1LKIA

The crystal structure and biological function of leukemia inhibitory factor: implications for receptor binding
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
172
structure length
172
Chain Sequence
b'NATCAIRHPCHGNLMNQIKNQLAQLNGSANALFISYYTAQGEPFPNNVEKLCAPNMTDFPSFHGNGTEKTKLVELYRMVAYLSASLTNITRDQKVLNPTAVSLQVKLNATIDVMRGLLSNVLCRLCNKYRVGHVDVPPVPDHSDKEAFQRKKLGCQLLGTYKQVISVVVQAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEUKEMIA INHIBITORY FACTOR
publication title The crystal structure and biological function of leukemia inhibitory factor: implications for receptor binding.
pubmed doi rcsb
source organism Mus musculus
molecule tags Cytokine
total genus 59
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 1994-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01291 LIF_OSM LIF / OSM family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 1lkiA00
4O9HA 1M49A 3D85C 1BP3A 1ALUA 2CYKA 1NBPA 4NEMA 2B5IA 5KNHI 1BGDA 3DLQI 2B8ZA 1LQSL 1SCFA 1F6FA 1V7MV 4FA8E 1M48A 1PY2A 2KZ1A 3BESL 2B8XA 5D70A 2LAGA 1JLIA 3EW3A 1INRA 3D87A 1VLKA 4NKQC 4GRWA 5C7XA 1ITMA 4NI9A 1Y6KL 5D28B 4PS4A 4YUEC 3NPZA 1BGEA 1M4BA 1HWHA 1BGCA 1EMRA 1FYHA 3S9DA 1HIKA 1RHGA 1CD9A 3SE3B 1B5LA 1RFBA 3Q1SI 3G6DA 1CN4C 4NEJA 1EXZA 3INKC 1D9CA 1EKUA 1M4AA 2B90A 4DOHA 3PIWA 3N0PA 3NCCA 5D72A 4I77Z 3OQ3A 4ZF7A 1HWGA 3QWRB 1Y6ML 3HMXB 3LB6A 4J4LC 3BPLA 5LQBA 1QVNA 1HZIA 1RCBA 3G9VB 1PW6A 1BBNA 1BCNA 1IJZA 2O26A 3NCFA 5FUCA 1AU1A 3D48P 3UF5A 3UX9A 3VA2A 1YKBA 2B91A 1GNCA 1Z92A 3QT2C 1V7NV 1HULA 1FG9A 2O27A 3MZGA 1AXIA 1ETEA 4CNIC 3L5XA 3NCBA 2B8UA 1HIJA 3UEZE 1GA3A 3DGCL 1BUYA 4Z5RD 1CYLA 1J7VL 1F45B 4MHLA 3HHRA 3LB6B 4WRLB 2ERJD 2Q7NB 2E9WC 1M4CA 4ZS7A 3WCYI 1PGRA 2IL6A 1IRLA 4YPGC 1ITLA 1I1RB 2D9QA 4NI7A 2GMFA 1ITFA 2LMSA 1HGUA 2L3OA 4RS1A 1LK3A 1N1FA 4YQXA 1D9GA 1A7MA 5E4EA 1CSGA 2L3YA 2Q98A 3BPOA 1IK0A 1EVSA 3N06A 2D48A 3QAZA 1WU3I 1ITIA 1RW5A 1M47A 1M4RA 5L6YC 1EERA 3NCEA 1IL6A 1P9MB 5FHXA 5D71A 3SE4B 3DUHC 1A22A 2H24A 1ILKA 3L5WI 1KF9A 4O6KA 5D22A 1AX8A 1HUWA 2INTA 1LKIA 2HYMB 4YDYI 1IARA 3QB7A 1Y6NL 1CNT1 3UF2A 2B8YA 3BPNA 3QB1A 3B5KA 4X51A 3PIVA 2ILKA 1Z7CA 1PVHB 3EJJA
chains in the Genus database with same CATH superfamily
1Y1WD 1M49A 4A3KD 2B8ZA 1LQSL 1F6FA 2KZ1A 4A3MD 3O7PA 5IYBD 3OG4A 4A3GD 2JA7D 4NKQC 5FLMD 4BBSD 5EQHA 4Q65A 3I4ND 4PS4A 1HWHA 2JA5D 1HIKA 1RHGA 1B5LA 3Q1SI 2PSMA 4EXPA 1EKUA 2B90A 4QIQA 3DI3A 1HWGA 3HOZD 3HMXB 3LB6A 5LQBA 1QVNA 4A93D 1HZIA 4YBQA 1BBNA 4ZYRA 1BCNA 1IJZA 4IU9A 3NCFA 5FUCA 3VA2A 1GNCA 3QT2C 1Y1VD 3NCBA 2B8UA 1HIJA 1GA3A 4IKWA 1BUYA 2R93D 4DKEA 2Q7NB 4ZWBA 3WCYI 1PGRA 2IL6A 3HOXD 4NI7A 3H3VE 4RS1A 1D9GA 5E4EA 5IP7D 2Q98A 4A3BD 4UVMA 3DI2A 2D48A 4DKDA 1ITIA 2OQPA 1M4RA 4JA3A 1EERA 3NCEA 4D2BA 4ZW9A 2H24A 1IARA 3QB7A 3FKID 4DKFA 2ILKA 4A3FD 1ALUA 2CYKA 3H0GD 4D2DA 3HOWD 1V7MV 4FA8E 1M48A 1PY2A 3BESL 4IKZA 1INRA 2R92D 1Y6KL 3NPZA 1M4BA 4PYPA 1EMRA 2B63D 4XNIA 1CN4C 1EXZA 4A3ED 5D59A 1D9CA 4DOHA 4APSA 1WCMD 2XQBA 3OQ3A 4A3DD 4J4LC 3G9VB 2V8NA 3AYHA 3D48P 3UX9A 3I4MD 1V7NV 2O27A 4BY7D 1ETEA 4A3ID 4LRLA 1PV7A 4D2CA 3HHRA 3LB6B 4WRLB 5EQIA 2E9WC 4ZS7A 5C4XD 4GC0A 1I1RB 2D9QA 5TS9A 2LMSA 1N1FA 1A7MA 4NN7A 5EQGA 1EVSA 1M47A 5L6YC 5D71A 1ILKA 3L5WI 1KF9A 5D6KA 2VUMD 1HUWA 2INTA 2Q14A 4A3JD 4YDYI 4BXXD 1CNT1 3UF2A 2B8YA 3B5KA 4BY1D 4OAAA 4TPHA 3EJJA 4O9HA 3PO3D 5IYCD 3D85C 1NBPA 4DKCA 4NEMA 2B5IA 1PV6A 5KNHI 1SCFA 2Z3QA 2B8XA 2JA8D 2LAGA 1JLIA 1VLKA 5IP9D 4GRWA 4EXNA 4J05A 1ITMA 5D28B 2C35A 1BGEA 4BBRD 1BGCA 1FYHA 3S9DA 4JR9A 1RFBA 3G6DA 4NEJA 4NN5A 3INKC 5IYDD 4TPGA 3PIWA 3NCCA 3QWRB 3OG6A 1RCBA 1PW6A 3HOUD 1AU1A 3UF5A 1YKBA 2B91A 1Z92A 2R7ZD 4W6VA 1AXIA 3L5XA 4LEPA 1Y14A 3DGCL 4ZWCA 4IU8A 1J7VL 4MHLA 2ERJD 4IKYA 4YPGC 1ITLA 3PO2D 4GBYA 2GMFA 1ITFA 1HGUA 2L3OA 4YB9D 4YQXA 5D58A 1CSGA 3BPOA 1IK0A 4JREA 3N06A 4U4WA 3QAZA 5A2NA 4LDSA 4OH3A 3SE4B 5GXBA 3DUHC 1A22A 4U4VA 1AX8A 2HYMB 1Y6NL 3BPNA 4X51A 1Z7CA 1BP3A 1PW4A 1BGDA 3HHCA 3DLQI 3TGXB 2XUTA 4IKXA 5D70A 3EW3A 4XNJA 3D87A 5C7XA 4NI9A 4YUEC 2JA6D 3SE3B 1CD9A 3WDOA 1M4AA 3O7QA 4GBZA 2Y5YA 3N0PA 5D72A 4I77Z 4ZF7A 1Y6ML 2CFQA 5A2OA 3BPLA 4A3LD 5C3ED 4TPJA 2O26A 5C65A 1HULA 1FG9A 3MZGA 4NN6A 4U4TA 4CNIC 2Z3RA 3UEZE 3HOYD 3HOVD 4Z5RD 1CYLA 1F45B 4A3CD 1M4CA 4GS7A 1IRLA 5C44D 1LK3A 2CFPA 2O6IA 2L3YA 1WU3I 1RW5A 3IRHA 1IL6A 1P9MB 5FHXA 4O6KA 5D22A 1LKIA 4IKVA 3QB1A 3PIVA 1PVHB
chains in the Genus database with same CATH topology
4O9HA 3PO3D 5IYCD 1Y1WD 4A3FD 1M49A 3D85C 1BP3A 1ALUA 2CYKA 1NBPA 3H0GD 4DKCA 4NEMA 2B5IA 5KNHI 4A3KD 1BGDA 3HHCA 3DLQI 2B8ZA 1LQSL 1SCFA 3TGXB 1F6FA 3HOWD 2Z3QA 1V7MV 4FA8E 1M48A 1PY2A 2KZ1A 3BESL 2B8XA 5D70A 4A3MD 2JA8D 5IYBD 2LAGA 1JLIA 3EW3A 1INRA 3OG4A 2R92D 4A3GD 2JA7D 3D87A 1VLKA 4NKQC 5IP9D 5FLMD 4GRWA 4BBSD 4EXNA 5C7XA 1ITMA 4NI9A 1Y6KL 5D28B 2C35A 4PS4A 3I4ND 4YUEC 2JA6D 3NPZA 1BGEA 4BBRD 1M4BA 1HWHA 1BGCA 1EMRA 2JA5D 1FYHA 3S9DA 1HIKA 1RHGA 1CD9A 3SE3B 1B5LA 2B63D 1RFBA 3Q1SI 3G6DA 1CN4C 4NEJA 1EXZA 4NN5A 4A3ED 3INKC 1D9CA 5IYDD 2PSMA 4EXPA 1EKUA 1M4AA 2B90A 4DOHA 3PIWA 3N0PA 3DI3A 1WCMD 3NCCA 5D72A 4I77Z 2XQBA 3OQ3A 4ZF7A 1HWGA 3QWRB 1Y6ML 3HOZD 3HMXB 3LB6A 4J4LC 4A3DD 3BPLA 5LQBA 3OG6A 1QVNA 4A93D 1HZIA 1RCBA 3G9VB 4A3LD 1PW6A 5C3ED 1BBNA 1BCNA 1IJZA 2O26A 3NCFA 5FUCA 3HOUD 1AU1A 3D48P 3AYHA 3UF5A 3UX9A 3VA2A 3I4MD 1YKBA 2B91A 1GNCA 1Z92A 3QT2C 1V7NV 2R7ZD 1HULA 1FG9A 2O27A 3MZGA 1Y1VD 4NN6A 4BY7D 1AXIA 1ETEA 4CNIC 4A3ID 4LRLA 3L5XA 3NCBA 2B8UA 2Z3RA 1Y14A 1HIJA 3UEZE 1GA3A 3HOYD 3DGCL 3HOVD 1BUYA 4Z5RD 2R93D 1CYLA 1J7VL 1F45B 4DKEA 4A3CD 4MHLA 3HHRA 3LB6B 4WRLB 2ERJD 2Q7NB 2E9WC 1M4CA 4ZS7A 3WCYI 4GS7A 1PGRA 2IL6A 1IRLA 4YPGC 5C4XD 1ITLA 1I1RB 2D9QA 4NI7A 5TS9A 2GMFA 5C44D 3HOXD 3PO2D 1ITFA 3H3VE 2LMSA 1HGUA 2L3OA 4RS1A 1LK3A 1N1FA 4YQXA 1D9GA 1A7MA 5E4EA 4NN7A 5IP7D 2O6IA 1CSGA 2L3YA 2Q98A 3BPOA 1IK0A 4A3BD 1EVSA 3N06A 3DI2A 2D48A 3QAZA 4DKDA 1WU3I 1ITIA 1RW5A 2OQPA 1M47A 3IRHA 1M4RA 5L6YC 1EERA 3NCEA 1IL6A 1P9MB 5FHXA 5D71A 3SE4B 3DUHC 1A22A 2H24A 1ILKA 3L5WI 1KF9A 4O6KA 5D22A 2VUMD 1AX8A 1HUWA 2INTA 2Q14A 1LKIA 4A3JD 2HYMB 4YDYI 1IARA 3QB7A 4BXXD 1Y6NL 1CNT1 3FKID 4DKFA 3UF2A 2B8YA 3BPNA 3QB1A 3B5KA 4BY1D 4X51A 3PIVA 2ILKA 1Z7CA 1PVHB 3EJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O9H A;  1M49 A;  3D85 C;  1BP3 A;  1ALU A;  2CYK A;  1NBP A;  4NEM A;  2B5I A;  5KNH I;  1BGD A;  3DLQ I;  2B8Z A;  1LQS L;  1SCF A;  1F6F A;  1V7M V;  4FA8 E;  1M48 A;  1PY2 A;  2KZ1 A;  3BES L;  2B8X A;  5D70 A;  2LAG A;  1JLI A;  3EW3 A;  1INR A;  3D87 A;  1VLK A;  4NKQ C;  4GRW A;  5C7X A;  1ITM A;  4NI9 A;  1Y6K L;  5D28 B;  4PS4 A;  4YUE C;  3NPZ A;  1BGE A;  1M4B A;  1HWH A;  1BGC A;  1EMR A;  1FYH A;  3S9D A;  1HIK A;  1RHG A;  1CD9 A;  3SE3 B;  1B5L A;  1RFB A;  3Q1S I;  3G6D A;  1CN4 C;  4NEJ A;  1EXZ A;  3INK C;  1D9C A;  1EKU A;  1M4A A;  2B90 A;  4DOH A;  3PIW A;  3N0P A;  3NCC A;  5D72 A;  4I77 Z;  3OQ3 A;  4ZF7 A;  1HWG A;  3QWR B;  1Y6M L;  3HMX B;  3LB6 A;  4J4L C;  3BPL A;  5LQB A;  1QVN A;  1HZI A;  1RCB A;  3G9V B;  1PW6 A;  1BBN A;  1BCN A;  1IJZ A;  2O26 A;  3NCF A;  5FUC A;  1AU1 A;  3D48 P;  3UF5 A;  3UX9 A;  3VA2 A;  1YKB A;  2B91 A;  1GNC A;  1Z92 A;  3QT2 C;  1V7N V;  1HUL A;  1FG9 A;  2O27 A;  3MZG A;  1AXI A;  1ETE A;  4CNI C;  3L5X A;  3NCB A;  2B8U A;  1HIJ A;  3UEZ E;  1GA3 A;  3DGC L;  1BUY A;  4Z5R D;  1CYL A;  1J7V L;  1F45 B;  4MHL A;  3HHR A;  3LB6 B;  4WRL B;  2ERJ D;  2Q7N B;  2E9W C;  1M4C A;  4ZS7 A;  3WCY I;  1PGR A;  2IL6 A;  1IRL A;  4YPG C;  1ITL A;  1I1R B;  2D9Q A;  4NI7 A;  2GMF A;  1ITF A;  2LMS A;  1HGU A;  2L3O A;  4RS1 A;  1LK3 A;  1N1F A;  4YQX A;  1D9G A;  1A7M A;  5E4E A;  1CSG A;  2L3Y A;  2Q98 A;  3BPO A;  1IK0 A;  1EVS A;  3N06 A;  2D48 A;  3QAZ A;  1WU3 I;  1ITI A;  1RW5 A;  1M47 A;  1M4R A;  5L6Y C;  1EER A;  3NCE A;  1IL6 A;  1P9M B;  5FHX A;  5D71 A;  3SE4 B;  3DUH C;  1A22 A;  2H24 A;  1ILK A;  3L5W I;  1KF9 A;  4O6K A;  5D22 A;  1AX8 A;  1HUW A;  2INT A;  1LKI A;  2HYM B;  4YDY I;  1IAR A;  3QB7 A;  1Y6N L;  1CNT 1;  3UF2 A;  2B8Y A;  3BPN A;  3QB1 A;  3B5K A;  4X51 A;  3PIV A;  2ILK A;  1Z7C A;  1PVH B;  3EJJ A; 
#chains in the Genus database with same CATH topology
 1Y1W D;  1M49 A;  4A3K D;  2B8Z A;  1LQS L;  1F6F A;  2KZ1 A;  4A3M D;  3O7P A;  5IYB D;  3OG4 A;  4A3G D;  2JA7 D;  4NKQ C;  5FLM D;  4BBS D;  5EQH A;  4Q65 A;  3I4N D;  4PS4 A;  1HWH A;  2JA5 D;  1HIK A;  1RHG A;  1B5L A;  3Q1S I;  2PSM A;  4EXP A;  1EKU A;  2B90 A;  4QIQ A;  3DI3 A;  1HWG A;  3HOZ D;  3HMX B;  3LB6 A;  5LQB A;  1QVN A;  4A93 D;  1HZI A;  4YBQ A;  1BBN A;  4ZYR A;  1BCN A;  1IJZ A;  4IU9 A;  3NCF A;  5FUC A;  3VA2 A;  1GNC A;  3QT2 C;  1Y1V D;  3NCB A;  2B8U A;  1HIJ A;  1GA3 A;  4IKW A;  1BUY A;  2R93 D;  4DKE A;  2Q7N B;  4ZWB A;  3WCY I;  1PGR A;  2IL6 A;  3HOX D;  4NI7 A;  3H3V E;  4RS1 A;  1D9G A;  5E4E A;  5IP7 D;  2Q98 A;  4A3B D;  4UVM A;  3DI2 A;  2D48 A;  4DKD A;  1ITI A;  2OQP A;  1M4R A;  4JA3 A;  1EER A;  3NCE A;  4D2B A;  4ZW9 A;  2H24 A;  1IAR A;  3QB7 A;  3FKI D;  4DKF A;  2ILK A;  4A3F D;  1ALU A;  2CYK A;  3H0G D;  4D2D A;  3HOW D;  1V7M V;  4FA8 E;  1M48 A;  1PY2 A;  3BES L;  4IKZ A;  1INR A;  2R92 D;  1Y6K L;  3NPZ A;  1M4B A;  4PYP A;  1EMR A;  2B63 D;  4XNI A;  1CN4 C;  1EXZ A;  4A3E D;  5D59 A;  1D9C A;  4DOH A;  4APS A;  1WCM D;  2XQB A;  3OQ3 A;  4A3D D;  4J4L C;  3G9V B;  2V8N A;  3AYH A;  3D48 P;  3UX9 A;  3I4M D;  1V7N V;  2O27 A;  4BY7 D;  1ETE A;  4A3I D;  4LRL A;  1PV7 A;  4D2C A;  3HHR A;  3LB6 B;  4WRL B;  5EQI A;  2E9W C;  4ZS7 A;  5C4X D;  4GC0 A;  1I1R B;  2D9Q A;  5TS9 A;  2LMS A;  1N1F A;  1A7M A;  4NN7 A;  5EQG A;  1EVS A;  1M47 A;  5L6Y C;  5D71 A;  1ILK A;  3L5W I;  1KF9 A;  5D6K A;  2VUM D;  1HUW A;  2INT A;  2Q14 A;  4A3J D;  4YDY I;  4BXX D;  1CNT 1;  3UF2 A;  2B8Y A;  3B5K A;  4BY1 D;  4OAA A;  4TPH A;  3EJJ A;  4O9H A;  3PO3 D;  5IYC D;  3D85 C;  1NBP A;  4DKC A;  4NEM A;  2B5I A;  1PV6 A;  5KNH I;  1SCF A;  2Z3Q A;  2B8X A;  2JA8 D;  2LAG A;  1JLI A;  1VLK A;  5IP9 D;  4GRW A;  4EXN A;  4J05 A;  1ITM A;  5D28 B;  2C35 A;  1BGE A;  4BBR D;  1BGC A;  1FYH A;  3S9D A;  4JR9 A;  1RFB A;  3G6D A;  4NEJ A;  4NN5 A;  3INK C;  5IYD D;  4TPG A;  3PIW A;  3NCC A;  3QWR B;  3OG6 A;  1RCB A;  1PW6 A;  3HOU D;  1AU1 A;  3UF5 A;  1YKB A;  2B91 A;  1Z92 A;  2R7Z D;  4W6V A;  1AXI A;  3L5X A;  4LEP A;  1Y14 A;  3DGC L;  4ZWC A;  4IU8 A;  1J7V L;  4MHL A;  2ERJ D;  4IKY A;  4YPG C;  1ITL A;  3PO2 D;  4GBY A;  2GMF A;  1ITF A;  1HGU A;  2L3O A;  4YB9 D;  4YQX A;  5D58 A;  1CSG A;  3BPO A;  1IK0 A;  4JRE A;  3N06 A;  4U4W A;  3QAZ A;  5A2N A;  4LDS A;  4OH3 A;  3SE4 B;  5GXB A;  3DUH C;  1A22 A;  4U4V A;  1AX8 A;  2HYM B;  1Y6N L;  3BPN A;  4X51 A;  1Z7C A;  1BP3 A;  1PW4 A;  1BGD A;  3HHC A;  3DLQ I;  3TGX B;  2XUT A;  4IKX A;  5D70 A;  3EW3 A;  4XNJ A;  3D87 A;  5C7X A;  4NI9 A;  4YUE C;  2JA6 D;  3SE3 B;  1CD9 A;  3WDO A;  1M4A A;  3O7Q A;  4GBZ A;  2Y5Y A;  3N0P A;  5D72 A;  4I77 Z;  4ZF7 A;  1Y6M L;  2CFQ A;  5A2O A;  3BPL A;  4A3L D;  5C3E D;  4TPJ A;  2O26 A;  5C65 A;  1HUL A;  1FG9 A;  3MZG A;  4NN6 A;  4U4T A;  4CNI C;  2Z3R A;  3UEZ E;  3HOY D;  3HOV D;  4Z5R D;  1CYL A;  1F45 B;  4A3C D;  1M4C A;  4GS7 A;  1IRL A;  5C44 D;  1LK3 A;  2CFP A;  2O6I A;  2L3Y A;  1WU3 I;  1RW5 A;  3IRH A;  1IL6 A;  1P9M B;  5FHX A;  4O6K A;  5D22 A;  1LKI A;  4IKV A;  3QB1 A;  3PIV A;  1PVH B; 
#chains in the Genus database with same CATH homology
 4O9H A;  3PO3 D;  5IYC D;  1Y1W D;  4A3F D;  1M49 A;  3D85 C;  1BP3 A;  1ALU A;  2CYK A;  1NBP A;  3H0G D;  4DKC A;  4NEM A;  2B5I A;  5KNH I;  4A3K D;  1BGD A;  3HHC A;  3DLQ I;  2B8Z A;  1LQS L;  1SCF A;  3TGX B;  1F6F A;  3HOW D;  2Z3Q A;  1V7M V;  4FA8 E;  1M48 A;  1PY2 A;  2KZ1 A;  3BES L;  2B8X A;  5D70 A;  4A3M D;  2JA8 D;  5IYB D;  2LAG A;  1JLI A;  3EW3 A;  1INR A;  3OG4 A;  2R92 D;  4A3G D;  2JA7 D;  3D87 A;  1VLK A;  4NKQ C;  5IP9 D;  5FLM D;  4GRW A;  4BBS D;  4EXN A;  5C7X A;  1ITM A;  4NI9 A;  1Y6K L;  5D28 B;  2C35 A;  4PS4 A;  3I4N D;  4YUE C;  2JA6 D;  3NPZ A;  1BGE A;  4BBR D;  1M4B A;  1HWH A;  1BGC A;  1EMR A;  2JA5 D;  1FYH A;  3S9D A;  1HIK A;  1RHG A;  1CD9 A;  3SE3 B;  1B5L A;  2B63 D;  1RFB A;  3Q1S I;  3G6D A;  1CN4 C;  4NEJ A;  1EXZ A;  4NN5 A;  4A3E D;  3INK C;  1D9C A;  5IYD D;  2PSM A;  4EXP A;  1EKU A;  1M4A A;  2B90 A;  4DOH A;  3PIW A;  3N0P A;  3DI3 A;  1WCM D;  3NCC A;  5D72 A;  4I77 Z;  2XQB A;  3OQ3 A;  4ZF7 A;  1HWG A;  3QWR B;  1Y6M L;  3HOZ D;  3HMX B;  3LB6 A;  4J4L C;  4A3D D;  3BPL A;  5LQB A;  3OG6 A;  1QVN A;  4A93 D;  1HZI A;  1RCB A;  3G9V B;  4A3L D;  1PW6 A;  5C3E D;  1BBN A;  1BCN A;  1IJZ A;  2O26 A;  3NCF A;  5FUC A;  3HOU D;  1AU1 A;  3D48 P;  3AYH A;  3UF5 A;  3UX9 A;  3VA2 A;  3I4M D;  1YKB A;  2B91 A;  1GNC A;  1Z92 A;  3QT2 C;  1V7N V;  2R7Z D;  1HUL A;  1FG9 A;  2O27 A;  3MZG A;  1Y1V D;  4NN6 A;  4BY7 D;  1AXI A;  1ETE A;  4CNI C;  4A3I D;  4LRL A;  3L5X A;  3NCB A;  2B8U A;  2Z3R A;  1Y14 A;  1HIJ A;  3UEZ E;  1GA3 A;  3HOY D;  3DGC L;  3HOV D;  1BUY A;  4Z5R D;  2R93 D;  1CYL A;  1J7V L;  1F45 B;  4DKE A;  4A3C D;  4MHL A;  3HHR A;  3LB6 B;  4WRL B;  2ERJ D;  2Q7N B;  2E9W C;  1M4C A;  4ZS7 A;  3WCY I;  4GS7 A;  1PGR A;  2IL6 A;  1IRL A;  4YPG C;  5C4X D;  1ITL A;  1I1R B;  2D9Q A;  4NI7 A;  5TS9 A;  2GMF A;  5C44 D;  3HOX D;  3PO2 D;  1ITF A;  3H3V E;  2LMS A;  1HGU A;  2L3O A;  4RS1 A;  1LK3 A;  1N1F A;  4YQX A;  1D9G A;  1A7M A;  5E4E A;  4NN7 A;  5IP7 D;  2O6I A;  1CSG A;  2L3Y A;  2Q98 A;  3BPO A;  1IK0 A;  4A3B D;  1EVS A;  3N06 A;  3DI2 A;  2D48 A;  3QAZ A;  4DKD A;  1WU3 I;  1ITI A;  1RW5 A;  2OQP A;  1M47 A;  3IRH A;  1M4R A;  5L6Y C;  1EER A;  3NCE A;  1IL6 A;  1P9M B;  5FHX A;  5D71 A;  3SE4 B;  3DUH C;  1A22 A;  2H24 A;  1ILK A;  3L5W I;  1KF9 A;  4O6K A;  5D22 A;  2VUM D;  1AX8 A;  1HUW A;  2INT A;  2Q14 A;  1LKI A;  4A3J D;  2HYM B;  4YDY I;  1IAR A;  3QB7 A;  4BXX D;  1Y6N L;  1CNT 1;  3FKI D;  4DKF A;  3UF2 A;  2B8Y A;  3BPN A;  3QB1 A;  3B5K A;  4BY1 D;  4X51 A;  3PIV A;  2ILK A;  1Z7C A;  1PVH B;  3EJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...