1LK7A

Structure of d-ribose-5-phosphate isomerase from in complex with phospho-erythronic acid
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
229
structure length
229
Chain Sequence
MNVEEMKKIAAKEALKFIEDDMVIGLGTGSTTAYFIKLLGEKLKRGEISDIVGVPTSYQAKLLAIEHDIPIASLDQVDAIDVAVDGADEVDPNLNLIKGRGAALTMEKIIEYRAGTFIVLVDERKLVDYLCQKMPVPIEVIPQAWKAIIEELSIFNAKAELRMGVNKDGPVITDNGNFIIDAKFPRIDDPLDMEIELNTIPGVIENGIFADIADIVIVGTREGVKKLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Hyperthermostable D-Ribose-5-Phosphate Isomerase from Pyrococcus horikoshii Characterization and Three-Dimensional Structure
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Isomerase
molecule keywords D-Ribose-5-Phosphate Isomerase
total genus 75
structure length 229
sequence length 229
chains with identical sequence B, C, D
ec nomenclature ec 5.3.1.6: Ribose-5-phosphate isomerase.
pdb deposition date 2002-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06026 Rib_5-P_isom_A Ribose 5-phosphate isomerase A (phosphoriboisomerase A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 1lk7A02
3.40.50.1360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1lk7A01
2RQKA 3KV1A 3AB2B 2O0MA 3OC6A 2J0XA 2RE1A 3W7BA 2DT9A 3LOUA 4NMLA 2LVWA 3BXHA 2QMXA 3ICOA 4TM7A 3OFHA 4OQQA 4X84A 1PBTA 3S1TA 3O1LA 4GMKA 4OQPA 1NE7A 3IBWA 3OFFA 1FS5A 4L4ZA 3MAHA 4TM8A 4L5JA 3TX2A 2GNPA 3AB4B 4IO1A 3UW1A 5HJ5A 1XTZA 3E7FA 4LUBA 2CDQA 2P9EA 1FQOA 4L50A 1LK5A 2BKVA 3EB9A 1JT9A 2JOQA 2NYIA 4L5IA 3OFGA 3BXGA 1UJ4A 5IT4A 3BXEA 3BXFA 1FRZA 5IT0A 1U8SA 3MWBA 3DC2A 2W48A 1HOTA 2KO1A 1YGYA 3OBIA 3TUJC 1KS2A 3ENQA 3TUIC 5JJBA 2R5FA 4L4YA 2P9GA 2JHEA 4GO7X 2MDAA 2WU1A 5T41A 1O8BA 2RQMA 3AAWB 3ENVA 3CH7A 2PC6A 1RWUA 1ZPVA 3K5PA 1M0SA 1FS6A 3EFBA 2J0WA 2QRRA 3DDNA 3N0VA 3L7OA 5IS2A 3P96A 2QMWA 3CSSA 3E15A 3DHXA 4R9NA 2DTJA 1UJ6A 1Y89A 3ENWA 2RI1A 2ZHOA 3HN6A 3HHEA 2F8MA 4GO1A 3DHWC 4GO5X 3U7JA 2OKGA 1Y7PA 1CD5A 2PA3A 4L51A 3LWDA 3CEDA 3KWMA 4M8LA 5FIIA 3LHIA 2J0EA 3LUYA 3OFEA 1LKZA 4R7TA 4PWUA 3NRBA 2F1FA 3TUZC 2RI0A 3IXQA 2LQJA 2QSWA 1SC6A 1UJ5A 1PSDA 1FSFA 2P9CA 2BKXA 3NZEA 1YBAA 1LK7A 1DEAA 3NWPA 2FGCA 1HORA 1VL1A 2H9ZA 2I9SA 3MTJA
chains in the Genus database with same CATH superfamily
3CTPA 4KSEB 3IUEA 1QGZA 4MQFB 4JI4F 3W2TA 4HPJB 2QV7A 4DG5A 1NLZA 2XCQA 4HHEA 3G2PA 5EMMA 4P32A 4C2BA 3BRSA 4JX8A 3QXSA 3CJ5A 1WG8A 5IWAB 2WMYA 2CLFB 3Q8WA 3TM5A 3VJLA 1ZGCA 4URZR 3WKBA 3DYAB 1PK8A 1UZDA 4J37A 2ATXA 4GMHA 5KVVA 3SF8B 2FB0A 2HLTA 1K3FA 3ZE2B 4F6LA 2JCXA 1WV1A 3PXCX 2CQIA 1D2CA 4PVDA 1TQDA 3W3AA 5EUMA 4FHDA 3GIIA 4JLUA 3GC6A 4N54A 4IJ6A 3P9CA 4TRMA 5E38A 4RNFA 1DTWB 5LJIA 1NM5A 4K28A 1HI1A 3TAMB 1NJYA 3NOGA 1M6HA 4PX2A 2DR9A 2QUHA 1KQGB 3V6DA 3C3CA 3NETA 4EFLA 4O44B 2PA0A 2VFSA 4XWOA 1O2DA 1UWLA 1F4VA 3IUQA 1O94C 4MAAA 3ZU2A 4ZV9A 2W6JA 1RKQA 3IAS1 4EDFA 1KI8A 5KOIA 4PC7A 3HZRA 5IT9Y 2ZOFA 3WBFA 4D9MA 1FDNA 3KQOA 4EI7A 1M1KT 1E8NA 4EHKA 5JAZA 3H9EO 2IDKA 5DM60 3I6ZA 4G1EB 1PNVA 1VB5A 2DMRA 4NU5A 1E0KA 4EOGA 5FA8A 2ZUBA 1R9JA 5AJUA 4MKFA 3IAUA 2CXXA 1U28A 1E3JA 1YB4A 2R5FA 3T95A 3B6MA 4X6UA 1A9XB 2F3UA 3B9PA 4YRDA 2XI2A 3C16C 4QICA 4IXTA 2DR6A 3OOEA 3MM8A 1CHNA 5F1KA 4R1PA 4GKKJ 4PZ0A 3AIIA 1KJ9A 3MFQA 4CMKA 5AKEA 5KYGA 3S8YA 1E77A 3PGJA 4YK7A 3NV7A 4OK5A 5A8WB 4MDFA 4OBBA 2HHLA 3VSAA 3DLIA 4WJKB 1VIXA 3QKUA 4Z7NB 3ZWXA 4R0NA 3V4OA 2BHRA 5LJ5Y 2ZS8A 4BAZA 5ER6A 1HHTP 2A3JA 1UMBA 4HTIA 2YUTA 4LFCF 3PEWA 1M7BA 2HK8A 1Q14A 4ZCPA 1PWZA 3OWHA 4WA7A 3ZGXA 5AVUA 1IUKA 1E0JA 4KAJA 3KTOA 1XP5A 4XEUA 2WFZA 1YSJA 1J7KA 3E7FA 3QQPA 2XBMA 2ZTUA 3UCEA 3N39C 1V1MB 1ISPA 3WX0A 2GKGA 2I71A 3VOTA 4F86A 5JAUA 4OKIA 2H63A 2K4MA 3EGXB 1WSRA 3FMPB 4X1KA 4FFNA 5T7LB 3LVRE 4X94A 4Q1BA 4OQDA 5HKKA 4POAA 1B2RA 2H4FA 2XMRA 1AT1B 1X1BA 4FFRA 3ZK8A 1BAPA 4D02A 3L6CA 2ZHAA 3TZBA 3MPVA 3GEDA 3EGOA 3VHXA 4CFZA 2EVWX 4UZFA 4KW7A 3KWMA 3TGPA 4RX1A 5PNTA 3RANA 1H98A 5K4HA 1ZLYA 5ADWA 5HKBA 3WBJA 4GEKA 3JS5A 5HMYA 3ZWWA 2H4WA 5BRNA 3EWSA 2G9NA 1VHFA 4AX4A 1RJ9B 2VNJA 5H9EJ 3EF0A 3M1IA 3PD7A 5I7RA 2IUFA 4R8LA 4EF4A 1LU9A 1UJCA 4QATA 2E0IA 1E20A 4B3GA 1OGYA 3NGXA 3KP1A 1MOSA 5AXAA 5H68A 4UUNA 4DNPA 4BVGA 4CL3A 4OHMA 2HA2A 3CUKA 1TNDA 4RSMA 4Y1RA 4IDEA 3KLEA 5KNBD 2IUYA 1VDZA 3DE1X 2PY6A 3CR7A 1D2RA 5IT5A 1II8B 2BGKA 5SZHB 3CEMA 1WDTA 2J41A 5L1KA 1ZJJA 3GV0A 3P1JA 2AJLI 5HM8A 4DDMA 4USMA 3ZKWA 5B55A 2HGNA 1UXHA 3CN7A 1RBAA 3MS2A 3DOKB 1NBOA 3EBPA 5KNCA 4D26A 3I58A 4YJ2F 3V6MA 1MNQA 1B23P 4MS1B 1AVTA 3Q86A 2Q49A 3MWFA 2ZCUA 3R0XA 3WIVA 2YJZA 4LRBA 1VR6A 4N56A 5BWBA 1M7GA 3E22B 4MTPA 5F35A 4KGXB 3CRQA 3QZUA 5A06A 4HB4A 2FW0A 3ISVA 4R9VA 2M9KA 3MM7B 1AD2A 3IHWA 5IARA 3G8QA 3KL2A 5TQJA 3VC1A 2J0XA 4GS5A 2XUDA 5L7WA 4H16A 2Z9DA 4DLNA 1GR0A 4CLWA 4MWEA 1EBFA 5LP6F 3M4NA 4JI8B 4BS2A 3UNXA 3F6SA 5M2PA 4UU8A 1UWAA 1VL5A 3ABQB 2QU7A 4P92A 1FXRA 1VQSA 4JENA 2P9EA 4ZYXA 1MW8X 1JEJA 4OLHA 4ICLA 1IPHA 1JKHA 2FR0A 2EWWA 1IEQA 2HA7A 4AN4A 4C11A 3CX6A 3HFZB 4R9SA 2G1AA 3SBXA 4UTOA 1UBCA 2FPPA 4YAWA 1FRLA 4BMPB 1VMAA 2RGWA 3SX0A 3U1NA 1FMFA 4NCHA 3K94A 4I1IA 3H9CA 1KHWA 1C9NA 1R89A 4CCSA 1UMDB 2D1RA 5A1JA 2G4VA 3F73A 1LA2A 4GGPA 1YVUA 4XLLA 1JG6A 2HNKA 4MWGA 4NJEB 5ICFA 3ZBUA 3V2UA 3LP0B 2OPBA 3J80U 1S1VA 5JCOA 4CN8A 2OLWA 4GYYA 5EOVA 1BOOA 2ZDQA 4R0EA 2J7KA 2RE1A 2YMPA 4JV5F 3WHPA 5F2NA 2YJTD 3SFTA 3V8RA 1NHKL 2W37A 1H85A 1FPQA 1HFWA 4XGRA 4DV2F 4L4ZA 2YV2A 2HLDD 4YACA 1BW9A 5BV0A 1YASA 2VHZA 1W6RA 2JEYA 2Z4RA 2V6JA 5SY4A 1HPLA 1Y6ZA 3KDNA 2BGUA 3TD9A 4IUYA 2B6HA 1N9KA 1K5GA 3IMQJ 3ZHCA 2I3DA 4JEMA 2F8EX 4ZPDA 3W2WA 3IAM1 5AHOA 3HXQA 4C9DA 1NVTA 1GXLA 4B73A 4TKVA 2XWBF 3H40A 4FKBA 5CHYA 1BUXA 4ZS6A 4PVCA 1P31A 4WWSA 3TZWA 4ZJQA 1NK8A 4CWAA 4HYYA 3VFDA 3AUYA 3NGMA 1O89A 5KSYA 1YI8A 3QHQA 1D9DA 5ETQA 3SYNA 3G0OA 3IDAA 3N7UA 2K3IA 4U95A 2I1VB 1XZLA 4UOQA 1XMQF 4QOEA 4UU0A 1LDEA 3KXLA 1YNSA 4TT3D 4INPA 1BU8A 1PTJA 1IR1A 4Q48A 5LYJB 1L8QA 3WWEA 3O4VA 3PK0A 1UOPA 1E94E 2OYCA 2BMBA 1BE1A 4ZHQF 2XGGA 3RG8A 1RWVA 1R10A 3EA4A 1CZHA 1PVVA 4ZYZA 4MR8A 5C5CA 3IIKA 1J2EA 3E22A 4HNVA 2ANCA 4Z5XA 1TRKA 3FOAA 3OFGA 3THSA 2NXNA 1S49A 2AX3A 1N7HA 2MQQA 1FFXA 2A9OA 4B3TB 1UKCA 3Q0EA 4J0IA 1OZ0A 1WG5A 1XROA 1X3LA 1A8QA 16PKA 3P0JA 3WB0A 5DM0A 3SDZA 3U7RA 1A0OB 4EZEA 4TMKA 1Y9EA 1OROA 4RK1A 4Z4HA 5JS2A 2RJ3A 4ZN3A 2HF8A 4QYXA 4IQ0A 2QSYA 1KAOA 1LNQA 2ZANA 2ZULA 3WX4A 4FCWA 3W2VA 5EEHA 2BGWA 1NSYA 2ODTX 3ZU5A 4NG4A 4ITVA 3FMBA 3KZVA 1PJTA 3T9BA 1VTKA 1G5RA 1XJWA 2YOHA 5JS8A 1U6BA 5FLEX 1I9GA 4OYIA 1Q0LA 3VGTA 2IYAA 2QN6A 3JWJA 1AQYA 3EVGA 2RMKA 5KYXA 4RGQA 4NL4H 4OOEA 1M0TA 1G7SA 5DP1A 1L5MA 3OLBA 4NQRA 4Q7QA 4I1VA 3AVPA 2JPDA 4BV9A 2R84A 4BKMA 3H1AA 4MI1A 4PZCA 3NIWA 3AF5A 1YG0A 3KG4A 3FBEA 4WLEA 2O3RA 2HFUA 4RKQA 1XC9A 4ID8A 5EE1A 1P75A 3VSEA 3DV0A 3D5EA 1G4HA 3KUGA 2F4NA 1HBUA 2IL1A 2V3CC 2CYCA 4PU0A 2A30A 4F4YA 3JATA 2YBEA 4WZQA 3HHEA 1ZD8A 4C48A 1RT7B 3N5CA 3NEYA 3ZTWA 2ZOMA 3NMUF 4FCVA 4DCMA 1K86A 3FUTA 4HLUA 4KB5A 4XDCA 2D7CA 3GF4A 2IBSA 1KVTA 2XLCA 1G3RA 4UQLA 4HDAA 4KV7A 4XWGA 1A97A 4MKIA 3PC6A 1D07A 2WIBA 2X4IA 2JFPA 3T7KA 5EUBA 2CAJA 4K9DA 3O3MB 4WRRA 3GJQB 3B12A 4B9NA 3X3HA 1MQ8B 5DEIA 1Q16B 4OQJA 3AOBA 1GT6A 3ZHZA 3V4VB 3BC1A 2OO5A 4WYWA 4RIIA 2FP3A 3PUVA 4TTPA 3TI9A 2W9CA 5ALTA 1OFGA 2H92A 4F7DA 3ZY4A 3VDNB 2P90A 4U2GA 4HDNB 1ZSNA 2RJOA 3AM3A 4GR5A 2BKOA 1K44A 3VVUA 2HY7A 2HH9A 3N5KA 3FSYA 1XCPA 3PHCA 4DUGD 2NXCA 1XKXA 3QKTA 1MR3F 5JT1A 2IRXA 5GJCA 4BNYA 1V96A 2X40A 3OX1A 2R11A 4IZ6A 3C6ZA 1ZFNA 3UXYA 3WK8A 5D6NA 4MR8B 4F7VA 2YW9A 3IP8A 1G5FA 2GVZC 1Y4AE 3M1AA 4LG1A 1U0HB 4JU8A 4X3PA 4DR6B 1LCIA 2A7QA 2QRHA 1IBLB 3ITHA 5HOQA 2AWOA 2ERXA 4RLHA 2WHEA 3EGWA 4PSCA 1NXSA 1PQWA 5FLXU 1OWOA 5A5FA 1L3TA 3TF5A 1JX6A 1YS7A 1YZ3A 221PA 2AGVA 5ICCA 1HNZF 4LVUA 4LAFA 3G2KA 1T9VA 5HQ3B 4DCVA 4K03A 1Y6RA 1V8OA 5LFAA 5GVQA 1SXJE 3CPEA 4KRYA 1FFCA 5IN5A 2X2FA 1RJGA 1U2CA 4YRNA 3IEIA 2PS9A 4M0UA 3PIOQ 3RVNA 4PAWA 5DOZA 4LJ6A 4Z86A 2GS8A 3OTOB 4PIPA 2PX6A 2QRVB 1ZEMA 3CZQA 2OK7A 2ZE7A 1FMJA 1CLUA 3DUFA 4N5IX 4K50A 4AF7A 5DYGA 1Y9AA 3PYMA 3PP8A 2ZM5A 4HNUA 4M0CA 3MPWA 3C3XA 4QYSA 2H6EA 1IN8A 1HNXJ 3IIJA 3WB1A 4Z4GA 3K9WA 3BN3A 4D4MA 2IBOA 2IA6A 4RKFA 4A10A 3LP2A 3V81B 2KHDA 3GR1A 1NXWA 2A2CA 1I9CA 4EO4A 1RYZA 1U90A 1KFKB 3SSOA 1KQFB 2WTXA 3ZNUA 2ZE5A 3SMQA 4IDOA 5CFOA 2HVDA 3MECA 4CLFA 1R3DA 1W36B 3BKTA 2K2PA 4F67A 1F14A 4BX9A 1U8UA 2NU6B 4F71A 4OHYA 4DRXB 3ZTSA 2ZK7A 3D0OA 1Q8LA 1N2ZA 2R1UA 5THXA 1ZJZA 2ZJQQ 4QDTA 3FSXA 4DV6J 3RC7A 4HJRA 4GT1A 4FR0A 4QJBA 4RW4A 5C42A 3EZYA 4DQIA 5CK5A 5LQUA 4X85A 1E61A 3PT5A 3AKZA 1BU5A 4YAKA 4PN3A 2ZM6B 2ZIZA 3IXQA 1XJWB 3OPYI 2QRMA 4K9NA 4EG6A 1QAQA 1HA1A 2COUA 3X1JA 4CLKA 1J5OA 3MWEB 5KOHA 2BGIA 2VAWA 1FI4A 1YBTA 5IVDA 4P9NA 1JLGB 1NT2A 1H5QA 5HZKA 4XIGS 4YRIA 3BRQA 1GKIA 2R7KA 3K70C 2I65A 4LQCA 1UINA 4KE7A 4UHFA 4BCAA 4M46A 2ODQA 1N2HA 2ZSBA 2GLUA 4DBLC 3MCVA 2J87A 1ZIOA 3F9IA 1BEUB 4LJ8A 1U7DA 2CWDA 4ETIA 2OESA 4W5OA 1RCXB 3WA7A 4QVGA 2HS0A 1BCSB 1PX2A 2GFIA 2V7GA 5DHFA 2W9AA 5FULA 4OYWA 2ZIXB 3DB2A 4QVIA 3DQQA 3WLQA 3C6UA 1NVKA 2V97A 2W6QA 4R9NA 1RWPB 5I7VA 4KE5A 4RAOA 3SC6A 3PDWA 2X5NA 1RM5A 1A1VA 4LFCJ 4CMCA 1CZOA 2I3GA 2WV9A 4NABA 3CF5Q 4DMKA 4ZKEA 5JMTA 4USUA 3AI3A 1NRKA 1J99A 4M0MA 1C9EA 1W1IA 2Q28A 2AF4C 5HGXA 2YNMA 5G02A 1W4LA 2F3RA 4BVLA 2A9JA 2PSHA 3QITA 1LLUA 3P32A 4C98A 4NE7A 2V8OA 2NO6A 5CYQA 4DIKA 1YKGA 1QLNA 3PWKA 2Y0DA 4I5EA 3VBEA 3JQQA 2VP3A 2NNLD 2QRVA 4H4MA 2VFTA 2X0NA 2PZMA 4QR1A 3E3AA 4YY3B 5A4MS 4NNJA 1RZRA 1CBKA 3DCYA 4NAUA 4QDKA 5K14B 1B4DA 3OU6A 1EFKA 3L41A 1BD4A 4DMFA 1UKBA 2ZXUA 4L76A 1X6VA 1NPYA 3EYZA 2X1BA 4QEZA 4WFYA 3OR2B 4B5LA 1RC0A 1OW3B 1FLVA 4Q3CA 1PNQA 3QBCA 2OAP1 3DN9A 2B4YA 4MW1A 3DLKA 5IMBA 2Z3WA 1RAHB 3ZNNA 4OZNA 2WKWA 2MU1A 3QWHA 1LI7A 2B69A 2CVEA 1TF2A 1J9EA 1ORTA 1JFTA 3T3EA 1SVSA 5IK2D 5H80A 3KSUA 2WVFA 2R6CA 3TNFA 3FTCA 2IIHA 4IOMA 1F48A 5K8TA 1TOAA 1VPVA 4YMUA 3H7AA 2XHEA 3QW4B 1XN1A 3V8QA 5L7YA 2QMEA 1YQQA 5CHEA 1CFZA 2XZDB 3FPHA 3URMA 2FZ4A 4FLEA 3OUYB 4XUDA 1T3TA 1MRZA 4G36A 1FXLA 2PH3A 3DOUA 3E4DA 2ONYA 3CH5A 4C3UA 2M5YA 3C45A 4J4TA 1O95C 1QVZA 1EK5A 1DZ3A 3AVOA 4O3MA 1ICIA 4OATA 4ZI5A 2VXCA 3W8RA 3CB2A 2NUHA 1YMUA 2WY2D 2AMVA 4A8JC 4WESA 3UOWA 1VQ8S 3DYBA 3B1WA 4V2IA 2J33A 1HQKA 3L1IA 1CCWA 1L5HB 6CHYA 4MVJE 5I42A 4WFBQ 1F06A 2XMVA 5AVYA 1OWPA 4BB5A 3JYOA 4MIBA 3GCXP 1W94A 2QLFA 1PZMA 4BPBA 4EL0A 2VP2A 1IPFA 4ZI7B 2AJBA 4B3HA 4KLNA 5G4LA 4EBFA 4O4JF 2WJJA 2E7ZA 2FSVA 2W2KA 5E7MA 3RGGA 5DTRA 2JD0A 4P84A 1U1DA 3HCEA 2ZAIA 3HWRA 2QA1A 3NLCA 3LBFA 4CQMD 5GIPE 4M54A 3KKOA 3OY7A 4KTQA 2LUOA 4RJTA 2GSWA 3NS6A 3CJKB 3G6ES 1NHVA 1W93A 2EDCA 3K0CA 1KAEA 2VYQA 4V24A 1H2FA 2ZR7A 3T1AA 3PX0A 2G80A 2V4JA 3MN1A 3WK5A 1ISJA 3O2QB 5AVVA 1UWBA 3DKIA 2XNRA 2YWFA 1UBSB 1LRLA 3SFUA 4MWBA 5C80A 1V2HE 4HADA 2UVPA 3MLEA 5FOTA 1KBRA 4CLDA 5K3BA 5FO1A 3ZDFA 1Y5RA 4G89A 2XLJA 1LPMA 1HARA 2VWQA 4JMPA 2V9WA 1XC7A 3G2QA 2GVZB 4ZFNA 1ADFA 3DDZX 2CXOA 4NZOA 2FDCA 1ZI6A 3KU4A 8ATCB 1U8ZA 4DXAA 4RUBA 2A5YB 3QNMA 1O97C 3DHVA 1IY2A 4XK8C 3CNQS 5JJLA 2DPJA 4BLTA 5T67A 2JH9A 4PRKA 3E81A 1W47A 3Q98A 2REQA 3LOUA 4GPTA 4OQFA 1AX9A 4ZAXA 3W5BA 5JMOA 1GAEO 3ZWDA 1XPRA 3I61A 1EDZA 4ZITA 4B3SJ 2BYCA 1OH6A 3HCFA 2BMJA 3KVOA 4U3JB 1CVIA 5T7LA 4Y6OA 4I1UA 5AMXA 3JTPA 1CDDA 1UQTA 1AF4A 1I0LA 3FRHA 1JHOA 2QRUA 2BJ9A 4HVLA 2JAUA 5E1OA 2RSQA 1FKPA 3UHAA 1GL9B 1BDJA 5AO9A 1SG0A 2OPQA 4FONA 1BO6A 1UOOA 2I6UA 3KVVA 4L57A 4ZOSA 2DNOA 3SQXA 4B4UA 4J1TA 1X4DA 8AT1A 4LF1A 4HAZA 4B0OA 2NZYA 3R9XA 4CM6A 4KRWA 1HDOA 3GQCA 4DQLA 2JLBA 4QPXA 2GPBA 3PT9A 4AZTA 4L8GA 2WUGA 4EW2A 3DNFA 2JX2A 3QLTA 4G0NA 1W36C 3EODA 1DEAA 1A1SA 1RJDA 4RTOA 1OWLA 1VM6A 3ENKA 1O0PA 1ZR4A 2BF7A 2IXGA 3ND9A 2VUUA 4FPIA 4CHGA 4K9QA 4G41A 4MRRA 4FWBA 1V7PC 3NTRA 1N75A 3OPYB 1FUIA 2BDEA 5DASA 2P6PA 4Y2RA 4HACB 2VBFA 5EXDA 4DFDA 2DNLA 3KVYA 3E27A 4R83A 4CQJA 4QU7A 1L7XA 2EKDA 3M4ZA 3I8XA 2F9MA 4TYBA 4KV8A 5CLGA 1N5VA 5A0YB 5D3KA 3AFMA 2FK7A 4PINA 1JS1X 2JC1A 1EM8A 2OG1A 3UICA 4JYAB 1DJLA 1O5TA 5C32A 1LTHR 3T99A 4AWBA 4LJMA 3P0RA 1IN7A 1CKEA 3FGZA 3D2LA 4BMSA 3UDCA 2GN1A 3JASA 2QZ4A 2HGLA 5CW1A 1G98A 3QHPA 4LF6B 4FMPA 4K4SA 4GKKF 4JJAA 3H16A 3PF8A 4HP8A 4PWYA 3GRAA 3W8FA 1WB6A 2Y0BB 5AXMA 5EN4A 4NCAA 2L82A 3V9AA 3D3CJ 4HDSB 2LMIA 3DR5A 2IYQA 3PNVA 2AIRB 4AZ3A 1D9FA 1DVRA 1G3OA 2P79A 1CSJA 2FUG1 2QN9A 3P0EA 2PG3A 3CO0S 3QY0A 2PX3A 4ZTBA 5CURA 1OY1A 5CXTA 4B3JA 3VNBA 2G6BA 1WBJB 3SR0A 3JQ8A 2B92A 3CEPB 2BJWA 4M5MA 1SN7A 1U1GA 3HDYA 1CF2O 5LYJF 2QT7A 1PAEX 2JHPA 2ORWA 6PFKA 2ZB7A 4C2UA 1TJPB 3IQXA 5DHAA 5HDQA 4UNNA 3WTCA 4DHWA 1SCBA 2W4PA 4POOA 4QWBA 1JPVA 4LHXA 5E7OB 1P8AA 3IFEA 1V37A 3CW2C 1FP4B 4JR0A 1I7QB 1EHCA 1OXKB 4FDAA 4CUJA 1YCFA 3TAXA 1MMFB 1YIAA 2RCYA 3RHTA 3WS7A 2MHNA 4UBMA 1G21A 4RIEA 3STTA 1WUUA 1V9SA 4JI1J 4BNJA 3H83A 4RK0A 1W5EA 3IBCB 3RAMA 1L5WA 5AI6A 3VPFA 3DZFA 1TL7A 4DF3A 2C0QA 2R8KA 4KXYA 4HNSA 2HHUA 1K4YA 2WSCC 1WLYA 1SJ9A 2ID8A 4MVJF 1GFIA 4HZUB 1P1LA 3BWXA 4EBBA 3SYZA 1YWGO 3TXXA 3ENQA 4DS4A 5ESDA 4HI2A 1M1YB 5FV7A 4E6EA 4LZZA 4NH0A 4D4GA 1DBIA 4C9BA 1Y9JA 5CYOA 2N7CA 2DWPA 1ISFA 1UAYA 3EAGA 2WTFA 2MQPA 3QVOA 1VMBA 2YJ4A 3NNDA 3GZTB 3ZU4A 4ZAWA 2L18A 2P67A 1RQGA 5JVDB 1GWNA 2DRIA 2C3YA 2B21A 2O2GA 3NBUA 2MXYA 1U5BA 1RBQA 2XGPA 2RGGA 3I6IA 2B6AA 4J9LA 1S59A 2IOYA 4QUJA 1XZEA 2I7VA 4OQQA 1LW2A 1AKYA 1CS0B 4J3FA 3QU5A 3V5NA 3II6X 2DHGA 2D7DA 3WV4A 3WIUA 3HCRA 4ETMA 3CVVA 1KTVA 4NLRA 3FTPA 1DCKA 3H2BA 4IFEA 3P5SA 3TKYA 3NHFA 3G3EA 1SAYA 1KONA 2POCA 3AESB 3DMHA 2ZT7A 4BNTA 5LQMA 4C0BA 4HVZA 1GGKA 1L4GA 3BFVA 2UXDJ 4RF4A 1WORA 3OXLA 4M1KA 3IV7A 5DDRC 2H5JA 5JCZA 5H8WA 2IC3A 1OWNA 5A7FA 4LDJA 3HI9A 1NXIA 1T0UA 5EVCA 2H1OA 3EVTA 4O3QA 1AQUA 4E32A 3ZIAA 3OO0A 5D3MB 2BFEA 4NBTA 1Y10A 4F3RA 1JXAA 1MB3A 2WJVA 2CLOB 2HHCA 3OQJA 4JC0A 2V4ZA 2CZGA 4HEQA 4WNAB 2H1HA 1S10A 1M10A 4KXXA 4RPLA 4M86A 4CKEA 3LX6A 4EEXA 2GGSA 4G0ZA 2XIJA 1UFWA 2OB2A 2WPNA 2WDZA 3P4YA 5E3RA 3U7QA 1ZHOA 4KQKA 3QVLA 2AG1A 2R00A 3H6KA 1SXQA 3SSNA 2BH9A 2J0QA 1BY9A 2Y1IA 2EG5A 2O6LA 1FDTA 1PZFA 2QE7A 4WFQA 3ZDAA 4M0LA 1UXJA 1J27A 2YY6A 2D4HA 3TPFA 2R4QA 1WU8A 2HWWA 2DAPA 2XWXA 1FFSA 1OVGA 3THXA 2VDLB 3MCZA 1WVIA 4LISA 1U3GA 2C22A 4IG0A 2UUCJ 2HAFA 3A9UA 4PHHA 4V02A 1FLAA 2B4RO 1Y98A 2QAGA 4QFMA 2IBMA 3BFXA 3E03A 1QCZA 5IKPA 2MLZA 5KBYA 4J7UA 4MV4A 3SDEB 1SBHA 3CZ5A 4C4PA 3NNAA 3QPBA 4GZLA 2D9OA 2ZIAA 2I6FA 4M21A 1SCNE 2CG8A 2VDRB 3BJYA 2OB1A 4LDPA 2FJUA 1P4AA 4WXPA 2B0GA 3M6MD 3MR5A 3ISTA 2YJNA 2ZAGA 1F60B 1O54A 1Q95G 2CLHB 2AV6A 4C30A 5G0RB 3BL6A 3HO1A 2DPYA 2GA8A 1L4HA 3NWJA 2COEA 1VE7A 4C7MA 4JB2A 1RDFA 1Z07A 1VQYA 2IY7A 1GQFA 2R2GA 2Q0QA 4CIOA 1S6OA 1IQRA 3SR4A 1JEYB 3L7BA 4KKXB 1QUVA 3JVIA 2GAOA 4YOEA 1PAUA 2G5CA 1NBEB 2XNSA 5EHHA 2AEJA 4LN1A 4DLEA 3FYUA 3A1CA 2PLFA 3LKBA 4FFWA 4B87A 2AYXA 1AE1A 3CCJS 1QF7A 1Z3CA 1KO4A 1RCFA 2JEFA 2ZR8A 2I2CA 4KTVE 2G63A 1VQ5S 1QYWA 4MUAA 3SXUB 3ZCVA 5T8KC 1YVEI 3IBGA 3EQ6A 4YUVA 1PKEA 4JZKA 3WYBA 3KR1A 1F0PA 4IJVA 1X1QA 3AXTA 4D99A 2GM9A 3GOHA 3WNQA 2IQ5A 3OZDA 3TR6A 2EIXA 1L5LA 4AF8A 4Y2VA 4TSKA 4PZZA 2GASA 4RDIA 1EFRD 3AV0B 3DNPA 5DE3A 4GKJB 2VRCD 1V11B 2KTQA 4QPDA 4V0LA 2QRLA 1ZK2A 1U47A 1ZW6A 3AONB 4B0PA 1N6HA 4DL5A 1J2TA 3RUEA 2C59A 2A78A 2ZIXA 2P2SA 2Y92A 3ZE6A 4ZC8A 2II6A 1BJRE 2OOSA 3UAZA 4QARA 4MUGA 1Q1KA 1W36D 1WM1A 1JDZA 1Z1ZA 1QV6A 4DE5A 3S55A 5FR2A 5DJ5A 1UEXC 2A18A 2FJEB 2QX9A 4AK9A 3FMIA 4K4YA 5IV4A 2IXEA 2BPOA 3FCVA 2D5AA 3DBIA 1UVNA 1NVGA 2W9BB 1R7RA 4TWAA 1Y5MA 4HWPA 4DV0F 1QYCA 2KS6A 5AI4A 4IVQA 3FWHA 3I9V1 4QOHA 4K4VA 3CNLA 4JEUA 2QM0A 3IC5A 4DV2J 1W96A 2PT0A 3W63A 4H4MB 2HHSA 1V9LA 3D2BA 1PEAA 3CY6A 2NSDA 4ZZ2A 4G07A 1YL6A 5ADZA 4KPYA 2YCLA 4C4TA 4F4DA 1DT3A 3AJEA 5K03A 4WN9B 4PZ9A 1OD6A 4IOAQ 1EUZA 2BMFA 4A0GA 1INLA 2FA9A 5IKOA 4KR9A 1P7WA 2FC8A 3W3AD 3QU2A 1X9IA 3GJYA 1H1TA 5ABPA 3ROPA 3WV5A 5LSOA 1VHLA 2Z57A 4U0JA 2G1HA 2LQ9A 1Q6YA 4EA7A 3HC7A 1MN6A 1RZUA 2ATVA 4GQAA 3IPLA 3NAIA 3NHLA 4QECA 4B9VA 3NI2A 2V2QA 3V1TC 3QKIA 1VS3A 2F64A 3LHIA 4YX9A 4NZZA 3DZHA 2EJWA 3GY0A 1E9VA 1FU4A 3NNHA 4TLMB 821PA 5TIIA 2KW5A 3VR0A 3ND5A 3K7RA 5DSTA 4AXJA 4L22A 4C3MA 3TTSA 1I3LA 1EKSA 5A8RB 1NKSA 3CR3C 3TQ1A 4JA0A 1DAFA 1PO6A 4UCXA 2YVKA 2ZREA 1Y37A 3PFIA 1YZUA 1ZAXA 1ACMB 4ARAA 2NTVA 3ZX4A 2QYHA 1Z0KA 2CPYA 1VMEA 1PO7A 3RNOA 4KPGA 1E6WA 1SD1A 3SBOA 3K8QA 1NSTA 1SXPA 1U04A 3ML1A 3PO4A 3ONVA 1U0EA 1Q1EA 1Q22A 3LKVA 4W9MC 2A2DA 5A0VA 3MOIA 2BW0A 2IH2A 4GMFA 5JTUA 2RGBA 3S2UA 2ONZA 1VRCA 1R6YA 5AT1B 1N8KA 2FSSA 3OE5A 1IJKA 4NE9A 5KFZA 2VAMA 3KHUA 1SL1A 4EYOA 3I5MA 1OKKA 2QUKA 3TWOA 4V38A 2C8LA 1GNSA 2QTAA 2AD9A 3GRZA 2XSJA 1HK7A 3L8EA 3TIFA 3SXUA 1TKZA 2WYVA 3QMQA 5FD8A 3QOXA 4QWMA 4FP9A 5GONF 4LF9F 5FPTA 2VPQA 1R0AA 2GCEA 3DMFA 2D0DA 3MD0A 3SI7A 3HXTA 2BTOA 3UN1A 1GZ5A 3QEBZ 1GU1A 5IVKA 2BN4A 1M8PA 1KYXA 1REQB 2P9ZA 1MF7A 4JI8J 2LDXA 3DM2B 4ZT7A 3CINA 2R8BA 1D6MA 4K59A 2GZAA 4AS3A 4GVLA 4TWZA 4TRNA 4FKYA 2UP1A 4B9UA 1JSCA 4D3SA 5LIRA 4Q45A 2GB4A 3MWDA 3JQGA 3PW5A 4F2WA 1SOUA 1BC5A 1XT6A 2HUPA 2MYUA 5HRAA 3B6ZA 1XHFA 4QRDA 2H2FA 3KKKA 3RVSA 1AZWA 1I0ZA 1ZX1A 4FYWB 3SKYA 3W6NA 3FCHA 3R5CA 4KN6A 3TUZC 3MURP 4QXOA 2I34A 2VDPB 1ZD4A 2UYQA 4MYUA 3IVRA 4MOWA 1E1CB 2PAFA 3V6LA 4CMIA 1FFAA 2A1TR 4B34A 1E3LA 1ETHA 1QE5A 2CJWB 3ISZA 4KYUA 4YVFA 1H9AA 2KJVA 1HI0P 5JAPA 1QP8A 4RFVA 2AI2A 2X0IA 1OTHA 4NJEA 4ZVTA 2H17A 4DJ5X 1R5JA 2C78A 2J6HA 2A0KA 2DNMA 1DIOB 4UUWA 3WBBA 2D5BA 2RF2B 4L9RA 4INOA 1PTKA 3AUAA 2XRZA 2AOWA 3ZYZA 1OYEA 3OTBA 4YUDA 2PFDA 4H31A 3L07A 3U7EB 3R5FA 4NLXA 4JL6A 2WHYA 1N25A 1SKYE 4BFXA 2JDID 2WYUA 3MOJB 4ILLA 2MQ8A 1G19A 4MRMB 1NWCA 4AXBA 1DTSA 2GBLC 2AV5A 3U9LA 3LP1A 2DBYA 4PFKA 2W11A 5CVUA 5JMWA 3K4HA 1JIVA 2QLMA 3QFSA 1XNRF 2FPPB 4I69A 3AHIA 3GLTA 4TTIA 5CCBA 2Z58B 1SO8A 3TO5A 4C0XA 3GR6A 3MAAC 3WNBA 3HM9A 3NASA 5FPQA 4OGLA 1QGYA 3NBYC 4HOYA 1HC7A 3PRVA 1M5OC 4PCAA 4JLKA 1EUQA 3H4MA 3QWBA 4Q7MB 4EEZA 5AHXA 3UJPA 1XU7A 1FFGA 2OWDA 4JC8A 3V8EA 2QAJA 1HNZJ 2B7BB 5F9LA 1GPBA 2IHZA 4C87A 4C14A 1CQIA 3M8KA 2VK2A 3IHTA 2VXYA 4H15A 5IKMA 3QPUA 2PGXA 3EOAI 5H1SV 4BLSA 2XB6A 4OP3A 3BIWA 4CM8B 3NHKA 3EUAA 5IEJA 5H5JA 3SHWA 2NGRA 2HK3A 1P9YA 4MUYA 2XC9A 5BN1A 2QBYB 2QD5A 4DEZA 5EIOA 1JG4A 4ND6A 3O2SB 1GTG1 3OCZA 2BCJQ 4EKEA 4EGJA 2JGEA 1WABA 4MQ5A 3TNYA 2QVLA 1P0FA 3V1LA 4M1YA 2IV3A 2OXTA 1ZUNA 2HYIB 2SBTA 3K2IA 3FSEA 3HP4A 3INNA 2HVEA 3SFGA 1I1QB 3A4MA 3EZGA 1FLNA 5KFXA 3BMCA 1GZDA 1UBMS 3RS5A 2NU7A 4OX9F 1VIVA 3R7LA 3VTAA 2X5XA 5KJFA 4GXRA 3BRCA 1FEZA 4EA8A 3UCGA 1WD7A 4CEIA 2QMUB 3KJFA 3E9EA 1NV8A 3P9IA 1RJ9A 3DOMB 4A8HA 3BK7A 5CLFA 2TS1A 3AF4A 3CW2A 1H4SA 3U1VA 3DXYA 1YK1A 1I14A 1PZXA 2BZ1A 1KK3A 2PLWA 1FDIA 5KG6A 1OI2A 2Q45A 5JNVA 4RU9A 1NQWA 2O3UA 3OQVA 4KGZA 3B9BA 5HROB 3ZLUA 4ARZA 2SKDA 1HYSA 3FSJX 3L7KA 3VH4A 3EIEA 3C1UA 1PJZA 2XNHA 2DUNA 2YWHA 5JZVA 5EKUA 5MF6A 1RTTA 3P5BA 3WKAA 1UP1A 2QZJA 3QEOA 3CRNA 2WAMA 2R2RA 3A32A 1PYGA 3MRVA 4ZVUB 4Q03A 3ITHB 3RJTA 1PV1A 2Y1DA 4DV0J 4TM7A 5HP1B 1LV7A 4IICA 3TNLA 3V7WA 2HWIA 4P2MA 4KXLA 5C8YF 1U63A 1RT2B 5JADA 3BE6A 3EEOA 3DAYA 3VZCA 3DLEB 1FDBA 4GSYA 2P2CA 3OHSX 4DMRA 1BX0A 3FZYA 4IIDA 5IULC 1E6YB 2VFVA 3V1KA 1LY1A 5CB4F 2NO1A 5HLFB 2JHFA 5J2PB 3GPAA 1F0KA 4ZEOA 4ALKA 3BMXA 1SL2A 1XJ0A 5IVPA 3PFEA 3OMLA 4DSNA 2ZJ4A 5F1PA 4NLYA 1J33A 5HS4A 4WAUA 1KLNA 2YDXA 3UMBA 3CLSC 3KJQB 3I6BA 1M2NA 1OX6A 4Z4CA 3OQOA 4ZVRA 4J49A 4DJTA 4QIVA 2CJPA 4YCLA 4DR5B 4QG3A 3D66A 1F1BB 3IB6A 3QMVA 1MRNA 3UK0A 5CNIA 2EYQA 4NCGB 5GY7A 5SV2A 5KFEA 2RB7A 1UP7A 4C7QA 1IY0A 2IH5A 3HYTA 4KGXA 5AVOA 1BQMA 2OEPA 1HE5A 2JAQA 4USKA 5TLSA 2QMXA 4H1UA 2H65B 1N4LA 3ZHOA 4LR7A 4B8YA 1QUEA 2O2SA 1JTVA 1Y1KE 4Z2AA 2ZH5A 3AI1A 4OB7A 3SEFA 521PA 5L6LB 1EG7A 4NDNE 4KPEC 2KHZA 3LT1A 3T3PB 2QXTA 5EIEA 3PE3A 2C4NA 5FI1B 2RGRA 2P9HA 3PU6A 2A0WA 1MZVA 4GI7A 1KC1A 2IVMA 3NS7A 3W60A 4AU1A 3N28A 2Y6UA 1QO0A 2YL2A 3S6JA 4G0QA 2VBXA 2ZR9A 3VC7A 4V0RA 2PUVA 4NFYA 3SNHA 4YDSA 1UJ6A 2UKDA 1RNLA 4RQTA 4AJKA 3ILHA 1E18A 1IB6A 2QVBA 3K2QA 3FCOA 3SZMA 3LCVB 1A8PA 3PKZA 2V67A 2FSVC 1QB8A 2GCGA 3VU0A 3OIYA 1TC2A 1CZRA 1G63A 3I96A 2VATA 5EP1A 3P2IA 1VQ6S 4AL6A 5L1JA 3IT0A 4V0MA 3MM9A 3I5CA 1K89A 3EVWA 3OXFA 3GUCA 4S1NA 4TQGA 5K01A 3ONWA 4CLEA 1KZ6A 2OEKA 4F02A 1MX1A 5KFNA 4PSUA 4MDEA 1G66A 3RRZA 3I5BA 1YOVA 2GXSA 5BQPA 3OTCA 4OO3A 3UXHA 2IPXA 2ZXEA 2XVZA 3D7NA 1X31C 3AKDA 3DKRA 1YQTA 3QELB 4M9XA 5BMVB 1TYEB 4DRYA 3VDXA 1H4TA 5JD3A 3ZE7A 4LVCA 4YV1A 1NJXA 3D5QA 4FCTA 4MULA 4YQZA 4OU4A 4U7FA 2OTCA 3R3WA 2GN8A 2CNNB 1XLVA 1SBNE 4ENRA 4AJEA 1FZTA 1M1HA 5I9BA 1XZIA 5DO2A 3LT0A 1M34B 1TM7E 4HNAB 3B82A 3P20A 3N9IA 1DBRA 1N36B 1VIAA 5DNEA 2I6XA 3CDUA 3TX8A 1SKSA 3NANA 2B25A 1HNNA 2CK3A 3BGFA 3OEED 5ETSA 4K5RA 5U4XA 5K8MA 4XPZA 3CUNA 5L3QA 4QIGA 3SE7A 3ZDYB 1VE1A 3OVMA 2WIKA 4YJ3A 4P52A 3AG6A 1SVIA 3AVVA 1MEJA 2GEDA 3P71T 2OD6A 4BZQA 1H8HD 4XWWA 2AOVA 5AQ1A 3QBEA 1GPJA 3BK1A 4Y2YA 3HPOA 1GQEA 2XCAA 5B7QA 2C28A 2M4MA 4HDMA 3JRWA 5IZHA 3CA8A 1VYVA 4B83A 5E1DA 4WIQA 2I54A 1AZTA 4N8EA 2R1TA 5JNUA 2FEPA 4BRUA 4LRTB 2VNKA 3WC0A 1P19A 2PD4A 2R3VA 2VEOA 4BTLA 3NX4A 2XUOA 1JR4A 5JAHA 2D3TA 1GSIA 1QLJA 5E3CA 2LR0A 2DHRA 4GSLA 3MILA 4RZ3A 4X4SA 1CRPA 2B78A 1Z74A 2J7WA 1N5OX 2YKNA 2W2TA 2ZWVA 4LQ9A 1HWLA 3IEKA 1RMYA 4RK5A 5CFQA 2FP4A 5BN5A 3MCNA 1C2TA 1VJ5A 4M88A 1TL7B 3BULA 5FL3A 4J9RA 4TMXA 3JQAB 1G3IA 4X6LA 1RABB 1M2GA 2WYWA 3QX7A 1ZHFA 1GUYA 1Q78A 2A1UB 4X1KB 4A6XA 3PR4A 4JEHA 4WZ6A 5JBIA 2FW7A 4KODA 3ST7A 3AD7C 2C2EA 2NLWA 1RAIA 2JGKA 3I6MA 4L6CA 1YLXA 4EB8A 2ETXA 1DRUA 3QGMA 4MTLA 1ANKA 2XZTA 3PQ5A 2ZB8A 4K7QA 4OZ2A 4Z7CA 4BWYA 4KWCA 1T6BY 2BKAA 2UYOA 1F6DA 4I4NA 5HIJA 3O2NA 4RK4A 4ERNA 2QEXS 3OZVA 5KT2A 1OV4A 3LPMA 1VOTA 1NKEA 4Y7DA 4GICA 3O8QB 3AR4A 4BL5A 1U5AA 2GFHA 1W19A 3ER9A 4FYHA 3W3SA 1FXWA 1B6SA 4N7BA 1RPZA 2VP5A 2V63A 4H7IA 5C1OA 5KNDH 1T8RA 1GTMA 1MO4A 1DC6A 5IJ9A 3IEVA 2GZ1A 2ZI3A 3RAJA 2V9PA 4NRUA 2AN4A 4RLEA 1RAGB 4AE5A 4BJ5A 3ZD9A 4WXYB 1WVGA 3RYIA 1IN1A 3GMSA 2QUZA 1HXHA 1GZ3A 1K4KA 1AKMA 1K7XB 1V7CA 2I67A 2B3DA 3KQVA 2HQGA 1L5QA 1NQUA 1XEAA 3PHIA 4M1MA 5AKIA 4G01B 3KB6A 4FI3F 3GCGA 1KL7A 1HQDA 4M7PA 1Z56C 3NM5A 3OX4A 1R15A 2BWJA 3RSLA 3OZ7A 3CPHA 1FTNA 5CIYA 1Z18A 4YMHA 3MAAB 2WT8A 3S01A 4UOFA 2DXDA 1O4VA 4JJGA 3AHPA 4RDCA 2FVPA 3GGDA 1I7NA 1UTAA 4AURA 2UZIR 5IBPA 1G1XA 4BKRA 2YVAA 1GUFA 4HKQA 2IYTA 2CJFA 4MTCA 5KTTA 4Y1GA 4CT5A 1EX1A 4DSTA 4L4YA 4LZOA 3DT9A 1GM5A 1VCMA 3QU7A 4S1TA 2NMVA 2AQIA 1N2JA 4DYHA 4LF4F 1NW5A 3DPUA 2O5DA 1WB9A 3D4PA 1QHFA 3P94A 1S01A 5J23A 3LOQA 1AN0A 2BGRA 4LRSB 2C1XA 4QWEA 3WDKA 2WSMA 3QXJA 3V33A 1NP7A 3P9SA 3FFXA 1S5PA 1NSFA 5BWNA 3CU5A 5AW2A 2ZJ0A 3S7ZA 5EWFA 3RFUA 4CO0A 2CVHA 3PYEA 4EMBA 1PSDA 2F6RA 4URVR 3T5JA 2C2MA 5FYDA 4OFWA 3WMGA 5ELMA 2O8EB 4JB0A 4IDQA 4L75A 3R7FA 2EV9A 4KG7A 4X65B 2OAQ1 2K2WA 5FWYB 2J31A 2C95A 2OIHA 2C4WA 4H59A 4O3FA 4JELA 2CLIB 3JQAD 9LDTA 2QTMA 2C2RA 4KLRA 4KFTA 3CGWA 4B47A 2PX5A 5BRJA 3HZHA 4R41A 4Z49A 2P5UA 1E2LA 1GAOA 3O5AA 1HDEA 4Z2XA 3T12A 2HD4A 1WF1A 3NH9A 5CFZA 2CWWA 4ZK7M 2Z6AA 4D25A 4WFIA 5ESRA 4HDRB 2HF2A 3OTIA 3CEHA 2HCRA 1JT2A 3U60B 1J2JA 1LVHA 3DXZA 3A4YA 1CEEA 2VT6A 4Y7CA 4YHHJ 2B3TB 4PXDA 4RHXA 3L46A 4CMEC 3IVMA 3GEIA 2EFGA 1Y8CA 4MHSA 3Q22A 1BXGB 5CFPA 2FXIA 4ER7A 4IHJB 4DFKA 4OI0A 3ZCQA 3A9CA 1GUZA 1EMDA 2VASA 1YC2A 4YAOA 5BW6B 5EXEA 1AH2A 4H4OB 1LW6E 4MW2A 1LZKA 3VR6H 1M90T 1ULAA 3VJMA 5IQ6A 4AT1A 1RP1A 1RM4A 4RVGA 1ADGA 4IMJB 3MINB 1NJWA 2HU2A 2WA1A 5L3SA 2QNRA 4RDHA 1KDYA 3ZO7A 3RHSA 3DOLA 2AN5A 5EMJA 3TOQA 1H66A 2SCUA 2W6ID 2D8MA 1TMKA 4MLCA 4IXNA 3BL8A 1ZCAA 1T4DA 2NSJA 4AZSA 2RBGA 5REQA 5A76A 3RR2A 1BG6A 2C0PA 4FYVA 3P96A 2ZJOA 1NXVA 1GZHB 2GR9A 1FX0A 4F4CA 1CG6A 5SYMA 1CEZA 1G8HA 2WJWA 3TLGA 2WIGA 4BKPA 2XA2A 4JB8A 2IWRA 5DX0A 4UM9D 2OLJA 1IXSB 3QNWA 5HDBB 1RKUA 3ESXA 1CJUA 2AF6A 2B8QA 3DVRX 5TGZA 4CQMA 5HMZA 3USCS 1PR5A 1ULRA 2AMJA 3DT6A 2O3TA 2BFBB 2XLBA 4FT2A 3FCWA 1R31A 4JJFA 4R1LA 2YQ1A 4LNHA 4MB2A 4ZREA 3UVJA 1Z06A 4R2HA 4FBUA 3ZBQA 2FQYA 2C1EA 4PFJA 2WOMB 1SBCA 3F2VA 3OQ6A 4AG5A 4B3BA 3ZJUA 2PKCA 4HDKB 3RE1A 2PGLA 4TKVB 2ODBA 4E51A 3SSAA 5IAJA 4JV1A 3PTAA 3O4IA 1Z4KA 2Y0SD 2FEXA 2W2NA 2RHHA 2HM7A 4IYRA 2GETA 3I04M 3JZFA 2EVZA 4QQ8A 2GQQA 1B3BA 4H7HA 4PCVA 3C6TA 3GPIA 1NTOA 4M5JA 1CJKC 5K0EA 4LC9A 3B70A 4ICIA 2ZOGA 3H2ZA 4Q1DA 1CE8B 1UK7A 3K89A 1MT0A 3HHLB 1XMJA 3WIEA 4Y2HA 2ZTLA 4LE0A 1RWMA 3O3CA 3U44B 1PHPA 5A3JA 2BH2A 1J1IA 4PGFA 2F3QA 5FLXY 3AF3A 1P44A 4BQSA 4C22A 1PE0A 2D7SA 2PWAA 2ZC3A 2B6AB 5A2GA 1PCXA 4UVHA 3NVAA 4KNWA 4LHYA 2R47A 4KDCA 4R7ZA 3N0WA 3K8ZA 4UY8T 3IR6A 5C35A 3W66A 4DBZA 3GN2A 4MAFA 3GLIE 2OK8A 2JIBA 2KRRA 2AOTA 4U2DA 3LP8A 4JWTA 1U2EA 5FD1A 1DT5A 4MQLA 1H0RA 4DV5F 4JS0A 1Z2EA 3EVMA 1KHVA 1OGJA 4EG0A 3CCES 2VBWA 4CM8A 3TPZA 4O4JB 3T1NA 1VCOA 3DJFA 3AHDA 2I4TA 3FNEA 5JE8A 4XLTA 2W8KA 5IU6A 2FCAA 4FOLA 2Q62A 4BQOA 3JZMA 2R7OA 2QRGA 3HBJA 4XO0A 1FVOA 2JASA 4RUCA 2FX5A 1ESDA 2YINC 2IJRA 3ZWPA 3IAS9 1HT1E 2OAUA 2G36A 1U2TA 2DGXA 2QC3A 5ED4A 2YJGA 4H17A 1VBKA 1A5TA 1U8YA 5HJEA 2VG7B 1HNVB 4RXTA 1RABA 2Q3PA 1D1SA 5A7HA 3RYIB 3JYPA 3LL7A 2JRLA 2FQWA 2EZUA 1GVNB 2FW6A 1GTVA 5DBGA 5EWJA 2ALZA 4H3KB 5CM9C 5FI3A 3BB3A 2RK3A 2EXUA 4DXLA 2H3HA 3O75A 4ZEVA 2YKMB 1YJ5A 1QGAA 4Z9AA 3RUCA 4M0KA 2YJ6A 3IPXA 4XTRA 1Z4MA 1YXMA 3K2EA 3MR7A 2B8JA 4HWKA 2OFGX 3ER6A 1ZK1A 1E9RA 3LBYA 2GI4A 3C98A 4WNYA 2NO9A 4RPKA 3L09A 4HGPA 2B9VA 1MN9A 3D5TA 3N5BA 2AQ4A 3KAJA 2PJRA 4DW8A 1REGX 4NEQA 2J5XA 1XK8A 5IAOA 4I8XA 2VNIA 1JBKA 4R5MA 1WW2A 4IRMA 1JDPA 4DG1A 3AQPA 1C1DB 3V8VA 3K0SA 3PNMA 4RGBA 3WQPA 1HE4A 4BQFA 2D2VA 2J0UA 1KVRA 3B7WA 3V55A 1HHQA 2Z6VA 3B89A 2JLWA 3PEEA 4CKCB 1X2EA 1Q53A 3PFCA 3H2IA 3OMXA 2QLLA 1U3CA 3T6BA 4LA4A 1T5DX 2IU0A 5DTIA 1RYEA 3CNOA 4RU1A 3EH2A 1B0ZA 4QYWA 4ZT5A 1S0NA 4M5GA 2CF6A 5FLKA 3WXBA 2BISA 4Z6KA 3C70A 4Z7JA 5H4GA 1J00A 4KVGA 1NLMA 1NJIT 2Y76A 5KC8A 2ZVSA 2O8FB 2OFFA 3BBBA 5ES4B 4NFHA 4B6QA 2YQ5A 2PUHA 1Z73A 2XT0A 1RHRB 1N48A 2HC9A 2H1FA 3ZJ4A 2VQEJ 4B6OA 4Y2CA 3LDHA 2OC4A 1GLVA 1P2UA 2FHJA 2J8ZA 4HPXB 3UWDA 4TKTA 4XR9A 1XRSB 1S7CA 1TA4A 1NBMA 1N88A 4U7PB 4TL7A 4GLOA 1GLNA 2B5VA 3OIWA 2JJ2A 4BEBA 3QVUA 4EH1A 4Y8VA 5TQ0A 3REGA 3W34A 3CNQP 1TL3A 3I2IA 4XWTA 4CLYA 1W87A 2EZ9A 3OZTA 1TUGA 1X9HA 1CQNA 1RPTA 2AZ1A 3V5RA 2AW5A 3A3PA 1HOTA 1NLUA 5KQLA 3H1TA 3PD1A 2MSKA 1CQXA 1T05B 4GGMX 3EZOA 4MGHA 1DTTA 4LJRA 1FKPB 3OBBA 2VQEB 3DOCA 1FRIA 3D8UA 1F4LA 3VBCA 3DHXA 2VDKB 4CLXA 3AETA 2OG2A 3VU3A 4KCGA 4GRAA 3LO3A 2AJ1A 1LTQA 1WC4A 2QG9A 1I2ZA 2QDKA 3HJVA 1HZJA 1HNWB 1XMOB 2O8VA 3NC4A 1M2OB 1JQKA 3IXMA 5HO4A 1MNAA 2CV0A 4DHVA 3KWJA 1KD1T 4XASA 2HDNB 5JSHA 2BFPA 4FNGA 3GEHA 1N8SA 1TD9A 3R0ZA 1KJQA 2Z3VA 1N1GA 2GF9A 2WW8A 2XMMA 4ACBA 3IR7B 1QC5A 5ECWA 2C57A 4DR3B 2MKCA 4RH1A 3KSZO 3GUUA 3UMGA 2VTBA 1T5LA 4M8SA 3NBXX 3F4LA 4YPFA 5AUOB 3EMKA 4X20B 4BUJA 3U62A 5HRCA 1Q44A 3S81A 1HZZC 1GL3A 3LTEA 1H7XA 3GU3A 1RZ3A 4RA6A 2EKBA 3KU1A 1SHUX 3TH5A 3EX7B 1ECCA 2V7PA 2C7GA 2IRYA 3DULA 3TZ6A 2B83A 3AR7A 4GKJF 1JR2A 2C03A 3CW9A 1DOHA 4ZU3A 4B4OA 4O6VA 2ZJZA 3U4HA 1PJLA 5HFNA 3OT4A 2F62A 1R4MB 1LW7A 2DBRA 1BE0A 3GFZA 4A3SA 2B37A 3IA7A 1VLZA 1TCBA 3CE9A 5GM1A 4LX8A 1OLUB 2MZ1A 3GV7B 4LF7B 4Q1EA 3AZOA 2AVNA 4OHVA 2BEFA 1AK2A 1K0FA 4Y2XA 4LTNA 4L85A 4GFDA 2CZ9A 3AWIA 1D7AA 1EFCA 1YT5A 4DSFA 3ZD6A 1ZK3A 3SMZA 3L05A 1LK7A 5DZ6A 5EMLA 3UWPA 4F4IA 2ILTA 5CB8A 1K6XA 2CCKA 3N8HA 3BICA 1X42A 4I55F 4IFTA 2R8JA 1AMUA 3WGTA 1VQ7S 1Q1NA 5B12A 5J5AA 2DULA 2R96A 2W90A 4E2YA 1Y3DE 1Z2PX 4JYBA 4MARA 1N4AA 4QODA 3GJSB 1ZA1B 1RMTA 3KE9A 1H3EA 3EVAA 1SJ1A 2WR8A 5J2QB 2JANA 4TZ6A 1CQMA 2DNNA 3RU7A 3WZMA 1C1XA 4ML3A 2VA3A 2V8BA 2EC2A 5DT2A 4UFNA 2CVIA 2A35A 3VNAA 1CUVA 4DLBA 1XTJA 1A98A 4WY5A 3I34X 4AZWA 2R7VA 3ADPA 4IQXA 3T35A 5HKKD 2WF9A 3C16A 5INTA 5FA6A 1X7HA 5AR1A 2G8NA 3QV2A 3CMMA 3MT0A 3N0VA 2CMFA 4C6SA 2E9SA 3RWOA 1A9RA 2BFMA 5KKAA 3N8DA 3OFVA 4LXHA 1KAGA 1D4ZA 2HCTA 2QMUA 4YUWA 1DO0A 1EQ0A 5DGBA 3D7SA 3PUKA 1BFKA 4LRXA 1KZ4A 1WDWB 2O2YA 1NUAA 3WXMA 4HAIA 3HG7A 4NK4A 2OBYA 3ZLTA 1TQ6A 4AZ3B 5DNYB 1HNXB 4FR2A 2OHIA 3AJ2A 3HD1A 1GD1O 3OQNA 4NL5A 2HFNA 7FDRA 5CNKA 4IIBA 4EAQA 2EBFX 4WZAE 4HNRA 1BMDA 5GONB 4FMCB 2QG9B 5EAIA 2F1RA 2JZNA 1PJ5A 3GJTA 1MW9X 2QLJB 5SICE 2R2AA 3BV8A 4MV3A 4AWAA 1UEVA 3LF2A 3IMGA 4M5HA 4LXYA 1WU7A 4GC5A 3B6KA 3ETOA 3DAGA 1T6ZA 1PYSB 1SXHA 1ZJ5A 4AUEA 3IS3A 4YHBA 5JVDF 4QIWD 2JDJA 5LQRA 1OHHD 5F5NA 1U1IA 3VV3A 4QGBA 1KBQA 2H3EB 4EG3A 4MPPA 3GG2A 4EJ0A 1U9IA 1JKJA 4LHVA 4DR6J 1V1MA 2PC6A 1MO5A 2CA9A 1P5RA 5K0NA 5CD4A 1NMYA 2O1PA 3LO5A 2VV5A 1T05A 1PJAA 4MQ6A 3T0IA 4IHQA 2PSFA 1XI2A 1BWVA 3UVJB 2OUGA 5EHZA 2QLBA 6ABPA 3H8YA 4MT1A 1WXQA 2CFSA 1VHIA 4C3LA 4KKVA 3MDFA 4GX1A 4ZICA 3KDAA 3VXKA 1GMVA 1RHUA 4CCHA 5DM1A 1D3WA 1V3TA 4ZCKA 3AP2A 5EKDA 3X44A 1VJ1A 3HU2A 2LTAA 3MT8A 3QEAZ 4L0DA 2E9ZA 4B08A 3I0NA 2HS3A 3KOMA 3MWEA 4DR6F 1WV0A 4KAIA 3MD3A 1BEZA 1UZUA 4XVUA 3U9SA 4KVZA 5EN1A 3PNKA 3PQ6A 2ZB3A 4DMLA 1FXWF 2ZJ6A 4P2BA 5AJZA 2W7OA 5B4UA 1CZLA 2HJHA 2KXHA 5I7AA 2RH5A 1KI4A 1ZOPA 4RE5A 4JP1A 3R0QA 1E5DA 4CG0A 3Q7TA 2RQMA 2ILZA 3TA1A 3GCDA 1ISSA 1D8TA 3MM5B 1DDIA 1DNPA 1WEYA 1BA2A 4C04A 3N8NA 3TKAA 2NXUA 1A27A 3ZNQA 4IXMA 1E98A 4FB5A 4I5GA 3OZFA 1AROP 2WONA 2ALYB 2GD1O 4DR7F 1C1BB 3DHWC 3MFHA 2W6IA 4TKZA 2E21A 3F6RA 4KLAA 1Y9DA 1I0IA 4DLGA 1FYEA 4I6WA 1YBHA 1GQRA 2K3KA 1WLSA 4LHWA 4KY3A 4MIOA 5B0EA 4R01A 1TU0B 1RYSA 5JRJA 6REQB 4JROA 1X94A 4G25A 1TVCA 4BQIA 4OM8A 3KB1A 1XQ6A 4TVOA 4CW7A 2Y9PB 2DQYA 3NIDB 1G1AA 1IEXA 2UV8A 4ARSA 4DR7J 2BGNA 2EG9A 1EQ2A 1NASA 3I53A 5ALKA 4UE2A 4D6PA 3PQ3A 1EE2A 2IUEA 4QKQA 1TZBA 5JPIA 4F45A 1M9NA 3ZTRA 2XYVA 2BE9B 2QTCA 2G9RA 3P9KA 5K0LA 1VKHA 1KJNA 4AAYA 5DGCA 4RJLA 1NXPA 2AKWB 2YC4C 1U9IC 1TK9A 3MRSA 4IEIA 3KXIA 1LPOA 3PC4A 4YBRA 4XM1A 4X66J 3JQFA 4MQBA 1O96A 4LI0A 2VH2A 2MKYA 3F46A 1JR3E 3KMSA 4CT8A 3RB8A 3RS3A 1R6XA 1AZSA 1XZHA 3RJ5A 4IYQA 1U7LA 1VFPA 1IVYA 4LDNA 1X9WA 4I99A 1CR0A 4I2NA 4WKNA 2MWMA 3ADDA 4C3OB 4QJ3A 3LWDA 1R0LA 4USVA 4JI3B 5EE9A 2NSYA 3SF8A 3RHFA 4RNDB 4MW9A 3WGUA 5HF5A 5KSOA 5B2ZA 2BJVA 2IJFA 5F9MA 2G9QA 2VSQA 3ORSA 2H7CA 1N54B 1LPBB 1V8ZA 2IOFA 3EHDA 4KR7A 2CNWD 2EP5A 4G84A 3FVTA 5FADA 4NLUA 3U7IA 2NZXA 3OSNA 2QG4A 4W92B 2HJ9A 4BHTA 3QSIA 2MZRA 2WT9A 2Q07A 3WICA 1NKCA 3SJ7A 4OZLA 1VBMA 3EWGA 1IR2A 4G4JA 5GV7A 1Z7WA 4BRZA 4DV5J 2AW0A 4JVNA 4HDHA 5EUHA 1X38A 4ODIA 1Q92A 4JQYA 1U5BB 4KXMA 1ZL2A 5EJ7A 4DIMA 5FBWB 2CE7A 2HSJA 3QYJA 4Z9YA 2GZHA 3IWXA 2VA9A 4EMSA 4YAIA 3VR2A 3V2UC 1OFTA 4IYJA 3ROEA 4A23A 1GYQA 4HLUC 2VEDA 4EUHA 4RVUA 5AW3A 4YONB 3O4GA 2DO4A 1YZGA 3T3DA 5B1EA 4NA3A 4GIBA 3GBPA 4AJ1A 3KMQA 1EUDA 4DUYJ 2IITA 1Q3KA 1T8TA 2I2XB 4DLZA 5DQHA 2YNGA 2BRLA 5C2JB 4D8YA 4DR7B 3X1YA 1V2GA 4TRJA 2C5LA 4ZYLA 1E0DA 3N0TA 3QOWA 1P6XA 1IL0A 3PO5A 2JAHA 3CR8A 2WNSA 1J90A 1W34A 1Z2DA 4XQEA 1GSHA 4CO4A 2J9XB 2UXCB 1N5SA 2LVWA 4A1FA 4Z4FA 3BXPA 1W59A 3OFHA 2V8DA 5IT9A 3KZOA 4OI1A 4E1VA 1DXOA 4RZRA 4HUTA 1L5RA 4FEAA 4INZA 4TVAB 3DMNA 4N5DA 1PQYA 2GZRA 3FBGA 5BYKA 4BVFA 3OJ0A 1R8SA 3TUJC 4I8IA 2GTHA 1R1DA 2PH5A 2Q9BA 1Q91A 1UR5A 4KNYA 4G1VA 1P45A 3VPXA 4KKOB 3OA2A 1MWYA 1ENYA 3E2PA 5BQXA 1ZOOA 3ZS8A 4DCPB 4TWIA 4GECA 2IYSA 2PGAA 2ZUTA 4X64B 1PIWA 1OYDA 1VZ2A 2C2YA 1XK6A 4PBRA 3W8PA 4HTAA 2J6TA 3C5VA 5F33A 1LX7A 2BUBA 3IC1A 2WU3A 4DQSA 5ALYA 3F6EX 2NQTA 5H9WA 3OIFA 3BJRA 1K2VN 1FKOA 1QK4A 1D1UA 3FOBA 4MJXA 3T3HA 4ZAZA 2GXQA 2RJNA 4PTLA 3V97A 4CKZA 4IIEA 1U2SA 4EYQA 1K7FB 2KJQA 5FI0B 3EVEA 3GEBA 2ZPUA 4II2A 1M8KA 4ZT3A 3UWSA 1SBTA 4TS9A 3FUWA 3NYIA 5JCOC 4HS4A 1ZU4A 3AI7A 1VYUA 1NR5A 2UYGA 1HWUA 1V4VA 5TC4A 1THMA 3GSIA 5E9JA 2JLVA 4Q19A 2HHJA 3COYA 2CYAA 1F5AA 1OZAA 1IBCA 1EJ2A 2KZMA 3QE2A 2J4FA 4V19X 3VR3D 2ZUAA 4RW6B 4H60A 2WSIA 2D3O1 4LOLA 5ALWA 4DLLA 3MB5A 3K1YA 4UULA 2PGCA 1TZMA 1HSZA 3TLMA 3OIDA 2EDAA 2KLBA 2Y71A 4EJSA 1E1DA 2SKEA 4FC7A 1YZ7A 4P9SA 2H18A 2JFQA 4KO0B 4TY8A 1VSTA 1U8FO 4U39A 2EXXA 5HP1A 3MGGA 5JLJA 3CWZA 3M8RA 4AUMA 4URGA 5I3UB 1IATA 4M63A 4D0GA 3EXG2 3PQDA 5T6BA 1VRWA 3R5DA 4S1OA 1QUFA 1ZCBA 4HDMB 1XJQA 3H2KA 3FVWA 2AU0A 4P3OA 3M70A 3KQNA 4MQEA 4NAVA 2C5HA 3DG9A 3F3KA 2QPTA 5KIAA 2VHJA 1NVEA 3K8VA 1A9NB 2YX7A 4LNUA 1Y5NA 4WHMA 3QELA 3V7FA 1VL6A 2UAGA 3D6MA 1U6ZA 2MKSA 4JAVC 2QTHA 3I9FA 1PILA 2R6R1 1WUHS 4EPYA 3KIPA 4WXMA 4GPIB 1QE1B 3Q8KA 5ADUS 3ZVNA 1VL8A 1EGAA 2VC2B 4X95A 4Q4LA 4PSDA 3QLVA 5KU7A 4XJXA 1OT5A 3KHGA 2LP4A 4QUEA 2C61A 1NK6A 3T1VA 5EXPA 4BO8A 2R9VA 1I3MA 5A04A 4RW8A 5E6RA 1QVGR 4PNHA 4QWWA 2QNIA 4W99A 3JAKB 1G291 2EF0A 2MY8A 3PNPA 4OXQA 2AB0A 5KNDA 3GJRA 3QG1A 5AJTA 1B0AA 1N1MA 5HBGA 2ST1A 1EINA 1WEHA 4MW0A 3HY3A 1MAAA 3MGKA 3U02A 4UTXA 3CUYA 4KK4A 4B84A 1W73A 4I2QB 3G9XA 5EQJB 1L6IA 1S6PA 4D98A 5B7NA 3IG1A 3JCZA 1F8UA 2JWNA 1XDBA 1VLVA 2V4MA 5AI5A 3LPYA 3Q3CA 1FK9A 3MTEA 3IIMA 3SYTA 2HRZA 4JOQA 3MJCA 2IZ5A 1QRRA 4GWGA 4XPCA 3U26A 4J6EA 4NASA 1WL8A 3P2MA 1RQ7A 4Y2GA 3C1OA 4F12A 2F1HA 2WQZA 3RUBL 2GGPA 3PFNA 2AQKA 5A5GA 1PSWA 4V0KA 4YRQA 2DNRA 1JB1A 4JQOA 2PVPA 2EWMA 4XGKA 1K9VF 1TCCA 2Y3YA 4BAUA 5KNBA 3SICE 1FDDA 3H6GA 1LW0B 2ZVJA 1MMNA 2Y1CA 2JFBA 3EBLA 2ONCA 5FBRB 3DDSA 3T3NA 3PHHA 1P2FA 1CS4A 2Y93A 2IDEA 4DV1B 3EZFA 3K20A 2G1PA 4RPIA 5KTYA 3KV3O 4EYSA 1FJGB 4ER0A 4MKXA 1UUFA 4TYMA 5KTMA 3PFOA 3Q7PA 4JBYA 2Q7OE 4PLTA 1PFWA 2C92A 3LFUA 4X3CA 4MYHA 5DIZA 1Z5ZA 3TCXB 3ASYA 2DLNA 3ETLA 4CKYA 3KAQA 4ZARA 2CBGA 4GYKA 4MYSA 3DFZA 3RJZA 1S4FA 1UMKA 4JXZA 2DFTA 4LFAJ 3UK7A 1XMQB 5KFAA 1O4WA 4NEYA 4BU0A 1XTBA 2N1BA 2AD5A 4Z53A 4WZBE 1X3SA 1VYAA 3S7RA 2Q3MA 3A3OB 4MKYA 5KNDD 3GAMA 1YTLA 5C31A 1D6NA 1RAEA 1COWD 3U37A 4WOBA 3KQWA 3PQFA 4DLRA 1I13A 4ANFA 3M8SA 2DGWA 4PLGA 2LKCA 5C9ZA 4PC3A 4QNRA 5FPYA 3CGGA 2ZRPA 1WWHA 5DLQC 5I5EA 4Y98A 3IQGX 4O0NA 4QW8A 1CP2A 4G97A 4CTAB 4HPWA 5ERGB 3HB7A 3UT0A 1R88A 1M2HA 3M5PA 4O2AB 4PX3A 1POXA 2EFCB 2BMEA 3BX1A 1E2HA 2DNYA 4KQ9A 5LMNF 3JR7A 4L5IA 5F4ZA 2F63A 1ZH8A 4EYIB 5I3CA 1L1RA 1FBNA 1ZZGA 4I5DA 2ASDA 1X7YA 3GUVA 3H97A 3HL0A 5C81A 5JH7F 5DLDA 4QCLA 4K46A 5DNWA 5DHPA 2ZH9A 1T9BA 2PV0A 2UYCA 1P1IA 3SIPB 1C9KA 4R1QA 3WI7A 1NM5C 1N9GB 4QTXA 3CXRA 5AI8A 3NMRA 1IQ0A 4LXXA 4HWSA 3EMVA 4YLYA 4ND5A 2WILA 3C7KA 2R44A 4G1UC 1GY8A 2O0LA 2FMTA 4Z0NA 1TVKB 1GGVA 2VG6A 3MGCA 2QSJA 4QLOA 3IRWP 4WK1A 2AHOB 2IY9A 3OC0A 2GNKA 4X65J 1Q0PA 1E99A 5AKKA 5CLLA 1R6AA 1EHYA 4DREA 5JHGB 1XQXA 1HRKA 1TTQB 4RSHA 3ILJA 1LBIA 3MMJA 2VP6A 2LU2A 3D6AA 1WJGA 1Z5GA 1OREA 1ZMTA 1SBZA 3EZ7A 4EYEA 2CW5A 1TM1E 3UD5A 3PYDA 1IHXA 3FWKA 2CMHA 5D3MA 1YI0A 1O9BA 1UAAA 3HKWA 4I50A 4EA6A 3UDLA 5CCXA 1RYMA 4P2SA 4AJJA 1V26A 2DR7A 4X0EA 2GXAA 5L9NA 3TRKA 2MTLA 2Q27A 3EGXA 3GUZA 2VZ0A 4F6RB 4TMFA 1Z0FA 1JWLA 5BPHA 2D74A 1DY3A 1JVNA 2Q3HA 4RY0A 2IYPA 5BOSA 2V3VA 4WGGA 3TZEA 1HWJA 2CFTA 1SC1A 4PZEA 4HAYA 5ALJA 3LP6A 5JNSA 1J5EJ 4GPZA 3TK1A 3A2MA 5H9FJ 1MKYA 4H4OA 2QZ9A 5DI3B 1YJNS 3BFJA 3A9WA 4LIPD 1ARZA 3RFTA 3PGA1 1SUSA 3A2NA 3L1HA 1EARA 4QD3A 5M2UA 1UFLA 4QG7A 2CJYB 1UKVY 1ZBQA 5GONA 4Q39A 3OT5A 3S1AB 2QN3A 3FFBA 2HMUA 4PE5B 4LZLA 2HA0A 4I46A 4LJAA 1P1FA 4QGFA 4KQ2A 4FUTA 5CXQA 2QS9A 1F12A 2ZYHA 5J2NB 1RYNA 2DR0A 4YQEA 1ZNYA 2P4QA 5AVWA 3L0CA 4ZDNA 1J2UA 1PNRA 1OF1A 1KLMA 2LU1A 3I37X 1K98A 4FZ3A 4V0ME 2E4YA 3R7NA 3LX4A 1E7RA 4HQLA 3RYLA 2YOGA 4TWBA 2FJDB 3IBSA 4ED7A 1U2RA 1CUHA 3EDYA 1JBEA 1JFSA 4L0CA 4O4GA 5D6OA 4JWKA 5HVGA 3RKSA 3IDZA 2CMGA 4RFLA 3SIWA 1Q20A 5HQJA 1M2VA 3T61A 1DBVO 3CWQA 3R8YA 4BLOA 3VVCA 5HCNA 3KK1A 1C0IA 2NUPA 2AJCA 3DV2A 4KRXA 3CVUA 3R74A 1PR4A 2WK4A 4IOCQ 5HRUA 3AM5A 1VPLA 2JGRA 1QUPA 2Z8XA 1D9XA 4A0HA 1EP2B 2J3DA 5CCEA 4RPFA 4U9HS 5CPBA 3IQHX 5MFZA 1UM9A 1QHGA 3RO7A 4KE8A 2H8KA 1F9HA 1W25A 3HDTA 3GGPA 2G1JA 3D43A 5G40A 1ZOTA 4PYMA 3HFKA 1EGQA 2NO5A 4QU9A 5BSVA 3IOMA 2XBPA 2K7JA 4NYIR 1TKCA 4PLPA 5KFIA 3GLIB 4EUEA 4BNGA 1XMPA 5EQFA 4LF9B 3F56A 3ACDA 4FYKA 3F9RA 3GJ4A 3L9WA 4HNGA 2AOUB 2BTEA 4C0HA 4YJDA 4ZGBA 4O3SA 1VE5A 1MAWA 1TM3E 4L4SA 4FF3A 1DO8A 3A6ZA 2HIHA 3QSYA 4X66B 3RDPA 4MHTA 4QO7A 1HNWJ 3M6FA 2YQ0A 3VAJA 3P2OA 5EJIA 2UDPA 3PEYA 1MORA 2HGMA 3TB6A 2DT9A 4LVNA 1UDBA 2WG0A 3IIEA 4NG5A 3OECA 1D1TA 2AFIA 1XRRA 4ACAA 2XQIA 1MIHA 1FS5A 5DG7A 2E7WA 4DSZA 1S12A 5E6SA 2PU5A 1XDDA 1QY7A 2GGPB 1JTFA 1UJ4A 1JVSA 3GN1A 2MCFA 3THTA 1KEUA 5CTAA 3AOCA 3UQZA 4DR3F 1TJ5A 1CJTB 4C7OB 2CUYA 3ZLVA 2VYND 4B46A 4FX5A 3RHZA 2HIYA 2UUWA 5JFGA 4KC0A 5AT1A 3B4MA 2FLNA 4G0VA 4N5HX 3DR3A 1GPKA 3JQGB 3ROKA 1X4GA 1H2RS 1U2PA 4OZ1A 2YX1A 4GQBA 1FUUA 2V7QD 3E23A 4LMPA 3B3QA 4MP8A 4BQNA 3FWNA 4PR0A 1BMFA 2RKIB 1FWPA 4E2XA 4B3RJ 2HQDA 4C6HA 3H5IA 1TO2E 5DLFA 2JLUA 5CVDA 4IKEA 1B1CA 4F1WA 5BN3A 4P0PB 4M3NA 1GNPA 4F1KA 2JFVA 4P5PA 4PFSA 5B5SA 4TNOA 1JMKC 1VHTA 5DGDA 1XRQA 1GYPA 2DNHA 1EH5A 4A47A 4NU8X 3FPSA 4KIFA 4YDHB 3P9RA 3EISA 2HMIB 2I7DA 1NB2A 2PYIA 1KOFA 3VWSA 1HT2E 2QM8A 2GYVA 1I2BA 4KUEA 3W6ZA 1R3UA 2C54A 3MEGB 2H4ZA 2GOYA 2B5WA 2YWJA 2GUGA 5BUSA 5JH7B 4IFYB 1BWRA 2HHHF 2V98A 1H2AS 1ZD2P 1Y8RA 1KDTA 3UJCA 4Q3KA 5EP2A 4A8SA 3K7EA 2DERA 3ICEA 4C2AA 1TJYA 4H3SA 5EPEA 2WT4A 2X7XA 4JOUA 2CD7A 2HJVA 2EJCA 5J2QA 3D7RA 2AZDA 2J3JA 2BKEA 4J91A 3RS8A 5FEMA 1MV8A 3GRKA 3CCVS 5H81A 3BSYA 4FIDA 1M2VB 1Z16A 1FRHA 2XTZA 4PHTA 5A4DA 2R6GA 1KDRA 1L9KA 1FZQA 3K9QO 1RPAA 3DRPA 4XX1A 3M6IA 5TSDA 4B79A 2IDLA 2H9AA 1URRA 4USTA 1F5CA 1CVLA 2ENWA 2XOXA 2LCFA 1FP6A 2NPIA 1NE2A 2WFLB 2P7HA 2AH5A 2MR6A 1MO6A 3H05A 1TL1A 5DULA 5DRKA 4G1BA 4J7AA 3PCXA 2WJYA 4LHZA 2IXTA 3Q8SB 4G1CA 3J81A 5C8DA 3DOEA 2ZSIA 3TLZA 1R0YA 1MO2A 1ZN2A 3EPJA 1WDLA 5H83A 4Q7AA 3LP5A 2AHRA 3UT5A 5JQWA 3FYCA 1T9UA 3DEJA 1U25A 2R7SA 1HNZB 3F98A 1N33F 4QGGA 3KZ1E 1F0XA 1ZCJA 3N58A 4IUBS 1I3KA 5DGXA 4UM7A 4URWR 4K3UA 5LU9A 1RI2A 2IDMA 4HX9A 4DMUB 3S28A 3HJBA 1B7FA 2PIIA 1EBBA 3CCRS 1CR2A 2FZVA 2OD4A 2H1IA 3WAKA 1KKUA 3C5HA 3LLUA 3KDOA 5B0GA 4XX0B 1KKLA 2XI4A 3DFMA 4W98A 3OOJA 2HNYB 4UAJA 2ZRIA 1XPOA 4DL2A 2HMAA 3JSMA 5H59A 2RC5A 3Q41A 1NVVR 2Y0PA 2BJDA 3UQSA 4FZJA 3VTFA 4FSXA 3ROMA 2KVQE 2YUIA 2Q1WA 4KKOA 2E1RA 1QKKA 1L3CA 1GAXA 4MNTA 1FC0A 3IO1A 5G0RA 1N36J 4D8TA 2QYSA 5HX7A 4IWXA 4CM4A 1QE1A 3T41A 2V68A 1DWPA 4YJHA 4HRXA 2UUCF 2QT9A 1E1KA 3RNLA 2O3QA 2ZYGA 1C80A 4KFCA 5AVRA 2C2HA 3PXUA 4P08A 4LTDA 1RHQA 1G2PA 4BHQA 3WWZA 2GZMA 1A88A 4ZAFA 4Z0PA 2MR5A 1KZGB 1J5EF 2GCIA 3KKZA 4JFAA 3CJ8A 1OQAA 2H4YB 2OZLA 2XZDA 4GPAA 2ZTVA 3QAEA 2Q6KA 5TS3A 1KBZA 3HN2A 4LZWA 2L08A 3DFUA 4MB0A 1ZMBA 4Z2YA 5AHKA 3SC2B 2ZATA 3OE7A 1SIWA 3EDRA 3ESZA 5J9FA 4V1CB 3N07A 3G85A 1DU4A 2AA3A 1Y34E 2MQOA 3UT5B 2R2SA 4KYIB 2RBEA 1NSPA 1AA9A 4N9QA 1K2WA 2X8BA 2OI2A 1RWPA 1O0SA 1CUUA 4YQWA 2DBBA 5IC6A 4S24A 4I4TB 4LSWA 5IJ9B 4IFYA 1T1GA 5DRTA 1SBYA 2N82B 1SQSA 1TL4A 4P38A 5E41A 4WTOB 2X2PA 2EG1A 2XRMA 2FEWB 4PHFA 5GAGI 1RVDA 3BM5A 3T0FA 4CXMA 3MAQA 2QB5A 3VAGA 3K9NA 4ECVA 1S77D 1XEWX 3COPA 3GNQA 5ALSA 1GSOA 3WL8A 4BVHA 3URKA 2JKVA 3Q8PB 1AXQA 4OEHA 3UUWA 2PMKA 3DVSX 1L7VC 1JGTA 4LYYA 3AEUA 4GXTA 2PH7A 1I5OA 2D9PA 2ZJAA 1EP3B 2R4FA 4RXMA 5BMVF 1GT8A 2GWHA 4OM7A 3MAJA 2KXNB 2CJBA 2E5HA 2WTNA 2F3JA 1NW4A 2XQGA 3QQ5A 5C7OO 2Z1NA 3GJ5A 1T3OA 2CL6X 3M2RA 4UW9A 1NMQA 5BYRA 5HMMA 1B70B 2PD3A 2FMHA 3OWXA 1QVVA 3JTOA 2ERRA 1JQ3A 4P0QB 4MKBA 2ZBEA 2RKBA 3ZK9A 3QRRA 3JPWA 1CPZA 2I0FA 1CJTA 4WKOA 2GJ8A 2W4IA 4WBNB 2J3MA 1JWBB 4BGUA 2RGEA 3EWAA 5H3LA 2GK7A 4P82A 2HRRA 2Z5FA 1N33B 1YKWA 3GE9A 3U7JA 4XTCS 3W8EA 1JQDA 5CRIA 5IDQA 3VZIA 3LUCA 2LQJA 1KK2A 4EW6A 2WUFA 3ITDA 3V81A 1HORA 2YHIB 2XMAA 3D6HB 1PTJC 5DWDA 2PDAA 4ZK2A 2H07A 5C2CA 2QZZA 3VPAA 3I05A 4B82A 3GDFA 3NMAA 4WV3A 2FSPA 1UK8A 3RW9A 1LQTA 4C88A 3QVVA 3LBNA 1C1CA 2CE2X 4XUCA 1WKVA 4GI1A 2ZDPA 1NATA 4LR9A 6NULA 4YCDA 3H5XA 1KOHA 3FDSA 3THOA 3GA7A 3UH0A 5LQKA 2A5GA 4C0JA 2V58A 3D4BA 1DP4A 2EF1A 4OZ3A 1MHPA 2Z4TA 2QRRA 1T8PA 2AC4A 5CX4A 5AXBA 4M89A 3F3MA 5K0ZA 2OO5C 1KO7A 1AQLA 4A8JB 1XSEA 4P0TA 3V4PB 5JARA 1EZZB 4HYEA 1B73A 4F56A 3RTCA 2H8GA 1C1YA 4D41A 1NVVQ 1G8YA 1SJRA 1S1WA 3TE7A 3MMCA 4DKJA 2P9TA 4OU5A 3RS7A 3IUMA 3GH1A 3FCYA 2XMBA 3AVQA 2VOEA 5HKAA 4UZBA 1Q0QA 1AS0A 1HD0A 3TR0A 4NCIA 1CQPA 1F38A 3ITKA 2FPUA 4EZ6A 3RB3A 3KK1B 4M5IA 5FDFA 1OJ7A 3WJAA 4J5OA 2HWHA 1TAUA 1V25A 3NEAA 3OO1A 4GH5A 4DTCA 1UJ2A 3HHLD 5LXTF 4X4RA 2PT7A 3LTNC 3HVRA 3UJHA 3A1YG 1SM4A 3EXYA 3BDAA 3KLOA 4DLUA 4N5LA 2VHWA 1S7HA 1YGYA 3D6UA 2VLIA 3TUIC 2HKIA 3VTKA 2WU1A 1W5AA 2VJCA 1H8ED 3FUVA 3BF4A 1CUJA 2W4QA 3TZQA 1RBYA 2JLFA 1PAUB 3EFBA 3TG2A 4ZKAA 4Q8EA 3L82B 4UUPA 3BFPA 3NQ41 1URNA 3WL7A 3BJMA 3C6KA 1F3VA 1Q0TA 3GD7A 1JFRA 1C30B 4TWRA 4MVCA 2HDHA 3L7PA 3FCAA 4DHEA 1HLFA 4WY8A 1EXWA 1FFBA 2PUAA 2AI3A 4BFUA 4ETXA 1N8NA 1TTHA 2HFKA 1IWBB 4ZYYA 2BBTA 4L72A 1R0AB 4XM2A 2A5LA 1R0BG 3W64A 2NVBA 1VI7A 3IP0A 3LKZA 4MVJA 1VQPS 4GZ3A 3YASA 2V7XA 4E7PA 3OJLA 1NAHA 4I08A 4IG0B 1JILA 2X8JB 5FORA 4IO1A 2QTNA 3D7KA 1M5TA 4LQ3A 3AVWA 1TZ0A 2AEFA 4PRLA 4EFDA 1TKTA 1YBFA 1E3TA 5E4JA 4D0LB 2ZYWX 4RO0A 4OMUA 4JI7B 5I7UA 1FXDA 4MAKA 3HY4A 1K6MA 4MO2A 3QZ8A 1KAHA 3QUSA 1MROA 3U27A 1ZZNA 3LGXA 4V0OA 4D82A 5EYPB 3GP5A 2HMIA 2XECA 4QREA 2EATA 5DDQC 1I24A 2N3LA 3BG5A 3AVYA 1XK7A 5GADl 1QG2A 3I1IA 4LJLA 5DG9A 1JXLA 2MJLA 1HSOA 1T8EA 5CIWA 4AFNA 2V7EA 2G0TA 1OBHA 4LVOA 1GFSA 3WSTA 3VQTA 3Q5DA 4QJVA 3A1NA 2XS7A 3UEOA 1L6RA 3DAOA 3ZWAA 1WW8A 3WFJA 3SEQA 3N79A 2Y68A 4QU0A 4IR7A 5L8VA 4JBLA 1YAJA 4PPFA 3PHGA 4RGYA 3T5KA 1JHYA 3GG0A 3EPPA 4NBWA 1D8ZA 2XZTB 1X13A 3WIOA 3N9UC 4DR3J 2XMWA 2KT3A 4BC0A 1GNKA 1BXGA 3SPXA 1GGFA 4US1R 4RIGA 1T5TA 1JWAB 3ZQ6A 4RWZA 4YRSA 4FHZA 4MQUA 4KO4S 4BECA 1YU6A 3ABZA 1W8DA 1E6VB 4FQ5A 3ON5A 4CT0A 1UXOA 2WTBA 3OBIA 1GPDG 4HGOA 3V48A 3GHYA