1LKYB

Structure of the wild-type tel-sam polymer
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
SIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKDLLLLTKEDFRYRSPHSGDVLYELLQHILKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Native interface of the SAM domain polymer of TEL.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords TRANSCRIPTION FACTOR ETV6
total genus 24
structure length 77
sequence length 77
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2002-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1lkyB00
2E8NA 1PK1A 1WWVA 4NJ8A 2KSOB 3SEIA 5F3XB 1KW4A 4RQMA 2FE9A 1V85A 2KMDA 3IDWA 1X9XA 2YTUA 3H8MA 3KKAC 3BS7A 1LKYB 2F8KA 4RQNA 5KNIA 2D3DA 1OW5A 2KG5A 1LKYA 4PZOA 1Z1VA 1JI7A 2DKZA 2E8MA 2JV3A 5JTIA 1F0MA 2QB0B 2EANA 2L5YA 2EAPA 2ESEA 1PK3A 2E8PA 1UCVA 2DKXA 1V38A 3TACB 5J8YC 1SXDA 3KKAA 1X66A 1OXJA 4NL9A 2F44A 2LMRA 1B0XA 2KSOA 2E8OA 2F3NA 5L1MA 2LPEA 2GLEA 2QARB 4IS7A 2DL0A 5J8YA 2QB0A 1SXEA 1SV0C 3BS5B 3TADC 4MHVA 1SV4A 1WWUA 2ES6A 4PZNA 3BS5A 1SGGA 1B4FA 3BQ7A 2QKQA 1RG6A 1COKA 1X40A 2QARA 3HILA 1SV0A 2K60A 2KE7A 3TADA 2K4PA 4NL9C 1PK1B 2Y9UA 2D8CA 5JRTA 2EAMA 3K1RB 2QB1A 1DXSA 2Y9TA 2EAOA 1UQVA 2KIVA 2B6GA 5JU5A 3SENA
chains in the Genus database with same CATH superfamily
2FMSA 4JB3A 4Q8EA 1JROA 4DQRA 4YQWA 3TQ1A 9ICJA 3RH4A 3BS7A 4ED3A 2W3RA 4DEZA 2LYAA 4YMMA 2HHVA 4F93B 2ZTCA 4YR0A 3EWAA 5L1IA 3UQ0A 2D3DA 3RB4A 5J29A 1X6IA 4O5EA 8ICTA 5CHGA 2OHFA 3KBBA 4GC7A 8ICKA 5D46A 3RR7A 4M2YA 2EH9A 1TKDA 2KTQA 4YVZA 1KKXA 1AROP 2VA2A 2PI5A 1L7NA 8ICVA 1QSSA 1B22A 2UVWA 3HJEA 3F53A 1ZRMA 5KFNA 4ECXA 3RJKA 1FO4A 2ZUCA 1KFTA 9ICFA 4QZGA 2DFLA 2XGQA 5DB7A 4KLGA 1WCLA 3Q8KA 9ICWA 4M9NA 7ICOA 2G0AA 4RUCA 1WYGA 4BUGA 4C0ZA 1BPBA 3H7IA 3SQIA 2PI4A 2JMGA 1N63A 3GZFA 1TV9A 1ZQPA 7ICHA 2PKEA 1NK6A 2WF9A 3LDAA 2K8AA 1V9PA 3AEVA 1RDFA 4Z6EA 2W03A 2KD1A 4PHPA 5J0OA 2K4PA 3THVA 1LB2B 2EAMA 1X42A 1PUZA 3QU5A 4ED1A 3BZKA 4I27A 3N97B 3M8RA 1PVQA 2KKPA 3TANA 4JUZA 3EUB2 2G08A 5ALZA 2XY6A 4NLZA 1L3VA 2ZXHA 3GU3A 1ZQBA 2XO7A 4X5VA 3BZCA 2HVHA 3NGDA 4JK1A 2YMLA 7ICGA 3RB3A 1JI7A 1Z1VA 3HP6A 2XY7A 2A1JB 2XIDA 2JEFA 2L5YA 5AI8A 2EAPA 2KK0A 3IG8A 7ICJA 4TUPA 2HVIA 3RJJA 1PK3A 3N7PD 5CP2A 4QZBA 2KIWA 1X2IA 4XA5A 5KG3A 5KG5A 5KG7A 3V6HA 2NRTA 5J0QA 4Y2QA 3JPQA 3PR4A 4R8UB 3TI0A 4F4YA 2WF5A 1SL0A 1S97A 1NJYA 4CGZA 2YN4A 2A19A 3QZ8A 4I28A 9ICOA 2JR5A 3SMVA 4RQ7A 4US9A 4P0PB 2NRVA 2K4IA 1Z1BA 4QWBA 1KFDA 4MF8A 2YQEA 1D9FA 3H4BA 4I2EA 2RP5A 2HBLA 1P7DA 1D9DA 2KV2A 1X40A 2OH2A 1RXVA 3ZI4A 2V9WA 5KFVA 4ECZA 1XSNA 1X9MA 3NVWA 1BPYA 2JHDA 3QU2A 5DQGA 4TQSA 5KL1B 2ZIXB 3C5FA 3MGVA 4UAWA 5AM1A 1JX4A 2IOFK 5DLGA 2ZIUB 3HRDD 1N5WA 4JV1A 3G6XA 5JU5A 4BJQA 4JV0A 2Q4TA 4NLNA 4F4XA 2BPFA 4M04A 3LYSA 1KRPA 2UVRA 2XCAA 4O3MA 2MAXA 5DBBA 1VDVA 5ALYA 1JN3A 3PW0A 5AK4A 4HAIA 1XNSA 3UPQA 3UMBA 2YB1A 3TFRA 4ECQA 3OTQA 3H0LB 5ALVA 3PW2A 2BCUA 3E58A 5DLFA 5AKKA 5ALHA 3ISCA 2CPRA 9ICVA 3KFUF 4KX5A 2AGQA 2Y1JA 4F5QA 2I5HA 3LK9A 7ICEA 4DO9A 4DOCA 3PW5A 2IA6A 1IXRA 1SZPA 3D2QA 3PMLA 3GILA 2B21A 4Y2TA 3MBYA 2ASLA 1JALA 5KG0A 3QE9Y 2R8KA 2FMQA 2JH1A 5DDYA 2LMRA 4JWMA 2ZG6A 2WFAA 4P4OA 4XRHA 1KQQA 2KHVA 3H0MB 1FFUA 2GLEA 1UT5A 3CYMA 2D6FC 4ECRA 3ORYA 3NUQA 2KNJA 4ECVA 2KHQA 2UVUA 4QZ9A 4GLXA 3PNCA 1RYSA 5J0PA 3IRUA 1MSWD 1RG6A 2LYBA 3AQEA 2ZIVB 3N4MB 4UW9A 1Z00A 7ICPA 1C20A 3MR3A 2D8CA 3JPTA 2JRZA 1RXWA 4DQIA 1ZQ1C 8ICLA 1JRPA 1DXSA 2YMPA 2HHSA 1K1SA 1ZQCA 4UAYA 4EBEA 4J9PA 4O0IA 9ICSA 4E0DA 5DQIA 3ZDAA 2DPJA 4Y2UA 5C5JA 3ZDEA 1ZQWA 3L5KA 3ICXA 9ICKA 4J9RA 4PGQA 1Z19A 2W55A 4ELVA 4EENA 2GWSA 1KEJA 5ALOA 4YP3A 8ICPA 2WF7A 2EZZA 4UASA 1T3NA 4NV0A 3GV7B 4DL6A 2F77X 4NLKA 3A0BU 4FZNA 4Q45A 4B9MA 1N61A 5D49A 4RPYA 2FPMA 4JMUA 4DL7A 1V38A 2MUTB 1L7MA 4UB6U 3UMGA 2FPKA 3RJGA 1BGXT 1F5SA 4USAA 1KDHA 5G5GA 1D8BA 4AYBC 4I2FA 1UT8A 9ICMA 5AKIA 5J8YA 3LVVA 9ICCA 5DB9A 3PSPA 4M9GA 1SV4A 5J2EA 2WHEA 2BDUA 3M9NB 2XY5A 3RB0A 2DPIA 1YZ6A 3QEAZ 2BQ3A 2F1IA 3PVXA 4P4PA 4J03A 3FAHA 4B9VA 5F9NA 3AU6A 2R8IA 1PVRA 8ICJA 3Q8QB 4FS2A 3QU7A 7ICKA 1CI4A 1QCKA 1ZD5A 5HNKA 5BOLA 4BDPA 4PGYA 3BQ0A 3EZ5A 4ACOA 2KIVA 4DWIA 4PPXA 5J2FA 3JPRA 4TQRA 4YR3A 3KHGA 2DQNB 4XUSA 2HHWA 4GXIA 2E1EA 1U45A 3PSFA 3H8MA 1QSLA 1LKYB 4IRKA 4RPZA 4J9LA 1COOA 8ICCA 4NLCA 1TE2A 4C7ZA 2RHFA 1C7YA 4KMOB 3LWLA 4B9LA 2HI0A 2FJ6A 1CUKA 4R63A 4I29A 3QZ7A 1JMSA 3M7DA 8ICOA 4ECWA 2W9AA 4GIBA 4C80A 4UAZA 3WK9A 3MR2A 4UARA 4CF3A 5KFHA 2IHNA 4QZIA 2OM6A 4PHEA 8ICRA 3SD7A 3EW9A 4BXOA 4ECUA 2W9CA 5IINA 5KAIU 7ICNA 1WUDA 2A3VA 4J9QA 4BWMA 4RQ0A 4I2JA 3PY8A 3GIJA 2GH1A 4PJ0U 1H38A 4FFDA 2J6UA 5J0XA 4DSEA 4Y2SA 3SZ2A 3OSNA 3IN5A 1N5XA 3NVYA 4QZCA 2JXJA 4KLOA 3BQ7A 2DUYA 4ECTA 1XO1A 3OPXA 1EXNA 1SWVA 3HKZC 2AQ0A 4RQ8A 1LV5A 4ED7A 1BVSA 5TISU 3Q8PB 2XC9A 4FO6A 5AKZA 5AK3A 1ZETA 4NM2A 4IRCA 3SV4A 5KFMA 3HWTA 3TFSA 1UQVA 1SL1A 4KN4A 1Q3VA 4O3PA 1LVHA 2M0NA 1DGSA 1KL9A 3N7SC 5AKHA 9ICRA 2NYVA 4KTQA 2RLTA 3GV5B 2E8NA 3RH5A 2NRWA 5KT2A 2WAQC 4DOBA 5DB6A 1ZQHA 2F2AB 4C8KA 3SR6A 4TUSA 1Z3EB 1JXLA 3F2BA 3MC1A 4PL2A 5KNIA 3AU2A 4B9SA 2C2RA 3I76A 2HOIA 1L7OA 3OGUA 4UBBA 2V4QA 2JEIA 7ICTA 1X9SA 2QB0B 3KHRA 1N48A 5EOZA 3TAPA 1S10A 4QZDA 3R9KA 4F92B 1UCVA 3WKEA 2MRLA 5B66U 3HW8A 5BPCA 5J2JA 2H3ZA 4DLEA 2HHTA 1HIWA 5DGAA 4A8EA 1N56A 2ZTDA 1L7PA 2KOBA 2Y1IA 2K89A 3B0XA 5AI5A 4DQQA 4R64A 1NZBA 1ZQNA 1MN8A 2W7OA 4RUAA 3GFKB 5KFBA 2LYHA 2IMWP 5GTIU 4U7CA 5D4BA 2W7PA 4OJ5A 1COKA 4RQ5A 3QUQA 1NK4A 5J2CA 4YG2A 2K4EA 4ZOHC 3JPSA 1PK1B 3QU4A 1ZQRA 2WTFA 5KT4A 2W3SA 2W9BB 3QU9A 5KFLA 4C4RA 1NKEA 2NO4A 3IM1A 4NLBA 3L4PA 2RDJA 1O03A 1XWLA 3QYPA 4DFPA 4F3OA 1B43A 3H8WA 4Y2JA 4KLHA 2BR0A 5AKJA 5EWFA 4J9NA 3S6JA 1ZQGA 2FE9A 5DBAA 3KKAC 4KLLA 4NM1A 4C7YA 4YXMA 3NRWA 3C1ZA 3WK5A 5AI6A 1S0MA 5EE9A 1MQ2A 2ZIVA 3WK7A 4O3OA 3ETRA 1ZJNA 1XC9A 4IR1A 2ZUDA 4M6WB 2I9GA 5AIAA 2KJ5A 5DB8A 5AKYA 8ICZA 4C8MA 2KVCA 1CRXA 3C5GA 4F5OA 4K4IA 4MEXA 2ASJA 2MSNA 1T3QA 2IBKA 3H8SA 2HBKA 4F2RA 9ICQA 5ALDA 2B0CA 1DK3A 2BQRA 5F9LA 5KFRA 9ICTA 5AI9A 2CRXA 2C28A 4M6WA 3BS5B 5CA7A 4GFJA 3DV9A 1RYRA 2PFOA 3UXOA 4F4ZA 5ALJA 2IOFA 1ZQJA 4K4GA 4PZNA 1ZQDA 1B4FA 2P66A 2BCQA 2QARA 4I2HA 4O9MA 2EQYA 5KT3A 4Z6CA 4MFCA 3D6JA 4DQSA 4IC9A 4C4SA 4O5CA 4QWDA 2ATLA 4NL9C 5H2FU 2JZBB 5CR0A 2JZBA 4QWEA 2P35A 1N2XA 1NOMA 4QZAA 9ICBA 2EAOA 2BCSA 3ED5A 3UQ2A 3TKAA 3PMNA 3RRHA 4DSKA 3EPGA 3EYZA 4DFMA 2XVTA 8ICSA 5L1LA 4QJFB 3F5AA 2F8LA 3K4GA 1QQ5A 2HCFA 2WB1F 4EEYA 2Z7JA 3IDWA 4IQTA 5KFAA 2PFNA 5J2BA 1ZQOA 3NVZA 4DL2A 4FZMA 5AK5A 1LKYA 3M8SA 5IIMA 4PZOA 5G5HA 2HHQA 2J6SA 2XI9A 5JUMA 3RJIA 3M9OB 4YCXA 3M6ZA 1U49A 3NVVA 2E8MA 4EZ9A 2PFQA 4Q43A 2W9CB 2F1JA 2HBJA 3AM9A 2H3IA 1IG6A 4UAVA 3SI8A 2I6XA 3C23A 5EWGA 4YD2A 4F71A 3KZXA 2HW3A 3FM9A 3BQ1A 1YT3A 5EE0A 2F1HA 3K1ZA 1OXJA 4NL9A 4I2IA 1NZPA 1X9WA 4OJPA 4PHDA 3WK8A 5CB1A 1ZQVA 4M47A 9ICHA 2IOHA 4YMNA 5KFCA 3MDAA 2VJ4A 4CNQA 4DSJA 5HMLA 5J2IA 3RR8A 3AMZA 3G6VA 5HHHA 3J81j 1NK0A 1L5UA 1MA7A 2G5IB 4KLIA 5HMMA 4G9BA 2KFZA 3ZDDA 4PHAA 5IIKA 4DQPA 4NXZA 4Q8FA 7ICFA 1K5OA 2RRDA 2W8KA 4I2CA 3K1RB 5IILA 4FZLA 2ZJ5A 1GO3F 3M6KA 2FLLA 4IQUA 3PO5A 2I1QA 4R65A 5L1JA 5ALLA 1A0PA 1S0NA 3JPOA 2KZMA 1Y88A 4QIWC 2YMQA 4CF4A 4KLSA 2P6RA 2G06A 5KT7A 5KG6A 3C21A 3QX7A 2E5SA 2EZXA 1NKBA 1L6NA 3PV8A 2KG5A 4BGDA 3SAHA 8ICMA 1DGJA 4UAUA 4HYKA 4F2SA 8ICEA 2ZJ8A 4DSIA 5KFJA 5AM4A 3VC8A 5DGBA 1X6JA 2JV3A 3WK6A 1XSPA 2DBYA 3CRXA 2EANA 1ZJMA 3QEBZ 5KFFA 3OHBA 3OJUA 2AGOA 2Y0SF 2ASDA 4C8LA 2KVSA 2W9BA 1ZOLA 3B9JA 2C22A 3A0HU 5AM0A 4OJLA 5IIIA 1VLBA 1YZ7A 3TACB 1QH9A 1TAUA 1SXDA 3T5JA 2FMPA 2NRZA 3CP8A 4B9UA 3RJEA 4LVSA 8ICUA 5KFOA 3ETLA 1QTMA 1D8LA 2YX8A 1QQ6A 4OCZA 3BJYA 5L1MA 2V4RA 2QARB 3IHQB 3UMCA 1ZQTA 5ALQA 1ZQKA 4EBCA 3NTUA 4OD0A 5ALWA 3RBEA 1NK5A 3Q8SB 1SWWA 1RQNA 3RRGA 1L8LA 3OJSA 1J2NA 3Q8RB 3PW7A 5KFPA 1UPHA 5KFXA 1U48A 7ICMA 2LKYA 3RJFA 4KLTA 2KE7A 1SV0A 3U26A 2BZFA 3D2SA 5JRTA 1KSPA 4ICAA 1TFRA 5CJ7A 2QB1A 4ELTA 4MEYA 2Y9TA 4UB8U 4WJ3B 5KG2A 1Z4NA 5ALFA 2KICA 2HHUA 3NRZA 3RFAA 2G07A 3HT3A 5DG8A 1SKRA 1MQ3A 4F4KA 5F3XB 4B9NA 4RPXA 1RPLA 3T3FA 5EE3A 4YFKA 3UXPA 2KMDA 4UB3A 1X9XA 2BCVA 2F8KA 1ZQEA 9ICPA 4RQNA 3C2LA 2FLPA 9ICAA 1WCNA 5AIBA 2LI6A 4J9OA 2G09A 2BKEA 4I2GA 3DEEA 4DS5A 4RT3A 4AYBF 5KFQA 2C2DA 2JEJA 4J9KA 2W8LA 3AN1A 3C1YA 4FE3A 3NASA 2KFNA 1FEZA 4JWNA 1A77A 1ECWA 1Q3UA 2DKXA 4IR9A 4I2AA 3V7LA 3C2KA 2HMXA 4ELUA 4DCCA 2VA8A 2F44A 1KN5A 1Z00B 1J2MA 2HOQA 2KSOA 4QWAA 4IL6U 5KFTA 2LPEA 4Y2VA 4YN4A 4DL4A 4NY8A 3D2NA 1QSYA 1QQ7A 1ZQFA 4RT2A 2A1AA 3O0FA 3LWMA 4J9MA 1U9LA 4DSLA 3GDXA 1AQ6A 2JH7A 2N1RA 4M0AA 3L3FX 1NK9A 5AI4A 4P0QB 2K60A 2KJ8A 4P2HA 3GQCA 1QLNA 9ICGA 3MGHA 3FYHA 4OJ6A 2LBOA 5KFZA 1TVAA 3ISDA 2Y0SC 4ED8A 3BQTA 2MA1A 2XICA 4QZHA 2P6UA 3FC4A 4QZFA 2BDPA 5J0TA 2M9NA 8ICFA 2F76X 4I2BA 4UBCA 3RB6A 1KFSA 4R8UA 4B6JA 1Q46A 1MC8A 3Q8MA 2K8BB 1OW5A 4M9LA 5ALGA 5ALSA 2R8HA 3UXNA 3OHAA 5KFYA 8ICBA 3H8JA 4UB5A 2ALZA 4P0QA 9ICEA 2LHTA 4BWJA 2GOLA 8ICAA 4KLFA 1DRGA 4UB2A 1KTQA 4KITB 1ZD3A 5FP0A 1T94A 2BPCA 3WKDA 1A6SA 3ZDBA 1IIPA 3RJHA 2RQ5A 2F3NA 2FLNA 1SL2A 2VIXA 2QB0A 4MHVA 4MFAA 4O5KA 3SYZA 4F72A 4DFJA 1PVPA 5AM5A 4YMOA 1HUOA 1SGGA 2QKQA 3KD3A 3AL0B 2ODGA 2ZJAA 2W43A 3HILA 3RF9A 2RDIA 2ZTEA 4LJXA 4DF4A 4ED6A 4EZ6A 4C8NA 4F8RA 4KMUA 2YB4A 4KLMA 3PZPA 5CRXA 4F50A 4P0PA 4QWCA 4K4HA 5J0RA 3EPIA 2BGWA 3ZDCA 1ZQXA 3KOOA 4DF8A 4I2DA 7ICQA 5AHXA 5KG4A 4YD1A 2CXYA 4Y2XA 2GO7A 3G6YA 5AK6A 2FPLA 3IV6A 1ZXIA 3AQFA 2FDRA 3MFIA 1RZTA 1T7PA 2EDUA 2H5XA 2ZIUA 3I1YA 3BQ2A 5KL8B 1S0OA 2YY6A 3V6JA 3T79A 3FDSA 2H3FA 3T5KA 4O3NA 2E8PA 3ZD9A 3LVWA 4MF2A 2W9MA 2NV3A 3E0FA 5AKXA 5KFSA 5C0YA 4UQGA 3OSPA 1X66A 1SIJA 2NRXA 1ED1A 1JUDA 5AI0A 5J2HA 1URJA 2Q0ZX 2E8OA 1N60A 1NI3A 2HSZA 3M9MB 1NK7A 3MABA 2DL0A 8ICNA 5AICA 3RH6A 1SV0C 4ED0A 1BPZA 3F5EA 5J2DA 2MU2A 1L3SA 2BHNA 4GXKA 2OYYA 3SAFA 3AUOA 5HR7A 3HX0A 4Y2PA 5J2KA 1SKSA 1SB3C 2E3TA 4DS4A 1L3TA 1BPXA 2DWQA 4DLGA 2WF8A 4M9JA 7ICSA 1NJZA 1TAMA 1ZQSA 4KLDA 1CEZA 3QNMA 5J2AA 4F5RA 3SV3A 1KLNA 3BDPA 5DG7A 2LM1A 5ALRA 5J0SA 2EZYA 3K75D 4M9HA 1JXEA 3MR6A 7ICIA 2G5HB 1ZRNA 1PK1A 4NJ8A 3MR5A 5ALIA 2HOFA 4RQ3A 3GIMA 2JGAA 2K8CB 1FIQA 4RQMA 5T14A 4TUQA 1M6YA 4F91B 1TK5A 1HJPA 5E79U 3SAGA 1S8OA 1VJ5A 4LZDA 5ALUA 4CCHA 2OCEA 2HHXA 1N62A 2E1FA 3JPPA 8ICWA 1O08A 4RQ4A 3RAQA 2VJ5A 3RAXA 2AH5A 1ZQQA 4KX3A 3M1YA 2PMZF 3I28A 4YXJA 1NJXA 2A1JA 3IG5A 4UATA 4CE6A 5J8YC 4KN7A 1NK8A 3GIIA 7ICUA 1NNLA 3QUCA 5B5EU 1ZQAA 4EYIB 4ED2A 2ISOA 2WAQF 4C8OA 3QUTA 3TADC 3ONNA 3TAQA 9ICXA 1TK8A 1ZD4A 1ZQZA 4DFKA 2PMZC 1T4GA 3KTQA 1PZNA 2XGPA 2CN1A 2KEYA 2VANA 1Q8KA 2WB1C 2AQ4A 4DSFA 5IIOA 1J97A 1NJWA 1A76A 3KHLA 3PR5B 2H3VA 4R66A 5EE1A 4Z6FA 5ALKA 2IHMA 3ALRA 1BPDA 4AP9A 3F2DA 4OJOA 4B9TA 4ECYA 2AXTU 3KZIU 2VA3A 5DG9A 5AKEA 5KFEA 4Z6DA 5A0LA 4IQWA 2HDOA 5ALEA 2YTUA 5J0UA 3NS1A 5KFDA 1S76D 4EYHB 4FS1A 4RU9A 2ZXIA 4QZ8A 2H3QA 2DKZA 4QIWF 9ICLA 3HPOA 4ZH4A 5CWRA 5KFKA 2ZIWA 1ZQMA 3V6KA 1F44A 1DOQA 1V97A 4NLGA 2K4HA 3PX0A 3V7KA 2UVVA 3C28A 4NWIA 4DL3A 3KKAA 4PGXA 5KTQA 1ZD2P 2W04A 1UA1A 5J0YA 1BNOA 4C4TA 1FFVA 2XCPA 2AU0A 1XSLA 2ZIXA 1S9FA 1K1QA 5ALTA 1SKWA 1SXEA 5DQHA 2OEHA 1IV8A 2BCRA 1WWUA 5L1KA 4GXJA 1Z4OA 4RNMA 3BS5A 2KN7A 5DDMA 1NKCA 3GIKA 2R8GA 7ICRA 3H40A 4J9SA 3TADA 4CRXA 2KJ9A 3PX4A 3WK4A 3N28A 4O3RA 5IIJA 3ZD8A 4O3QA 3MDCA 3RTVA 4DL5A 7ICVA 5ALXA 3QXGA 4Y2YA 2R8JA 4FBTA 2B6GA 3E2EA 1ZQUA 5KFUA 4F5NA 4BXOB 2BQUA 1KW4A 1OUQA 3CW2C 4TURA 2KKVA 3C29A 1V85A 2AGPA 5HHIA 5L9XA 4F4WA 4CF5A 5KT6A 4U6PA 4Y2RA 2ISPA 3DDHA 5CEHA 3N7RC 4QW9A 1XU4A 2VKQA 9ICIA 4DFDA 5HP4A 2DF4B 3H4DA 4RNNA 3H0RB 9ICUA 1RYUA 4KLUA 1S0VA 1XS9D 5ALMA 2ESEA 1ZQLA 3ISBA 1ZQIA 4KLEA 3B0YA 5AM2A 3RBDA 4KLQA 1BPEA 4LZGA 3UM9A 4Q44A 3WKCA 5ALPA 4UB1A 4RQ6A 5KFIA 4PH5A 1B0XA 5KFGA 2FI1A 4P4MA 4XQ8A 4PL1A 3PO4A 4IS7A 4EELA 1WG8A 1D8YA 1SZHA 3TARA 1L8OA 2WF6A 5AKLA 3WU2U 2O6KA 2ES6A 5HR6A 1RM6C 2AHOB 4FBUA 1HEKA 5KAFU 2QLTA 2J6TA 4IQVA 2R18A 4RQ1A 4IRDA 8ICIA 2C2EA 5DKWA 4JV2A 2HBMA 5TZVA 1U47A 4ECSA 1BNPA 5J0WA 4RQ2A 1S5LU 4RZRA 2Y9UA 3IP4B 3MFHA 4BX9C 8ICXA 1ZYQA 1UA0A 2JEGA 2BPGA 1HUZA 3T5HA 8ICGA 3SENA 3KHHA 1WWVA 2KSOB 3SEIA 3JPNA 4G3IA 2PFPA 5J2GA 3PX6A 5ALNA 3HKZF 2MUTA 4EBDA 5AM3A 8ICYA 1T8EA 4F5PA 4QZEA 4EX6A 3C2MA 3MGIA 3V72A 2W54A 3VCBA 8ICQA 4QW8A 1DK2A 1XO0A 2NO5A 2AJQA 3PSIA 5KT5A 4KLJA 1JIHA 2KZZA 5JTIA 3Q8LA 1F0MA 1IM4A 3GV8B 4RNOA 4CDGA 1TAQA 4QNLA 4OO1J 1ZQYA 5GTHU 2KP7A 5BOMA 5EWEA 4YR2A 3V7JA 4GC6A 4EX7A 3F2CA 4MFFA 2PXIA 4O3SA 5DBCA 4EEKA 2ZUBA 3WKAA 2OXOA 3CNHA 8ICHA 2OWOA 4UB4A 5KFWA 9ICNA 2DGZA 3PW4A 1UHUA 2LM4A 1KBUA 1RQLA 5KG1A 5K4LA 2ZIWB 3QUBA 1S77D 5AKGA 3WKBA 2W11A 4DOAA 3PSTA 1U4BA 2YMMA 1L3UA 1TK0A 2KZ3A 4US8A 3T5LA 7ICLA
chains in the Genus database with same CATH topology
2E8NA 1PK1A 1WWVA 4NJ8A 2KSOB 3SEIA 5F3XB 1KW4A 4RQMA 2FE9A 1V85A 2KMDA 3IDWA 1X9XA 2YTUA 3H8MA 3KKAC 3BS7A 1LKYB 2F8KA 4RQNA 5KNIA 2D3DA 1OW5A 2KG5A 1LKYA 4PZOA 1Z1VA 1JI7A 2DKZA 2E8MA 2JV3A 5JTIA 1F0MA 2QB0B 2EANA 2L5YA 2EAPA 2ESEA 1PK3A 2E8PA 1UCVA 2DKXA 1V38A 3TACB 5J8YC 1SXDA 3KKAA 1X66A 1OXJA 4NL9A 2F44A 2LMRA 1B0XA 2KSOA 2E8OA 2F3NA 5L1MA 2LPEA 2GLEA 2QARB 4IS7A 2DL0A 5J8YA 2QB0A 1SXEA 1SV0C 3BS5B 3TADC 4MHVA 1SV4A 1WWUA 2ES6A 4PZNA 3BS5A 1SGGA 1B4FA 3BQ7A 2QKQA 1RG6A 1COKA 1X40A 2QARA 3HILA 1SV0A 2K60A 2KE7A 3TADA 2K4PA 4NL9C 1PK1B 2Y9UA 2D8CA 5JRTA 2EAMA 3K1RB 2QB1A 1DXSA 2Y9TA 2EAOA 1UQVA 2KIVA 2B6GA 5JU5A 3SENA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8N A;  1PK1 A;  1WWV A;  4NJ8 A;  2KSO B;  3SEI A;  5F3X B;  1KW4 A;  4RQM A;  2FE9 A;  1V85 A;  2KMD A;  3IDW A;  1X9X A;  2YTU A;  3H8M A;  3KKA C;  3BS7 A;  1LKY B;  2F8K A;  4RQN A;  5KNI A;  2D3D A;  1OW5 A;  2KG5 A;  1LKY A;  4PZO A;  1Z1V A;  1JI7 A;  2DKZ A;  2E8M A;  2JV3 A;  5JTI A;  1F0M A;  2QB0 B;  2EAN A;  2L5Y A;  2EAP A;  2ESE A;  1PK3 A;  2E8P A;  1UCV A;  2DKX A;  1V38 A;  3TAC B;  5J8Y C;  1SXD A;  3KKA A;  1X66 A;  1OXJ A;  4NL9 A;  2F44 A;  2LMR A;  1B0X A;  2KSO A;  2E8O A;  2F3N A;  5L1M A;  2LPE A;  2GLE A;  2QAR B;  4IS7 A;  2DL0 A;  5J8Y A;  2QB0 A;  1SXE A;  1SV0 C;  3BS5 B;  3TAD C;  4MHV A;  1SV4 A;  1WWU A;  2ES6 A;  4PZN A;  3BS5 A;  1SGG A;  1B4F A;  3BQ7 A;  2QKQ A;  1RG6 A;  1COK A;  1X40 A;  2QAR A;  3HIL A;  1SV0 A;  2K60 A;  2KE7 A;  3TAD A;  2K4P A;  4NL9 C;  1PK1 B;  2Y9U A;  2D8C A;  5JRT A;  2EAM A;  3K1R B;  2QB1 A;  1DXS A;  2Y9T A;  2EAO A;  1UQV A;  2KIV A;  2B6G A;  5JU5 A;  3SEN A; 
#chains in the Genus database with same CATH topology
 2FMS A;  4JB3 A;  4Q8E A;  1JRO A;  4DQR A;  4YQW A;  3TQ1 A;  9ICJ A;  3RH4 A;  3BS7 A;  4ED3 A;  2W3R A;  4DEZ A;  2LYA A;  4YMM A;  2HHV A;  4F93 B;  2ZTC A;  4YR0 A;  3EWA A;  5L1I A;  3UQ0 A;  2D3D A;  3RB4 A;  5J29 A;  1X6I A;  4O5E A;  8ICT A;  5CHG A;  2OHF A;  3KBB A;  4GC7 A;  8ICK A;  5D46 A;  3RR7 A;  4M2Y A;  2EH9 A;  1TKD A;  2KTQ A;  4YVZ A;  1KKX A;  1ARO P;  2VA2 A;  2PI5 A;  1L7N A;  8ICV A;  1QSS A;  1B22 A;  2UVW A;  3HJE A;  3F53 A;  1ZRM A;  5KFN A;  4ECX A;  3RJK A;  1FO4 A;  2ZUC A;  1KFT A;  9ICF A;  4QZG A;  2DFL A;  2XGQ A;  5DB7 A;  4KLG A;  1WCL A;  3Q8K A;  9ICW A;  4M9N A;  7ICO A;  2G0A A;  4RUC A;  1WYG A;  4BUG A;  4C0Z A;  1BPB A;  3H7I A;  3SQI A;  2PI4 A;  2JMG A;  1N63 A;  3GZF A;  1TV9 A;  1ZQP A;  7ICH A;  2PKE A;  1NK6 A;  2WF9 A;  3LDA A;  2K8A A;  1V9P A;  3AEV A;  1RDF A;  4Z6E A;  2W03 A;  2KD1 A;  4PHP A;  5J0O A;  2K4P A;  3THV A;  1LB2 B;  2EAM A;  1X42 A;  1PUZ A;  3QU5 A;  4ED1 A;  3BZK A;  4I27 A;  3N97 B;  3M8R A;  1PVQ A;  2KKP A;  3TAN A;  4JUZ A;  3EUB 2;  2G08 A;  5ALZ A;  2XY6 A;  4NLZ A;  1L3V A;  2ZXH A;  3GU3 A;  1ZQB A;  2XO7 A;  4X5V A;  3BZC A;  2HVH A;  3NGD A;  4JK1 A;  2YML A;  7ICG A;  3RB3 A;  1JI7 A;  1Z1V A;  3HP6 A;  2XY7 A;  2A1J B;  2XID A;  2JEF A;  2L5Y A;  5AI8 A;  2EAP A;  2KK0 A;  3IG8 A;  7ICJ A;  4TUP A;  2HVI A;  3RJJ A;  1PK3 A;  3N7P D;  5CP2 A;  4QZB A;  2KIW A;  1X2I A;  4XA5 A;  5KG3 A;  5KG5 A;  5KG7 A;  3V6H A;  2NRT A;  5J0Q A;  4Y2Q A;  3JPQ A;  3PR4 A;  4R8U B;  3TI0 A;  4F4Y A;  2WF5 A;  1SL0 A;  1S97 A;  1NJY A;  4CGZ A;  2YN4 A;  2A19 A;  3QZ8 A;  4I28 A;  9ICO A;  2JR5 A;  3SMV A;  4RQ7 A;  4US9 A;  4P0P B;  2NRV A;  2K4I A;  1Z1B A;  4QWB A;  1KFD A;  4MF8 A;  2YQE A;  1D9F A;  3H4B A;  4I2E A;  2RP5 A;  2HBL A;  1P7D A;  1D9D A;  2KV2 A;  1X40 A;  2OH2 A;  1RXV A;  3ZI4 A;  2V9W A;  5KFV A;  4ECZ A;  1XSN A;  1X9M A;  3NVW A;  1BPY A;  2JHD A;  3QU2 A;  5DQG A;  4TQS A;  5KL1 B;  2ZIX B;  3C5F A;  3MGV A;  4UAW A;  5AM1 A;  1JX4 A;  2IOF K;  5DLG A;  2ZIU B;  3HRD D;  1N5W A;  4JV1 A;  3G6X A;  5JU5 A;  4BJQ A;  4JV0 A;  2Q4T A;  4NLN A;  4F4X A;  2BPF A;  4M04 A;  3LYS A;  1KRP A;  2UVR A;  2XCA A;  4O3M A;  2MAX A;  5DBB A;  1VDV A;  5ALY A;  1JN3 A;  3PW0 A;  5AK4 A;  4HAI A;  1XNS A;  3UPQ A;  3UMB A;  2YB1 A;  3TFR A;  4ECQ A;  3OTQ A;  3H0L B;  5ALV A;  3PW2 A;  2BCU A;  3E58 A;  5DLF A;  5AKK A;  5ALH A;  3ISC A;  2CPR A;  9ICV A;  3KFU F;  4KX5 A;  2AGQ A;  2Y1J A;  4F5Q A;  2I5H A;  3LK9 A;  7ICE A;  4DO9 A;  4DOC A;  3PW5 A;  2IA6 A;  1IXR A;  1SZP A;  3D2Q A;  3PML A;  3GIL A;  2B21 A;  4Y2T A;  3MBY A;  2ASL A;  1JAL A;  5KG0 A;  3QE9 Y;  2R8K A;  2FMQ A;  2JH1 A;  5DDY A;  2LMR A;  4JWM A;  2ZG6 A;  2WFA A;  4P4O A;  4XRH A;  1KQQ A;  2KHV A;  3H0M B;  1FFU A;  2GLE A;  1UT5 A;  3CYM A;  2D6F C;  4ECR A;  3ORY A;  3NUQ A;  2KNJ A;  4ECV A;  2KHQ A;  2UVU A;  4QZ9 A;  4GLX A;  3PNC A;  1RYS A;  5J0P A;  3IRU A;  1MSW D;  1RG6 A;  2LYB A;  3AQE A;  2ZIV B;  3N4M B;  4UW9 A;  1Z00 A;  7ICP A;  1C20 A;  3MR3 A;  2D8C A;  3JPT A;  2JRZ A;  1RXW A;  4DQI A;  1ZQ1 C;  8ICL A;  1JRP A;  1DXS A;  2YMP A;  2HHS A;  1K1S A;  1ZQC A;  4UAY A;  4EBE A;  4J9P A;  4O0I A;  9ICS A;  4E0D A;  5DQI A;  3ZDA A;  2DPJ A;  4Y2U A;  5C5J A;  3ZDE A;  1ZQW A;  3L5K A;  3ICX A;  9ICK A;  4J9R A;  4PGQ A;  1Z19 A;  2W55 A;  4ELV A;  4EEN A;  2GWS A;  1KEJ A;  5ALO A;  4YP3 A;  8ICP A;  2WF7 A;  2EZZ A;  4UAS A;  1T3N A;  4NV0 A;  3GV7 B;  4DL6 A;  2F77 X;  4NLK A;  3A0B U;  4FZN A;  4Q45 A;  4B9M A;  1N61 A;  5D49 A;  4RPY A;  2FPM A;  4JMU A;  4DL7 A;  1V38 A;  2MUT B;  1L7M A;  4UB6 U;  3UMG A;  2FPK A;  3RJG A;  1BGX T;  1F5S A;  4USA A;  1KDH A;  5G5G A;  1D8B A;  4AYB C;  4I2F A;  1UT8 A;  9ICM A;  5AKI A;  5J8Y A;  3LVV A;  9ICC A;  5DB9 A;  3PSP A;  4M9G A;  1SV4 A;  5J2E A;  2WHE A;  2BDU A;  3M9N B;  2XY5 A;  3RB0 A;  2DPI A;  1YZ6 A;  3QEA Z;  2BQ3 A;  2F1I A;  3PVX A;  4P4P A;  4J03 A;  3FAH A;  4B9V A;  5F9N A;  3AU6 A;  2R8I A;  1PVR A;  8ICJ A;  3Q8Q B;  4FS2 A;  3QU7 A;  7ICK A;  1CI4 A;  1QCK A;  1ZD5 A;  5HNK A;  5BOL A;  4BDP A;  4PGY A;  3BQ0 A;  3EZ5 A;  4ACO A;  2KIV A;  4DWI A;  4PPX A;  5J2F A;  3JPR A;  4TQR A;  4YR3 A;  3KHG A;  2DQN B;  4XUS A;  2HHW A;  4GXI A;  2E1E A;  1U45 A;  3PSF A;  3H8M A;  1QSL A;  1LKY B;  4IRK A;  4RPZ A;  4J9L A;  1COO A;  8ICC A;  4NLC A;  1TE2 A;  4C7Z A;  2RHF A;  1C7Y A;  4KMO B;  3LWL A;  4B9L A;  2HI0 A;  2FJ6 A;  1CUK A;  4R63 A;  4I29 A;  3QZ7 A;  1JMS A;  3M7D A;  8ICO A;  4ECW A;  2W9A A;  4GIB A;  4C80 A;  4UAZ A;  3WK9 A;  3MR2 A;  4UAR A;  4CF3 A;  5KFH A;  2IHN A;  4QZI A;  2OM6 A;  4PHE A;  8ICR A;  3SD7 A;  3EW9 A;  4BXO A;  4ECU A;  2W9C A;  5IIN A;  5KAI U;  7ICN A;  1WUD A;  2A3V A;  4J9Q A;  4BWM A;  4RQ0 A;  4I2J A;  3PY8 A;  3GIJ A;  2GH1 A;  4PJ0 U;  1H38 A;  4FFD A;  2J6U A;  5J0X A;  4DSE A;  4Y2S A;  3SZ2 A;  3OSN A;  3IN5 A;  1N5X A;  3NVY A;  4QZC A;  2JXJ A;  4KLO A;  3BQ7 A;  2DUY A;  4ECT A;  1XO1 A;  3OPX A;  1EXN A;  1SWV A;  3HKZ C;  2AQ0 A;  4RQ8 A;  1LV5 A;  4ED7 A;  1BVS A;  5TIS U;  3Q8P B;  2XC9 A;  4FO6 A;  5AKZ A;  5AK3 A;  1ZET A;  4NM2 A;  4IRC A;  3SV4 A;  5KFM A;  3HWT A;  3TFS A;  1UQV A;  1SL1 A;  4KN4 A;  1Q3V A;  4O3P A;  1LVH A;  2M0N A;  1DGS A;  1KL9 A;  3N7S C;  5AKH A;  9ICR A;  2NYV A;  4KTQ A;  2RLT A;  3GV5 B;  2E8N A;  3RH5 A;  2NRW A;  5KT2 A;  2WAQ C;  4DOB A;  5DB6 A;  1ZQH A;  2F2A B;  4C8K A;  3SR6 A;  4TUS A;  1Z3E B;  1JXL A;  3F2B A;  3MC1 A;  4PL2 A;  5KNI A;  3AU2 A;  4B9S A;  2C2R A;  3I76 A;  2HOI A;  1L7O A;  3OGU A;  4UBB A;  2V4Q A;  2JEI A;  7ICT A;  1X9S A;  2QB0 B;  3KHR A;  1N48 A;  5EOZ A;  3TAP A;  1S10 A;  4QZD A;  3R9K A;  4F92 B;  1UCV A;  3WKE A;  2MRL A;  5B66 U;  3HW8 A;  5BPC A;  5J2J A;  2H3Z A;  4DLE A;  2HHT A;  1HIW A;  5DGA A;  4A8E A;  1N56 A;  2ZTD A;  1L7P A;  2KOB A;  2Y1I A;  2K89 A;  3B0X A;  5AI5 A;  4DQQ A;  4R64 A;  1NZB A;  1ZQN A;  1MN8 A;  2W7O A;  4RUA A;  3GFK B;  5KFB A;  2LYH A;  2IMW P;  5GTI U;  4U7C A;  5D4B A;  2W7P A;  4OJ5 A;  1COK A;  4RQ5 A;  3QUQ A;  1NK4 A;  5J2C A;  4YG2 A;  2K4E A;  4ZOH C;  3JPS A;  1PK1 B;  3QU4 A;  1ZQR A;  2WTF A;  5KT4 A;  2W3S A;  2W9B B;  3QU9 A;  5KFL A;  4C4R A;  1NKE A;  2NO4 A;  3IM1 A;  4NLB A;  3L4P A;  2RDJ A;  1O03 A;  1XWL A;  3QYP A;  4DFP A;  4F3O A;  1B43 A;  3H8W A;  4Y2J A;  4KLH A;  2BR0 A;  5AKJ A;  5EWF A;  4J9N A;  3S6J A;  1ZQG A;  2FE9 A;  5DBA A;  3KKA C;  4KLL A;  4NM1 A;  4C7Y A;  4YXM A;  3NRW A;  3C1Z A;  3WK5 A;  5AI6 A;  1S0M A;  5EE9 A;  1MQ2 A;  2ZIV A;  3WK7 A;  4O3O A;  3ETR A;  1ZJN A;  1XC9 A;  4IR1 A;  2ZUD A;  4M6W B;  2I9G A;  5AIA A;  2KJ5 A;  5DB8 A;  5AKY A;  8ICZ A;  4C8M A;  2KVC A;  1CRX A;  3C5G A;  4F5O A;  4K4I A;  4MEX A;  2ASJ A;  2MSN A;  1T3Q A;  2IBK A;  3H8S A;  2HBK A;  4F2R A;  9ICQ A;  5ALD A;  2B0C A;  1DK3 A;  2BQR A;  5F9L A;  5KFR A;  9ICT A;  5AI9 A;  2CRX A;  2C28 A;  4M6W A;  3BS5 B;  5CA7 A;  4GFJ A;  3DV9 A;  1RYR A;  2PFO A;  3UXO A;  4F4Z A;  5ALJ A;  2IOF A;  1ZQJ A;  4K4G A;  4PZN A;  1ZQD A;  1B4F A;  2P66 A;  2BCQ A;  2QAR A;  4I2H A;  4O9M A;  2EQY A;  5KT3 A;  4Z6C A;  4MFC A;  3D6J A;  4DQS A;  4IC9 A;  4C4S A;  4O5C A;  4QWD A;  2ATL A;  4NL9 C;  5H2F U;  2JZB B;  5CR0 A;  2JZB A;  4QWE A;  2P35 A;  1N2X A;  1NOM A;  4QZA A;  9ICB A;  2EAO A;  2BCS A;  3ED5 A;  3UQ2 A;  3TKA A;  3PMN A;  3RRH A;  4DSK A;  3EPG A;  3EYZ A;  4DFM A;  2XVT A;  8ICS A;  5L1L A;  4QJF B;  3F5A A;  2F8L A;  3K4G A;  1QQ5 A;  2HCF A;  2WB1 F;  4EEY A;  2Z7J A;  3IDW A;  4IQT A;  5KFA A;  2PFN A;  5J2B A;  1ZQO A;  3NVZ A;  4DL2 A;  4FZM A;  5AK5 A;  1LKY A;  3M8S A;  5IIM A;  4PZO A;  5G5H A;  2HHQ A;  2J6S A;  2XI9 A;  5JUM A;  3RJI A;  3M9O B;  4YCX A;  3M6Z A;  1U49 A;  3NVV A;  2E8M A;  4EZ9 A;  2PFQ A;  4Q43 A;  2W9C B;  2F1J A;  2HBJ A;  3AM9 A;  2H3I A;  1IG6 A;  4UAV A;  3SI8 A;  2I6X A;  3C23 A;  5EWG A;  4YD2 A;  4F71 A;  3KZX A;  2HW3 A;  3FM9 A;  3BQ1 A;  1YT3 A;  5EE0 A;  2F1H A;  3K1Z A;  1OXJ A;  4NL9 A;  4I2I A;  1NZP A;  1X9W A;  4OJP A;  4PHD A;  3WK8 A;  5CB1 A;  1ZQV A;  4M47 A;  9ICH A;  2IOH A;  4YMN A;  5KFC A;  3MDA A;  2VJ4 A;  4CNQ A;  4DSJ A;  5HML A;  5J2I A;  3RR8 A;  3AMZ A;  3G6V A;  5HHH A;  3J81 j;  1NK0 A;  1L5U A;  1MA7 A;  2G5I B;  4KLI A;  5HMM A;  4G9B A;  2KFZ A;  3ZDD A;  4PHA A;  5IIK A;  4DQP A;  4NXZ A;  4Q8F A;  7ICF A;  1K5O A;  2RRD A;  2W8K A;  4I2C A;  3K1R B;  5IIL A;  4FZL A;  2ZJ5 A;  1GO3 F;  3M6K A;  2FLL A;  4IQU A;  3PO5 A;  2I1Q A;  4R65 A;  5L1J A;  5ALL A;  1A0P A;  1S0N A;  3JPO A;  2KZM A;  1Y88 A;  4QIW C;  2YMQ A;  4CF4 A;  4KLS A;  2P6R A;  2G06 A;  5KT7 A;  5KG6 A;  3C21 A;  3QX7 A;  2E5S A;  2EZX A;  1NKB A;  1L6N A;  3PV8 A;  2KG5 A;  4BGD A;  3SAH A;  8ICM A;  1DGJ A;  4UAU A;  4HYK A;  4F2S A;  8ICE A;  2ZJ8 A;  4DSI A;  5KFJ A;  5AM4 A;  3VC8 A;  5DGB A;  1X6J A;  2JV3 A;  3WK6 A;  1XSP A;  2DBY A;  3CRX A;  2EAN A;  1ZJM A;  3QEB Z;  5KFF A;  3OHB A;  3OJU A;  2AGO A;  2Y0S F;  2ASD A;  4C8L A;  2KVS A;  2W9B A;  1ZOL A;  3B9J A;  2C22 A;  3A0H U;  5AM0 A;  4OJL A;  5III A;  1VLB A;  1YZ7 A;  3TAC B;  1QH9 A;  1TAU A;  1SXD A;  3T5J A;  2FMP A;  2NRZ A;  3CP8 A;  4B9U A;  3RJE A;  4LVS A;  8ICU A;  5KFO A;  3ETL A;  1QTM A;  1D8L A;  2YX8 A;  1QQ6 A;  4OCZ A;  3BJY A;  5L1M A;  2V4R A;  2QAR B;  3IHQ B;  3UMC A;  1ZQT A;  5ALQ A;  1ZQK A;  4EBC A;  3NTU A;  4OD0 A;  5ALW A;  3RBE A;  1NK5 A;  3Q8S B;  1SWW A;  1RQN A;  3RRG A;  1L8L A;  3OJS A;  1J2N A;  3Q8R B;  3PW7 A;  5KFP A;  1UPH A;  5KFX A;  1U48 A;  7ICM A;  2LKY A;  3RJF A;  4KLT A;  2KE7 A;  1SV0 A;  3U26 A;  2BZF A;  3D2S A;  5JRT A;  1KSP A;  4ICA A;  1TFR A;  5CJ7 A;  2QB1 A;  4ELT A;  4MEY A;  2Y9T A;  4UB8 U;  4WJ3 B;  5KG2 A;  1Z4N A;  5ALF A;  2KIC A;  2HHU A;  3NRZ A;  3RFA A;  2G07 A;  3HT3 A;  5DG8 A;  1SKR A;  1MQ3 A;  4F4K A;  5F3X B;  4B9N A;  4RPX A;  1RPL A;  3T3F A;  5EE3 A;  4YFK A;  3UXP A;  2KMD A;  4UB3 A;  1X9X A;  2BCV A;  2F8K A;  1ZQE A;  9ICP A;  4RQN A;  3C2L A;  2FLP A;  9ICA A;  1WCN A;  5AIB A;  2LI6 A;  4J9O A;  2G09 A;  2BKE A;  4I2G A;  3DEE A;  4DS5 A;  4RT3 A;  4AYB F;  5KFQ A;  2C2D A;  2JEJ A;  4J9K A;  2W8L A;  3AN1 A;  3C1Y A;  4FE3 A;  3NAS A;  2KFN A;  1FEZ A;  4JWN A;  1A77 A;  1ECW A;  1Q3U A;  2DKX A;  4IR9 A;  4I2A A;  3V7L A;  3C2K A;  2HMX A;  4ELU A;  4DCC A;  2VA8 A;  2F44 A;  1KN5 A;  1Z00 B;  1J2M A;  2HOQ A;  2KSO A;  4QWA A;  4IL6 U;  5KFT A;  2LPE A;  4Y2V A;  4YN4 A;  4DL4 A;  4NY8 A;  3D2N A;  1QSY A;  1QQ7 A;  1ZQF A;  4RT2 A;  2A1A A;  3O0F A;  3LWM A;  4J9M A;  1U9L A;  4DSL A;  3GDX A;  1AQ6 A;  2JH7 A;  2N1R A;  4M0A A;  3L3F X;  1NK9 A;  5AI4 A;  4P0Q B;  2K60 A;  2KJ8 A;  4P2H A;  3GQC A;  1QLN A;  9ICG A;  3MGH A;  3FYH A;  4OJ6 A;  2LBO A;  5KFZ A;  1TVA A;  3ISD A;  2Y0S C;  4ED8 A;  3BQT A;  2MA1 A;  2XIC A;  4QZH A;  2P6U A;  3FC4 A;  4QZF A;  2BDP A;  5J0T A;  2M9N A;  8ICF A;  2F76 X;  4I2B A;  4UBC A;  3RB6 A;  1KFS A;  4R8U A;  4B6J A;  1Q46 A;  1MC8 A;  3Q8M A;  2K8B B;  1OW5 A;  4M9L A;  5ALG A;  5ALS A;  2R8H A;  3UXN A;  3OHA A;  5KFY A;  8ICB A;  3H8J A;  4UB5 A;  2ALZ A;  4P0Q A;  9ICE A;  2LHT A;  4BWJ A;  2GOL A;  8ICA A;  4KLF A;  1DRG A;  4UB2 A;  1KTQ A;  4KIT B;  1ZD3 A;  5FP0 A;  1T94 A;  2BPC A;  3WKD A;  1A6S A;  3ZDB A;  1IIP A;  3RJH A;  2RQ5 A;  2F3N A;  2FLN A;  1SL2 A;  2VIX A;  2QB0 A;  4MHV A;  4MFA A;  4O5K A;  3SYZ A;  4F72 A;  4DFJ A;  1PVP A;  5AM5 A;  4YMO A;  1HUO A;  1SGG A;  2QKQ A;  3KD3 A;  3AL0 B;  2ODG A;  2ZJA A;  2W43 A;  3HIL A;  3RF9 A;  2RDI A;  2ZTE A;  4LJX A;  4DF4 A;  4ED6 A;  4EZ6 A;  4C8N A;  4F8R A;  4KMU A;  2YB4 A;  4KLM A;  3PZP A;  5CRX A;  4F50 A;  4P0P A;  4QWC A;  4K4H A;  5J0R A;  3EPI A;  2BGW A;  3ZDC A;  1ZQX A;  3KOO A;  4DF8 A;  4I2D A;  7ICQ A;  5AHX A;  5KG4 A;  4YD1 A;  2CXY A;  4Y2X A;  2GO7 A;  3G6Y A;  5AK6 A;  2FPL A;  3IV6 A;  1ZXI A;  3AQF A;  2FDR A;  3MFI A;  1RZT A;  1T7P A;  2EDU A;  2H5X A;  2ZIU A;  3I1Y A;  3BQ2 A;  5KL8 B;  1S0O A;  2YY6 A;  3V6J A;  3T79 A;  3FDS A;  2H3F A;  3T5K A;  4O3N A;  2E8P A;  3ZD9 A;  3LVW A;  4MF2 A;  2W9M A;  2NV3 A;  3E0F A;  5AKX A;  5KFS A;  5C0Y A;  4UQG A;  3OSP A;  1X66 A;  1SIJ A;  2NRX A;  1ED1 A;  1JUD A;  5AI0 A;  5J2H A;  1URJ A;  2Q0Z X;  2E8O A;  1N60 A;  1NI3 A;  2HSZ A;  3M9M B;  1NK7 A;  3MAB A;  2DL0 A;  8ICN A;  5AIC A;  3RH6 A;  1SV0 C;  4ED0 A;  1BPZ A;  3F5E A;  5J2D A;  2MU2 A;  1L3S A;  2BHN A;  4GXK A;  2OYY A;  3SAF A;  3AUO A;  5HR7 A;  3HX0 A;  4Y2P A;  5J2K A;  1SKS A;  1SB3 C;  2E3T A;  4DS4 A;  1L3T A;  1BPX A;  2DWQ A;  4DLG A;  2WF8 A;  4M9J A;  7ICS A;  1NJZ A;  1TAM A;  1ZQS A;  4KLD A;  1CEZ A;  3QNM A;  5J2A A;  4F5R A;  3SV3 A;  1KLN A;  3BDP A;  5DG7 A;  2LM1 A;  5ALR A;  5J0S A;  2EZY A;  3K75 D;  4M9H A;  1JXE A;  3MR6 A;  7ICI A;  2G5H B;  1ZRN A;  1PK1 A;  4NJ8 A;  3MR5 A;  5ALI A;  2HOF A;  4RQ3 A;  3GIM A;  2JGA A;  2K8C B;  1FIQ A;  4RQM A;  5T14 A;  4TUQ A;  1M6Y A;  4F91 B;  1TK5 A;  1HJP A;  5E79 U;  3SAG A;  1S8O A;  1VJ5 A;  4LZD A;  5ALU A;  4CCH A;  2OCE A;  2HHX A;  1N62 A;  2E1F A;  3JPP A;  8ICW A;  1O08 A;  4RQ4 A;  3RAQ A;  2VJ5 A;  3RAX A;  2AH5 A;  1ZQQ A;  4KX3 A;  3M1Y A;  2PMZ F;  3I28 A;  4YXJ A;  1NJX A;  2A1J A;  3IG5 A;  4UAT A;  4CE6 A;  5J8Y C;  4KN7 A;  1NK8 A;  3GII A;  7ICU A;  1NNL A;  3QUC A;  5B5E U;  1ZQA A;  4EYI B;  4ED2 A;  2ISO A;  2WAQ F;  4C8O A;  3QUT A;  3TAD C;  3ONN A;  3TAQ A;  9ICX A;  1TK8 A;  1ZD4 A;  1ZQZ A;  4DFK A;  2PMZ C;  1T4G A;  3KTQ A;  1PZN A;  2XGP A;  2CN1 A;  2KEY A;  2VAN A;  1Q8K A;  2WB1 C;  2AQ4 A;  4DSF A;  5IIO A;  1J97 A;  1NJW A;  1A76 A;  3KHL A;  3PR5 B;  2H3V A;  4R66 A;  5EE1 A;  4Z6F A;  5ALK A;  2IHM A;  3ALR A;  1BPD A;  4AP9 A;  3F2D A;  4OJO A;  4B9T A;  4ECY A;  2AXT U;  3KZI U;  2VA3 A;  5DG9 A;  5AKE A;  5KFE A;  4Z6D A;  5A0L A;  4IQW A;  2HDO A;  5ALE A;  2YTU A;  5J0U A;  3NS1 A;  5KFD A;  1S76 D;  4EYH B;  4FS1 A;  4RU9 A;  2ZXI A;  4QZ8 A;  2H3Q A;  2DKZ A;  4QIW F;  9ICL A;  3HPO A;  4ZH4 A;  5CWR A;  5KFK A;  2ZIW A;  1ZQM A;  3V6K A;  1F44 A;  1DOQ A;  1V97 A;  4NLG A;  2K4H A;  3PX0 A;  3V7K A;  2UVV A;  3C28 A;  4NWI A;  4DL3 A;  3KKA A;  4PGX A;  5KTQ A;  1ZD2 P;  2W04 A;  1UA1 A;  5J0Y A;  1BNO A;  4C4T A;  1FFV A;  2XCP A;  2AU0 A;  1XSL A;  2ZIX A;  1S9F A;  1K1Q A;  5ALT A;  1SKW A;  1SXE A;  5DQH A;  2OEH A;  1IV8 A;  2BCR A;  1WWU A;  5L1K A;  4GXJ A;  1Z4O A;  4RNM A;  3BS5 A;  2KN7 A;  5DDM A;  1NKC A;  3GIK A;  2R8G A;  7ICR A;  3H40 A;  4J9S A;  3TAD A;  4CRX A;  2KJ9 A;  3PX4 A;  3WK4 A;  3N28 A;  4O3R A;  5IIJ A;  3ZD8 A;  4O3Q A;  3MDC A;  3RTV A;  4DL5 A;  7ICV A;  5ALX A;  3QXG A;  4Y2Y A;  2R8J A;  4FBT A;  2B6G A;  3E2E A;  1ZQU A;  5KFU A;  4F5N A;  4BXO B;  2BQU A;  1KW4 A;  1OUQ A;  3CW2 C;  4TUR A;  2KKV A;  3C29 A;  1V85 A;  2AGP A;  5HHI A;  5L9X A;  4F4W A;  4CF5 A;  5KT6 A;  4U6P A;  4Y2R A;  2ISP A;  3DDH A;  5CEH A;  3N7R C;  4QW9 A;  1XU4 A;  2VKQ A;  9ICI A;  4DFD A;  5HP4 A;  2DF4 B;  3H4D A;  4RNN A;  3H0R B;  9ICU A;  1RYU A;  4KLU A;  1S0V A;  1XS9 D;  5ALM A;  2ESE A;  1ZQL A;  3ISB A;  1ZQI A;  4KLE A;  3B0Y A;  5AM2 A;  3RBD A;  4KLQ A;  1BPE A;  4LZG A;  3UM9 A;  4Q44 A;  3WKC A;  5ALP A;  4UB1 A;  4RQ6 A;  5KFI A;  4PH5 A;  1B0X A;  5KFG A;  2FI1 A;  4P4M A;  4XQ8 A;  4PL1 A;  3PO4 A;  4IS7 A;  4EEL A;  1WG8 A;  1D8Y A;  1SZH A;  3TAR A;  1L8O A;  2WF6 A;  5AKL A;  3WU2 U;  2O6K A;  2ES6 A;  5HR6 A;  1RM6 C;  2AHO B;  4FBU A;  1HEK A;  5KAF U;  2QLT A;  2J6T A;  4IQV A;  2R18 A;  4RQ1 A;  4IRD A;  8ICI A;  2C2E A;  5DKW A;  4JV2 A;  2HBM A;  5TZV A;  1U47 A;  4ECS A;  1BNP A;  5J0W A;  4RQ2 A;  1S5L U;  4RZR A;  2Y9U A;  3IP4 B;  3MFH A;  4BX9 C;  8ICX A;  1ZYQ A;  1UA0 A;  2JEG A;  2BPG A;  1HUZ A;  3T5H A;  8ICG A;  3SEN A;  3KHH A;  1WWV A;  2KSO B;  3SEI A;  3JPN A;  4G3I A;  2PFP A;  5J2G A;  3PX6 A;  5ALN A;  3HKZ F;  2MUT A;  4EBD A;  5AM3 A;  8ICY A;  1T8E A;  4F5P A;  4QZE A;  4EX6 A;  3C2M A;  3MGI A;  3V72 A;  2W54 A;  3VCB A;  8ICQ A;  4QW8 A;  1DK2 A;  1XO0 A;  2NO5 A;  2AJQ A;  3PSI A;  5KT5 A;  4KLJ A;  1JIH A;  2KZZ A;  5JTI A;  3Q8L A;  1F0M A;  1IM4 A;  3GV8 B;  4RNO A;  4CDG A;  1TAQ A;  4QNL A;  4OO1 J;  1ZQY A;  5GTH U;  2KP7 A;  5BOM A;  5EWE A;  4YR2 A;  3V7J A;  4GC6 A;  4EX7 A;  3F2C A;  4MFF A;  2PXI A;  4O3S A;  5DBC A;  4EEK A;  2ZUB A;  3WKA A;  2OXO A;  3CNH A;  8ICH A;  2OWO A;  4UB4 A;  5KFW A;  9ICN A;  2DGZ A;  3PW4 A;  1UHU A;  2LM4 A;  1KBU A;  1RQL A;  5KG1 A;  5K4L A;  2ZIW B;  3QUB A;  1S77 D;  5AKG A;  3WKB A;  2W11 A;  4DOA A;  3PST A;  1U4B A;  2YMM A;  1L3U A;  1TK0 A;  2KZ3 A;  4US8 A;  3T5L A;  7ICL A; 
#chains in the Genus database with same CATH homology
 2E8N A;  1PK1 A;  1WWV A;  4NJ8 A;  2KSO B;  3SEI A;  5F3X B;  1KW4 A;  4RQM A;  2FE9 A;  1V85 A;  2KMD A;  3IDW A;  1X9X A;  2YTU A;  3H8M A;  3KKA C;  3BS7 A;  1LKY B;  2F8K A;  4RQN A;  5KNI A;  2D3D A;  1OW5 A;  2KG5 A;  1LKY A;  4PZO A;  1Z1V A;  1JI7 A;  2DKZ A;  2E8M A;  2JV3 A;  5JTI A;  1F0M A;  2QB0 B;  2EAN A;  2L5Y A;  2EAP A;  2ESE A;  1PK3 A;  2E8P A;  1UCV A;  2DKX A;  1V38 A;  3TAC B;  5J8Y C;  1SXD A;  3KKA A;  1X66 A;  1OXJ A;  4NL9 A;  2F44 A;  2LMR A;  1B0X A;  2KSO A;  2E8O A;  2F3N A;  5L1M A;  2LPE A;  2GLE A;  2QAR B;  4IS7 A;  2DL0 A;  5J8Y A;  2QB0 A;  1SXE A;  1SV0 C;  3BS5 B;  3TAD C;  4MHV A;  1SV4 A;  1WWU A;  2ES6 A;  4PZN A;  3BS5 A;  1SGG A;  1B4F A;  3BQ7 A;  2QKQ A;  1RG6 A;  1COK A;  1X40 A;  2QAR A;  3HIL A;  1SV0 A;  2K60 A;  2KE7 A;  3TAD A;  2K4P A;  4NL9 C;  1PK1 B;  2Y9U A;  2D8C A;  5JRT A;  2EAM A;  3K1R B;  2QB1 A;  1DXS A;  2Y9T A;  2EAO A;  1UQV A;  2KIV A;  2B6G A;  5JU5 A;  3SEN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...