1LKYB

Structure of the wild-type tel-sam polymer
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
SIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKDLLLLTKEDFRYRSPHSGDVLYELLQHILKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Native interface of the SAM domain polymer of TEL.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords TRANSCRIPTION FACTOR ETV6
total genus 24
structure length 77
sequence length 77
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2002-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1lkyB00
4NL9C 2E8MA 1COKA 1LKYA 2F3NA 1SV4A 1SV0A 2QARA 2Y9TA 2YTUA 3TADA 1UQVA 5KNIA 1WWVA 2E8NA 1PK1B 2QB0A 3BS5A 2E8PA 3BS5B 2DKZA 2DKXA 2L5YA 1PK1A 1WWUA 1PK3A 5JRTA 1X66A 3HILA 2KG5A 3SEIA 3K1RB 4MHVA 2F44A 1V85A 4RQMA 1B4FA 1SV0C 2Y9UA 1Z1VA 3IDWA 2D8CA 2EAPA 2F8KA 5J8YC 2EAMA 1X40A 1JI7A 5F3XB 1DXSA 4PZOA 4PZNA 1OW5A 3BQ7A 3TACB 2FE9A 2ESEA 2LMRA 2JV3A 1B0XA 2B6GA 2KSOB 3SENA 1F0MA 1SXDA 2K60A 3BS7A 2KE7A 2DL0A 5J8YA 2EANA 3KKAA 2D3DA 1UCVA 2QB1A 1V38A 1SGGA 2GLEA 2EAOA 4NJ8A 3KKAC 3H8MA 2KMDA 3TADC 5JU5A 2K4PA 2QB0B 4RQNA 2LPEA 2KIVA 2KSOA 1KW4A 1X9XA 2QARB 1RG6A 5JTIA 5L1MA 2ES6A 1LKYB 4NL9A 1SXEA 2E8OA 1OXJA 2QKQA 4IS7A
chains in the Genus database with same CATH superfamily
2YX8A 4P4MA 2HOQA 1XC9A 3IG5A 3J81j 1XNSA 1IM4A 3PX4A 4K4HA 2XO7A 2BPFA 2Y9TA 3MC1A 1YZ6A 4DOBA 4M6WB 1BPDA 5J0WA 2OYYA 4P0PB 4R8UA 2BKEA 4QW8A 2L5YA 3VCBA 1PK3A 3L4PA 2V4RA 3FAHA 8ICAA 4DQIA 2ISOA 1BPXA 1NKEA 3PW7A 4DL4A 3GV8B 7ICPA 2WF8A 3QEBZ 2DWQA 4DSKA 5EWEA 3NVYA 2W7PA 3RJHA 1N62A 9ICVA 4CF3A 5ALPA 1BPYA 2DF4B 9ICNA 7ICHA 2YMLA 4UBBA 5J2IA 4IQVA 5IILA 3MBYA 1KEJA 3JPQA 3GV5B 2EANA 3V72A 1PVQA 4ECVA 4CDGA 5A0LA 5ALEA 1IV8A 1UCVA 1X6JA 1J2MA 3QUCA 5C0YA 2GLEA 1L3TA 1VJ5A 2G08A 1RXVA 5DQHA 4EEKA 4B9NA 1V97A 3HRDD 3SQIA 7ICSA 3CRXA 2EDUA 2ES6A 3QYPA 1CRXA 5J2HA 3KZIU 3EUB2 2C22A 4UBCA 2JEFA 9ICGA 8ICOA 4J9QA 2KOBA 3RJIA 2KICA 3SZ2A 1T3QA 8ICQA 1U45A 2HOIA 2HVIA 4MFCA 4PHPA 1SV4A 3NRZA 5KTQA 4QZGA 4J9KA 4DFMA 2O6KA 4UB3A 4Q45A 4P0PA 5KFTA 4OCZA 3AU6A 3WK4A 2ZIUA 1L3UA 1D8YA 3AN1A 2H3ZA 4Q44A 1B4FA 3KHRA 3ONNA 4UAWA 3C2KA 2EAPA 3A0BU 5J8YC 3NGDA 1B22A 2ZUCA 2WB1C 2KHQA 5L1IA 4M9JA 1T8EA 5KFOA 3M9NB 5B66U 2KJ9A 2J6TA 3U26A 1SXDA 4F3OA 1KLNA 5CWRA 3BS7A 3S6JA 4DS5A 2DL0A 2RLTA 2OEHA 1UPHA 3AEVA 1ZQBA 4I2DA 4FE3A 1WCLA 3N7PD 2M0NA 3RJFA 4YR2A 4O3PA 5AKYA 1JIHA 1N5WA 1AQ6A 1CUKA 4QZBA 4PJ0U 3RF9A 4BDPA 4RQ6A 4GXJA 3E2EA 1JALA 4UB4A 1L7PA 2IA6A 3OJSA 5KFIA 2ZG6A 3MDAA 4O3NA 3LWMA 4EX7A 3WK7A 3H8SA 3SD7A 1BVSA 4YMMA 2QKQA 1RXWA 5KFXA 1ZQPA 7ICIA 2FLPA 2Q4TA 1NOMA 5CA7A 1SL1A 1NK7A 5J0YA 2IHNA 3QEAZ 1RYUA 2W11A 2F3NA 2YTUA 3TADA 3JPPA 2BGWA 3THVA 3LVWA 3B0XA 8ICZA 4F5QA 4ZH4A 2GH1A 1QSSA 1P7DA 1MN8A 2A3VA 3MDCA 1YT3A 3CYMA 1X66A 4HAIA 5J2KA 3WK5A 1GO3F 4TQRA 3RH5A 4CNQA 5L1KA 1MSWD 1TAMA 5ALWA 9ICPA 3OPXA 1BPBA 3D2NA 2EAMA 1DGJA 4M9GA 2PMZF 4F5PA 5AIAA 4DSLA 5CP2A 4YR0A 2P66A 5HP4A 4O5CA 2OCEA 2FPMA 4GIBA 1WYGA 1Z3EB 2PXIA 3HKZF 2W55A 1L8LA 7ICGA 1HUOA 3H8JA 1CI4A 7ICRA 5HHHA 1L3VA 4XUSA 1PVPA 3WK6A 4MEXA 2N1RA 4BWMA 3N4MB 5D4BA 1S0VA 4YMOA 2R8HA 4DOAA 4B9LA 4JMUA 5L1JA 2H3VA 2FMPA 5J0SA 2C2RA 5IIJA 4EZ6A 4NLZA 2UVRA 1TAUA 5KG2A 7ICEA 3GILA 4NM2A 4ED1A 3KFUF 5JTIA 3SYZA 3PZPA 3OGUA 2B21A 5BOMA 4U6PA 2HMXA 4I28A 4C8LA 4NL9C 3DEEA 4FS1A 9ICRA 2Z7JA 1SL2A 4RQ8A 2CN1A 5DG9A 5J0OA 1BNPA 3QU9A 5DGAA 1XSNA 2KFZA 2QARA 2YMMA 1NZBA 2HHTA 5CEHA 4CRXA 5KNIA 8ICJA 2CRXA 1SIJA 1OUQA 3VC8A 9ICBA 1L8OA 1MQ3A 2XVTA 3M7DA 2BPCA 1KDHA 4KN7A 9ICKA 5KFWA 9ICQA 4UB6U 1S77D 2WF9A 2JH7A 3OSNA 2F8KA 2E1EA 2IMWP 5AK6A 3SAHA 2MA1A 1QTMA 4QNLA 2LMRA 9ICUA 5B5EU 2KIWA 4ED6A 2PKEA 3ISCA 3UQ0A 2DQNB 2NRXA 2JEGA 4Y2UA 4J9OA 3V6KA 5AM0A 4J9PA 8ICEA 3GIJA 4DSJA 3IM1A 8ICFA 3OHBA 5J0UA 4ELUA 5J2GA 1ZQSA 1JX4A 4PGXA 1S76D 3NVVA 1VLBA 3UXPA 5ALIA 4UB8U 3AUOA 3SR6A 3NTUA 4C7ZA 3WKEA 3WKDA 2ZUDA 4KMUA 2W7OA 1RPLA 2K4EA 2HHXA 2MRLA 3FDSA 1U47A 4MF2A 4M9LA 3GV7B 3K4GA 4QZDA 7ICLA 4DLEA 4I2AA 5D46A 2QARB 1X9MA 9ICWA 5KG3A 5HR7A 2D6FC 5L1LA 4QWDA 4BJQA 4TUPA 3Q8QB 2BCQA 1KSPA 1S5LU 2C2EA 5ALYA 4B9TA 4LJXA 3QE9Y 5KFDA 5DKWA 1ZD2P 2PFQA 5DQIA 4RQ3A 3SAFA 3RAQA 3QZ7A 2WF5A 4ZOHC 1K5OA 5ALSA 5GTHU 4HYKA 2FPLA 2J6SA 3LDAA 7ICMA 5JUMA 5T14A 1WWUA 4UB5A 2CXYA 4M9NA 5EE1A 2KG5A 1A77A 1NKBA 4CCHA 4C80A 1SV0C 2NRVA 1SKRA 5ALNA 5ALVA 3KHLA 7ICTA 4CE6A 3C1YA 4C4RA 3C23A 3T5JA 4UQGA 5KFSA 2XI9A 7ICUA 2YQEA 4GXIA 1LB2B 2G09A 4AYBF 5ALGA 4RT3A 4TQSA 1HIWA 3KD3A 2F1IA 2KSOB 4DFPA 3NASA 4KLQA 4JWMA 3PX6A 3CNHA 9ICIA 3Q8KA 2WAQC 3M8SA 1S97A 1ZQOA 4O9MA 2WHEA 2FI1A 5BPCA 1LVHA 5DLGA 2HI0A 3PW5A 3PR4A 1ZQFA 3BQ2A 2MU2A 2HDOA 4I2IA 1Z00B 4OO1J 5BOLA 1D9DA 4B9SA 1LV5A 4YR3A 2HBKA 2EAOA 3T5HA 4OJOA 2KMDA 1YZ7A 2BCSA 1Y88A 1SWVA 4M6WA 4IR9A 3RJEA 4AP9A 1ZRNA 2KSOA 1X9XA 5DQGA 2IBKA 1NJXA 4NLNA 2RHFA 4NL9A 4IR1A 4NLGA 4DL6A 2GOLA 1SB3C 3B9JA 4DSIA 1ZQGA 7ICNA 3BQ1A 9ICEA 3WKBA 5EWGA 1KRPA 3KHHA 2KP7A 4Y2VA 2EZYA 1ZD4A 2E8NA 3UXOA 3ZD9A 2KK0A 3BS5B 2DKZA 1ZQKA 2W9CA 3OSPA 1Q3VA 4KX5A 4DL3A 2HBLA 2XGPA 3EPGA 5H2FU 4F5NA 3PSTA 4RQ7A 1X40A 1S8OA 1L7OA 3PO5A 3HWTA 3HKZC 1OW5A 1JXLA 5KFMA 2LM1A 3HP6A 1CEZA 4Y2YA 2YB1A 3NRWA 2BDUA 1F0MA 8ICCA 5KFNA 4RUCA 1NK4A 2UVWA 4OJ5A 3B0YA 5AM5A 2LYHA 3H4BA 2MAXA 3O0FA 3KKAA 1TKDA 1ZD5A 2JHDA 3E0FA 4DQSA 1SZHA 4EELA 1ZQEA 7ICQA 1SGGA 3UQ2A 1U49A 1NJWA 3HT3A 3KKAC 3M1YA 1WG8A 8ICMA 1A6SA 2KTQA 1N61A 3ZDBA 5KG6A 2W9BB 4R63A 4Y2PA 4Q8FA 1IIPA 1LKYB 5HMLA 2P6RA 3Q8MA 4BXOA 1OXJA 1O08A 4YMNA 4RT2A 4I2EA 1X6IA 2R8IA 5AKIA 4O3RA 1COKA 1QQ6A 9ICJA 3RAXA 1N56A 4FBTA 3OJUA 5KFUA 2I6XA 2E3TA 5KFFA 2HHWA 2W54A 4US8A 2W8KA 4ELVA 3QUQA 2HHUA 2G0AA 2OXOA 4KLEA 5G5HA 2P35A 3ISDA 8ICTA 4KLDA 3RJGA 1S0OA 4B6JA 4I2BA 3K75D 1SWWA 4RQMA 5AM3A 4OJPA 5EE3A 3EPIA 3UPQA 1ZQDA 3WKCA 2LBOA 4Y2RA 4KX3A 4KLOA 1S10A 4Z6EA 1X9SA 1JROA 4RQ5A 4QZ8A 4PZOA 3QNMA 4PZNA 3V7LA 2KNJA 5KT7A 3GIIA 4OD0A 2WAQF 5GTIU 1ZRMA 4QZCA 3MR5A 1RZTA 1QQ5A 2RDIA 3GZFA 3D2QA 2K60A 5KT3A 2FPKA 4RUAA 1N60A 5J0TA 1WUDA 2F8LA 1UA0A 2G06A 4EBDA 2JH1A 2HBMA 3RB3A 3RRGA 2D3DA 4F5RA 4RPYA 2G07A 2E1FA 2OWOA 3RR8A 3UXNA 5J0PA 4KLGA 2OM6A 1DOQA 4XRHA 2QB0B 4Z6CA 2ZIXA 1KW4A 4YXJA 3F53A 1BNOA 1RG6A 3WK9A 5KFPA 2JZBA 4QWCA 4C8NA 2MSNA 3RBDA 2FMSA 4FBUA 2BCUA 4DL7A 4UAYA 4IS7A 2KKPA 2KV2A 2A1JB 3UMBA 4F71A 3Q8PB 2F2AB 1C7YA 4MFFA 3C21A 1LKYA 3D2SA 2KJ8A 4DFDA 4JV0A 4C4TA 3WKAA 1ZETA 2OH2A 3F5AA 5AM4A 3PV8A 3IP4B 4RPXA 4EBEA 5KFCA 4PHDA 3I1YA 5FP0A 2K8BB 2F1JA 3FC4A 4PL2A 2EQYA 2ZJ5A 2JR5A 2F44A 1C20A 4R65A 5ALHA 9ICAA 1T94A 9ICLA 5DBBA 1ZQNA 4QWBA 2BHNA 2R18A 4FFDA 4YFKA 3TACB 2J6UA 2FE9A 2WF6A 4PHAA 2Y1JA 3M8RA 4F2RA 4XA5A 4PGYA 4DQRA 4M04A 3RB6A 4ECTA 3TAQA 1PZNA 5ALOA 5ALTA 1ZQHA 5AI4A 4NM1A 3CW2C 4DLGA 2W04A 5J8YA 5KT2A 1KBUA 3MR2A 5KG7A 5CR0A 3TKAA 2VA8A 5AI0A 3C2MA 8ICRA 4C4SA 3IHQB 4IQTA 2NRTA 4LVSA 1B43A 1IG6A 4GLXA 1N63A 4C0ZA 5J0RA 3TADC 2IHMA 4U7CA 2A1AA 2KIVA 1MC8A 4ICAA 4UW9A 5J2DA 1X9WA 1ZXIA 3M6KA 2FJ6A 2K4IA 3I28A 4RNNA 4ECRA 1ZQTA 2R8GA 4IRCA 2HW3A 1TV9A 1UT8A 1F44A 2KZZA 5AKKA 5DLFA 3H0MB 3OTQA 2C2DA 2KN7A 2IOFA 2G5IB 4JV1A 2H3IA 2LI6A 7ICJA 3MR3A 4UAUA 4ECZA 3V7KA 1SZPA 2AGOA 3TQ1A 2I9GA 3M9MB 4DQPA 2I1QA 1UHUA 4F4KA 2HOFA 2F77X 2C28A 2XY7A 1D9FA 4I2JA 4B9UA 3UM9A 4O5EA 2DUYA 5EE0A 5AK3A 7ICVA 2H5XA 1RM6C 4QZ9A 2Y0SF 5KG4A 4TURA 1A76A 1UT5A 4IRDA 4UAVA 1NKCA 5E79U 2K4HA 3L5KA 1ZQYA 5ALDA 4UASA 5J2EA 2HSZA 2QLTA 4RZRA 3GDXA 3M9OB 3PX0A 5HNKA 3RRHA 3LVVA 3BZKA 4F4WA 1Z4OA 8ICIA 5IIOA 4JB3A 2UVUA 4JUZA 3Q8SB 3BQ0A 4KLIA 4X5VA 4P4PA 5HMMA 2ZIUB 4RNMA 3LWLA 3LYSA 5C5JA 3ED5A 4P0QA 4F92B 3PMLA 1AROP 4UATA 2BCVA 4TUSA 2KHVA 2NO4A 5KT5A 4KLUA 2YN4A 1DK3A 2BQ3A 5IIMA 9ICOA 4Z6FA 3PVXA 1ZQQA 1KTQA 3C2LA 3JPRA 5KFBA 5KFAA 2NO5A 5DB9A 2ASJA 1RQLA 3RB4A 5K4LA 8ICLA 4R64A 4P2HA 4O3OA 3EYZA 4RNOA 4ED2A 1JMSA 2VJ5A 3ISBA 5AKZA 4O3QA 4KLLA 3MGVA 3QU7A 1D8LA 3IN5A 5KG1A 2AGQA 1EXNA 5ALFA 1URJA 4EX6A 2ATLA 4KTQA 2ALZA 3A0HU 4P4OA 2P6UA 2KZ3A 8ICBA 3QU5A 8ICVA 4JV2A 3ZDEA 1BPZA 3F2CA 5G5GA 3IRUA 4YN4A 2DGZA 4PPXA 1JI7A 1HJPA 2AXTU 5F3XB 1KFTA 1DXSA 4CF4A 4MFAA 3BJYA 3BQ7A 3F2BA 3H8WA 4F8RA 3C5GA 2ESEA 1U4BA 4J9LA 1PVRA 1UA1A 1MQ2A 2JEIA 1QCKA 3IV6A 3EZ5A 4J9RA 4OJLA 8ICGA 2KKVA 1X2IA 3ICXA 1A0PA 4G3IA 4DF4A 1N5XA 1NK8A 5AK4A 3EW9A 3PW0A 3QUTA 1KFDA 5KL8B 4UAZA 3G6YA 1KQQA 4M9HA 2NV3A 4J03A 4KLJA 1NZPA 4F4ZA 2JEJA 5DG8A 5J29A 2K4PA 7ICOA 4RQNA 1K1QA 1TAQA 3OHAA 3RJJA 2AQ0A 4NLBA 4KMOB 4ELTA 2M9NA 1ZYQA 1TK8A 2LHTA 2ZIVB 5CRXA 4JK1A 5AI8A 3SV4A 4DSFA 2MUTA 4Q43A 2AHOB 1XO1A 5DBCA 4FS2A 1L7MA 5KFHA 3HPOA 3SV3A 2XCPA 4A8EA 4KLTA 2IOFK 3AQEA 2IOHA 2ZIWA 8ICHA 4RQ1A 4I2HA 3ZDDA 5KFGA 2FDRA 2KFNA 4EENA 4QZFA 1KFSA 2VA3A 4YD2A 1FFUA 3LK9A 1D8BA 1Z00A 1ZQIA 3QX7A 4I29A 1NK9A 4F5OA 3ZD8A 1QSLA 3JPNA 2W9AA 4XQ8A 4I2FA 1TVAA 1ZQVA 2ISPA 2JV3A 2ASLA 3ORYA 3C5FA 4YVZA 5F9NA 4ECYA 5AHXA 2AQ4A 4ACOA 2KVCA 3K1ZA 4Y2SA 3TARA 3TI0A 1XS9D 3GFKB 3C28A 5KFJA 5CJ7A 4C8KA 5D49A 2XIDA 3AMZA 3G6VA 7ICKA 1QSYA 4QZHA 4EEYA 4M0AA 3PNCA 2WFAA 2LYAA 4C8OA 4JWNA 5KG5A 4I2GA 2BCRA 3UMCA 5ALZA 4F72A 2LPEA 3JPOA 1T4GA 3PY8A 8ICSA 4C7YA 2YMQA 5L9XA 5AKJA 3QU4A 4E0DA 4UARA 3H0LB 2V9WA 5L1MA 2BZFA 4O3SA 3Q8RB 1RYSA 3BDPA 1JXEA 4GC7A 1KKXA 5KFZA 3V6HA 1FEZA 5ALJA 3SI8A 5AKLA 9ICSA 3AU2A 2PMZC 2ZTEA 3C29A 2AGPA 2KZMA 3L3FX 3H40A 5KFRA 1XO0A 4GXKA 2W3RA 2F76X 4R8UB 1NI3A 2Y0SC 4KN4A 4ECXA 3HILA 4WJ3B 3SEIA 2NRWA 3GQCA 4RPZA 3ETRA 4DOCA 4IL6U 5DB8A 2HHQA 2HHVA 2JMGA 9ICTA 2JGAA 4F4YA 1KN5A 4Q8EA 3PW4A 1NK6A 3QU2A 5AKHA 4QZIA 4NY8A 4PGQA 1BPEA 2GWSA 8ICKA 4UB1A 2PFNA 3SENA 2GO7A 2UVVA 5AICA 4G9BA 4QJFB 4DEZA 2PFPA 3MFIA 5KFVA 4DSEA 3TFRA 4RQ2A 2ZUBA 2QB1A 5IIKA 4RQ4A 3BQTA 1S0MA 4NJ8A 3JPTA 1ZQ1C 1ZQMA 1WCNA 1TK5A 2RP5A 1SKWA 4O5KA 5DB6A 3PR5B 5KG0A 1QH9A 5AIBA 4GFJA 1PUZA 4US9A 1U48A 2KEYA 4KITB 4DCCA 1NK0A 2JXJA 5DB7A 4Y2XA 2BR0A 2DBYA 2RDJA 2BDPA 1N2XA 1FIQA 5KFLA 3KZXA 3MABA 1MA7A 4CF5A 4KLMA 3RB0A 4J9MA 4EYHB 5AI6A 5J2FA 1N48A 4R66A 2W9BA 4LZGA 4YG2A 3ETLA 2R8KA 1DGSA 1PK1B 2FLNA 5J0XA 5CB1A 2ZJ8A 3BS5A 1XSLA 4F4XA 4I2CA 5ALRA 4F2SA 5TISU 2R8JA 1VDVA 4ED0A 2W8LA 2YB4A 1L7NA 1TE2A 2Y9UA 4QWEA 3ZDAA 3KBBA 7ICFA 3QZ8A 5KT4A 5J2CA 4IQWA 2A1JA 3Q8LA 8ICYA 4GC6A 3V6JA 1ZQXA 2AU0A 3GIKA 1B0XA 1Q8KA 4DL5A 3GU3A 5DGBA 2Q0ZX 1NK5A 3AM9A 9ICHA 2KD1A 4QW9A 1S9FA 4IC9A 5ALUA 2K89A 3GIMA 1SKSA 9ICCA 4QIWC 5CHGA 2LYBA 5IINA 3MR6A 4O0IA 1S0NA 4FZMA 2DFLA 5DDYA 4PHEA 3PW2A 1Z4NA 3SMVA 4NLKA 2EZXA 3H8MA 2YMPA 1FO4A 1X42A 4YQWA 2B0CA 5JU5A 3DDHA 5F9LA 3KHGA 4NWIA 3AQFA 4K4GA 4QZAA 2XGQA 4UB2A 4YCXA 2OHFA 2E8OA 3WK8A 2MUTB 3BZCA 2ZIVA 1V9PA 1ZOLA 2W9MA 5KT6A 3PSFA 3TFSA 1J97A 5HR6A 4YXMA 4Z6DA 5J0QA 1ZQJA 2NYVA 1T3NA 1UQVA 4FO6A 2W3SA 1WWVA 2VANA 4Y2JA 5KL1B 4OJ6A 3KOOA 5AK5A 3RH6A 1PK1A 1QQ7A 3RBEA 3K1RB 4QZEA 4AYBC 1Z1VA 3IDWA 3MFHA 3KTQA 1Q3UA 2RRDA 1TK0A 3R9KA 4YD1A 4K4IA 2BQRA 2ZTCA 5ALXA 5J2AA 4BWJA 4TUQA 2WTFA 4BXOB 1ZQCA 5AKGA 1ZQLA 2G5HB 3N7RC 2EZZA 4Y2QA 2PI5A 1FFVA 2H3QA 2WF7A 4DQQA 1M6YA 3V7JA 2Y1IA 4NXZA 4DL2A 4EZ9A 4ED8A 3PSPA 1COOA 1RDFA 5AM1A 1ZQZA 4ED3A 2XC9A 1TFRA 2F1HA 3QXGA 4MEYA 3UMGA 3WU2U 3MGHA 3I76A 4PL1A 2FLLA 1Z1BA 5KAIU 2VJ4A 1ZQAA 5AM2A 4M2YA 2HBJA 3FM9A 1DRGA 4KLFA 3NS1A 2NRZA 1QLNA 2LM4A 2KJ5A 1F5SA 1J2NA 2FMQA 2HHSA 2ZJAA 4DWIA 2ZXIA 4I27A 2E8MA 3NVWA 3RFAA 4F93B 2V4QA 2PFOA 2CPRA 1SV0A 1BGXT 1XU4A 3T5LA 3NVZA 4QWAA 4USAA 3QUBA 3ZDCA 1ECWA 2QB0A 4O3MA 4P0QB 3HX0A 5J2BA 4F50A 4MF8A 1JUDA 2YY6A 8ICXA 4CGZA 2PI4A 8ICPA 3RR7A 1ZQUA 4NLCA 4NV0A 1ZJMA 9ICMA 3PO4A 4QIWF 2HCFA 5HHIA 5AKXA 3TAPA 1SL0A 4KLSA 4YP3A 1ZD3A 1NJYA 4DF8A 3RJKA 8ICWA 2XCAA 5KAFU 4FZNA 4ED7A 3N97B 3DV9A 2ZTDA 1IXRA 3SAGA 4B9MA 2EH9A 2I5HA 3AL0B 1NJZA 5DDMA 2HVHA 5AKEA 3PMNA 8ICUA 3TANA 4IRKA 9ICFA 2RQ5A 3H7IA 5DBAA 4J9NA 3ZI4A 5ALMA 2DPJA 4IQUA 3T3FA 2XICA 3E58A 3N7SC 4KLHA 3HJEA 2E5SA 3IG8A 4ECWA 5AI9A 4C8MA 1H38A 4EBCA 3RH4A 4M47A 5EE9A 1K1SA 4DS4A 2VKQA 3H0RB 3N28A 2VA2A 2XY5A 2ODGA 5J2JA 4LZDA 2A19A 4DFJA 1T7PA 4ECQA 2E8PA 2H3FA 2DKXA 4BUGA 5JRTA 1L6NA 5ALLA 3D6JA 1Z19A 4Y2TA 4MHVA 5KFQA 3HW8A 1DK2A 4RQ0A 2VIXA 3F2DA 1XSPA 1XWLA 1V85A 1L5UA 3RTVA 1ZJNA 2D8CA 1RQNA 2ASDA 9ICXA 4PH5A 5IIIA 3EWAA 3PSIA 5KFKA 1L3SA 4ECSA 2JRZA 4ECUA 1ZQWA 2JZBB 3JPSA 1Q46A 5KFEA 3NUQA 2B6GA 2XY6A 2BPGA 2ZIXB 3CP8A 3T5KA 3T79A 2W43A 3C1ZA 4DFKA 1JRPA 2AH5A 5EWFA 4BGDA 2AJQA 1HUZA 5ALKA 2KE7A 2LKYA 4DO9A 1JN3A 3M6ZA 2DPIA 5DG7A 1ED1A 1HEKA 3ALRA 2WB1F 1O03A 5AI5A 3MGIA 1V38A 4F91B 1NNLA 4FZLA 3F5EA 3FYHA 2W9CB 5EOZA 2W03A 2BQUA 3G6XA 8ICNA 2ZIWB 4BX9C 1ZQRA 3H4DA 1U9LA 4J9SA 5KFYA 2K8CB 1KL9A 5ALQA 2K8AA 2KVSA 4EYIB 5TZVA 4B9VA 1SXEA 2ZXHA 4RU9A 1RYRA
chains in the Genus database with same CATH topology
4NL9C 2E8MA 1COKA 1LKYA 2F3NA 1SV4A 1SV0A 2QARA 2Y9TA 2YTUA 3TADA 1UQVA 5KNIA 1WWVA 2E8NA 1PK1B 2QB0A 3BS5A 2E8PA 3BS5B 2DKZA 2DKXA 2L5YA 1PK1A 1WWUA 1PK3A 5JRTA 1X66A 3HILA 2KG5A 3SEIA 3K1RB 4MHVA 2F44A 1V85A 4RQMA 1B4FA 1SV0C 2Y9UA 1Z1VA 3IDWA 2D8CA 2EAPA 2F8KA 5J8YC 2EAMA 1X40A 1JI7A 5F3XB 1DXSA 4PZOA 4PZNA 1OW5A 3BQ7A 3TACB 2FE9A 2ESEA 2LMRA 2JV3A 1B0XA 2B6GA 2KSOB 3SENA 1F0MA 1SXDA 2K60A 3BS7A 2KE7A 2DL0A 5J8YA 2EANA 3KKAA 2D3DA 1UCVA 2QB1A 1V38A 1SGGA 2GLEA 2EAOA 4NJ8A 3KKAC 3H8MA 2KMDA 3TADC 5JU5A 2K4PA 2QB0B 4RQNA 2LPEA 2KIVA 2KSOA 1KW4A 1X9XA 2QARB 1RG6A 5JTIA 5L1MA 2ES6A 1LKYB 4NL9A 1SXEA 2E8OA 1OXJA 2QKQA 4IS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NL9 C;  2E8M A;  1COK A;  1LKY A;  2F3N A;  1SV4 A;  1SV0 A;  2QAR A;  2Y9T A;  2YTU A;  3TAD A;  1UQV A;  5KNI A;  1WWV A;  2E8N A;  1PK1 B;  2QB0 A;  3BS5 A;  2E8P A;  3BS5 B;  2DKZ A;  2DKX A;  2L5Y A;  1PK1 A;  1WWU A;  1PK3 A;  5JRT A;  1X66 A;  3HIL A;  2KG5 A;  3SEI A;  3K1R B;  4MHV A;  2F44 A;  1V85 A;  4RQM A;  1B4F A;  1SV0 C;  2Y9U A;  1Z1V A;  3IDW A;  2D8C A;  2EAP A;  2F8K A;  5J8Y C;  2EAM A;  1X40 A;  1JI7 A;  5F3X B;  1DXS A;  4PZO A;  4PZN A;  1OW5 A;  3BQ7 A;  3TAC B;  2FE9 A;  2ESE A;  2LMR A;  2JV3 A;  1B0X A;  2B6G A;  2KSO B;  3SEN A;  1F0M A;  1SXD A;  2K60 A;  3BS7 A;  2KE7 A;  2DL0 A;  5J8Y A;  2EAN A;  3KKA A;  2D3D A;  1UCV A;  2QB1 A;  1V38 A;  1SGG A;  2GLE A;  2EAO A;  4NJ8 A;  3KKA C;  3H8M A;  2KMD A;  3TAD C;  5JU5 A;  2K4P A;  2QB0 B;  4RQN A;  2LPE A;  2KIV A;  2KSO A;  1KW4 A;  1X9X A;  2QAR B;  1RG6 A;  5JTI A;  5L1M A;  2ES6 A;  1LKY B;  4NL9 A;  1SXE A;  2E8O A;  1OXJ A;  2QKQ A;  4IS7 A; 
#chains in the Genus database with same CATH topology
 2YX8 A;  4P4M A;  2HOQ A;  1XC9 A;  3IG5 A;  3J81 j;  1XNS A;  1IM4 A;  3PX4 A;  4K4H A;  2XO7 A;  2BPF A;  2Y9T A;  3MC1 A;  1YZ6 A;  4DOB A;  4M6W B;  1BPD A;  5J0W A;  2OYY A;  4P0P B;  4R8U A;  2BKE A;  4QW8 A;  2L5Y A;  3VCB A;  1PK3 A;  3L4P A;  2V4R A;  3FAH A;  8ICA A;  4DQI A;  2ISO A;  1BPX A;  1NKE A;  3PW7 A;  4DL4 A;  3GV8 B;  7ICP A;  2WF8 A;  3QEB Z;  2DWQ A;  4DSK A;  5EWE A;  3NVY A;  2W7P A;  3RJH A;  1N62 A;  9ICV A;  4CF3 A;  5ALP A;  1BPY A;  2DF4 B;  9ICN A;  7ICH A;  2YML A;  4UBB A;  5J2I A;  4IQV A;  5IIL A;  3MBY A;  1KEJ A;  3JPQ A;  3GV5 B;  2EAN A;  3V72 A;  1PVQ A;  4ECV A;  4CDG A;  5A0L A;  5ALE A;  1IV8 A;  1UCV A;  1X6J A;  1J2M A;  3QUC A;  5C0Y A;  2GLE A;  1L3T A;  1VJ5 A;  2G08 A;  1RXV A;  5DQH A;  4EEK A;  4B9N A;  1V97 A;  3HRD D;  3SQI A;  7ICS A;  3CRX A;  2EDU A;  2ES6 A;  3QYP A;  1CRX A;  5J2H A;  3KZI U;  3EUB 2;  2C22 A;  4UBC A;  2JEF A;  9ICG A;  8ICO A;  4J9Q A;  2KOB A;  3RJI A;  2KIC A;  3SZ2 A;  1T3Q A;  8ICQ A;  1U45 A;  2HOI A;  2HVI A;  4MFC A;  4PHP A;  1SV4 A;  3NRZ A;  5KTQ A;  4QZG A;  4J9K A;  4DFM A;  2O6K A;  4UB3 A;  4Q45 A;  4P0P A;  5KFT A;  4OCZ A;  3AU6 A;  3WK4 A;  2ZIU A;  1L3U A;  1D8Y A;  3AN1 A;  2H3Z A;  4Q44 A;  1B4F A;  3KHR A;  3ONN A;  4UAW A;  3C2K A;  2EAP A;  3A0B U;  5J8Y C;  3NGD A;  1B22 A;  2ZUC A;  2WB1 C;  2KHQ A;  5L1I A;  4M9J A;  1T8E A;  5KFO A;  3M9N B;  5B66 U;  2KJ9 A;  2J6T A;  3U26 A;  1SXD A;  4F3O A;  1KLN A;  5CWR A;  3BS7 A;  3S6J A;  4DS5 A;  2DL0 A;  2RLT A;  2OEH A;  1UPH A;  3AEV A;  1ZQB A;  4I2D A;  4FE3 A;  1WCL A;  3N7P D;  2M0N A;  3RJF A;  4YR2 A;  4O3P A;  5AKY A;  1JIH A;  1N5W A;  1AQ6 A;  1CUK A;  4QZB A;  4PJ0 U;  3RF9 A;  4BDP A;  4RQ6 A;  4GXJ A;  3E2E A;  1JAL A;  4UB4 A;  1L7P A;  2IA6 A;  3OJS A;  5KFI A;  2ZG6 A;  3MDA A;  4O3N A;  3LWM A;  4EX7 A;  3WK7 A;  3H8S A;  3SD7 A;  1BVS A;  4YMM A;  2QKQ A;  1RXW A;  5KFX A;  1ZQP A;  7ICI A;  2FLP A;  2Q4T A;  1NOM A;  5CA7 A;  1SL1 A;  1NK7 A;  5J0Y A;  2IHN A;  3QEA Z;  1RYU A;  2W11 A;  2F3N A;  2YTU A;  3TAD A;  3JPP A;  2BGW A;  3THV A;  3LVW A;  3B0X A;  8ICZ A;  4F5Q A;  4ZH4 A;  2GH1 A;  1QSS A;  1P7D A;  1MN8 A;  2A3V A;  3MDC A;  1YT3 A;  3CYM A;  1X66 A;  4HAI A;  5J2K A;  3WK5 A;  1GO3 F;  4TQR A;  3RH5 A;  4CNQ A;  5L1K A;  1MSW D;  1TAM A;  5ALW A;  9ICP A;  3OPX A;  1BPB A;  3D2N A;  2EAM A;  1DGJ A;  4M9G A;  2PMZ F;  4F5P A;  5AIA A;  4DSL A;  5CP2 A;  4YR0 A;  2P66 A;  5HP4 A;  4O5C A;  2OCE A;  2FPM A;  4GIB A;  1WYG A;  1Z3E B;  2PXI A;  3HKZ F;  2W55 A;  1L8L A;  7ICG A;  1HUO A;  3H8J A;  1CI4 A;  7ICR A;  5HHH A;  1L3V A;  4XUS A;  1PVP A;  3WK6 A;  4MEX A;  2N1R A;  4BWM A;  3N4M B;  5D4B A;  1S0V A;  4YMO A;  2R8H A;  4DOA A;  4B9L A;  4JMU A;  5L1J A;  2H3V A;  2FMP A;  5J0S A;  2C2R A;  5IIJ A;  4EZ6 A;  4NLZ A;  2UVR A;  1TAU A;  5KG2 A;  7ICE A;  3GIL A;  4NM2 A;  4ED1 A;  3KFU F;  5JTI A;  3SYZ A;  3PZP A;  3OGU A;  2B21 A;  5BOM A;  4U6P A;  2HMX A;  4I28 A;  4C8L A;  4NL9 C;  3DEE A;  4FS1 A;  9ICR A;  2Z7J A;  1SL2 A;  4RQ8 A;  2CN1 A;  5DG9 A;  5J0O A;  1BNP A;  3QU9 A;  5DGA A;  1XSN A;  2KFZ A;  2QAR A;  2YMM A;  1NZB A;  2HHT A;  5CEH A;  4CRX A;  5KNI A;  8ICJ A;  2CRX A;  1SIJ A;  1OUQ A;  3VC8 A;  9ICB A;  1L8O A;  1MQ3 A;  2XVT A;  3M7D A;  2BPC A;  1KDH A;  4KN7 A;  9ICK A;  5KFW A;  9ICQ A;  4UB6 U;  1S77 D;  2WF9 A;  2JH7 A;  3OSN A;  2F8K A;  2E1E A;  2IMW P;  5AK6 A;  3SAH A;  2MA1 A;  1QTM A;  4QNL A;  2LMR A;  9ICU A;  5B5E U;  2KIW A;  4ED6 A;  2PKE A;  3ISC A;  3UQ0 A;  2DQN B;  2NRX A;  2JEG A;  4Y2U A;  4J9O A;  3V6K A;  5AM0 A;  4J9P A;  8ICE A;  3GIJ A;  4DSJ A;  3IM1 A;  8ICF A;  3OHB A;  5J0U A;  4ELU A;  5J2G A;  1ZQS A;  1JX4 A;  4PGX A;  1S76 D;  3NVV A;  1VLB A;  3UXP A;  5ALI A;  4UB8 U;  3AUO A;  3SR6 A;  3NTU A;  4C7Z A;  3WKE A;  3WKD A;  2ZUD A;  4KMU A;  2W7O A;  1RPL A;  2K4E A;  2HHX A;  2MRL A;  3FDS A;  1U47 A;  4MF2 A;  4M9L A;  3GV7 B;  3K4G A;  4QZD A;  7ICL A;  4DLE A;  4I2A A;  5D46 A;  2QAR B;  1X9M A;  9ICW A;  5KG3 A;  5HR7 A;  2D6F C;  5L1L A;  4QWD A;  4BJQ A;  4TUP A;  3Q8Q B;  2BCQ A;  1KSP A;  1S5L U;  2C2E A;  5ALY A;  4B9T A;  4LJX A;  3QE9 Y;  5KFD A;  5DKW A;  1ZD2 P;  2PFQ A;  5DQI A;  4RQ3 A;  3SAF A;  3RAQ A;  3QZ7 A;  2WF5 A;  4ZOH C;  1K5O A;  5ALS A;  5GTH U;  4HYK A;  2FPL A;  2J6S A;  3LDA A;  7ICM A;  5JUM A;  5T14 A;  1WWU A;  4UB5 A;  2CXY A;  4M9N A;  5EE1 A;  2KG5 A;  1A77 A;  1NKB A;  4CCH A;  4C80 A;  1SV0 C;  2NRV A;  1SKR A;  5ALN A;  5ALV A;  3KHL A;  7ICT A;  4CE6 A;  3C1Y A;  4C4R A;  3C23 A;  3T5J A;  4UQG A;  5KFS A;  2XI9 A;  7ICU A;  2YQE A;  4GXI A;  1LB2 B;  2G09 A;  4AYB F;  5ALG A;  4RT3 A;  4TQS A;  1HIW A;  3KD3 A;  2F1I A;  2KSO B;  4DFP A;  3NAS A;  4KLQ A;  4JWM A;  3PX6 A;  3CNH A;  9ICI A;  3Q8K A;  2WAQ C;  3M8S A;  1S97 A;  1ZQO A;  4O9M A;  2WHE A;  2FI1 A;  5BPC A;  1LVH A;  5DLG A;  2HI0 A;  3PW5 A;  3PR4 A;  1ZQF A;  3BQ2 A;  2MU2 A;  2HDO A;  4I2I A;  1Z00 B;  4OO1 J;  5BOL A;  1D9D A;  4B9S A;  1LV5 A;  4YR3 A;  2HBK A;  2EAO A;  3T5H A;  4OJO A;  2KMD A;  1YZ7 A;  2BCS A;  1Y88 A;  1SWV A;  4M6W A;  4IR9 A;  3RJE A;  4AP9 A;  1ZRN A;  2KSO A;  1X9X A;  5DQG A;  2IBK A;  1NJX A;  4NLN A;  2RHF A;  4NL9 A;  4IR1 A;  4NLG A;  4DL6 A;  2GOL A;  1SB3 C;  3B9J A;  4DSI A;  1ZQG A;  7ICN A;  3BQ1 A;  9ICE A;  3WKB A;  5EWG A;  1KRP A;  3KHH A;  2KP7 A;  4Y2V A;  2EZY A;  1ZD4 A;  2E8N A;  3UXO A;  3ZD9 A;  2KK0 A;  3BS5 B;  2DKZ A;  1ZQK A;  2W9C A;  3OSP A;  1Q3V A;  4KX5 A;  4DL3 A;  2HBL A;  2XGP A;  3EPG A;  5H2F U;  4F5N A;  3PST A;  4RQ7 A;  1X40 A;  1S8O A;  1L7O A;  3PO5 A;  3HWT A;  3HKZ C;  1OW5 A;  1JXL A;  5KFM A;  2LM1 A;  3HP6 A;  1CEZ A;  4Y2Y A;  2YB1 A;  3NRW A;  2BDU A;  1F0M A;  8ICC A;  5KFN A;  4RUC A;  1NK4 A;  2UVW A;  4OJ5 A;  3B0Y A;  5AM5 A;  2LYH A;  3H4B A;  2MAX A;  3O0F A;  3KKA A;  1TKD A;  1ZD5 A;  2JHD A;  3E0F A;  4DQS A;  1SZH A;  4EEL A;  1ZQE A;  7ICQ A;  1SGG A;  3UQ2 A;  1U49 A;  1NJW A;  3HT3 A;  3KKA C;  3M1Y A;  1WG8 A;  8ICM A;  1A6S A;  2KTQ A;  1N61 A;  3ZDB A;  5KG6 A;  2W9B B;  4R63 A;  4Y2P A;  4Q8F A;  1IIP A;  1LKY B;  5HML A;  2P6R A;  3Q8M A;  4BXO A;  1OXJ A;  1O08 A;  4YMN A;  4RT2 A;  4I2E A;  1X6I A;  2R8I A;  5AKI A;  4O3R A;  1COK A;  1QQ6 A;  9ICJ A;  3RAX A;  1N56 A;  4FBT A;  3OJU A;  5KFU A;  2I6X A;  2E3T A;  5KFF A;  2HHW A;  2W54 A;  4US8 A;  2W8K A;  4ELV A;  3QUQ A;  2HHU A;  2G0A A;  2OXO A;  4KLE A;  5G5H A;  2P35 A;  3ISD A;  8ICT A;  4KLD A;  3RJG A;  1S0O A;  4B6J A;  4I2B A;  3K75 D;  1SWW A;  4RQM A;  5AM3 A;  4OJP A;  5EE3 A;  3EPI A;  3UPQ A;  1ZQD A;  3WKC A;  2LBO A;  4Y2R A;  4KX3 A;  4KLO A;  1S10 A;  4Z6E A;  1X9S A;  1JRO A;  4RQ5 A;  4QZ8 A;  4PZO A;  3QNM A;  4PZN A;  3V7L A;  2KNJ A;  5KT7 A;  3GII A;  4OD0 A;  2WAQ F;  5GTI U;  1ZRM A;  4QZC A;  3MR5 A;  1RZT A;  1QQ5 A;  2RDI A;  3GZF A;  3D2Q A;  2K60 A;  5KT3 A;  2FPK A;  4RUA A;  1N60 A;  5J0T A;  1WUD A;  2F8L A;  1UA0 A;  2G06 A;  4EBD A;  2JH1 A;  2HBM A;  3RB3 A;  3RRG A;  2D3D A;  4F5R A;  4RPY A;  2G07 A;  2E1F A;  2OWO A;  3RR8 A;  3UXN A;  5J0P A;  4KLG A;  2OM6 A;  1DOQ A;  4XRH A;  2QB0 B;  4Z6C A;  2ZIX A;  1KW4 A;  4YXJ A;  3F53 A;  1BNO A;  1RG6 A;  3WK9 A;  5KFP A;  2JZB A;  4QWC A;  4C8N A;  2MSN A;  3RBD A;  2FMS A;  4FBU A;  2BCU A;  4DL7 A;  4UAY A;  4IS7 A;  2KKP A;  2KV2 A;  2A1J B;  3UMB A;  4F71 A;  3Q8P B;  2F2A B;  1C7Y A;  4MFF A;  3C21 A;  1LKY A;  3D2S A;  2KJ8 A;  4DFD A;  4JV0 A;  4C4T A;  3WKA A;  1ZET A;  2OH2 A;  3F5A A;  5AM4 A;  3PV8 A;  3IP4 B;  4RPX A;  4EBE A;  5KFC A;  4PHD A;  3I1Y A;  5FP0 A;  2K8B B;  2F1J A;  3FC4 A;  4PL2 A;  2EQY A;  2ZJ5 A;  2JR5 A;  2F44 A;  1C20 A;  4R65 A;  5ALH A;  9ICA A;  1T94 A;  9ICL A;  5DBB A;  1ZQN A;  4QWB A;  2BHN A;  2R18 A;  4FFD A;  4YFK A;  3TAC B;  2J6U A;  2FE9 A;  2WF6 A;  4PHA A;  2Y1J A;  3M8R A;  4F2R A;  4XA5 A;  4PGY A;  4DQR A;  4M04 A;  3RB6 A;  4ECT A;  3TAQ A;  1PZN A;  5ALO A;  5ALT A;  1ZQH A;  5AI4 A;  4NM1 A;  3CW2 C;  4DLG A;  2W04 A;  5J8Y A;  5KT2 A;  1KBU A;  3MR2 A;  5KG7 A;  5CR0 A;  3TKA A;  2VA8 A;  5AI0 A;  3C2M A;  8ICR A;  4C4S A;  3IHQ B;  4IQT A;  2NRT A;  4LVS A;  1B43 A;  1IG6 A;  4GLX A;  1N63 A;  4C0Z A;  5J0R A;  3TAD C;  2IHM A;  4U7C A;  2A1A A;  2KIV A;  1MC8 A;  4ICA A;  4UW9 A;  5J2D A;  1X9W A;  1ZXI A;  3M6K A;  2FJ6 A;  2K4I A;  3I28 A;  4RNN A;  4ECR A;  1ZQT A;  2R8G A;  4IRC A;  2HW3 A;  1TV9 A;  1UT8 A;  1F44 A;  2KZZ A;  5AKK A;  5DLF A;  3H0M B;  3OTQ A;  2C2D A;  2KN7 A;  2IOF A;  2G5I B;  4JV1 A;  2H3I A;  2LI6 A;  7ICJ A;  3MR3 A;  4UAU A;  4ECZ A;  3V7K A;  1SZP A;  2AGO A;  3TQ1 A;  2I9G A;  3M9M B;  4DQP A;  2I1Q A;  1UHU A;  4F4K A;  2HOF A;  2F77 X;  2C28 A;  2XY7 A;  1D9F A;  4I2J A;  4B9U A;  3UM9 A;  4O5E A;  2DUY A;  5EE0 A;  5AK3 A;  7ICV A;  2H5X A;  1RM6 C;  4QZ9 A;  2Y0S F;  5KG4 A;  4TUR A;  1A76 A;  1UT5 A;  4IRD A;  4UAV A;  1NKC A;  5E79 U;  2K4H A;  3L5K A;  1ZQY A;  5ALD A;  4UAS A;  5J2E A;  2HSZ A;  2QLT A;  4RZR A;  3GDX A;  3M9O B;  3PX0 A;  5HNK A;  3RRH A;  3LVV A;  3BZK A;  4F4W A;  1Z4O A;  8ICI A;  5IIO A;  4JB3 A;  2UVU A;  4JUZ A;  3Q8S B;  3BQ0 A;  4KLI A;  4X5V A;  4P4P A;  5HMM A;  2ZIU B;  4RNM A;  3LWL A;  3LYS A;  5C5J A;  3ED5 A;  4P0Q A;  4F92 B;  3PML A;  1ARO P;  4UAT A;  2BCV A;  4TUS A;  2KHV A;  2NO4 A;  5KT5 A;  4KLU A;  2YN4 A;  1DK3 A;  2BQ3 A;  5IIM A;  9ICO A;  4Z6F A;  3PVX A;  1ZQQ A;  1KTQ A;  3C2L A;  3JPR A;  5KFB A;  5KFA A;  2NO5 A;  5DB9 A;  2ASJ A;  1RQL A;  3RB4 A;  5K4L A;  8ICL A;  4R64 A;  4P2H A;  4O3O A;  3EYZ A;  4RNO A;  4ED2 A;  1JMS A;  2VJ5 A;  3ISB A;  5AKZ A;  4O3Q A;  4KLL A;  3MGV A;  3QU7 A;  1D8L A;  3IN5 A;  5KG1 A;  2AGQ A;  1EXN A;  5ALF A;  1URJ A;  4EX6 A;  2ATL A;  4KTQ A;  2ALZ A;  3A0H U;  4P4O A;  2P6U A;  2KZ3 A;  8ICB A;  3QU5 A;  8ICV A;  4JV2 A;  3ZDE A;  1BPZ A;  3F2C A;  5G5G A;  3IRU A;  4YN4 A;  2DGZ A;  4PPX A;  1JI7 A;  1HJP A;  2AXT U;  5F3X B;  1KFT A;  1DXS A;  4CF4 A;  4MFA A;  3BJY A;  3BQ7 A;  3F2B A;  3H8W A;  4F8R A;  3C5G A;  2ESE A;  1U4B A;  4J9L A;  1PVR A;  1UA1 A;  1MQ2 A;  2JEI A;  1QCK A;  3IV6 A;  3EZ5 A;  4J9R A;  4OJL A;  8ICG A;  2KKV A;  1X2I A;  3ICX A;  1A0P A;  4G3I A;  4DF4 A;  1N5X A;  1NK8 A;  5AK4 A;  3EW9 A;  3PW0 A;  3QUT A;  1KFD A;  5KL8 B;  4UAZ A;  3G6Y A;  1KQQ A;  4M9H A;  2NV3 A;  4J03 A;  4KLJ A;  1NZP A;  4F4Z A;  2JEJ A;  5DG8 A;  5J29 A;  2K4P A;  7ICO A;  4RQN A;  1K1Q A;  1TAQ A;  3OHA A;  3RJJ A;  2AQ0 A;  4NLB A;  4KMO B;  4ELT A;  2M9N A;  1ZYQ A;  1TK8 A;  2LHT A;  2ZIV B;  5CRX A;  4JK1 A;  5AI8 A;  3SV4 A;  4DSF A;  2MUT A;  4Q43 A;  2AHO B;  1XO1 A;  5DBC A;  4FS2 A;  1L7M A;  5KFH A;  3HPO A;  3SV3 A;  2XCP A;  4A8E A;  4KLT A;  2IOF K;  3AQE A;  2IOH A;  2ZIW A;  8ICH A;  4RQ1 A;  4I2H A;  3ZDD A;  5KFG A;  2FDR A;  2KFN A;  4EEN A;  4QZF A;  1KFS A;  2VA3 A;  4YD2 A;  1FFU A;  3LK9 A;  1D8B A;  1Z00 A;  1ZQI A;  3QX7 A;  4I29 A;  1NK9 A;  4F5O A;  3ZD8 A;  1QSL A;  3JPN A;  2W9A A;  4XQ8 A;  4I2F A;  1TVA A;  1ZQV A;  2ISP A;  2JV3 A;  2ASL A;  3ORY A;  3C5F A;  4YVZ A;  5F9N A;  4ECY A;  5AHX A;  2AQ4 A;  4ACO A;  2KVC A;  3K1Z A;  4Y2S A;  3TAR A;  3TI0 A;  1XS9 D;  3GFK B;  3C28 A;  5KFJ A;  5CJ7 A;  4C8K A;  5D49 A;  2XID A;  3AMZ A;  3G6V A;  7ICK A;  1QSY A;  4QZH A;  4EEY A;  4M0A A;  3PNC A;  2WFA A;  2LYA A;  4C8O A;  4JWN A;  5KG5 A;  4I2G A;  2BCR A;  3UMC A;  5ALZ A;  4F72 A;  2LPE A;  3JPO A;  1T4G A;  3PY8 A;  8ICS A;  4C7Y A;  2YMQ A;  5L9X A;  5AKJ A;  3QU4 A;  4E0D A;  4UAR A;  3H0L B;  2V9W A;  5L1M A;  2BZF A;  4O3S A;  3Q8R B;  1RYS A;  3BDP A;  1JXE A;  4GC7 A;  1KKX A;  5KFZ A;  3V6H A;  1FEZ A;  5ALJ A;  3SI8 A;  5AKL A;  9ICS A;  3AU2 A;  2PMZ C;  2ZTE A;  3C29 A;  2AGP A;  2KZM A;  3L3F X;  3H40 A;  5KFR A;  1XO0 A;  4GXK A;  2W3R A;  2F76 X;  4R8U B;  1NI3 A;  2Y0S C;  4KN4 A;  4ECX A;  3HIL A;  4WJ3 B;  3SEI A;  2NRW A;  3GQC A;  4RPZ A;  3ETR A;  4DOC A;  4IL6 U;  5DB8 A;  2HHQ A;  2HHV A;  2JMG A;  9ICT A;  2JGA A;  4F4Y A;  1KN5 A;  4Q8E A;  3PW4 A;  1NK6 A;  3QU2 A;  5AKH A;  4QZI A;  4NY8 A;  4PGQ A;  1BPE A;  2GWS A;  8ICK A;  4UB1 A;  2PFN A;  3SEN A;  2GO7 A;  2UVV A;  5AIC A;  4G9B A;  4QJF B;  4DEZ A;  2PFP A;  3MFI A;  5KFV A;  4DSE A;  3TFR A;  4RQ2 A;  2ZUB A;  2QB1 A;  5IIK A;  4RQ4 A;  3BQT A;  1S0M A;  4NJ8 A;  3JPT A;  1ZQ1 C;  1ZQM A;  1WCN A;  1TK5 A;  2RP5 A;  1SKW A;  4O5K A;  5DB6 A;  3PR5 B;  5KG0 A;  1QH9 A;  5AIB A;  4GFJ A;  1PUZ A;  4US9 A;  1U48 A;  2KEY A;  4KIT B;  4DCC A;  1NK0 A;  2JXJ A;  5DB7 A;  4Y2X A;  2BR0 A;  2DBY A;  2RDJ A;  2BDP A;  1N2X A;  1FIQ A;  5KFL A;  3KZX A;  3MAB A;  1MA7 A;  4CF5 A;  4KLM A;  3RB0 A;  4J9M A;  4EYH B;  5AI6 A;  5J2F A;  1N48 A;  4R66 A;  2W9B A;  4LZG A;  4YG2 A;  3ETL A;  2R8K A;  1DGS A;  1PK1 B;  2FLN A;  5J0X A;  5CB1 A;  2ZJ8 A;  3BS5 A;  1XSL A;  4F4X A;  4I2C A;  5ALR A;  4F2S A;  5TIS U;  2R8J A;  1VDV A;  4ED0 A;  2W8L A;  2YB4 A;  1L7N A;  1TE2 A;  2Y9U A;  4QWE A;  3ZDA A;  3KBB A;  7ICF A;  3QZ8 A;  5KT4 A;  5J2C A;  4IQW A;  2A1J A;  3Q8L A;  8ICY A;  4GC6 A;  3V6J A;  1ZQX A;  2AU0 A;  3GIK A;  1B0X A;  1Q8K A;  4DL5 A;  3GU3 A;  5DGB A;  2Q0Z X;  1NK5 A;  3AM9 A;  9ICH A;  2KD1 A;  4QW9 A;  1S9F A;  4IC9 A;  5ALU A;  2K89 A;  3GIM A;  1SKS A;  9ICC A;  4QIW C;  5CHG A;  2LYB A;  5IIN A;  3MR6 A;  4O0I A;  1S0N A;  4FZM A;  2DFL A;  5DDY A;  4PHE A;  3PW2 A;  1Z4N A;  3SMV A;  4NLK A;  2EZX A;  3H8M A;  2YMP A;  1FO4 A;  1X42 A;  4YQW A;  2B0C A;  5JU5 A;  3DDH A;  5F9L A;  3KHG A;  4NWI A;  3AQF A;  4K4G A;  4QZA A;  2XGQ A;  4UB2 A;  4YCX A;  2OHF A;  2E8O A;  3WK8 A;  2MUT B;  3BZC A;  2ZIV A;  1V9P A;  1ZOL A;  2W9M A;  5KT6 A;  3PSF A;  3TFS A;  1J97 A;  5HR6 A;  4YXM A;  4Z6D A;  5J0Q A;  1ZQJ A;  2NYV A;  1T3N A;  1UQV A;  4FO6 A;  2W3S A;  1WWV A;  2VAN A;  4Y2J A;  5KL1 B;  4OJ6 A;  3KOO A;  5AK5 A;  3RH6 A;  1PK1 A;  1QQ7 A;  3RBE A;  3K1R B;  4QZE A;  4AYB C;  1Z1V A;  3IDW A;  3MFH A;  3KTQ A;  1Q3U A;  2RRD A;  1TK0 A;  3R9K A;  4YD1 A;  4K4I A;  2BQR A;  2ZTC A;  5ALX A;  5J2A A;  4BWJ A;  4TUQ A;  2WTF A;  4BXO B;  1ZQC A;  5AKG A;  1ZQL A;  2G5H B;  3N7R C;  2EZZ A;  4Y2Q A;  2PI5 A;  1FFV A;  2H3Q A;  2WF7 A;  4DQQ A;  1M6Y A;  3V7J A;  2Y1I A;  4NXZ A;  4DL2 A;  4EZ9 A;  4ED8 A;  3PSP A;  1COO A;  1RDF A;  5AM1 A;  1ZQZ A;  4ED3 A;  2XC9 A;  1TFR A;  2F1H A;  3QXG A;  4MEY A;  3UMG A;  3WU2 U;  3MGH A;  3I76 A;  4PL1 A;  2FLL A;  1Z1B A;  5KAI U;  2VJ4 A;  1ZQA A;  5AM2 A;  4M2Y A;  2HBJ A;  3FM9 A;  1DRG A;  4KLF A;  3NS1 A;  2NRZ A;  1QLN A;  2LM4 A;  2KJ5 A;  1F5S A;  1J2N A;  2FMQ A;  2HHS A;  2ZJA A;  4DWI A;  2ZXI A;  4I27 A;  2E8M A;  3NVW A;  3RFA A;  4F93 B;  2V4Q A;  2PFO A;  2CPR A;  1SV0 A;  1BGX T;  1XU4 A;  3T5L A;  3NVZ A;  4QWA A;  4USA A;  3QUB A;  3ZDC A;  1ECW A;  2QB0 A;  4O3M A;  4P0Q B;  3HX0 A;  5J2B A;  4F50 A;  4MF8 A;  1JUD A;  2YY6 A;  8ICX A;  4CGZ A;  2PI4 A;  8ICP A;  3RR7 A;  1ZQU A;  4NLC A;  4NV0 A;  1ZJM A;  9ICM A;  3PO4 A;  4QIW F;  2HCF A;  5HHI A;  5AKX A;  3TAP A;  1SL0 A;  4KLS A;  4YP3 A;  1ZD3 A;  1NJY A;  4DF8 A;  3RJK A;  8ICW A;  2XCA A;  5KAF U;  4FZN A;  4ED7 A;  3N97 B;  3DV9 A;  2ZTD A;  1IXR A;  3SAG A;  4B9M A;  2EH9 A;  2I5H A;  3AL0 B;  1NJZ A;  5DDM A;  2HVH A;  5AKE A;  3PMN A;  8ICU A;  3TAN A;  4IRK A;  9ICF A;  2RQ5 A;  3H7I A;  5DBA A;  4J9N A;  3ZI4 A;  5ALM A;  2DPJ A;  4IQU A;  3T3F A;  2XIC A;  3E58 A;  3N7S C;  4KLH A;  3HJE A;  2E5S A;  3IG8 A;  4ECW A;  5AI9 A;  4C8M A;  1H38 A;  4EBC A;  3RH4 A;  4M47 A;  5EE9 A;  1K1S A;  4DS4 A;  2VKQ A;  3H0R B;  3N28 A;  2VA2 A;  2XY5 A;  2ODG A;  5J2J A;  4LZD A;  2A19 A;  4DFJ A;  1T7P A;  4ECQ A;  2E8P A;  2H3F A;  2DKX A;  4BUG A;  5JRT A;  1L6N A;  5ALL A;  3D6J A;  1Z19 A;  4Y2T A;  4MHV A;  5KFQ A;  3HW8 A;  1DK2 A;  4RQ0 A;  2VIX A;  3F2D A;  1XSP A;  1XWL A;  1V85 A;  1L5U A;  3RTV A;  1ZJN A;  2D8C A;  1RQN A;  2ASD A;  9ICX A;  4PH5 A;  5III A;  3EWA A;  3PSI A;  5KFK A;  1L3S A;  4ECS A;  2JRZ A;  4ECU A;  1ZQW A;  2JZB B;  3JPS A;  1Q46 A;  5KFE A;  3NUQ A;  2B6G A;  2XY6 A;  2BPG A;  2ZIX B;  3CP8 A;  3T5K A;  3T79 A;  2W43 A;  3C1Z A;  4DFK A;  1JRP A;  2AH5 A;  5EWF A;  4BGD A;  2AJQ A;  1HUZ A;  5ALK A;  2KE7 A;  2LKY A;  4DO9 A;  1JN3 A;  3M6Z A;  2DPI A;  5DG7 A;  1ED1 A;  1HEK A;  3ALR A;  2WB1 F;  1O03 A;  5AI5 A;  3MGI A;  1V38 A;  4F91 B;  1NNL A;  4FZL A;  3F5E A;  3FYH A;  2W9C B;  5EOZ A;  2W03 A;  2BQU A;  3G6X A;  8ICN A;  2ZIW B;  4BX9 C;  1ZQR A;  3H4D A;  1U9L A;  4J9S A;  5KFY A;  2K8C B;  1KL9 A;  5ALQ A;  2K8A A;  2KVS A;  4EYI B;  5TZV A;  4B9V A;  1SXE A;  2ZXH A;  4RU9 A;  1RYR A; 
#chains in the Genus database with same CATH homology
 4NL9 C;  2E8M A;  1COK A;  1LKY A;  2F3N A;  1SV4 A;  1SV0 A;  2QAR A;  2Y9T A;  2YTU A;  3TAD A;  1UQV A;  5KNI A;  1WWV A;  2E8N A;  1PK1 B;  2QB0 A;  3BS5 A;  2E8P A;  3BS5 B;  2DKZ A;  2DKX A;  2L5Y A;  1PK1 A;  1WWU A;  1PK3 A;  5JRT A;  1X66 A;  3HIL A;  2KG5 A;  3SEI A;  3K1R B;  4MHV A;  2F44 A;  1V85 A;  4RQM A;  1B4F A;  1SV0 C;  2Y9U A;  1Z1V A;  3IDW A;  2D8C A;  2EAP A;  2F8K A;  5J8Y C;  2EAM A;  1X40 A;  1JI7 A;  5F3X B;  1DXS A;  4PZO A;  4PZN A;  1OW5 A;  3BQ7 A;  3TAC B;  2FE9 A;  2ESE A;  2LMR A;  2JV3 A;  1B0X A;  2B6G A;  2KSO B;  3SEN A;  1F0M A;  1SXD A;  2K60 A;  3BS7 A;  2KE7 A;  2DL0 A;  5J8Y A;  2EAN A;  3KKA A;  2D3D A;  1UCV A;  2QB1 A;  1V38 A;  1SGG A;  2GLE A;  2EAO A;  4NJ8 A;  3KKA C;  3H8M A;  2KMD A;  3TAD C;  5JU5 A;  2K4P A;  2QB0 B;  4RQN A;  2LPE A;  2KIV A;  2KSO A;  1KW4 A;  1X9X A;  2QAR B;  1RG6 A;  5JTI A;  5L1M A;  2ES6 A;  1LKY B;  4NL9 A;  1SXE A;  2E8O A;  1OXJ A;  2QKQ A;  4IS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...