ3A 4TM8A 4JP8A 4JYMA 4PZLA 4RIGA 1SY7A 1L3VA 1RAEA 5TY0A 1KK1A 4KR0A 1TK3A 3HNPA 4MNTA 1K44A 2QM0A 3MCTA 2BMVA 4D4LA 3PG9A 3C3BA 3NH9A 2XZTA 3ETDA 1AXGA 4A8JB 1FBTA 4G5QA 2IMOA 1TCBA 1AT1B 2HAIA 1L7VC 2CCKA 4GX1A 3WXBA 2FSGA 5HJYA 4C3KA 5FYQA 1ZC4A 3HCCA 1V9CA 1C29B 3D0OA 1EGMB 2I5JB 4K4TA 2C5SA 1N33F 4XIFA 3K1ZA 1TL1B 4UFOA 4I55A 4NSNA 2EW8A 5BWOA 4U0JA 1RYMA 1LCIA 2NU9A 2D41A 1CLUA 2E49A 1X7HA 2JEOA 3K9FC 3H6GA 3C2PA 1H5QA 2FRXA 4IQ0A 4FZRA 1A71A 1Z6PA 3VU0A 4BNMA 1RI3A 4DC9A 1NM5C 1ORHA 4BFUA 4O2AF 1SD5A 4FJ1A 4WACA 3DOLB 3LCCA 5LA6A 1T0BA 2X4DA 4U7CA 1OZHA 4D9CA 4AWXA 3AC0A 4Y2XA 4YR3A 2H9ZA 3BDAA 3JYNA 4MI1A 4X95A 3U62A 3QKSB 3KEFA 4V1CI 4LT6A 1T1EA 3NC1C 2X9VA 1L4GA 1V1JA 4DDTA 4KFUA 2Q0QA 1ZR4A 4YCNA 5KSWB 5D0HA 4KFTA 4KRXA 5AI0A 1CDEA 4E1VA 4ZU6X 3HLKA 1FDVA 5AE2A 3NAMA 1Z6QA 3HHKA 4DMGA 3LH5A 1CVLA 4QOTA 2CC2A 3RR7A 4X62F 3V4SA 2E7WA 4DL6A 2POQX 5JC1A 4BNGA 1YVUA 1V8PA 4HNAA 3R7LA 3ZZUA 4YAFA 5A7GA 3V1YA 3R74A 4KDCA 4UQOA 5D7BA 1AQIA 4LMBA 4JOCA 4K8RA 1F3FA 2GCEA 2G7MC 2IOYA 2JHCA 5BN5B 1PYDA 3ILIA 4RGVA 1VL0A 2JRLA 1XXLA 4Q5VA 2P6OA 4LF9F 3GCWA 1PX2A 4UVEA 2RDJA 1IZ9A 3M3HA 2CJBA 1J2YA 3OPYA 2YVUA 5TGZA 4IO9Q 3E22B 2ZSKA 3FHLA 2IHR1 3DCAA 2FQQB 2HMYB 4ANDA 1CY1A 3AUUA 1E4YA 4B08A 1M5VC 3CEDA 1RLUA 2QX4A 3PGMA 2WTNA 4O23A 5I4MA 3GROA 3BJMA 2VOJA 5BP7A 4IIXA 1RE1A 5DP1A 2LKDA 1GAOA 3I8OA 1GAEO 4S2UA 3H7HB 1X7ZB 1K4KA 3I32A 5CIWA 5L6LB 2HJWA 4LBIA 2FW1A 3DHYA 1S0OA 2G5CA 2C9BA 2HWUA 1P0MA 3HV2A 3P6YC 4C4PA 1GL9B 2A1TS 2OA0A 2X7IA 2ZSDA 2IU0A 2WI8A 3HRHA 4GI2A 1N6IA 3MMXA 5G41A 5IFKA 1S79A 2BFOA 2PVPA 3I01A 2NLWA 4KT0C 3ETLA 1EFHA 2PGDA 4M9CA 4N9WA 1JJAA 4LCEA 1VMBA 1HQEB 4QA9A 3BS4A 5JCXA 5DOZA 4ZT7A 5K4GA 4OHRA 4OX9Y 3UVEA 5AHXA 3F9RA 3GSIA 2JK0A 1W7WA 2QXUA 2MKCA 4DZRA 2OO5A 5G02A 2B1QA 3KKFA 3LUFA 1WU8A 4YRBA 2YXEA 1W85A 4DWWA 3GRUA 2UUAJ 4MRRA 1LBEA 1I3LA 2HHHB 1KFEB 5K3BA 2QA5A 1OLSB 1XB2A 4UVIA 2DT5A 3WDLA 2G63A 1ZSVA 2XI4A 3X0DA 3E61A 2VDVE 3EQ7A 5K0LA 1SWVA 1OVGA 3RYTC 1E32A 1GHTA 4CIVA 3O0TA 1SKYB 2G83A 3R7SB 1GRNA 4QJ5A 4DV2F 2ATIA 2O23A 1DRUA 2I8AA 1QH9A 1U0NA 4KVFA 1V5IB 5I8PA 1MNQA 4NH0A 3BHMA 2QEQA 4IRKA 4BFCA 2VDPB 2Q28A 2BOAA 3OBBA 2ZRDA 4IBOA 2ZI4A 2JAHA 4ZIVA 2CLHB 3QBVA 1D6JA 2J8SA 5B3JC 1OI4A 4HADA 3RRKA 1KFDA 1EMDA 4RY2A 3AKEA 4G0MA 4P4NA 5AI5A 3A37A 3DV0A 5DN9A 4M99A 4J7UA 4M9RA 3SJZA 2Z2YB 1MABB 4HJRA 3IWLA 4FJ0A 3LBNA 5K3FA 1IJFA 1Y5NB 3CNQS 4DLWA 1J2JA 2NSLA 2JFFA 4LYJA 1CS4A 1QH0A 1I8TA 5AM3A 4E6PA 2O1XA 2ZIUB 3CKKA 5CLJA 2IHTA 3L6CA 1G5FA 3GEBA 2LU2A 1HDGO 1EFPB 4FMBB 2RF2B 2ZRFA 2VRBA 5CXXA 2WAAA 4LFAJ 4KUEA 3RJMB 4BO3A 2G9RA 4HLQB 1NVAA 4INPA 5HOQA 4ECVA 3PQDA 4NVRA 4AL7A 4OK3A 3EX7C 3UICA 2IRWA 3L5KA 1C1BA 3GIJA 2EWWA 2V3WA 1VLVA 3JZAA 4YX9A 1GG5A 4BRWA 5FI5A 1P4GA 2HCJB 4ED5A 1CUUA 5DS7A 2PS3A 3HD2A 2RAQA 3DXBA 3OY7A 2F3SA 3U4CA 1B3BA 5IMBA 4R8VA 3A1FA 4QVGA 2HF8A 1ZZFA 4FGLA 3C43A 5EN1A 5FNZA 2BJEA 5JXGA 3BXEA 2MJLA 3TL2A 3K0SA 2A14A 3F8WA 1QQTA 5I42B 3RYCA 5BSHA 1BO6A 1SB9A 3KK2B 4NZMA 3OZIA 1LJLA 2JLGA 1F9FA 2FJ0A 4KXNA 4QQRA 4TYWA 4BBJA 4TRRA 4KWEA 2ZTLA 2XMBA 4RZXA 1J5EJ 2PZFA 1F4LA 3ESRA 4A5OA 3I9V6 4U2GA 5BSFA 1Q21A 2Q9CA 4GKKB 2HFOA 3J80U 3IPYA 3OU6A 1CF2O 1F51E 1M6YA 4GLJA 3MPYA 5AUPB 4TU7A 3ABOB 2UYHA 4OD0A 1PZXA 4PPGA 3NS7A 2RGDA 2AGQA 3NHSA 2QTHA 3LUGA 2BJ9A 1CY4A 1U99A 3L05A 2B5OA 3CE6A 1R43A 2BACA 3COYA 2PWBA 2NTVA 4DIDA 4EI7A 5ILOA 2VP9A 4YQEA 4HFMA 3SJUA 1H7WA 1GFSA 4PQRA 1WDTA 1E2BA 3ZWKA 3OTOB 1M2VB 1NW8A 3HT3A 2PL5A 1K4MA 3G2JA 3LOQA 3KETA 3HJHA 4IY1A 2RKOA 3H75A 5C34B 3D6HA 3DONA 2CVFA 1BCRA 3QY9A 3UJ9A 1R4NA 3AUXA 4Z8YA 2B94A 4DEXA 1OFHA 1DLOB 4ZN1A 4EFMA 4R54A 5BVHB 2X0IA 3V46A 1NU6A 1TL4A 3DR5A 4PO8A 3WNDA 1HUQA 3ZXXA 2Y6UA 4WIIA 1BIFA 4BNTA 2LCFA 3E7XA 4IJKA 3UATA 1OPIA 4URGA 3Q3VA 2R85A 2CVEA 2CZQA 3JV7A 5JXSA 3LMKA 4BZQA 4F5YA 3BE5A 4XIYA 1E99A 2E5JA 4ZA1A 3B5JA 3C85A 4MUEA 4LQ4A 2J0WA 4TL7A 3W9HA 1V16B 1OZFA 1W4ZA 2OLKA 3L4BC 2NCKL 1MQ9A 1FOEB 4I6EA 3T3DA 4Q7QA 5BW5A 2ZANA 3KHHA 2HIMA 3I6PA 1UIRA 3R3SA 3D1OA 1U1FA 4DR3F 5A04A 1EUDB 4B4VA 3B4MA 2HHWA 2R1TA 4N40A 3OCYA 1NMXA 1KJ9A 2G1AA 4G5HA 3EIHA 2E1RA 1VYVA 3JQAA 2P9CA 4DNPA 2PYIA 3Q8UA 3O4FA 4DV4B 1I94J 3FNBA 3TTXA 2FW6A 3SQGA 3I2KA 4L8YA 1U1RA 3VJRA 2EDCA 2E37A 2BABA 3SOZA 5JFGA 5BNZA 2O6LA 2RUSA 1RS0A 2FDNA 1DTEA 4CW7A 2OUGA 3KHGA 4KFRA 1AKNA 2ERCA 3IVMA 3MINB 5KZMB 3JZMA 3SQXA 2BKLA 1KI6B 3ZDQA 3RUCA 4H7IA 1NU4A 2Q6OA 3LPYA 3HY6A 4RTKA 1QVFR 3HVHA 1E3IA 3U6KA 3A27A 5FWXA 3DDZX 1NRWA 4QFBA 2GBFA 4RCYA 2HK7A 2ZHBA 4FB5A 2V5AA 4YJFA 4IJUA 1ONSA 5HIAA 2I4IA 1ZH0A 1R4AA 2YFHA 3OIFA 3FPSA 5CM2Z 2VF3A 1NI4A 1MMLA 1APSA 4O4HA 3AH8A 4URSA 1NF2A 4WN9B 3ZR4B 1R0WA 2FX5A 3VNAA 4ETZA 2MR6A 2J6TA 2DNQA 3SXUA 5TPZA 1V4VA 1KEVA 3UWKA 2XJ4A 4D96A 5AI8A 4FFRA 5F7ZA 5GV7A 1NK5A 3STVA 2C4NA 4P2XA 1P44A 3DOOA 3HDHA 4ES3A 2GK6A 4UM7A 3TA1A 3DLIA 1S59A 1GL6A 5EA2A 3K9BA 1LW0B 2ZEJA 2YXNA 3NHAA 3A3PB 2FUKA 3DEZA 4Y3UA 4I6GA 2A9RA 5A03A 1P7YA 5LD2C 1DDOA 3S1AB 1FNMA 1YA8A 3JS9A 2HYIB 3I61A 3FTNA 1BFKA 5J2UA 1KZ9A 1WUHS 1NUAA 4EZIA 1YCDA 4RPGA 5I7RA 5JNTA 5HLFB 4JKYA 4QRHA 3BCRA 2WSEC 4C4WA 1XHLA 4PSAA 2HT1A 5CVCA 2NUTA 3FEYB 2O8DA 3UC9A 3B38A 4CLKA 4JI6B 2OPQB 3EZFA 1A9XA 1GDHA 2PEHA 3IIJA 1M2KA 3DLPX 2FLVA 1U8AA 4NLUA 1E59A 3V4OA 3IPCA 5IM4A 4LMPA 5KQMA 4MAKA 3B89A 4DTCA 1SC3B 5IZCA 1XU7A 2E5WA 3U44B 3V4LA 1GSIA 1KSGA 1QGUB 3P0IA 3VU1A 3PX3A 1Z25A 5EEHA 4C05A 4OEHA 2GTHA 1J0CA 1WG5A 2G9ZA 1CF9A 3GLIE 3UXYA 2HNYA 3FNQA 2WSFC 1NVGA 3NU1A 1K5DA 3RBAA 2Z04A 4I66A 2CV1A 2O54A 1WF3A 4DPKA 1KJYA 1PZHA 2B36A 8ABPA 5AM2A 2X42A 4ED8A 3KLIB 5DTQA 4CKYA 1A7JA 1DO0A 2Q21A 3F7NA 1DEXA 4NZNA 2YKMA 4URXR 4B4DA 1ESZA 2CLEB 2ABYA 4RCVA 3R3YA 4IZIA 1RDFA 5J2QB 3U3RA 1JH8A 3ADOA 2H4HA 2BL4A 4PVCA 4C2BA 4LHYA 4AXIA 4FYYA 4C0WA 1CFZA 3CH4B 4JOBA 5CB8A 5DSTA 2HIGA 3L0OA 2G9UA 4LF4F 1SXPA 4NPCA 4A26A 2AL7A 2QRKA 5KUTA 4TKUA 4OHUA 4QAJA 1GTRA 4XKJA 2SHKA 1TQDA 2WHPA 4CV1A 1W0KA 3TQRA 3IWXA 3QPDA 1NJ6A 1GA6A 2AE1A 5HIJA 5FLEX 1BEZA 1P2FA 5BR7A 3AIOA 2D5IA 4HBGA 2JGKA 1N2JA 1B73A 2QLWA 5F3ZA 2FU5C 5HIIA 4MCHA 3ZX5A 1IM2A 1PW7A 3IFEA 3OSNA 4JUBA 3DLJA 2OD9A 3I2FA 4DF4A 4QYTA 5MN4A 1X5SA 1P9OA 3OMWA 1Z7GA 4B3MF 4UASA 4HYYA 1SH7A 3SNKA 3V48A 3UMGA 2DAPA 1H1LA 3E3AA 2OXIA 4D9EA 1T7PA 4TU8A 3GJ0A 2FJPA 1FQJA 2C3MA 3G82A 3AOEA 4BVJA 4CDRA 3TLAA 3OPNA 5DBFA 1B3RA 4HFJA 4PYLA 1RLCL 3GR0A 3U5ZB 4ZP9A 2WA1A 3UJPA 5EXDA 1D5CA 4H0CA 1RXCA 1GRRA 1Z08A 5HJ7A 2ZYIA 5ETQA 5A0TA 2FZKA 1X9SA 3O8OA 2AX3A 3LPLA 5KVCA 1XC7A 2AOUA 3NY0A 4PX9A 4DCVA 1WG4A 4N5LA 1IM6A 4FYVA 4FHCA 4JU8A 4UY85 4YJDA 4WWSA 2LMIA 1JEEA 1F2GA 3RUEA 5CYPA 1DX6A 3IHWA 4ZDKA 5DYYA 1YZQA 1TZCA 4DX8H 2VFSA 2AQ8A 2W9XA 2W8ZA 1XKLA 3P4UA 4PLGA 4MEAA 2AGVA 1BS1A 4BAUA 3C3YA 3JARB 2GEDA 2YWJA 5ALHA 2FY8A 2CDRB 1RJDA 2E5LB 1S89A 4BXOB 2XMUA 3FMOB 3Q8KA 2RUGA 4C29A 3EXFA 3KK1B 1XCGB 4DL9A 1I9CA 2GJKA 4QLAA 1XTIA 3HYRA 2DHQA 4BBPA 1T1JA 1KJWA 4REQB 3STUA 2D62A 3EXHA 2HA3A 3IKVA 2GHRA 1KHTA 3JATA 1Z83A 1KY2A 3H86A 3QVOA 3VQTA 3MPWA 2DFKB 4EW1A 1OXXK 3M5DA 5FLKA 1M33A 2LDIA 4QL3A 2XZOA 1Z4IA 3W90A 1NZDA 2SXLA 1NYLA 4FKBA 1X4DA 2FWNA 5IVHA 4ZVRA 1VJ1A 3KOZA 1T2DA 1M1YE 3IERA 3KHLA 5BQFA 4KO2S 4BHTA 2A9QA 3DMYA 2YIMA 5I45A 1HDZA 3AHEA 4Q3DA 2HA6A 2BBEA 1IOWA 2BYTA 4PM4A 3WFIA 1RWPA 3PPVA 1TQ8A 4JI5B 1GRCA 2ZRGA 4UAUA 5DETA 4LSNB 3ODGA 3HX9A 1W76A 1J06A 4TMTA 1NKBA 4RVDA 4MARA 3MUNA 1IJKA 1W35A 3MJFA 4UBLA 3T52A 1IY8A 1T11A 2Y3IA 2YVSA 1IM5A 1U7DA 5HATA 4XVQA 1QO7A 2VDJA 2WY2D 1PNVA 5CFZA 2HWIA 2W4CA 4TLEA 4B81A 2ZJ2A 1DWPA 3WLJA 1ZZNA 3T7IA 3H8JA 4MV7A 3LC2O 1TCAA 4OXIA 1VGVA 1WABA 3H87A 2TMKA 3NO4A 2RGAA 4MVJI 2QI9C 4EOGA 3MGJA 4KO1S 3ZTSA 2V55B 4L3NA 2E3JA 5H82A 2JZ5A 1YKFA 4LF5B 4LSLA 4RESA 5CURA 3VR5D 2ZXEA 1QUEA 2Q49A 3EE6A 3OFNA 1X4AA 3QOWA 1T6BY 1NBEB 3L0ZA 1NONA 1RGVA 1U2EA 1W88B 2PZMA 2BYCA 2XMRA 3W1WA 3HB4X 3QU4A 3OCUA 3K4PA 2LCWA 3OL7A 1X1BA 3D59A 3FQLA 1XC9A 2ZH4A 4OGWA 1QIFA 4HZGA 1HBOB 3CD0A 4LRTB 2OV4A 1T9GR 2IV7A 4BJ5A 1EE9A 1J21A 3GTYX 5D85A 2XUPA 4J9RA 3IO3A 5EGYA 2XSFA 2Y1RI 2QQ5A 2CPHA 5H9EJ 4Y34A 2HEIA 3HKBA 3VH3A 1DWQA 2GYYA 5CFQA 4M1KA 4MPRA 2LCIA 2E5IA 2BFDA 4G0ZA 2N47A 3IJEB 3UTCA 2CYCA 3KYLA 1W4CA 1P2UA 4BS2A 2VAXA 1VQLS 3IBWA 3MM8A 1KZHA 2PMHA 3HN2A 5TF0A 4ARIA 5FR2A 1VCOA 5KWSA 3MTDA 3B9QA 4V0RA 4F0JA 4KKXB 4OFXA 3NONA 3TARA 4DV7J 2ETVA 2NYVA 2ZH8A 2C2YA 4KYIB 3GEPA 4IQMA 5K3DA 1NLMA 3WIBA 1RACB 3SR3A 1M2JA 1T1SA 4BE4A 1GRQA 2B56A 2RGGA 2Y0BB 5K09A 1FLNA 2ONKA 4B8YA 4ESVA 2IP2A 1NULA 4JBGA 4CQMD 4EG3A 3F0NA 3DAYA 4DXAA 1T8SA 4RBTA 2VDOB 2VNHA 2Q1WA 1RT1A 2JGEA 2XYHB 3ZCRA 2ZI6A 3OOHA 1YBAA 3SKYA 2CL6X 5CT9A 5IARA 2R7NA 1Z5ZA 1ZICA 1VE5A 1YB5A 1LNQA 1FYFA 4FXDA 2XH8A 3MURP 2RHCA 1KGDA 4QDJA 4L0DA 4ND7A 1XMVA 3QW2A 2ZIXA 1KERA 5JSUA 2F1JA 3BK1A 4LGVA 1E8MA 2G1UA 2JEZA 1GN8A 1BQNA 3W3AA 4IO1A 1IUKA 2KYZA 8AT1A 4IFIA 1KQKA 2WONB 4B2PA 2VG8A 4H3KB 3AVUA 4HDKB 5C0OE 3KJGA 1ZRMA 4MGYR 4RDHA 1P1KA 2XMTA 4Z2AA 1LJUA 5G0TA 2C7QA 3KXPA 1KBZA 1W581 4BNDA 4OOFA 4YB8A 2WE8A 5A0VA 1LZKA 3QFCA 5CLLA 2V2KA 2R97A 3EGIA 3M5PA 5ALJA 3KTDA 5L40A 1T2AA 4NYZA 2ECQA 2WNIA 5JV5A 1VSQA 2E6UX 4GL4A 1OHHD 1JXVA 2IPMA 3SC2B 3NM5A 2C3UA 2XLCA 2ZSIA 1WRBA 2D06A 1VIDA 4GKAA 2HMIB 1WBJB 1XERA 2CXSA 1JDBC 1G8YA 3AVPA 2AR9A 3QZ8A 4RGBA 4PCVA 1KFSA 2FWIA 2G0CA 2PKYX 1K0TA 3V00A 4G5SA 3PYGA 3S8MA 3P2MA 4ZLJA 3R20A 3KWMA 4ZXFA 2X23A 3ZKAA 1NI5A 4LBWA 1V8BA 3T5GA 5E1MA 2XTNA 3RVMA 3U19A 1X4CA 3UMCA 2JAQA 3H9CA 3VR5H 3C6XA 1Y3BE 2QSUA 2YBVA 3T1QA 3DVRX 4UOEA 4FS3A 1BMTA 4CLPA 4R9VA 2C4WA 5TARA 4A8SA 3DLHA 3DEHA 2QX8A 5CT8A 2H4JA 3UTDA 3HKCB 3D7RA 2OEJA 4O8ZA 2MZTA 2P11A 3REFA 5C81A 1BHNA 1DOHA 4O25A 4NHEA 4DX7A 1SXJA 4I6YA 4UQGA 1S4MA 4HPJB 4BGVA 4YJGB 2Y0EA 4B4UA 2OZKA 3PQ6A 3CH7A 3WKAA 3F44A 1GQSA 1CRQA 4BGEA 2DY9A 2A2CA 5JSYA 4ECXA 4GC7A 1NFQA 1X70A 4FWIB 1PGJA 5D3MB 1T3ZA 1CUWA 2ERRA 5H9FK 5JXJA 3HJCA 4F6LA 3TCNA 5FA6A 3I9JA 3LBFA 3T0GA 1USIA 2AX4A 4RSGA 4EQ6B 3TLCA 4AO8A 4HQNA 4YMIA 3EWGA 4BB6A 5AVQA 4DGSA 4P0TA 1MMFB 2Y76A 5JQWA 5A6WA 3FD8A 5GADI 1SD1A 1TTHA 2WG0A 5SZIA 1NWCA 2M4MA 4MFBA 3OQ1A 3N9IA 3MD1A 1W0JA 5D3GA 2IM0A 2IQ5A 3RREA 3X44A 2ILTA 2RJNA 1IULA 4ZOSA 1Z15A 3R40A 2OPSB 3R9KA 4ZRDA 3TDKA 4YJHA 2GAOA 4BFSA 4B4WA 4UVDA 2ZZNA 3OLCX 4TYBA 1HOXA 3NGUA 5DU2A 1U0HB 2GHQA 3TQSA 2HNZB 3LWDA 2E9SA 3NBPB 1TAQA 1XYGA 5L45A 1N3BA 5T4BA 1KEEB 1ECPA 1XQIA 3OIDA 3DV9A 3NJ4A 3ADPA 1EWQA 3ILXA 1UVJA 1E2PA 4Y2PA 2VKRA 2XB8A 3SMQA 3K9HA 4HP8A 2R25B 3DTVB 3PR1A 1CBUA 3GRRA 5K8NA 3IRXA 1TYAE 2ENWA 3PX7A 1PT6A 4KKOA 3L18A 3CEMA 4ARAA 2XUKA 3IV9A 1XI2A 3T1YF 16PKA 2HEKA 5LLDA 1WUTA 2B9VA 4B9TA 4DR6B 3PFWO 1Q0SA 3NIWA 2FOXA 4WT7A 1IOLA 3SIWA 3AHFA 3K94A 1QG6A 2GR9A 4LYHA 2OCPA 1RWVA 4OYRA 3NVAA 5L3ZA 1QGZA 4YV7A 2CNOB 3TMAA 2ZJ0A 4I8DA 1JLGA 3QK7A 3IE2A 2XMKA 1OBFO 4F45A 2UXBJ 3HGTA 2XWJI 2ZQZA 4B2LA 1ZSYA 4BVFA 4KWIA 2PCLA 1P1JA 3F47A 3CKYA 1HW9A 2Q9AA 1JA1A 2WLTA 4PZAA 1AN0A 4UUBA 2W42A 1TL7B 1D2EA 4O2LA 4ZFNA 4A91A 1IAVA 3OXGA 1KH2A 3MLEA 4IRDA 4NEZA 1YZUA 4MRNA 4DEZA 4OL9A 2JCXA 4E2FA 4CFZA 1K9MT 2X76A 1F9EA 3WMWA 4MINA 2QYCA 4YGXB 1R4ZA 2CZCA 4RUCA 1SKWA 2BGIA 3U0BA 1XZLA 4X1IA 3PUXA 3F6YA 2GS8A 3BH6A 3VAZA 4EX7A 2RHTA 2EBWA 5C25B 1L4FA 4Q15A 2IYTA 4L07A 4UUOA 5AW9A 3TCXB 4ED2A 2X9LA 2R60A 4ZLLA 5IT0A 3KG0A 1BNCA 4HNTA 1A0OB 4WBNF 3OCZA 1UFQA 2MTLA 4AICA 3R0QA 4GLBA 3AXKA 4MJKA 2UUBJ 1A82A 4JBHA 4A8PA 3L6BA 1WQ1R 3AFOA 1P1TA 4HXFB 4ITUA 4P9SA 5J4HA 2JX2A 3QEOA 3LGAA 1HYSB 3SYZA 1YK0A 1PR1A 3G17A 1UXOA 2DNNA 5JDCC 1GZDA 4LXHA 5KX5F 3KG2A 3Q6NA 1KO8A 3CWJA 1N5KA 1V35A 1O58A 4HNQA 5B2ZA 2IEGA 3BXOA 3M4ZA 5CX4A 3TQIA 3CNOA 1KJQA 3O8DA 1HPZB 1RTDB 4EF5A 3T7AA 3ZXWA 4INOA 2V7EA 2CWKA 1LDBA 4QBTA 5LB4A 3CRNA 1X42A 2WSSA 1LWFA 4QHTA 2AG5A 3R5GA 3PQ7A 1Z0UA 5A0YB 1RT4A 2V7TA 4GXTA 1DCKA 1I3OA 3T9AA 4XQGA 4JR2A 4KPFC 3GYBA 4JUZA 3BR8A 1T05A 1E7RA 2LNDA 4IFEA 1I51B 2XDQB 5KPDA 1LKZA 4U96A 2QTRA 1XJ5A 3JR7A 3L43A 4KX3A 2WUDA 4CM9A 2ZE8A 2V4RA 1KXZA 1BUXA 1BA3A 2QTWB 4E22A 4TQRA 4ZV4A 4X61A 3ZK7A 1CR2A 5DN6D 5AVRA 1Q79A 4EKDA 2IPNA 5FTKA 1ZK2A 1Y1QA 3CRMA 3PCRB 3SSAA 3FPAA 3L82B 1NSAA 5EIFA 1QTMA 3ZE6A 2NQ2C 3MCNA 1QF9A 4BTVA 3WDMA 2DG2A 2HSEA 1CQIB 1G8KA 5DISB 1FDAA 4QNRA 4CO5A 3DEJA 3OR2A 1DE0A 5I7UA 1SK8A 1JHAA 2P9QA 1Z2AA 4R2WA 2WYOA 3BZWA 3IT2A 2ZUTA 3H17A 3NYQA 2IP4A 1VSVA 3WK7A 3RB3A 5GVSA 4ETXA 4ZIRA 3RIHA 1ZD5A 4P38A 1A6LA 1KP3A 1S0VA 1CEZA 2RH8A 3SJCA 4GI7A 4ZCMA 3V6KA 5DWQA 5C24B 2PUVA 2CNLA 4MR9A 2RI1A 3EG9A 4DIFA 2XTJA 4NBUA 4LIPD 1ZY2A 4ADSG 3TEGA 3Q1LA 3FA2A 1SOWA 3QYAA 1YB7A 1U6JA 3QKWA 4F6RB 3ONEA 5HUHA 3H6KA 4LKOA 4DSUA 4BMZA 2ZS9A 1L9KA 2X40A 3HXQA 3L7CA 4ZK6A 1EFVA 1CX9B 4L5AA 1Z2ZA 1NBHA 4DUZB 3M8KA 2FPPA 1Q14A 3PPIA 1DIRA 4UTNA 2QRQA 4C2AA 1E9EA 3U1MA 3UMVA 3WRYC 4HNUA 2AJ4A 4QIWD 4BNJA 1T2CA 1TFUA 3IMGA 3T5TA 3IBYA 3PFHA 4QW8A 4DV1F 3LOPA 2A0UA 4PYQA 2JBAA 4HTIA 2R8BA 4OVKA 1QVZA 2DXEA 4YIHA 3T61A 1WHSB 3LNTA 4UNRA 8OHMA 2PLAA 2XMMA 1W4LA 2IL1A 3PHEA 3I39X 1JN0A 4JB3A 3COVA 4GF5A 3EY4A 1PGPA 3BKWA 1NYQA 3FLEA 1YH3A 4QBHA 3IEPA 1NH7A 4MPJA 1FKPB 4MMZB 2YVAA 3KEOA 4CMKA 2MYUA 4UCFA 5CDTA 1R27A 3CF4G 1EZZA 4JH0A 5ALMA 1NXPA 2H2AA 1NHGA 5LP6F 3O2SB 4A4DA 3EM1A 4X66F 2C9CA 4GMXA 1AF4A 2G36A 3GVIA 4H7PA 5LUBA 3BYRA 3SR0A 1RXYA 3G7NA 4EHJA 5GJVC 3QUTA 3Q7IA 2R62A 4MWBA 2OTCA 3LCMA 1NBIA 1DLIA 2FEOA 1XQVA 2CPYA 1HM5A 1JX6A 1JLAB 2HHAA 3IURA 3IIMA 5IPFA 3K5LA 3DZKA 3JVVA 2B3DA 3M6AA 2HVHA 1T1RA 5K14B 1VBZA 1E5LA 2I7CA 3DWIA 3BVPA 3VUFA 2VHYA 2FEPA 2XKAA 4BS9A 2ZIGA 1K8XB 3A3KA 4RIFA 2QRLA 4TZ6A 2EQ5A 3WYGA 4ZMSA 4Z0HO 4X24A 1KAEA 3K53A 1Q12A 5JXIA 5DDQC 1VI2A 3E82A 2X41A 3RS4A 5DJBA 3O1IC 4YCMA 1JB1A 2FVXA 2G13A 1GLNA 3COJA 1L3SA 3AZOA 2PFFB 1SA0B 3QWBA 4R7GA 2Q3JA 5EIHA 2DT8A 3WKDA 1AY0A 2ORIA 3IQHX 4F91B 2FZLA 1XUOA 3DOJA 2RDIA 4JVNA 3AA9A 2HYDA 1ZTWA 2OFWA 3ZHXA 1BMFD 4OZ2A 1U1KA 1M1XB 1CUGA 5F2NA 4KBYA 1U4OA 3QPUA 4U2FA 5EVJA 3ZN2A 4JUDX 4OQJA 1DWUA 2WFZA 3OZGA 4DX6A 2VYNA 1NFFA 4IRCA 1ZA1A 3VR4A 3W7VA 4TYPA 1I6KA 3VMFA 2VATA 4XA8A 1SBNE 4RW9A 4US2R 2A9PA 4N0QA 4UOFA 2HF2A 2MQ8A 5EE5B 2EU8A 2GQ2A 4IHQA 3PLRA 4WA8A 1SVWA 4QDOA 1FUUA 2I67A 4PN7A 4CKBA 4UTGA 4IJWA 4AXXA 4HLUC 2XMCA 2KTQA 4RCZA 1OAKA 3DD1A 4JLOA 2FZEA 2GM3A 5LLSA 3MUEA 2O67A 2C7VA 1MJ5A 2YCLA 3V7WA 3BWMA 1Q74A 5EHNA 1C3EA 5KHOC 3WP1B 4PHFA 4C0LA 3WKBA 4Z51A 2O7SA 1RT6B 2ILYA 3PFNA 1DPGA 3TLEA 4FD3A 4P4SB 3DB1A 3FTPA 1J1ZA 5EAIA 5PNTA 2R7OA 2PUCA 4MGEA 1PP4A 3NORA 4FDVA 5HEKA 1RE0A 5A1TA 2B98A 2HZAA 2VV5A 4WFIA 2A5YB 3Q2OA 5F78A 4KAXA 4L75A 5IXUA 2BMWA 1LK0A 2DUUA 2C7GA 3LP2B 4WLVA 5D0GA 5FPQA 4TLLB 4BZZA 4FVMA 1Q2XA 3GLFE 4RKWA 5FQOA 3K17A 2P6NA 4X3PA 5J4LA 4QYMA 4W5RA 1KEZA 3D7LA 1RQGA 1ZOLA 3DMFA 3FF1A 4RTRA 2DY0A 5ERYA 3CX3A 3OQ6A 5ADVA 5K9FA 2B4TO 1GNKA 1JF8A 3C15A 3E7DA 2O48X 4GI3A 3T5CA 4XM0A 1T9TA 1CPZA 4JB8B 1OC4A 2AHOB 3LVRE 2CFOA 3Q11A 1Q77A 1F2UB 5F1YA 5LMUJ 1ZA2B 1RQNA 3Q12A 3OJOA 3UR0A 2VZEA 3MR5A 5ETOA 5LT5A 3SZ2A 4N56A 3V5NA 1T3GA 2QL6A 3F74A 2RC6A 2IS1A 1NQ5A 5ITZA 4PIMA 2ADOA 2OG2A 4FCWA 2XCOA 2HNDB 4LDPA 1US8A 3EOAI 4QIGA 3FTDA 2J7KA 4AY5A 3N8KA 1VQ9S 4QU6A 3L79A 2NX2A 4IS2A 1ABBA 5FFMA 5DGTA 4F5ZA 3ZKWA 3DOKB 5CB6A 4C20A 4Z2YA 2WAQD 1S1TA 5DULA 1LC3A 2W6JA 3MQ2A 5F1OA 4EVSA 2ZYDA 4EEZA 4EVRA 3SDEA 2PZAA 3P2OA 1ZEJA 3ZVRA 3TFQA 4DIUA 2RU9A 2CKWA 4BNHA 1KRHA 5LL6P 3VNUA 1CJMA 3AFIA 3KXLA 4KNVA 5JISA 4MWTA 4MLCA 1S1WB 1GQ2A 3VZCA 3RSQA 3I0MA 2KXHA 4AYBD 2HCTA 3V55A 1KEPA 4DWOA 4RJ2A 2ORVA 2OWEA 4URWR 1RWKA 3QELA 4BNZA 4PLTA 1L3IA 1Z4KA 2F8MA 4CETA 4U2KA 4GRDA 4FFWA 2E5GA 1RKQA 2WWIA 2O1EA 3A9VA 3N2KB 5KFXA 2QNIA 2UUPA 4DR5F 2XR1A 1YQGA 1L5OA 2FP3A 1SC1B 4H4EA 2INGX 3GMSA 3EBPA 5CLGA 1YFKA 3BH0A 2X8LA 2C4HA 4ISCA 1B7YB 5BURA 4X4TA 2VPXA 2WP0A 3FETA 2IOHA 4JBWA 3OFKA 3EUWA 5ALLA 2C0CA 3D6MA 4X65J 1G4AE 4YJ2A 2BDTA 2OHVA 2NOAA 1EWYA 4YHHJ 3EZYA 2O8CA 4OQYA 3HI9A 4YP3A 1Q5YA 1RWOA 4NYOA 1L4EA 1R88A 2B1IA 5IC6B 4X90A 4KJIA 4LFBF 4M83A 3NAHA 5LMZA 4S35A 2N75A 2PANA 3KZCA 3DW3X 2JAWA 4DR2F 2Q2NA 2QJTA 1Z56C 4B7ZA 1JR4A 2VHJA 4O8CA 5A5GA 3QMPA 3IV6A 2RAUA 3I55S 2WMNB 2QFIA 3GB0A 2ZGVA 7REQB 5GMOA 3HHNB 3FSGD 2FGKA 3DLGB 3G2IA 1LK7A 1UZAA 2D5AA 3LDHA 2C3YA 4ZC1A 3BSOA 2WTAA 4EHHA 3TIFA 6AT1A 4K0KB 4BUJA 2GS9A 1NX9A 3I6IA 2WKSA 3LHSA 1H65A 2BDEA 3LFTA 2OV3A 2RI6A 1F14A 1TKCA 1ZHOA 2NO5A 4BJHB 4YYEA 2HHCA 4PZVA 2IT1A 2OQ2A 4L8GA 1A4RA 3K05A 1IPEA 5I6DA 5ES4B 4WLEA 3OTDA 2VQFB 3BA1A 4MSUA 5L3SB 2OY0A 1QK3A 3ND5A 4RSHA 4OSOA 3N28A 1UVLA 3FSIA 2DRDA 4JQSA 3RG8A 4HVCA 3HCRA 4PEOA 3K5OA 3TYXA 1E1KA 1U1OA 4ZZ1A 1CP3A 2RD2A 5KFWA 4CCYB 5E33A 3MVEA 4MKIA 1N6QA 4YI3A 1YB1A 3BKUA 2Q1YA 1XLTA 2CV0A 3KJVB 4X85A 4LI0A 4GRSA 3UBMA 3LWZA 3GY0A 3B1WA 4I4TF 4OATA 4JKIA 3LG2A 1L5KA 3NEAA 1IH8A 4KSEB 1TVRB 5LDGA 4ZCTA 1KZYC 4KX5A 3OHSX 4PLZA 4B4KA 1XLUA 3KOXA 1NXXA 1XPJA 3L8EA 2BOPA 4LMRA 3P27A 4M1SA 4EKEA 1ZCZA 3OCVA 3V7UA 5EMNA 1F3LA 3U5TA 1GG8A 2AC2A 1GIAA 2W2KA 2X0EA 3HNRA 2I03A 4F3TA 4M88A 2KL8A 1HORA 3ESBA 5JNUA 3U40A 3MLBA 3HXTA 5H3HA 4Z3KA 1HTTA 4LAFA 3AYZB 3GAFA 1PJ7A 4TKVA 2WT4A 4I0WB 4RMJA 3UPDA 5LJ5Y 3TLGB 3TUJC 2IOFK 1RJ9B 3L41A 4F6CA 2DNPA 5J5AA 4LJSA 4F04A 1GV0A 2V03A 4R8UA 4CO4A 5A9RA 5B1YA 2P2GA 3LX6A 3ROQA 3R9IA 1VL5A 4HWGA 1KJJA 4UFPA 1AUXA 4XVUA 4W4TA 2JCVA 3IMEA 3HVRA 1P7VA 2QTNA 5EKDA 3JX9A 1PX0A 4EG8A 3TLXA 2W2NP 3PUVA 3BEDA 5DQIA 1IM8A 3BXHA 4AY6A 2CNNB 2G1KA 1I30A 3PVXA 3UK7A 4ED6A 4OMCA 2UUTA 1P5HA 3RAFC 1AV7A 4YXFA 1KBOA 3MWGA 3BFPA 2SECE 3TZCA 1F2TB 2PMDA 3R41A 1QH1A 5HJXA 1JVSA 4BJ1A 4HWRA 1J97A 3MNFA 3CUSA 1JQKA 2JVIA 4MZXA 1GCIA 4UXHA 2GOYA 3H5UA 4GOND 3DL2A 4YRSA 5EMKA 3HEMA 3RAQA 4FS2A 3BSSA 4BX3A 1UJCA 2IEAA 3BQ1A 2EFOA 1HO3A 4UHFA 4C8LA 2ZC3A 3AVWA 2W2TA 2XWSA 4YRCA 2B4OA 1C4KA 4Q3LA 5E3PA 2E9ZA 4UHDA 4COOA 1FL9A 1U7PA 5BYRA 3M8PA 1ZINA 4XJVA 4AZ3B 3AFNA 3JQEA 3CCVS 4EJSB 2V6MA 4MGZR 5GADU 3WAKA 1DG3A 3D4OA 1YCHA 3SICE 2PO4A 5F5NA 3AZPA 3RB4A 4ZO9A 3B2EA 5HCNA 1I2AA 3BSAA 2MZQA 2BJ7A 1VFNA 1CJUA 5JJ5A 1KWMA 2QL5B 2X4IA 3RFXA 4QBUA 2EFVA 3RAPR 3K89A 3S7RA 4DWJA 2UZ1A 4AY4A 2GMHA 3KSBC 4R83A 1Z13A 2HWHA 5JAMA 1C9YA 9LDTA 2GGPA 4F4UA 1BD6A 3C14C 2VQEF 1RQLA 2FPWA 3GEIA 4LRQA 1QP8A 4LZJA 3HPRA 4GSLA 4JV1A 2VFTA 3QH4A 4KPUA 2WJ3A 3EX7B 3D5QA 5JFTA 3HF5A 4LF7F 5AOVA 2A1IA 5DHQA 3AT1B 3ZCVA 4V19J 5CG1A 4ZMMA 4I3FA 4W5TA 2WFAA 2MR5A 2LW7A 2FE4A 2IW3A 1C9EA 5JBQA 3NS6A 2UAGA 1T0HB 3IBSA 3VR3D 2IC3A 4GPIB 4KPYA 2ZREA 3BMQA 1IY9A 2BHNA 2WJYA 4CGYA 1NWHA 1AV6A 4LRWA 2IUFA 3CVVA 2WLSA 2HO5A 4L6AA 4KXVA 4LOKA 3SHWA 2ID4A 3EVTA 2TYSB 2ZH7A 4UTPA 2GCOA 1MQ8B 2JVKA 4XVRA 1X0PA 1Q4RA 2IH5A 4E70A 5K8IA 3TW6A 3LANA 3HDTA 1AHNA 1VBFA 3CCUS 2ZZTA 4OUKX 2I65A 1WAMA 2GN1A 1T9YA 2IZ7A 4Q8EA 4PQFA 1KVQA 2FUG9 4M89A 1TUGB 4DG9A 3PD7A 3KJEA 1WEYA 4RIHA 3CC4S 1D0SA 2W71A 2D1YA 1XTJA 2IW1A 3I83A 4DV0F 3NEJA 3DOMB 2K3KA 4FXWA 3TTYA 5JH7B 2B4RO 1P5ZB 4C98A 2ZB7A 1IEVA 2HU8A 3HJBA 3LYLA 2DHRA 3ENKA 4M7PA 4LIRA 1FESA 3F3YA 5LYJA 3EBLA 1SJFA 3HB9A 2ZLBA 4AZSA 3ISJA 3KKPA 4U9UA 2W2MP 1CUVA 1JFLA 1FTNA 4RD0A 3JTEA 4QYZJ 3WK6A 4AS2A 3IP7A 3CE8A 1AJEA 4HGQA 4EYKA 4DB2A 3LIPA 3KXDA 4EPYA 2GBLA 4B6QA 3E3LA 2EBFX 3AWDA 3JQ9A 2YKQA 3W3SA 1T4DA 3BTUA 4QM7A 1IB0A 3OQOA 1WWKA 2O7RA 4W5NA 4ZHQF 4PLHA 4DUTA 2D2IA 3ZI7A 2VLBA 5AIBA 1AKYA 1HG0A 5IF3A 2EIHA 1ICEA 1VDZA 1XZ8A 2R2SA 5LSOA 2IEIA 1E1QD 1XJCA 1MH1A 3LW7A 1UZMA 4WZAA 1WJ9A 2AV6A 3OSUA 4GYWA 4CMGA 3LQ4A 3GG9A 1BHSA 1RT3A 4DN0A 4LJ8A 1YQXA 4B87A 4DLNA 5FD1A 5BQXA 3AK4A 3DD5A 2VTBB 3H98A 5COAA 3AIKA 5M04A 5J4YA 3QE9Y 3QBTA 2O1WA 1GEHA 4Z7OB 4XLTA 3P32A 1YFJA 2RGNA 3OLQA 5K6TA 1SC4A 3GIWA 3FKJA 4EQZA 2ZBCA 2H57A 3GRZA 1Y6FA 3ANXA 3PENA 1I7DA 4K3VA 3TM5A 2AYZA 2MEWA 1NMZA 2I2AA 2G09A 1ORVA 3PXEA 1L1RA 4RD4A 4LF8F 1DC8A 2Q0HA 3MOJB 5ICSA 3M8QA 2GZ3A 1OLUB 2W8BA 3PO5A 3MFQA 4RNNA 4EPRA 3BMCA 2AN1A 4FE3A 3NC4A 2GVZA 3NGKA 3FFWA 3ONWA 4MQFB 1U02A 3BEGB 3MECA 2WF7A 4J9MA 2L18A 1JT2A 3TH5A 2HC9A 1MROA 1E2UA 1E58A 2O50A 1C8BA 3N6LA 2L42A 4P5PA 5KFGA 4RJVA 1YT5A 3PG5A 1VL6A 4CODB 1DURA 1S9HA 2HXSA 1SG6A 3U3JA 5BUSA 2ZJPQ 2PGOA 1ZAKA 4WUTA 3K6KA 2ZD1A 3VYUB 2IP1A 2WJAA 1UP4A 2XHEA 3DZDA 4MKZA 1PJBA 2OCXA 2APJA 3EA0A 3KLNA 1WCIA 4PQUA 4CMCA 3KZVA 3PM9A 3J7YI 5AKIA 4QU7A 2UDPA 4U95A 2A1BA 2EKQA 4P3OA 3DDIA 5FV4A 3QXCA 1XZBA 1JLQA 5KNDD 5C46F 2JFZA 1Z68A 1N5VA 4HKTA 3GLGE 4PPYA 4IDHA 2Z5FA 4LXGA 1IR0A 3PNLA 3MD9A 1UWBA 3OCWA 3FCHA 1GPUA 2OLEA 2JGJA 4EYHB 1TVKA 4JI7J 1U24A 5BYJA 1W4AA 2AJCA 3FCSB 4MR7B 5LXTF 1OYDA 4Y1GA 3PIDA 2EVZA 5DH9A 2H1CA 2AYMA 1R6VA 4KQ6A 5F4ZA 3O44A 3KZNA 3KDSE 4O08A 2YH2A 4KMMA 1PL0A 3HFRA 3E6AA 3TRGA 4KQWA 1B23P 2W6NA 4QWCA 2G08A 2VG5A 2FNAA 3GG0A 1TEHA 4N5MA 3PC8A 4CDGA 3N79A 4AKIA 3LD9A 1Y4ZB 1JDZA 2P4SA 3DMJB 1POWA 2PUBA 4AMYA 2UXDF 4L5BA 1DJNA 2NZ2A 5ECDA 4C9BA 2QUKA 5C52B 3MUFA 3AA8A 3MZ0A 2PZKA 4N0MA 1ECGA 4F1JA 2VQDA 1DQYA 1NT4A 5IT5A 3HFGA 4L9SA 1UCNA 5CA0A 5CVEA 4YWHA 4QTYA 2DKNA 5LBUA 1H0HA 1X3LA 3DNPA 3QLEA 5JCOC 1FIUA 3PW5A 2VP5A 1G4UR 4DFJA 4CE6A 1EP1B 4MW6A 2EHJA 3BO4A 3FIJA 4Y98A 1QR6A 5LZ9A 4B3FX 5IASA 1IB6A 1FD2A 4JT2A 2REOA 3SX0A 1MFPA 1V3TA 4IXMA 3KB8A 1XDGA 3C5VA 2UUCF 4ACBA 4LXTA 2E82A 5HXAA 3Q8YA 2BHRA 4R9SA 3ADDA 1QRDA 1H6AA 2H1OA 3OKAA 4B3XA 3EEQA 3AR6A 4AMGA 5CFLA 4PLYA 1NPTO 2EZUA 2RJZA 1HEUA 4HDAA 2DCUB 2QMYA 2PKEA 3CBQA 1VBXA 1XEZA 4HDRA 2GJAA 1W9HA 3WC2A 1MC4A 3ORYA 3TDMA 1XD8A 3PNOA 3KSMA 4OSPA 1LU9A 4RY0A 4YMTA 2H0QA 1H85A 3RV3A 3GWGA 1XYVA 2I80A 4M5JA 1PK8A 4WP9A 2FSHA 4XB6B 1K8YB 3EDQB 2XVAA 1KVKA 1FUYB 1E6VB 1Z5NA 5AM0A 3LHIA 2DK2A 3W62A 4YCJA 4G5OA 1QS0B 4K59A 5ALRA 1OH6A 1SRRA 4GKJF 4AMVA 2AW5A 3HDGA 3KL4A 1Q44A 1C3VA 4MRMA 3S99A 1HYGA 3ESQA 3KWLA 2DGWA 3HWSA 4XARA 1VQSA 3VKUA 4MXDA 3LUKA 1UOQA 3SS9X 3MJCA 1F2HA 4YB1P 5A9SB 1BDIA 1RMYA 4ENVA 4QFCA 2RARA 1GQQA 3DUFA 1R8CA 1LDMA 3MS2A 1DCTA 1PEDA 2MYTA 5EY5B 3KHRA 1N4DA 1UBTS 4I2QB 1KE2A 1XTBA 2HHVA 4F46A 3K70D 2IA0A 5F9LA 3FOFC 4CWBA 1CY2A 3OOSA 4DLTA 2YJ6A 3WOVA 5KNDH 2CF6A 2EAUA 1NOKA 3QEJA 1IL0A 4CMIA 2NAFA 1FO1A 2VHCA 3OEHD 3DI6A 1S77D 2CJYB 3SIPB 2WG1A 3OU2A 1Q19A 3DCJA 1U6KA 4BNIA 4M1TA 2WDPA 2AUNA 1AKWA 1YL6A 2C97A 3ZXYA 1G55A 1P3Y1 1GLGA 2GEFA 1HNNA 1ZZGA 5KT3A 4BCCA 3V8PA 2R7QA 4ARVA 3CD6S 1DZ5A 1XZAA 2Z4PA 4XIGS 2YNGB 1JLFB 2W00A 2F17A 3EWAA 1D8ZA 3H0CA 3WGMA 5KFSA 3QF4A 3CO9A 3T1HB 4OMDA 1VM6A 4RHTA 3UWOA 4DFPA 1ZOTA 3UN5A 4ALJA 1ZW6A 5F73A 3ADCA 1UVIA 2EKZA 1NAHA 4L02A 2TS1A 1W5FA 1N3LA 4RWXA 3GE9A 1NVDA 4BFWA 2IHBA 4ZHSA 1ZPWX 1V95A 3NWPA 1P7ZA 5HF9A 4RW0A 5B3AA 4YT4A 1W26A 4JA0A 5HRUA 3EIFA 2OCYC 2WPDA 3J80A 5DTEA 3H42B 4KXQA 1FKOA 1PJQA 1W1WA 4QPCA 2YZ2A 1P61B 1E8DA 1D7AA 4XZ3A 4J3NA 4D3YA 1HG1A 4MW2A 1OX4B 2HA7A 2PN1A 3N0WA 4OBXA 4H3HB 3RVOA 4IDNA 3PQFA 1XF9A 2Z6UA 1TGYA 1EGVB 5IT9U 4I8XA 2CFIA 4DY6A 3P2JA 2AVNA 4IR1A 1ZGJA 4PHCA 1HW8A 4UT4A 2Q3BA 3I8SA 2DJIA 2JIZA 1D0EA 4OI1A 4YAUA 1Y3HA 5M34A 4U9RA 3H5VA 2R7UA 4DMKA 2X8JA 1WV0A 2O57A 1KDPA 4C5AA 4NFYA 4WFJA 3INYA 2H4YB 1L7XA 1R8YA 4ZPWR 5B0CA 3SDBA 4CR7A 2VKTA 3NJ8A 2Z2ZA 4DDVA 1Y1SA 4G1UC 3KDAA 2FY1A 4RKEA 2IEDA 3LF2A 5E3JA 4JI8F 4F5EA 1G2QA 4LIWA 1TF2A 2YWRA 1REQA 3W2WB 4NG4A 2W6PA 2IAJB 3V4IB 1GU7A 4MDYA 5BOSA 2H8GA 3MIZA 3UJ8A 4I1SA 2B20A 1ESCA 3DH0A 3EASA 3LXMA 3K0CC 4Q01A 3RAMA 3I23A 1FRIA 5B4TA 1W2WB 4DR1J 4DVGA 1JUDA 2KJQA 1FS4A 4BUZA 3Q9LA 3E05A 2F9LA 2XYPA 1TU0A 3I0NA 4YCCA 2CPDA 3WQBA 2C61A 1R50A 2ZBIA 4UU7A 1IATA 2Z8YM 4HXYA 4ZREA 1GTG1 4UBJA 2FHMA 4BWFB 4DQUA 4MV3A 3ZCXA 1C4WA 4YY3B 2KB0A 2FIUA 5L3QB 4E5UA 1Z1ZA 2HHJA 4UTZA 4B6JA 3H9UA 3GLIB 2C1EB 4BIIA 4UDYX 4ER0A 2CJFA 4ZKEA 4LYDA 4OL0A 5M5BA 1K7YA 4MA5A 1V1MB 1QE1A 4PYKA 5H80A 4NZPA 4GH5A 1IWPB 5AKGA 4KHMA 3IKLA 2YINC 3UMJA 3BMNB 3D6FA 1S0UA 5D4NA 1MB0A 2G5TA 4O3NA 3UDCA 3TRKA 1RPAA 3OE7A 5G40A 1CSJA 1Z0SA 3BTOA 1QO0A 3TRJA 1VRUB 2AEEA 3OEWA 1KNXA 2FVPA 3GRYA 4DCSA 3FMFA 5KJFA 3ETCA 3DE3X 5JE8A 2NREA 4Y6RA 5JPDA 1WXHA 2J30A 3DWFA 1NF3A 2VBXA 2FPUA 5ALDA 3HSSA 3PHIA 2V8HA 5BO5A 2MKJA 1AFIA 3KSUA 4R0JA 2Y8WA 1G20E 5IMSA 1P5FA 3HCEA 3CEAA 5I7OA 1MA3A 3P3DA 1YVFA 3KNGA 1WQ4A 3A7DA 1NB7A 4L50A 3TSWA 3AF0A 1EIZA 1ZK0A 1HBJA 3CNBA 3MWLA 4U00A 2V34A 2ZJFA 4D56A 1X9MA 1DL5A 4AMBA 4M0PA 3FTCA 4L4XA 2ID7A 2VC0A 5DQGA 3CMES 4IIYA 2C07A 4A82A 2H1IA 3QHAA 4Q37A 2JZCA 4W1PA 3W6UA 2RHLA 2B2CA 2DO0A 4R05A 3H4IA 3WLAA 2MQNA 3U4HA 2QJ3A 1I2ZA 1RM0A 4CIXA 3RYHB 1IEQA 3H2ZA 3S68A 4JUAA 3IALA 3T9NA 4TTSA 1DQ8A 3TW0A 1OY6A 2WWWA 1G8HA 3DRXA 3DM2B 4HYQA 5EZ5A 1YI8A 2FG5A 4ERXA 3UJBA 4D5GA 1ZVQA 4ZDWA 1U7LA 1IBLF 3WMEA 2ONCA 5HS4A 3L0CA 3NPAA 4QUGA 4LRDA 3H1BA 3QSGA 3PEYA 2HB6A 1BXGA 3E81A 4QT0A 1XRRA 1R4MB 2A10A 3I5YA 2JVJA 3IMQJ 4KQ1A 5EESA 1LXJA 4B09A 3L2OB 3UCFA 3GW8A 3R0IA 3LQVA 4LWPA 4FDTA 5B7PA 2OPPB 4F5DA 4B3SB 4KR6A 2NLOA 1C3JA 2IV2X 4B8WA 1HE8B 1TAUA 4OQNA 3M1VA 1R0AB 3NS5A 3TZWA 2XJ9A 4C14A 4IDBA 3IEVA 4NCGA 3C5HA 4USMA 1TNDA 4M8NE 4X91A 3BSFA 3RVBA 2QTVB 4MV5A 4DI6A 4EPVA 2UXCF 3LTNC 3AR4A 4Y2YA 3ICWA 2JLQA 2IVYA 3VDXA 1MGPA 3C3LA 4WERA 3TRIA 4IDPA 4F38A 2Z43A 1YMQA 2K1RB 4RU2A 3M3PA 4ZVTA 2EATA 3DM9B 1Z7EA 2CQ1A 1TF5A 3OC0A 4Q39A 2Z6QA 3CZPA 3AY3A 1YDWA 2WSBA 2ZSFA 2QZZA 4FFMA 4N8OA 2WT9A 5L8VA 2VJCA 1OXUA 3EVBA 1EM8B 2BP7B 2CL7X 2XVMA 3M8SA 5KMGA 2ILZA 3PEHA 3TOZA 3L7OA 3RC9A 3AONB 4QW9A 5L39A 5LQKA 1WPRA 2BFFB 4O3OA 4BPRA 2PYZA 4UAGA 5TR9A 1VP3A 5H8WA 2FUG6 1TZKA 4P98A 2CT8A 4CLYA 3E7FA 4UU1A 1JHZA 3FZGA 4C06A 5CA1A 4WV3A 1SJ3P 3JQKA 2NV2B 2RK3A 2BTEA 4RMIA 3LT2A 5IP5A 1DBQA 3FMWA 1RTTA 1PQWA 2GCFA 2U1AA 1PFGA 2BGJA 4BAZA 2HM7A 5B6PA 1Y8QB 1C80A 3NBUA 4A10A 1NMYA 3DT6A 1CR1A 4PG4A 3L8HA 5JJCA 1UBFA 2FFHA 1U3TA 3R8YA 1VJGA 4YYZA 1QB7A 4J1TC 3T9ZA 1TR0A 3ME5A 4I1OA 2NVOA 3AEKA 4I1RA 3SVZA 1PR4A 4UU8A 1YUMA 4NLDA 4DCOA 5A06A 2C22A 2ZWIA 4EHIA 2I8LA 1GAJA 2D1RA 3S2SA 3CC7S 4M5HA 5IKMA 5KFOA 3PR5B 1HMVA 1Y1PA 1NE2A 1YZFA 1SKMA 5EINA 1KOGA 2QFJA 4WTYA 1XCBA 3GAZA 2MKKA 2JGAA 1KYXA 4JJFA 4AS3A 1RBAA 1LC0A 5IJ0B 4DUYJ 2Y1WA 1T10A 2LUOA 2GLXA 1FRLA 1NXQA 4AY2A 3IA7A 2YJ4A 1V26A 4W63A 3BCUA 1JEQB 2A30A 4BX0A 4AFFA 5ENDA 1DX4A 1Q8KA 1XK8A 1Q0LA 1PFWA 5MN5A 5CR9A 3E8OA 5EJ9A 2CE7A 2H7CA 1MMDA 3ESDA 1M75A 3O1JC 5AT1A 1P4RA 1VYHA 2YJTD 4B6SA 3LS2A 3AI7A 4LHVA 4RR5A 3IBFB 4K9RA 2A9FA 2GK3A 5LMNB 1SH3A 5IAOA 3V6HA 3J81U 3V3TA 3OUYB 3PEFA 1JAZA 4LECA 4S24A 2KZMA 3I87A 4A92A 4NMXB 1BU8A 5A9TA 2W6IA 2ZDGA 4TVAB 2A35A 2HXYA 2WE7A 1C0UA 2PXXA 4ESHA 4ZCRA 1U2QA 7ADHA 1IKWB 3CCRS 1Q11A 2Y2UA 2WNSA 3THWA 4DPOA 1N9GA 3HJUA 4D3XA 4K9NA 4MS1B 3HHLD 4D99A 1V11B 2RU3A 2BW2A 4GX2A 5K0JA 2CZVC 2FPGB 5SYMA 2FMTA 1RHQB 3KEGA 5JO9A 4ZOAA 3VC1A 3JPWA 4DQQA 1HH4A 3AZQA 5A1JA 2V9CA 2AC4A 1DTTA 2G0NA 1MMNA 2QRMA 4X1KA 4FU0A 4CKXA 1XGKA 4GE0A 5CCDA 1TB4A 4LZPA 5KFYA 5BWBA 3I6MA 3K72B 5LQDA 1ZM4A 4FZVA 1G5IA 2OO3A 3FY4A 1YJTA 4YO8A 4NENA 5J63A 2BUAA 4TQ9A 2JJ8A 4YR2A 4FS8A 4KTVE 2CJQA 4YDHB 5TS3A 5F3RA 1R0RE 4RQBA 3LUDA 3LDGA 1MTOA 3MAAA 5HP1B 3D3WA 4V0SA 2YKGA 1HE3A 1ISJA 3FKSA 4MVJP 2FW9A 3D64A 4LBZA 4WCVA 4Q9KA 2ZAOA 4XDHA 1Y3JA 3L04A 4BQRA 4BHQA 1ZPDA 4NFHA 3GRAA 4RO0A 2OAUA 3EWIA 3W2EA 4RPKA 3UW3A 1AKRA 4XDZA 1SBQA 1PO7A 5AKKA 3IQDB 5CDYA 4QT4A 3DQPA 5K20B 2F3QA 4OHBA 4L8LA 3OQMA 1C0KA 5E4YA 1GDDA 2ID8A 4N7BA 1ZQ1A 4RA6A 4D44A 4C07A 3E01A 3TSCA 2FAXA 1WTCA 1CJKC 2ZE7A 2L17A 4YALA 3S7ZA 4GM0A 1TV6B 2CGEA 3R9XB 4K9QA 1IE3A 1RBZA 4WN3A 1WZCA 3QHQA 1VHJA 4WYLA 2PA0A 4FE7A 3ECCA 4I9HA 3KKNA 5A3RA 5C51B 1EESA 1RHRB 2R2AA 4OYHA 5ADWA 4O2BA 5DK6A 1YR9A 2HXGA 1P1HA 2HWTA 4D3FA 4M95A 1VPLA 2IYRA 2IHZA 1W29A 3GA0A 2BRKA 3ZQUA 1EUYA 1BE8A 5LB2A 1SCUB 2BR3A 1U63A 2NZ4A 4YCSA 2JNJA 2G9NA 5JVDA 5DRTA 4Z0NA 5KFHA 2QYOA 5DO9A 3CVOA 3M2UA 3TEMA 4YHBA 3B82A 5J47A 4G56A 3IDQA 4HS4A 4KGZA 3BB1A 4CH0S 4IP0A 5T3YA 2JFQA 1GZ4A 2PYDA 3AO0B 4B0PA 3CLVA 4KPEC 3QXHA 4B7AA 1J0XO 2R8OA 3PGVA 4FVCA 3N5FA 4RPIA 3W66A 2XY6A 2G40A 4F3MA 3DS8A 2RQCA 2PIIA 2C58A 4EFNA 3ORHA 4OJNA 1B8UA 4PSCA 3H3XA 4EA7A 4WFAQ 2H5JA 4UJ5A 3PNQA 2JWNA 4QGGA 1TKDA 5L9XA 4BLWA 4X4QA 1G0NA 3VYVA 4YRFA 3IILA 4EBCA 3DLAA 2QO3A 3AVQA 3ESXA 3VFDA 4RQTA 2XLJA 1J5PA 3K2QA 2GAFA 5GP1A 1E1LA 2K3IA 3NOVA 1GSHA 3LAWA 3DZFA 4DPMA 1ISIA 3HG7A 1Z6GA 3QXXA 3F6EX 5HF8A 1FTGA 1DV2A 4B6EA 3J7YU 3OWHA 4PHGA 1B8NA 2MSNA 4QHSA 4PWWA 2HFVA 1C0LA 1WLSA 1W52X 1ISGA 1X4EA 2ZDHA 1UJ6A 4ZPBA 5A4IS 1QXSA 3C97A 4J9QA 2NSBA 5E4FA 3Q9NA 5EX3A 2M7SA 1GQYA 1T91A 4MUNA 4BBZA 1U0TA 3CR7A 3SBOA 3LUYA 4NICA 3NHYA 1N36F 4X3OA 2A5LA 2HBRB 1N4AA 1KJIA 4B9SA 4K50A 4IIJF 2VSFA 2IA6A 1HWYA 1L5YA 2AMLA 1R3UA 1GGNA 2A1UA 3D7NA 2XCQA 3EDRB 1EP2B 3OTBA 4MQLA 5C31A 5CYQA 4KR2A 3FDZA 3RTDA 2KHCA 1QK5A 3WO0A 3CBGA 4OYZA 4UOQA 5KAMA 5K3CA 4BGUA 4IOAQ 4OJYA 1Y9ZA 1JKHB 1RMTA 2M6KA 3WA6A 5CM8B 3USES 1KZGB 1C81A 2QB5A 3MFHA 1GZ7A 1XDBA 2HNAA 1IKXA 1QDLB 5CU7A 3CKLA 3AEXA 2O8FB 1PQUA 3TK1A 1KMHB 2B0CA 1ZNXA 3I4FA 4CRWB 4YRRA 2QLBB 5ISMA 3E4DA 5KFZA 4IFYB 1MPTA 4NYMQ 4E21A 3OTHA 2OQRA 3ODPA 1OJ7A 3KUHA 1UOPA 1VG0B 3SZGA 4ZDJA 1H05A 2CNKA 4JP3A 5DDOC 1I13A 4X84A 2ZYAA 5JHGB 1O8CA 4RX1A 4TVKA 1HHQA 1IXZA 1YGYA 4ZHRA 4JN6B 2YNHB 4OGKA 4ZJQA 4M37A 3VJKA 1NUSA 2PQ0A 5YASA 4ID5A 3L0DA 1RYNA 1B2RA 2EL7A 4MIOA 5AJXA 3N7TA 2YZKA 4G1MB 2WVHA 5EFOA 3LKBA 3GEEA 1LF5A 2DBYA 5ICEA 2OH2A 1LS1A 4KHPB 2OL4A 2H31A 1K9VF 1Z28A 1N32J 3PW7A 3Q86A 3BGLA 3UOAB 3K9CA 4YRNA 2D3ZA 4RHEA 1NN0A 3FMVA 1VQPS 5A8WB 1YB4A 1WXDA 5KYUA 2FQYA 2Q79A 1J42A 2FQQA 4J1NA 4CM8A 2Q8QA 2GBCA 4FLEA 3IGFA 4ZCQA 5DM70 3M30B 3EA5A 3CULA 1JL3A 2DTDA 3GUHA 1BCSA 5FUYA 2R9LA 1RLMA 3QNMA 4Q02A 3MFYA 1I3CA 1KLMB 3A1SA 1XMOB 5M2QA 5ETVA 3EIEA 2GFFA 4PUOA 3Q41A 1WBBA 4MTCA 4ALMA 4I1VA 3TX0A 1FRNA 2JHEA 3UHFA 5UKDA 2XBLA 4OUDA 3BBFA 2PIDA 3ZZOA 2FJXA 3ZWYA 3QY0A 4EHAA 4AX8A 5TX7A 2C3PA 1ITPA 3KXKA 1BD4A 3FPLA 1AA1B 1RAHB 4FOLA 4E5DA 5JRDS 4IEFB 1GSAA 4OYAA 4TS3A 4UMFA 2NO1A 1I5RA 1L3UA 1OGYA 2YNMD 1J25A 1BJKA 3OX3A 3KKKA 3LC7O 5EJ7A 1UC8A 2ZQYA 1SIOA 1BC5A 4C4YA 3DRRA 2QLNA 3EIUA 2HA0A 3RAGA 5CVTA 3I3SR 2DHCA 1SU6A 2HCRA 1IDOA 4EMDA 4R7TA 4JV5J 2GN4A 4D3HA 4C04A 3D5EA 2H0AA 5I5GA 2NO6A 4NR0A 3TB4A 5HF6A 1J5XA 3ZTQA 3RU7A 2IDJA 2BFNA 2YKPA 1E1NA 4AL5A 4L51A 1PNRA 3A8EA 1CZUA 2YTCA 2HQDA 1VQ5S 1WEXA 1F0NA 3UZUA 4EUFA 3FFIA 3B6BA 1WUUA 4O0NA 3JAKA 1EB8A 1WB4A 4DLVA 4OGLA 4EY3A 3V34A 4L74A 4QIVA 4OHXA 4WCDA 1W48A 1GX6A 5K05A 3L7PA 1SKBA 5D78A 3AM1A 5GV8A 3C16C 3EUEA 2RRNA 1MHPA 1TADA 1Z6XA 4JHXA 4MIBA 1OVMA 1NT2A 1GL7A 2NZJA 4G07A 3WHPA 5DNVA 1MABA 1AZSA 2IPOB 1FSPA 3I6QA 2K2PA 5TGDA 1S7CA 3DDSA 3L8GA 4NYIQ 3GV7B 1TJ3A 1LEHA 2QGFA 3U3MA 2PT5A 5DRYA 1VHQA 2L9DA 4W90B 2XUDA 5TVGA 1HWKA 3COSA 3F6SA 2EG5A 1SVIA 3FYHA 5C37A 2XULA 2PJZA 1EFPA 2NQPA 4CQLB 5LKAA 3DVSX 2IVFB 4EY4A 5T7BA 1XDUA 4IG3B 4BRZA 5FA8A 4F4KA 1DTQB 5KT5A 3DKDA 2R1ZA 2EOAA 1G8GA 1QTNB 1E9FA 3V7YA 4RJLA 1TEXA 1NK6A 3L01A 1U0RA 3LQ1A 3R5DA 1QGYA 4TV9B 2D5CA 2Y8EA 2LIVA 2H2FA 4M8IA 1FEHA 1M5PC 4Q4HB 4LC1A 1T5LA 3WLLA 3VPAA 4C6TA 2IS4A 3NBKA 1L4KA 3KM0A 1YZVA 2L2QA 1ZC3A 4O0IA 4XM2A 4M4SA 4RL1A 1CJBA 3TRFA 1Q7TA 3GLRA 3GDHA 1UEIA 3WYEA 4FBLA 1MZVA 3KQSA 5I42A 2HNKA 2AMVA 3BRQA 4IDAA 1YOVB 3KK2A 1R37A 3VDMA 1YQTA 2BHSA 5DK4A 4ARCA 2YRWA 2XY7A 4WTOA 4NNOA 4WZMA 4HEA1 1U1EA 3M5WA 3NHUA 1CUEA 2BH9A 5AW3A 3M9MB 1Y00A 1WD5A 1B0ZA 1N2CE 2ZM6B 4RXMA 4LISA 2EG1A 5AHRA 5I3CA 1SB6A 2IDEA 5K51A 5JSZB 2AOWA 3A32A 3I2IA 2AFRA 3GF4A 1Y7LA 2YOHA 5BYQA 2H8KA 3LA6A 2I34A 2OOKA 3ETGA 4G97A 5GONF 2AYXA 1E7WA 1VHTA 2I2YA 4OLOA 2A0FB 3WDSA 3WLNA 1KH1A 4EUEA 4DANA 4PHTA 1EE1A 3A9SA 4OPMA 3BXPA 2R8JA 4C0XA 3HM2A 1QKJA 2JK1A 4IDQA 3GX1A 1L5HA 5JWRA 2NYIA 4BO5A 1F9HA 4D1YA 3H5SA 3WQRA 4QD3A 1EVQA 3UJCA 1U9CA 3ZHZA 2ET6A 5ALNA 4I50A 3VYRB 3SSMA 2XNHA 1GZSA 1H3EA 1A8UA 1RYEA 3KMQA 1NUQA 1PJ6A 2ISSD 1Q95A 2QX7A 3VR6D 3M7VA 4R8SA 1Q5PA 1XNQB 2Q3LA 1M5SA 2W25A 4LNHA 4DJBA 1AFJA 4JSYA 3OU7A 3M2PA 2PT9A 1WA5A 3W63A 3RAJA 5EUHA 2J07A 4DXHA 2IX3A 2IU6A 4PFJA 3EUFA 1X1EA 1QBKC 4BQIA 5EYPB 2R86A 4TS1A 3M82A 3WY9A 4RANA 1UZNA 3IG1B 1V16A 1K9SA 4V0QA 2VJYA 5F7OA 3HJFA 5AVYA 1W49A 1GMVA 3V6DB 3KUCA 1D2HA 4IOJA 1ZISA 2WA2A 2OFHX 1PILA 5CCLA 2H2IA 4W7HA 5AE3A 3E3MA 4GECA 2JLYA 1VI6A 2ZI5A 5TS2A 4HO1X 4NC9A 4KGVB 1H42A 1KDTA 4HTJA 1X2BA 2OYCA 3C6MA 4KZKA 5K3AA 5BSRA 5JO0A 3AJ2A 2AYEA 1F8GA 4X6UA 2YWWA 4QRDA 2EZTA 1YF3A 3DA8A 2I71A 1C0TA 3S6EA 1T4CB 3LV8A 3RTVA 1A9YA 2PT6A 2VP6A 1T9UA 2D9OA 1Y6QA 3I09A 1R8JA 2G0TA 3ERCA 2QAIA 1M2OA 5BWLA 2GVDC 2OV2A 3HZRA 3K1JA 3PCXA 1P5RA 3OZUA 3HM9A 2BFBB 4F1WA 2FWBA 3I05A 3Q83A 4DILA 5B7QA 4LK2A 3MINA 4XH9B 5AKEA 3D0HE 1F60A 1PYGA 3FVYA 2CVHA 4OHMA 4CP5A 4Q1BA 3FUYA 2LWIA 5HQJA 5HDQA 1UWKA 1FA0A 2WVFA 4OHPA 3NBQA 4QUBA 3M6UA 4DMCA 3W06A 1D2AA 2VBFA 3EDOA 3GLFB 3R0ZA 4KQKA 1RU1A 3MLAA 1QHHA 4ALNA 3CLTD 5CCXA 1L7MA 4LCJA 5FBQB 4II2A 4E2ZA 2QLMA 3P9PA 4O4IA 3GPDG 3MRVA 1VP9A 5HROB 2P4QA 1FQKA 1M6VB 1O4VA 2DHXA 2ZKTA 1UJNA 2DBZA 3KPJA 3O92A 3FHJA 2V7QD 3VZDA 4TTJA 4U3JA 2R00A 3ONFA 5HSPA 5HIKA 3KOUA 2PO5A 5IDYA 5K2MA 3QWUA 4DN9A 2JD2A 2QY6A 2P9YA 4TTRA 4TYQA 4H7HA 4J29A 2A59A 2HQ3A 1UFKA 1AB6A 1QFXA 1P9RA 3W8EA 4DPYA 4FFLA 4DMFA 2JLBA 1LW0A 2HNBA 2AS0A 1Q92A 2HFJA 2KHDA 3PR2B 2Q6CA 5IAAA 2HPAA 4TXLA 3MUTP 1FDNA 4EI9A 1YZLA 3O3MB 4LR7A 3KQQA 1E3QA 3DZCA 3RTCA 2VYFA 3LDFA 5KG2A 1ZIPA 1E6EA 4WGFA 3X3HA 4GBGA 1WL8A 3KLPX 3L4SO 4AUMA 5J2TA 3DFZA 4J4BA 3U6BA 3MMNA 2IZ0A 2ZT7A 1C1YA 4D9FA 3K0KA 1EFDN 2JA1A 3QEBZ 4QYIA 2QLFB 3AX6A 3HDQA 4GXQA 1Z4NA 3ML1A 3E70C 4ANCA 4PLVA 1FLDA 4B5LA 4MKRA 5BV2P 3PWTA 1KVJA 2JBHA 1VPDA 4KQ9A 5EKUA 2QUIA 2Z2KA 1CUSA 4ZO6A 4D82A 3C7CB 4FSDA 1QGUA 1A7GE 1BN7A 3S27A 1R6XA 4TYMA 2I4TA 3B9PA 1YK1A 1LNZA 3UG6A 3EGOA 4KSBA 1LWCB 5JMWA 3TFOA 4XJXA 1L7OA 4RZRA 3F2IA 5JALA 4JZKA 3GLHB 1Y10A 4B6RA 3MHTA 2JVRA 3NP9A 2OFXA 4ZPJA 5CH3A 3I9ZA 1BN6A 1XZNA 3QUBA 3GMIA 4MWZA 5KTTA 1N78A 3NJRA 4GW3A 4K26A