1LKYB

Structure of the wild-type tel-sam polymer
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
77
structure length
77
Chain Sequence
SIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKDLLLLTKEDFRYRSPHSGDVLYELLQHILKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION FACTOR ETV6
publication title Native interface of the SAM domain polymer of TEL.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 24
structure length 77
sequence length 77
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2002-04-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.50 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Transcription Factor, Ets-1 1lkyB00
2EANA 2Y9TA 2EAOA 2EAMA 5JRTA 2KSOB 1UCVA 1F0MA 3HILA 2D3DA 4PZNA 1X40A 4NL9C 1B0XA 2FE9A 1PK1A 4RQMA 1B4FA 1PK1B 2JV3A 1V85A 1UQVA 1SXEA 2D8CA 2QB0A 3H8MA 5F3XB 3TADA 2K60A 3KKAA 1SV4A 2Y9UA 4PZOA 2DKXA 3K1RB 2QARA 5KNIA 3BS7A 2ESEA 2QKQA 1COKA 3SENA 2QARB 5JU5A 2E8OA 1JI7A 1SGGA 1SXDA 4RQNA 3IDWA 1RG6A 1LKYA 2B6GA 1DXSA 2LMRA 2E8NA 3TADC 5L1MA 2DKZA 3KKAC 1LKYB 2EAPA 1Z1VA 2QB0B 1PK3A 2DL0A 2KMDA 1WWVA 2K4PA 1V38A 1X9XA 2ES6A 2F3NA 1X66A 1KW4A 3BS5A 1SV0A 2LPEA 4MHVA 3BS5B 2KSOA 2KIVA 2L5YA 2KE7A 1WWUA 2QB1A 2E8PA 3BQ7A 3SEIA 2GLEA 4NL9A 1OXJA 4IS7A 1OW5A 2F8KA 2YTUA 2E8MA 2KG5A 4NJ8A 2F44A 3TACB 5JTIA 5J8YC 5J8YA 1SV0C
chains in the Genus database with same CATH superfamily
4FZNA 3AQFA 3I76A 4O5EA 4UB5A 8ICIA 2J6SA 3T5LA 1B0XA 5IILA 2XY7A 3HKZC 1PK1A 3N97B 4KN4A 1JUDA 3RR7A 4PHAA 4O0IA 1NK7A 3PVXA 5KFSA 2A1JA 3IG5A 1WCLA 2E1EA 2ZUCA 3L5KA 3Q8PB 3SZ2A 4DFKA 4QZIA 5CWRA 3QYPA 4QNLA 8ICQA 5KG4A 5J2IA 4TUPA 2FLLA 3C2KA 3RH5A 1ZYQA 2XGPA 4YP3A 1T4GA 1D9FA 4DQPA 2QKQA 3JPSA 3F2DA 5AM2A 2YMMA 2HHWA 3SYZA 2JXJA 3T79A 1YT3A 5KG7A 3LWLA 3ZDEA 3SV4A 2VA3A 3H7IA 5BOLA 3H0RB 4J9OA 3FAHA 1ECWA 1FFVA 5CA7A 2ZIVB 2W9CB 3D2NA 1Z4NA 1ZD4A 3CW2C 4M6WB 1D9DA 4JV0A 2K4PA 4Y2RA 5AI6A 3I1YA 2ES6A 1DK3A 2DWQA 5AKIA 4BGDA 5G5GA 5KFAA 5KFEA 1S97A 4O3NA 1QQ5A 2KE7A 2QB1A 4CE6A 2VIXA 2WAQF 7ICPA 1KTQA 3SAGA 2F8KA 2KG5A 4A8EA 4QZ8A 4KLIA 4B9NA 5ALWA 3M9NB 1U45A 4E0DA 4GIBA 4UAYA 4KLMA 1URJA 4DCCA 4YR2A 4QW9A 2PI4A 5J0OA 3PMLA 2M0NA 2H5XA 5AI0A 4OJOA 1S0MA 3MGIA 5DBCA 1NK8A 1ZQBA 5L9XA 2K8AA 1L7PA 4UAVA 1UHUA 2JV3A 1NOMA 1UA0A 2XC9A 2HBLA 1UQVA 3THVA 2IMWP 4KLDA 4QWBA 3MDCA 4RQ2A 4IQVA 5KG0A 2ASJA 1N60A 2R8HA 4O3RA 3RAQA 5BOMA 1RYRA 1WYGA 2XCPA 2DFLA 3BQTA 3AMZA 4LJXA 4I2EA 4M47A 2E1FA 1RZTA 2YMLA 2XY5A 1RG6A 2RRDA 4NV0A 4UATA 2W9CA 2ZUDA 3EWAA 2EAPA 4KLEA 8ICKA 5GTIU 2W03A 4KLTA 4QWEA 2LM4A 3G6YA 3UPQA 4EEKA 9ICBA 2FLNA 1BPYA 2N1RA 4MHVA 2HOQA 2ASDA 2KICA 5KFLA 2JZBB 5GTHU 3NRWA 5AK6A 4QZGA 3RBDA 1F44A 2ZIWB 4NL9A 2HOFA 1TE2A 5EE3A 2AGPA 1Z00B 2F44A 3KFUF 4F4XA 2BPCA 2KZMA 2HW3A 1CRXA 4Z6FA 3PNCA 5C5JA 1A77A 2Q0ZX 1ZQWA 2D3DA 5L1JA 1DK2A 2OM6A 3GQCA 2UVWA 3WKEA 4IR9A 4DFJA 2AGQA 1ZD3A 1T8EA 1B4FA 3M1YA 4R8UA 3GV7B 3QU4A 4DSJA 2NO4A 1X9WA 3ORYA 1HEKA 3RR8A 2QB0A 5ALHA 2MSNA 1J2MA 5ALZA 1C20A 1N63A 5AM5A 9ICOA 2ZIXB 4PZOA 3NUQA 3RAXA 5EE9A 1ZRNA 1COOA 2OCEA 3Q8MA 1COKA 2DGZA 3MDAA 8ICHA 4US9A 4ACOA 4G3IA 5DBAA 3ICXA 3SV3A 3WKBA 5KFFA 1DXSA 3IHQB 5F9LA 4QZDA 7ICLA 2KTQA 8ICFA 5G5HA 1BGXT 2KD1A 3OSNA 9ICGA 4WJ3B 3HKZF 5KFNA 1S5LU 4PH5A 4UB4A 4PHEA 1KKXA 3I28A 2RQ5A 5AK3A 4I2AA 4F5QA 3H0LB 2BGWA 2KIVA 4EYIB 1WWUA 2WB1F 8ICCA 1RPLA 4FS1A 1Z00A 1BNPA 1MN8A 2K8CB 3QE9Y 2NRZA 3EUB2 3UMCA 2DBYA 3CP8A 4NJ8A 3TAPA 1N5WA 3RJFA 5EE0A 3EPIA 3FYHA 4OCZA 5A0LA 2CPRA 1SKSA 5KFBA 1N56A 3WK5A 2NO5A 4YQWA 5J0TA 2EAOA 1X9SA 3ZDAA 1S9FA 3E0FA 1N2XA 2KVCA 4M9JA 1JIHA 5KFPA 2WF7A 2BQ3A 3M9MB 1X40A 1CUKA 5F9NA 1L6NA 2FPKA 1L3TA 3PSIA 2K4IA 4C4SA 3RB6A 3JPTA 4FE3A 3GU3A 3M6KA 3RB4A 9ICQA 4KLJA 5DLGA 4YD1A 5F3XB 2ZIXA 1VJ5A 9ICSA 3KKAA 2LBOA 4DL5A 4YD2A 1TK8A 9ICVA 3KHHA 1L7MA 2BPGA 8ICBA 2BPFA 5DG9A 4DOBA 3QNMA 2XI9A 3UMBA 3WK7A 5AKLA 1HJPA 2BKEA 5KFTA 1ZQXA 5C0YA 1NK5A 3C1ZA 2ZIUB 4F2RA 1JMSA 5ALJA 2LYAA 2E8NA 4AYBF 8ICZA 3TADC 8ICTA 1MQ3A 4DL6A 3PX0A 2R18A 2LYBA 3C29A 1L8OA 5KG3A 4HYKA 3JPQA 3RBEA 2ZTDA 8ICSA 4YVZA 4P0PA 2UVVA 4ZH4A 3T5JA 4AP9A 3HX0A 3D6JA 4G9BA 1NJWA 4Y2SA 1ZQAA 2KN7A 4ED6A 2BCRA 4XQ8A 4EZ9A 4EENA 4F8RA 5KFXA 1V9PA 4K4IA 4GC6A 7ICHA 3TQ1A 4C8NA 1RXWA 3WKAA 2XCAA 2EH9A 2F77X 4RNNA 2J6TA 2K8BB 3QZ7A 5KFJA 1D8LA 2R8GA 3NRZA 4IL6U 5IINA 1RYUA 5DB9A 4ED1A 1Z3EB 4J9LA 4EBEA 1QSSA 1KSPA 4LVSA 1T7PA 2HHSA 2XICA 2AXTU 4ECQA 1V85A 4F71A 5KG2A 1ZQJA 4ECYA 5AKJA 5J2EA 4IC9A 3SI8A 4NM1A 2DKXA 4I2CA 5AK4A 2ESEA 1KLNA 3KHLA 1X42A 2QARB 2UVUA 1BPDA 5IIIA 4ECRA 3ISCA 4ICAA 2K4EA 2XGQA 1B22A 3UQ0A 7ICMA 1NK4A 1ZQVA 2E5SA 1NKCA 4KN7A 3WU2U 3LK9A 4C7YA 3RJJA 5ALPA 4RUAA 4JUZA 2Y1JA 4IQTA 3BQ1A 9ICLA 2JH7A 4EYHB 3H8SA 2I9GA 1S0VA 2V9WA 3H40A 5AKYA 2DF4B 3PO5A 2KSOA 1L7NA 4I29A 4R66A 2L5YA 2GO7A 4RQ4A 1PVRA 2NRXA 2VJ4A 3AQEA 5IIJA 4TUQA 3RB3A 1JROA 4J9PA 1NJZA 1KRPA 5KTQA 3BQ2A 4JK1A 2IOFA 3IP4B 2A19A 1U49A 1OW5A 3GILA 3RJGA 3SQIA 3MR5A 2Q4TA 2ODGA 1JXEA 5H2FU 4I27A 3JPRA 1ED1A 2HHVA 2WF9A 3C23A 1ZQQA 5KAIU 5KAFU 1QTMA 4QZCA 5J0QA 2H3FA 1UPHA 3SD7A 3Q8SB 2FE9A 5D4BA 2R8JA 3PX4A 1KN5A 2W3SA 1TK0A 1FEZA 1S0OA 1ZETA 8ICPA 4Q8EA 4O5KA 2NV3A 4UB8U 2DPIA 1TAUA 9ICFA 5DDMA 1ZQLA 3QU2A 2QARA 3AN1A 1N5XA 3T5KA 3D2QA 4UW9A 4RQ7A 3F2CA 4NLNA 4U6PA 4C8KA 4IQWA 2BQUA 2G08A 2W55A 4J9RA 4DLGA 4KLGA 2WF8A 2AQ0A 2C2EA 2A3VA 4MFAA 4M2YA 2H3VA 5TISU 9ICNA 3WK9A 1ZQGA 3AM9A 3NVYA 5KFHA 5KL8B 1QLNA 1XC9A 3B0XA 4PHDA 4UASA 1QQ7A 5J0WA 2KVSA 4US8A 2ISPA 4R64A 1ZXIA 2W3RA 5D49A 2IOFK 4F93B 3LWMA 2W04A 4C8LA 2H3ZA 1O03A 4Y2XA 2H3IA 2AH5A 2IHMA 4Q8FA 4KX5A 5KFDA 4RPXA 3WKDA 3H8WA 4DF4A 2IOHA 1OUQA 4F50A 1OXJA 4J9QA 2MU2A 1NZBA 3RH6A 3S6JA 4RPYA 5HHHA 3C21A 1RDFA 3TAQA 4NLGA 3FC4A 3ISBA 2B21A 4DLEA 2AHOB 3F5EA 1UCVA 4JWMA 4I2GA 2RDJA 3GV8B 4DS5A 4OO1J 3FDSA 4P0QA 4CGZA 3MR6A 4ECZA 3PY8A 7ICFA 2G5HB 3KOOA 2HBKA 1ZD5A 4NY8A 1SXEA 4DSKA 1SZHA 2DPJA 1ZQYA 2M9NA 3C2LA 1Q8KA 4TQRA 2Y9UA 8ICXA 1U47A 1CI4A 3H8JA 3C2MA 2ASLA 9ICIA 3HT3A 2I6XA 5J2AA 4F5OA 4IQUA 4PGQA 8ICWA 2V4RA 4DSFA 3KD3A 3MR2A 4F5RA 1NKEA 5FP0A 5AK5A 1N62A 1U4BA 3EPGA 2Y0SC 4R8UB 2PFPA 1U9LA 1Z1VA 2QB0B 3H4DA 2DL0A 2KHVA 4M0AA 1KL9A 3V7JA 3RRHA 1X9XA 1IXRA 2VJ5A 4UAZA 3EYZA 4O3MA 2I5HA 4U7CA 4KLOA 4OJ5A 4RQ6A 1ZJNA 4QIWC 1YZ7A 3QXGA 4YR0A 2E8PA 2EZZA 3A0BU 4DQIA 1SL2A 5T14A 2KV2A 4P4OA 2IA6A 2MRLA 4DEZA 2H3QA 2HBJA 4IR1A 4I2JA 5KL1B 3WK4A 5J29A 5AM3A 2MUTB 4Y2QA 3TARA 5J0RA 4MEYA 2W9BA 3HILA 4MFCA 2ZUBA 3NGDA 4LZGA 5KFRA 2EZYA 3OHBA 4B9UA 3F2BA 4BDPA 3A0HU 3RJHA 2HHQA 2LHTA 5J2BA 3L4PA 5ALKA 2W8LA 2K4HA 9ICUA 1JN3A 4QJFB 4I2FA 1SZPA 2PMZF 2K60A 4Y2VA 3RJIA 2FI1A 1GO3F 4USAA 3LVVA 4M9GA 1ZQUA 2V4QA 3SMVA 2BCQA 2NYVA 2FLPA 5ALNA 1NZPA 2G07A 1Z4OA 4IRCA 3IDWA 4C4TA 3N28A 3EW9A 3N7SC 5J0UA 1L3SA 7ICEA 1O08A 2BHNA 5KFQA 4DSLA 4YMMA 5CJ7A 5DQIA 5AKGA 4IRKA 4M04A 2FJ6A 8ICYA 3WK8A 3QUQA 8ICLA 4Q45A 3PO4A 4IRDA 5HMMA 4Y2PA 2HDOA 1ZQ1C 1XSLA 3PR5B 3ED5A 4TURA 3BDPA 4Z6DA 3TFRA 1QH9A 4Q44A 2GH1A 1TKDA 2ZG6A 4NM2A 2CN1A 2WHEA 4C4RA 5ALOA 3HPOA 3GIJA 2MUTA 5DB6A 1HIWA 4P0PB 2Y9TA 2D6FC 8ICAA 3HJEA 3MABA 3C5FA 3K75D 4DFMA 2OXOA 4RQ3A 3TKAA 3DDHA 3LDAA 2F2AB 1JALA 5J2HA 2PFOA 4F72A 2KK0A 4EX6A 3EZ5A 1KQQA 4JWNA 4UAWA 4UB3A 1SKWA 2W11A 2HMXA 1WG8A 1L3UA 5CHGA 4K4GA 5ALXA 4JMUA 1SV4A 5KFUA 3K4GA 2FPLA 2HSZA 1PVQA 4FS2A 5IIOA 4F4WA 5CB1A 3IG8A 3KHGA 1PVPA 9ICEA 2C22A 4O9MA 3PR4A 1SGGA 4RQNA 1A6SA 7ICNA 2WTFA 3CNHA 3Q8QB 5KFMA 2VA8A 3BJYA 9ICCA 4CDGA 4YFKA 1WWVA 1V38A 4RNOA 5J2CA 4KMUA 4DQRA 3QU7A 3OTQA 1UT5A 5ALRA 1KEJA 1SV0A 4KLQA 2FMSA 2FMPA 5ALUA 4EELA 4F91B 3V6KA 3NVZA 2F1JA 1Q3VA 2MAXA 1N48A 2RP5A 1NK9A 2LKYA 4RNMA 2F1IA 4GFJA 1UA1A 2PI5A 4EBCA 1BPBA 5J8YA 5EWFA 2Y0SF 2EANA 4M9LA 2C2DA 4CF3A 1WUDA 3ZDCA 3QU9A 2ATLA 3IV6A 3KHRA 1ZQOA 4QZHA 7ICTA 2IHNA 5KFIA 2KSOB 3IRUA 4XRHA 3IN5A 3UXOA 2WAQC 5J2GA 4NL9C 1P7DA 4ED0A 3B0YA 2VKQA 5DB7A 4B9TA 5ALDA 2KKVA 4F2SA 3OHAA 9ICXA 1PUZA 4FBUA 7ICRA 1SKRA 4PHPA 2JEFA 2EQYA 3ETRA 4M9HA 2DUYA 1MQ2A 5AIAA 3HRDD 5KNIA 2RDIA 4RQ0A 4RUCA 3F5AA 4P4MA 5DDYA 3QEAZ 2UVRA 3RFAA 3ALRA 3QUCA 1SXDA 1ZQHA 2JEGA 2BCSA 4BWJA 1L3VA 4RQ5A 3ZI4A 1LKYB 4PGYA 4O3OA 3RTVA 3LYSA 5IIMA 4DSIA 2FDRA 3L3FX 3QUBA 2CXYA 4DOCA 2YMQA 4EX7A 3VCBA 2P35A 3MGHA 3MBYA 1IIPA 4PJ0U 2G09A 1ZQMA 4RQ8A 3KBBA 3M8SA 2BR0A 2LI6A 1FFUA 4UQGA 3HP6A 5CP2A 3AU6A 8ICMA 3JPOA 4ECTA 5AI4A 2R8IA 2E8MA 2FMQA 3TANA 4I2HA 3TACB 2BQRA 4MF2A 2B0CA 5JTIA 5TZVA 3K1ZA 5AM4A 2YN4A 5CRXA 3Q8RB 1TAMA 4GXIA 3PV8A 2ZTEA 2O6KA 3UXNA 1F0MA 4F5PA 4F92B 1KFDA 1A0PA 3G6VA 4QZFA 1FIQA 4Y2JA 1S8OA 3NS1A 2EDUA 1QSLA 3E2EA 4YN4A 2R8KA 4KLSA 5ALYA 5KT6A 2PFQA 1TFRA 5J0XA 1RYSA 4ECSA 4DS4A 5DGAA 4MEXA 9ICKA 4Y2TA 2HBMA 5HMLA 4C80A 3AL0B 4BJQA 3BS7A 3AUOA 2QLTA 1ZQRA 5ALMA 5EWEA 5KFOA 2OWOA 4P0QB 3V6HA 5AIBA 5AKEA 1ZQEA 2HCFA 1RXVA 2OH2A 4B9MA 2E3TA 1LKYA 2B6GA 4K4HA 3GDXA 5L1LA 3PW2A 1S10A 4X5VA 3KKAC 3PW0A 4C8OA 1K5OA 1WCNA 3ONNA 1K1SA 2W8KA 2ZXHA 2ZJAA 2ZJ8A 5AI9A 3GV5B 3V7KA 4Z6CA 4CF4A 2NRWA 2LPEA 3TFSA 4ELTA 4QZBA 1SL1A 5J2JA 2JRZA 1T3NA 3ZDBA 7ICGA 3OJUA 3OPXA 5DQHA 4QWDA 2GLEA 2WFAA 3ISDA 3SR6A 2OEHA 4KLLA 4KLFA 1HUZA 2AQ4A 7ICVA 4JV2A 2JH1A 2G06A 2ISOA 5J8YC 4UB2A 1XSNA 4QZEA 1DOQA 1D8YA 2W9MA 4PPXA 9ICMA 3KTQA 2WB1C 9ICPA 2AGOA 4NXZA 5KFZA 3PX6A 5HP4A 2BDPA 1X6IA 3T5HA 8ICRA 4RQMA 5IIKA 3PZPA 4YXMA 1SL0A 1T94A 2OYYA 1DGSA 1V97A 2KEYA 3GIMA 4GLXA 4ECXA 3GZFA 3K1RB 4FO6A 5DQGA 2W9BB 5DBBA 1Q3UA 3WK6A 1JI7A 1SIJA 4UBCA 4ED3A 4KLUA 2F8LA 5DKWA 3TI0A 4J9SA 5EOZA 4FZLA 1TV9A 4YR3A 1ZQDA 3NTUA 1CEZA 3N7RC 1ZQFA 3MR3A 3ZDDA 4XUSA 2HHXA 3M7DA 2F76X 4MFFA 3OSPA 1ZQKA 1KW4A 5J0SA 4O3PA 1IG6A 5EWGA 4I28A 1ZQSA 4ZOHC 4M9NA 1J2NA 3BQ7A 2C28A 4GXKA 4AYBC 3M8RA 2LYHA 3SEIA 1NKBA 4OJLA 1JRPA 1ZJMA 5KFCA 1A76A 2EZXA 4I2IA 5DLFA 4Z6EA 5ALVA 1DGJA 1ZRMA 4YMOA 1T3QA 2C2RA 1Z1BA 1KBUA 3ZD9A 2EAMA 2WF6A 3BZKA 5JRTA 2HOIA 3NVVA 1QQ6A 4BUGA 3AEVA 1ZQCA 4F3OA 2XY6A 5AKZA 5DG8A 5BPCA 2Y1IA 2IBKA 1ZQNA 4C8MA 2KNJA 3B9JA 5ALLA 4FBTA 2XIDA 3PSPA 2YY6A 4RZRA 5EE1A 1N61A 4UB6U 5L1IA 4DFDA 1XS9D 2I1QA 2YMPA 9ICRA 3C5GA 2ZIVA 3TADA 3JPNA 3V72A 5AKKA 5L1KA 4M6WA 2RHFA 4ED2A 4KITB 1LVHA 3T3FA 2HVIA 2KJ5A 2JR5A 1PZNA 2W43A 1L7OA 5J2KA 3OJSA 2AJQA 5JUMA 1HUOA 4ELUA 9ICHA 5E79U 1L5UA 1QSYA 3WKCA 4KMOB 4DQQA 2DKZA 3PW4A 1PK3A 5AICA 1NJYA 1SB3C 5DGBA 1BPEA 5KT7A 5KFVA 1AQ6A 1NNLA 3F53A 5DG7A 4I2BA 4J03A 1Q46A 4ED7A 1KDHA 5KG6A 1VLBA 1XNSA 1ZQZA 5ALIA 8ICGA 3AU2A 1YZ6A 3C1YA 2ZTCA 2FPMA 2NRTA 1QCKA 2JEJA 4KX3A 5K4LA 2HVHA 1VDVA 4O3QA 3NASA 1ZQIA 2YTUA 3CYMA 5AI5A 2YB4A 4KTQA 3V6JA 4DL4A 1BPXA 3UM9A 4B6JA 4BWMA 4DL7A 4P4PA 3UXPA 1SWWA 3QU5A 4OD0A 1KFSA 3DEEA 2KHQA 3J81j 4RQ1A 3RB0A 5HHIA 1X6JA 5ALSA 4J9NA 1S77D 4NLZA 1B43A 7ICSA 4B9LA 1RM6C 3C28A 1JX4A 3RRGA 2A1AA 5CR0A 5KFWA 3RF9A 5KFKA 4XA5A 1L8LA 3BQ0A 1LB2B 9ICJA 5KFGA 3OGUA 4I2DA 5DB8A 1XO0A 3BZCA 2BCVA 3SAHA 4OJ6A 5KT4A 4LZDA 3CRXA 2JZBA 4MF8A 3PW5A 3GIIA 2CRXA 5D46A 2YQEA 8ICJA 4EBDA 2LMRA 5KG1A 2W7OA 2ZIWA 2HHUA 2KFZA 2NRVA 3GIKA 5ALEA 1RQNA 4NLKA 2PXIA 4J9KA 2P6UA 4TUSA 4UBBA 1SWVA 2JGAA 4PL2A 4B9SA 4CCHA 2BDUA 2KOBA 3MC1A 2F1HA 2JEIA 3QX7A 4O5CA 4DOAA 7ICKA 2K89A 5HNKA 4ECWA 3QUTA 1BPZA 7ICQA 2KP7A 3Q8KA 1NK0A 4RT3A 3LVWA 3RJKA 9ICAA 4GC7A 4YCXA 2KKPA 2ALZA 3DV9A 3G6XA 5ALFA 4HAIA 1NJXA 5AI8A 4YMNA 3M9OB 4Y2YA 1J97A 2W7PA 2JMGA 3V7LA 5B66U 2ZXIA 3FM9A 4O3SA 2P6RA 1D8BA 4JB3A 5AHXA 8ICVA 3JPPA 2DQNB 2GOLA 3N4MB 5ALTA 5J2FA 1H38A 2JHDA 1S76D 4QZAA 1EXNA 4QWCA 1XU4A 4PGXA 2D8CA 3H8MA 2PFNA 2KFNA 5AM1A 1KFTA 3PSTA 1NK6A 7ICUA 1X2IA 4ECVA 5JU5A 3H4BA 3U26A 4EZ6A 5ALGA 2VANA 4QIWF 1MC8A 2YB1A 2GWSA 5HR7A 3MGVA 4NLBA 1UT8A 5AKHA 3GFKB 4BX9C 4F5NA 4DO9A 7ICIA 2KJ9A 2G0AA 4YG2A 1Y88A 3ETLA 1F5SA 5KG5A 4RU9A 1Z19A 2KMDA 2Z7JA 9ICTA 2F3NA 1X66A 2J6UA 3PW7A 4DQSA 4DL3A 3D2SA 4CF5A 4CNQA 3MFHA 1ZOLA 4DWIA 2VA2A 4OJPA 3BS5B 4Y2UA 3RJEA 5KT2A 1C7YA 4J9MA 7ICOA 4GXJA 3N7PD 5CEHA 3IM1A 2KIWA 4F4ZA 1TK5A 1JXLA 4IS7A 5AKXA 5B5EU 5J0PA 4RT2A 4F4YA 4PL1A 2BCUA 8ICNA 1TAQA 1FO4A 3SAFA 4C0ZA 1ZQPA 4DSEA 4EEYA 4BXOB 4Q43A 2ZJ5A 1AROP 4CRXA 1BVSA 5J2DA 3QZ8A 2AU0A 4KLHA 3H0MB 8ICUA 2LM1A 4R65A 5ALQA 3UQ2A 4DFPA 1ZQTA 9ICWA 4PZNA 1X9MA 3HW8A 2WF5A 1XSPA 3ZD8A 4B9VA 4ECUA 3UMGA 1DRGA 2HHTA 2ZIUA 4JV1A 1PK1B 4F4KA 3RH4A 4YXJA 4FFDA 4R63A 2G5IB 2KZ3A 2XO7A 3O0FA 1XO1A 4UB1A 2KJ8A 2A1JB 2W54A 4NLCA 8ICEA 1LV5A 4TQSA 5HR6A 4ELVA 5KFYA 2XVTA 3QEBZ 1RQLA 5J0YA 8ICOA 2KZZA 4C7ZA 2RLTA 3SENA 3NVWA 1NI3A 1TVAA 2E8OA 3PSFA 4DL2A 4RPZA 4QWAA 5AM0A 2PMZC 5L1MA 4P2HA 2W9AA 2OHFA 2P66A 1K1QA 3KZXA 3KZIU 3Q8LA 3VC8A 1M6YA 1S0NA 4DF8A 1MSWD 1BNOA 3BS5A 3HWTA 5KT3A 1XWLA 4UARA 2HI0A 3PMNA 1IM4A 4ED8A 2PKEA 3E58A 2YX8A 4QW8A 2MA1A 3M6ZA 4UAUA 5KT5A 3R9KA 2BZFA 7ICJA 4FZMA 4QZ9A 1U48A 1MA7A 3MFIA 4NWIA 4BXOA 1ZD2P 1SV0C 1IV8A
chains in the Genus database with same CATH topology
2EANA 2Y9TA 2EAOA 2EAMA 5JRTA 2KSOB 1UCVA 1F0MA 3HILA 2D3DA 4PZNA 1X40A 4NL9C 1B0XA 2FE9A 1PK1A 4RQMA 1B4FA 1PK1B 2JV3A 1V85A 1UQVA 1SXEA 2D8CA 2QB0A 3H8MA 5F3XB 3TADA 2K60A 3KKAA 1SV4A 2Y9UA 4PZOA 2DKXA 3K1RB 2QARA 5KNIA 3BS7A 2ESEA 2QKQA 1COKA 3SENA 2QARB 5JU5A 2E8OA 1JI7A 1SGGA 1SXDA 4RQNA 3IDWA 1RG6A 1LKYA 2B6GA 1DXSA 2LMRA 2E8NA 3TADC 5L1MA 2DKZA 3KKAC 1LKYB 2EAPA 1Z1VA 2QB0B 1PK3A 2DL0A 2KMDA 1WWVA 2K4PA 1V38A 1X9XA 2ES6A 2F3NA 1X66A 1KW4A 3BS5A 1SV0A 2LPEA 4MHVA 3BS5B 2KSOA 2KIVA 2L5YA 2KE7A 1WWUA 2QB1A 2E8PA 3BQ7A 3SEIA 2GLEA 4NL9A 1OXJA 4IS7A 1OW5A 2F8KA 2YTUA 2E8MA 2KG5A 4NJ8A 2F44A 3TACB 5JTIA 5J8YC 5J8YA 1SV0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EAN A;  2Y9T A;  2EAO A;  2EAM A;  5JRT A;  2KSO B;  1UCV A;  1F0M A;  3HIL A;  2D3D A;  4PZN A;  1X40 A;  4NL9 C;  1B0X A;  2FE9 A;  1PK1 A;  4RQM A;  1B4F A;  1PK1 B;  2JV3 A;  1V85 A;  1UQV A;  1SXE A;  2D8C A;  2QB0 A;  3H8M A;  5F3X B;  3TAD A;  2K60 A;  3KKA A;  1SV4 A;  2Y9U A;  4PZO A;  2DKX A;  3K1R B;  2QAR A;  5KNI A;  3BS7 A;  2ESE A;  2QKQ A;  1COK A;  3SEN A;  2QAR B;  5JU5 A;  2E8O A;  1JI7 A;  1SGG A;  1SXD A;  4RQN A;  3IDW A;  1RG6 A;  1LKY A;  2B6G A;  1DXS A;  2LMR A;  2E8N A;  3TAD C;  5L1M A;  2DKZ A;  3KKA C;  1LKY B;  2EAP A;  1Z1V A;  2QB0 B;  1PK3 A;  2DL0 A;  2KMD A;  1WWV A;  2K4P A;  1V38 A;  1X9X A;  2ES6 A;  2F3N A;  1X66 A;  1KW4 A;  3BS5 A;  1SV0 A;  2LPE A;  4MHV A;  3BS5 B;  2KSO A;  2KIV A;  2L5Y A;  2KE7 A;  1WWU A;  2QB1 A;  2E8P A;  3BQ7 A;  3SEI A;  2GLE A;  4NL9 A;  1OXJ A;  4IS7 A;  1OW5 A;  2F8K A;  2YTU A;  2E8M A;  2KG5 A;  4NJ8 A;  2F44 A;  3TAC B;  5JTI A;  5J8Y C;  5J8Y A;  1SV0 C; 
#chains in the Genus database with same CATH topology
 4FZN A;  3AQF A;  3I76 A;  4O5E A;  4UB5 A;  8ICI A;  2J6S A;  3T5L A;  1B0X A;  5IIL A;  2XY7 A;  3HKZ C;  1PK1 A;  3N97 B;  4KN4 A;  1JUD A;  3RR7 A;  4PHA A;  4O0I A;  1NK7 A;  3PVX A;  5KFS A;  2A1J A;  3IG5 A;  1WCL A;  2E1E A;  2ZUC A;  3L5K A;  3Q8P B;  3SZ2 A;  4DFK A;  4QZI A;  5CWR A;  3QYP A;  4QNL A;  8ICQ A;  5KG4 A;  5J2I A;  4TUP A;  2FLL A;  3C2K A;  3RH5 A;  1ZYQ A;  2XGP A;  4YP3 A;  1T4G A;  1D9F A;  4DQP A;  2QKQ A;  3JPS A;  3F2D A;  5AM2 A;  2YMM A;  2HHW A;  3SYZ A;  2JXJ A;  3T79 A;  1YT3 A;  5KG7 A;  3LWL A;  3ZDE A;  3SV4 A;  2VA3 A;  3H7I A;  5BOL A;  3H0R B;  4J9O A;  3FAH A;  1ECW A;  1FFV A;  5CA7 A;  2ZIV B;  2W9C B;  3D2N A;  1Z4N A;  1ZD4 A;  3CW2 C;  4M6W B;  1D9D A;  4JV0 A;  2K4P A;  4Y2R A;  5AI6 A;  3I1Y A;  2ES6 A;  1DK3 A;  2DWQ A;  5AKI A;  4BGD A;  5G5G A;  5KFA A;  5KFE A;  1S97 A;  4O3N A;  1QQ5 A;  2KE7 A;  2QB1 A;  4CE6 A;  2VIX A;  2WAQ F;  7ICP A;  1KTQ A;  3SAG A;  2F8K A;  2KG5 A;  4A8E A;  4QZ8 A;  4KLI A;  4B9N A;  5ALW A;  3M9N B;  1U45 A;  4E0D A;  4GIB A;  4UAY A;  4KLM A;  1URJ A;  4DCC A;  4YR2 A;  4QW9 A;  2PI4 A;  5J0O A;  3PML A;  2M0N A;  2H5X A;  5AI0 A;  4OJO A;  1S0M A;  3MGI A;  5DBC A;  1NK8 A;  1ZQB A;  5L9X A;  2K8A A;  1L7P A;  4UAV A;  1UHU A;  2JV3 A;  1NOM A;  1UA0 A;  2XC9 A;  2HBL A;  1UQV A;  3THV A;  2IMW P;  4KLD A;  4QWB A;  3MDC A;  4RQ2 A;  4IQV A;  5KG0 A;  2ASJ A;  1N60 A;  2R8H A;  4O3R A;  3RAQ A;  5BOM A;  1RYR A;  1WYG A;  2XCP A;  2DFL A;  3BQT A;  3AMZ A;  4LJX A;  4I2E A;  4M47 A;  2E1F A;  1RZT A;  2YML A;  2XY5 A;  1RG6 A;  2RRD A;  4NV0 A;  4UAT A;  2W9C A;  2ZUD A;  3EWA A;  2EAP A;  4KLE A;  8ICK A;  5GTI U;  2W03 A;  4KLT A;  4QWE A;  2LM4 A;  3G6Y A;  3UPQ A;  4EEK A;  9ICB A;  2FLN A;  1BPY A;  2N1R A;  4MHV A;  2HOQ A;  2ASD A;  2KIC A;  5KFL A;  2JZB B;  5GTH U;  3NRW A;  5AK6 A;  4QZG A;  3RBD A;  1F44 A;  2ZIW B;  4NL9 A;  2HOF A;  1TE2 A;  5EE3 A;  2AGP A;  1Z00 B;  2F44 A;  3KFU F;  4F4X A;  2BPC A;  2KZM A;  2HW3 A;  1CRX A;  4Z6F A;  3PNC A;  5C5J A;  1A77 A;  2Q0Z X;  1ZQW A;  2D3D A;  5L1J A;  1DK2 A;  2OM6 A;  3GQC A;  2UVW A;  3WKE A;  4IR9 A;  4DFJ A;  2AGQ A;  1ZD3 A;  1T8E A;  1B4F A;  3M1Y A;  4R8U A;  3GV7 B;  3QU4 A;  4DSJ A;  2NO4 A;  1X9W A;  3ORY A;  1HEK A;  3RR8 A;  2QB0 A;  5ALH A;  2MSN A;  1J2M A;  5ALZ A;  1C20 A;  1N63 A;  5AM5 A;  9ICO A;  2ZIX B;  4PZO A;  3NUQ A;  3RAX A;  5EE9 A;  1ZRN A;  1COO A;  2OCE A;  3Q8M A;  1COK A;  2DGZ A;  3MDA A;  8ICH A;  4US9 A;  4ACO A;  4G3I A;  5DBA A;  3ICX A;  3SV3 A;  3WKB A;  5KFF A;  1DXS A;  3IHQ B;  5F9L A;  4QZD A;  7ICL A;  2KTQ A;  8ICF A;  5G5H A;  1BGX T;  2KD1 A;  3OSN A;  9ICG A;  4WJ3 B;  3HKZ F;  5KFN A;  1S5L U;  4PH5 A;  4UB4 A;  4PHE A;  1KKX A;  3I28 A;  2RQ5 A;  5AK3 A;  4I2A A;  4F5Q A;  3H0L B;  2BGW A;  2KIV A;  4EYI B;  1WWU A;  2WB1 F;  8ICC A;  1RPL A;  4FS1 A;  1Z00 A;  1BNP A;  1MN8 A;  2K8C B;  3QE9 Y;  2NRZ A;  3EUB 2;  3UMC A;  2DBY A;  3CP8 A;  4NJ8 A;  3TAP A;  1N5W A;  3RJF A;  5EE0 A;  3EPI A;  3FYH A;  4OCZ A;  5A0L A;  2CPR A;  1SKS A;  5KFB A;  1N56 A;  3WK5 A;  2NO5 A;  4YQW A;  5J0T A;  2EAO A;  1X9S A;  3ZDA A;  1S9F A;  3E0F A;  1N2X A;  2KVC A;  4M9J A;  1JIH A;  5KFP A;  2WF7 A;  2BQ3 A;  3M9M B;  1X40 A;  1CUK A;  5F9N A;  1L6N A;  2FPK A;  1L3T A;  3PSI A;  2K4I A;  4C4S A;  3RB6 A;  3JPT A;  4FE3 A;  3GU3 A;  3M6K A;  3RB4 A;  9ICQ A;  4KLJ A;  5DLG A;  4YD1 A;  5F3X B;  2ZIX A;  1VJ5 A;  9ICS A;  3KKA A;  2LBO A;  4DL5 A;  4YD2 A;  1TK8 A;  9ICV A;  3KHH A;  1L7M A;  2BPG A;  8ICB A;  2BPF A;  5DG9 A;  4DOB A;  3QNM A;  2XI9 A;  3UMB A;  3WK7 A;  5AKL A;  1HJP A;  2BKE A;  5KFT A;  1ZQX A;  5C0Y A;  1NK5 A;  3C1Z A;  2ZIU B;  4F2R A;  1JMS A;  5ALJ A;  2LYA A;  2E8N A;  4AYB F;  8ICZ A;  3TAD C;  8ICT A;  1MQ3 A;  4DL6 A;  3PX0 A;  2R18 A;  2LYB A;  3C29 A;  1L8O A;  5KG3 A;  4HYK A;  3JPQ A;  3RBE A;  2ZTD A;  8ICS A;  4YVZ A;  4P0P A;  2UVV A;  4ZH4 A;  3T5J A;  4AP9 A;  3HX0 A;  3D6J A;  4G9B A;  1NJW A;  4Y2S A;  1ZQA A;  2KN7 A;  4ED6 A;  2BCR A;  4XQ8 A;  4EZ9 A;  4EEN A;  4F8R A;  5KFX A;  1V9P A;  4K4I A;  4GC6 A;  7ICH A;  3TQ1 A;  4C8N A;  1RXW A;  3WKA A;  2XCA A;  2EH9 A;  2F77 X;  4RNN A;  2J6T A;  2K8B B;  3QZ7 A;  5KFJ A;  1D8L A;  2R8G A;  3NRZ A;  4IL6 U;  5IIN A;  1RYU A;  5DB9 A;  4ED1 A;  1Z3E B;  4J9L A;  4EBE A;  1QSS A;  1KSP A;  4LVS A;  1T7P A;  2HHS A;  2XIC A;  2AXT U;  4ECQ A;  1V85 A;  4F71 A;  5KG2 A;  1ZQJ A;  4ECY A;  5AKJ A;  5J2E A;  4IC9 A;  3SI8 A;  4NM1 A;  2DKX A;  4I2C A;  5AK4 A;  2ESE A;  1KLN A;  3KHL A;  1X42 A;  2QAR B;  2UVU A;  1BPD A;  5III A;  4ECR A;  3ISC A;  4ICA A;  2K4E A;  2XGQ A;  1B22 A;  3UQ0 A;  7ICM A;  1NK4 A;  1ZQV A;  2E5S A;  1NKC A;  4KN7 A;  3WU2 U;  3LK9 A;  4C7Y A;  3RJJ A;  5ALP A;  4RUA A;  4JUZ A;  2Y1J A;  4IQT A;  3BQ1 A;  9ICL A;  2JH7 A;  4EYH B;  3H8S A;  2I9G A;  1S0V A;  2V9W A;  3H40 A;  5AKY A;  2DF4 B;  3PO5 A;  2KSO A;  1L7N A;  4I29 A;  4R66 A;  2L5Y A;  2GO7 A;  4RQ4 A;  1PVR A;  2NRX A;  2VJ4 A;  3AQE A;  5IIJ A;  4TUQ A;  3RB3 A;  1JRO A;  4J9P A;  1NJZ A;  1KRP A;  5KTQ A;  3BQ2 A;  4JK1 A;  2IOF A;  3IP4 B;  2A19 A;  1U49 A;  1OW5 A;  3GIL A;  3RJG A;  3SQI A;  3MR5 A;  2Q4T A;  2ODG A;  1JXE A;  5H2F U;  4I27 A;  3JPR A;  1ED1 A;  2HHV A;  2WF9 A;  3C23 A;  1ZQQ A;  5KAI U;  5KAF U;  1QTM A;  4QZC A;  5J0Q A;  2H3F A;  1UPH A;  3SD7 A;  3Q8S B;  2FE9 A;  5D4B A;  2R8J A;  3PX4 A;  1KN5 A;  2W3S A;  1TK0 A;  1FEZ A;  1S0O A;  1ZET A;  8ICP A;  4Q8E A;  4O5K A;  2NV3 A;  4UB8 U;  2DPI A;  1TAU A;  9ICF A;  5DDM A;  1ZQL A;  3QU2 A;  2QAR A;  3AN1 A;  1N5X A;  3T5K A;  3D2Q A;  4UW9 A;  4RQ7 A;  3F2C A;  4NLN A;  4U6P A;  4C8K A;  4IQW A;  2BQU A;  2G08 A;  2W55 A;  4J9R A;  4DLG A;  4KLG A;  2WF8 A;  2AQ0 A;  2C2E A;  2A3V A;  4MFA A;  4M2Y A;  2H3V A;  5TIS U;  9ICN A;  3WK9 A;  1ZQG A;  3AM9 A;  3NVY A;  5KFH A;  5KL8 B;  1QLN A;  1XC9 A;  3B0X A;  4PHD A;  4UAS A;  1QQ7 A;  5J0W A;  2KVS A;  4US8 A;  2ISP A;  4R64 A;  1ZXI A;  2W3R A;  5D49 A;  2IOF K;  4F93 B;  3LWM A;  2W04 A;  4C8L A;  2H3Z A;  1O03 A;  4Y2X A;  2H3I A;  2AH5 A;  2IHM A;  4Q8F A;  4KX5 A;  5KFD A;  4RPX A;  3WKD A;  3H8W A;  4DF4 A;  2IOH A;  1OUQ A;  4F50 A;  1OXJ A;  4J9Q A;  2MU2 A;  1NZB A;  3RH6 A;  3S6J A;  4RPY A;  5HHH A;  3C21 A;  1RDF A;  3TAQ A;  4NLG A;  3FC4 A;  3ISB A;  2B21 A;  4DLE A;  2AHO B;  3F5E A;  1UCV A;  4JWM A;  4I2G A;  2RDJ A;  3GV8 B;  4DS5 A;  4OO1 J;  3FDS A;  4P0Q A;  4CGZ A;  3MR6 A;  4ECZ A;  3PY8 A;  7ICF A;  2G5H B;  3KOO A;  2HBK A;  1ZD5 A;  4NY8 A;  1SXE A;  4DSK A;  1SZH A;  2DPJ A;  1ZQY A;  2M9N A;  3C2L A;  1Q8K A;  4TQR A;  2Y9U A;  8ICX A;  1U47 A;  1CI4 A;  3H8J A;  3C2M A;  2ASL A;  9ICI A;  3HT3 A;  2I6X A;  5J2A A;  4F5O A;  4IQU A;  4PGQ A;  8ICW A;  2V4R A;  4DSF A;  3KD3 A;  3MR2 A;  4F5R A;  1NKE A;  5FP0 A;  5AK5 A;  1N62 A;  1U4B A;  3EPG A;  2Y0S C;  4R8U B;  2PFP A;  1U9L A;  1Z1V A;  2QB0 B;  3H4D A;  2DL0 A;  2KHV A;  4M0A A;  1KL9 A;  3V7J A;  3RRH A;  1X9X A;  1IXR A;  2VJ5 A;  4UAZ A;  3EYZ A;  4O3M A;  2I5H A;  4U7C A;  4KLO A;  4OJ5 A;  4RQ6 A;  1ZJN A;  4QIW C;  1YZ7 A;  3QXG A;  4YR0 A;  2E8P A;  2EZZ A;  3A0B U;  4DQI A;  1SL2 A;  5T14 A;  2KV2 A;  4P4O A;  2IA6 A;  2MRL A;  4DEZ A;  2H3Q A;  2HBJ A;  4IR1 A;  4I2J A;  5KL1 B;  3WK4 A;  5J29 A;  5AM3 A;  2MUT B;  4Y2Q A;  3TAR A;  5J0R A;  4MEY A;  2W9B A;  3HIL A;  4MFC A;  2ZUB A;  3NGD A;  4LZG A;  5KFR A;  2EZY A;  3OHB A;  4B9U A;  3F2B A;  4BDP A;  3A0H U;  3RJH A;  2HHQ A;  2LHT A;  5J2B A;  3L4P A;  5ALK A;  2W8L A;  2K4H A;  9ICU A;  1JN3 A;  4QJF B;  4I2F A;  1SZP A;  2PMZ F;  2K60 A;  4Y2V A;  3RJI A;  2FI1 A;  1GO3 F;  4USA A;  3LVV A;  4M9G A;  1ZQU A;  2V4Q A;  3SMV A;  2BCQ A;  2NYV A;  2FLP A;  5ALN A;  1NZP A;  2G07 A;  1Z4O A;  4IRC A;  3IDW A;  4C4T A;  3N28 A;  3EW9 A;  3N7S C;  5J0U A;  1L3S A;  7ICE A;  1O08 A;  2BHN A;  5KFQ A;  4DSL A;  4YMM A;  5CJ7 A;  5DQI A;  5AKG A;  4IRK A;  4M04 A;  2FJ6 A;  8ICY A;  3WK8 A;  3QUQ A;  8ICL A;  4Q45 A;  3PO4 A;  4IRD A;  5HMM A;  4Y2P A;  2HDO A;  1ZQ1 C;  1XSL A;  3PR5 B;  3ED5 A;  4TUR A;  3BDP A;  4Z6D A;  3TFR A;  1QH9 A;  4Q44 A;  2GH1 A;  1TKD A;  2ZG6 A;  4NM2 A;  2CN1 A;  2WHE A;  4C4R A;  5ALO A;  3HPO A;  3GIJ A;  2MUT A;  5DB6 A;  1HIW A;  4P0P B;  2Y9T A;  2D6F C;  8ICA A;  3HJE A;  3MAB A;  3C5F A;  3K75 D;  4DFM A;  2OXO A;  4RQ3 A;  3TKA A;  3DDH A;  3LDA A;  2F2A B;  1JAL A;  5J2H A;  2PFO A;  4F72 A;  2KK0 A;  4EX6 A;  3EZ5 A;  1KQQ A;  4JWN A;  4UAW A;  4UB3 A;  1SKW A;  2W11 A;  2HMX A;  1WG8 A;  1L3U A;  5CHG A;  4K4G A;  5ALX A;  4JMU A;  1SV4 A;  5KFU A;  3K4G A;  2FPL A;  2HSZ A;  1PVQ A;  4FS2 A;  5IIO A;  4F4W A;  5CB1 A;  3IG8 A;  3KHG A;  1PVP A;  9ICE A;  2C22 A;  4O9M A;  3PR4 A;  1SGG A;  4RQN A;  1A6S A;  7ICN A;  2WTF A;  3CNH A;  3Q8Q B;  5KFM A;  2VA8 A;  3BJY A;  9ICC A;  4CDG A;  4YFK A;  1WWV A;  1V38 A;  4RNO A;  5J2C A;  4KMU A;  4DQR A;  3QU7 A;  3OTQ A;  1UT5 A;  5ALR A;  1KEJ A;  1SV0 A;  4KLQ A;  2FMS A;  2FMP A;  5ALU A;  4EEL A;  4F91 B;  3V6K A;  3NVZ A;  2F1J A;  1Q3V A;  2MAX A;  1N48 A;  2RP5 A;  1NK9 A;  2LKY A;  4RNM A;  2F1I A;  4GFJ A;  1UA1 A;  2PI5 A;  4EBC A;  1BPB A;  5J8Y A;  5EWF A;  2Y0S F;  2EAN A;  4M9L A;  2C2D A;  4CF3 A;  1WUD A;  3ZDC A;  3QU9 A;  2ATL A;  3IV6 A;  3KHR A;  1ZQO A;  4QZH A;  7ICT A;  2IHN A;  5KFI A;  2KSO B;  3IRU A;  4XRH A;  3IN5 A;  3UXO A;  2WAQ C;  5J2G A;  4NL9 C;  1P7D A;  4ED0 A;  3B0Y A;  2VKQ A;  5DB7 A;  4B9T A;  5ALD A;  2KKV A;  4F2S A;  3OHA A;  9ICX A;  1PUZ A;  4FBU A;  7ICR A;  1SKR A;  4PHP A;  2JEF A;  2EQY A;  3ETR A;  4M9H A;  2DUY A;  1MQ2 A;  5AIA A;  3HRD D;  5KNI A;  2RDI A;  4RQ0 A;  4RUC A;  3F5A A;  4P4M A;  5DDY A;  3QEA Z;  2UVR A;  3RFA A;  3ALR A;  3QUC A;  1SXD A;  1ZQH A;  2JEG A;  2BCS A;  4BWJ A;  1L3V A;  4RQ5 A;  3ZI4 A;  1LKY B;  4PGY A;  4O3O A;  3RTV A;  3LYS A;  5IIM A;  4DSI A;  2FDR A;  3L3F X;  3QUB A;  2CXY A;  4DOC A;  2YMQ A;  4EX7 A;  3VCB A;  2P35 A;  3MGH A;  3MBY A;  1IIP A;  4PJ0 U;  2G09 A;  1ZQM A;  4RQ8 A;  3KBB A;  3M8S A;  2BR0 A;  2LI6 A;  1FFU A;  4UQG A;  3HP6 A;  5CP2 A;  3AU6 A;  8ICM A;  3JPO A;  4ECT A;  5AI4 A;  2R8I A;  2E8M A;  2FMQ A;  3TAN A;  4I2H A;  3TAC B;  2BQR A;  4MF2 A;  2B0C A;  5JTI A;  5TZV A;  3K1Z A;  5AM4 A;  2YN4 A;  5CRX A;  3Q8R B;  1TAM A;  4GXI A;  3PV8 A;  2ZTE A;  2O6K A;  3UXN A;  1F0M A;  4F5P A;  4F92 B;  1KFD A;  1A0P A;  3G6V A;  4QZF A;  1FIQ A;  4Y2J A;  1S8O A;  3NS1 A;  2EDU A;  1QSL A;  3E2E A;  4YN4 A;  2R8K A;  4KLS A;  5ALY A;  5KT6 A;  2PFQ A;  1TFR A;  5J0X A;  1RYS A;  4ECS A;  4DS4 A;  5DGA A;  4MEX A;  9ICK A;  4Y2T A;  2HBM A;  5HML A;  4C80 A;  3AL0 B;  4BJQ A;  3BS7 A;  3AUO A;  2QLT A;  1ZQR A;  5ALM A;  5EWE A;  5KFO A;  2OWO A;  4P0Q B;  3V6H A;  5AIB A;  5AKE A;  1ZQE A;  2HCF A;  1RXV A;  2OH2 A;  4B9M A;  2E3T A;  1LKY A;  2B6G A;  4K4H A;  3GDX A;  5L1L A;  3PW2 A;  1S10 A;  4X5V A;  3KKA C;  3PW0 A;  4C8O A;  1K5O A;  1WCN A;  3ONN A;  1K1S A;  2W8K A;  2ZXH A;  2ZJA A;  2ZJ8 A;  5AI9 A;  3GV5 B;  3V7K A;  4Z6C A;  4CF4 A;  2NRW A;  2LPE A;  3TFS A;  4ELT A;  4QZB A;  1SL1 A;  5J2J A;  2JRZ A;  1T3N A;  3ZDB A;  7ICG A;  3OJU A;  3OPX A;  5DQH A;  4QWD A;  2GLE A;  2WFA A;  3ISD A;  3SR6 A;  2OEH A;  4KLL A;  4KLF A;  1HUZ A;  2AQ4 A;  7ICV A;  4JV2 A;  2JH1 A;  2G06 A;  2ISO A;  5J8Y C;  4UB2 A;  1XSN A;  4QZE A;  1DOQ A;  1D8Y A;  2W9M A;  4PPX A;  9ICM A;  3KTQ A;  2WB1 C;  9ICP A;  2AGO A;  4NXZ A;  5KFZ A;  3PX6 A;  5HP4 A;  2BDP A;  1X6I A;  3T5H A;  8ICR A;  4RQM A;  5IIK A;  3PZP A;  4YXM A;  1SL0 A;  1T94 A;  2OYY A;  1DGS A;  1V97 A;  2KEY A;  3GIM A;  4GLX A;  4ECX A;  3GZF A;  3K1R B;  4FO6 A;  5DQG A;  2W9B B;  5DBB A;  1Q3U A;  3WK6 A;  1JI7 A;  1SIJ A;  4UBC A;  4ED3 A;  4KLU A;  2F8L A;  5DKW A;  3TI0 A;  4J9S A;  5EOZ A;  4FZL A;  1TV9 A;  4YR3 A;  1ZQD A;  3NTU A;  1CEZ A;  3N7R C;  1ZQF A;  3MR3 A;  3ZDD A;  4XUS A;  2HHX A;  3M7D A;  2F76 X;  4MFF A;  3OSP A;  1ZQK A;  1KW4 A;  5J0S A;  4O3P A;  1IG6 A;  5EWG A;  4I28 A;  1ZQS A;  4ZOH C;  4M9N A;  1J2N A;  3BQ7 A;  2C28 A;  4GXK A;  4AYB C;  3M8R A;  2LYH A;  3SEI A;  1NKB A;  4OJL A;  1JRP A;  1ZJM A;  5KFC A;  1A76 A;  2EZX A;  4I2I A;  5DLF A;  4Z6E A;  5ALV A;  1DGJ A;  1ZRM A;  4YMO A;  1T3Q A;  2C2R A;  1Z1B A;  1KBU A;  3ZD9 A;  2EAM A;  2WF6 A;  3BZK A;  5JRT A;  2HOI A;  3NVV A;  1QQ6 A;  4BUG A;  3AEV A;  1ZQC A;  4F3O A;  2XY6 A;  5AKZ A;  5DG8 A;  5BPC A;  2Y1I A;  2IBK A;  1ZQN A;  4C8M A;  2KNJ A;  3B9J A;  5ALL A;  4FBT A;  2XID A;  3PSP A;  2YY6 A;  4RZR A;  5EE1 A;  1N61 A;  4UB6 U;  5L1I A;  4DFD A;  1XS9 D;  2I1Q A;  2YMP A;  9ICR A;  3C5G A;  2ZIV A;  3TAD A;  3JPN A;  3V72 A;  5AKK A;  5L1K A;  4M6W A;  2RHF A;  4ED2 A;  4KIT B;  1LVH A;  3T3F A;  2HVI A;  2KJ5 A;  2JR5 A;  1PZN A;  2W43 A;  1L7O A;  5J2K A;  3OJS A;  2AJQ A;  5JUM A;  1HUO A;  4ELU A;  9ICH A;  5E79 U;  1L5U A;  1QSY A;  3WKC A;  4KMO B;  4DQQ A;  2DKZ A;  3PW4 A;  1PK3 A;  5AIC A;  1NJY A;  1SB3 C;  5DGB A;  1BPE A;  5KT7 A;  5KFV A;  1AQ6 A;  1NNL A;  3F53 A;  5DG7 A;  4I2B A;  4J03 A;  1Q46 A;  4ED7 A;  1KDH A;  5KG6 A;  1VLB A;  1XNS A;  1ZQZ A;  5ALI A;  8ICG A;  3AU2 A;  1YZ6 A;  3C1Y A;  2ZTC A;  2FPM A;  2NRT A;  1QCK A;  2JEJ A;  4KX3 A;  5K4L A;  2HVH A;  1VDV A;  4O3Q A;  3NAS A;  1ZQI A;  2YTU A;  3CYM A;  5AI5 A;  2YB4 A;  4KTQ A;  3V6J A;  4DL4 A;  1BPX A;  3UM9 A;  4B6J A;  4BWM A;  4DL7 A;  4P4P A;  3UXP A;  1SWW A;  3QU5 A;  4OD0 A;  1KFS A;  3DEE A;  2KHQ A;  3J81 j;  4RQ1 A;  3RB0 A;  5HHI A;  1X6J A;  5ALS A;  4J9N A;  1S77 D;  4NLZ A;  1B43 A;  7ICS A;  4B9L A;  1RM6 C;  3C28 A;  1JX4 A;  3RRG A;  2A1A A;  5CR0 A;  5KFW A;  3RF9 A;  5KFK A;  4XA5 A;  1L8L A;  3BQ0 A;  1LB2 B;  9ICJ A;  5KFG A;  3OGU A;  4I2D A;  5DB8 A;  1XO0 A;  3BZC A;  2BCV A;  3SAH A;  4OJ6 A;  5KT4 A;  4LZD A;  3CRX A;  2JZB A;  4MF8 A;  3PW5 A;  3GII A;  2CRX A;  5D46 A;  2YQE A;  8ICJ A;  4EBD A;  2LMR A;  5KG1 A;  2W7O A;  2ZIW A;  2HHU A;  2KFZ A;  2NRV A;  3GIK A;  5ALE A;  1RQN A;  4NLK A;  2PXI A;  4J9K A;  2P6U A;  4TUS A;  4UBB A;  1SWV A;  2JGA A;  4PL2 A;  4B9S A;  4CCH A;  2BDU A;  2KOB A;  3MC1 A;  2F1H A;  2JEI A;  3QX7 A;  4O5C A;  4DOA A;  7ICK A;  2K89 A;  5HNK A;  4ECW A;  3QUT A;  1BPZ A;  7ICQ A;  2KP7 A;  3Q8K A;  1NK0 A;  4RT3 A;  3LVW A;  3RJK A;  9ICA A;  4GC7 A;  4YCX A;  2KKP A;  2ALZ A;  3DV9 A;  3G6X A;  5ALF A;  4HAI A;  1NJX A;  5AI8 A;  4YMN A;  3M9O B;  4Y2Y A;  1J97 A;  2W7P A;  2JMG A;  3V7L A;  5B66 U;  2ZXI A;  3FM9 A;  4O3S A;  2P6R A;  1D8B A;  4JB3 A;  5AHX A;  8ICV A;  3JPP A;  2DQN B;  2GOL A;  3N4M B;  5ALT A;  5J2F A;  1H38 A;  2JHD A;  1S76 D;  4QZA A;  1EXN A;  4QWC A;  1XU4 A;  4PGX A;  2D8C A;  3H8M A;  2PFN A;  2KFN A;  5AM1 A;  1KFT A;  3PST A;  1NK6 A;  7ICU A;  1X2I A;  4ECV A;  5JU5 A;  3H4B A;  3U26 A;  4EZ6 A;  5ALG A;  2VAN A;  4QIW F;  1MC8 A;  2YB1 A;  2GWS A;  5HR7 A;  3MGV A;  4NLB A;  1UT8 A;  5AKH A;  3GFK B;  4BX9 C;  4F5N A;  4DO9 A;  7ICI A;  2KJ9 A;  2G0A A;  4YG2 A;  1Y88 A;  3ETL A;  1F5S A;  5KG5 A;  4RU9 A;  1Z19 A;  2KMD A;  2Z7J A;  9ICT A;  2F3N A;  1X66 A;  2J6U A;  3PW7 A;  4DQS A;  4DL3 A;  3D2S A;  4CF5 A;  4CNQ A;  3MFH A;  1ZOL A;  4DWI A;  2VA2 A;  4OJP A;  3BS5 B;  4Y2U A;  3RJE A;  5KT2 A;  1C7Y A;  4J9M A;  7ICO A;  4GXJ A;  3N7P D;  5CEH A;  3IM1 A;  2KIW A;  4F4Z A;  1TK5 A;  1JXL A;  4IS7 A;  5AKX A;  5B5E U;  5J0P A;  4RT2 A;  4F4Y A;  4PL1 A;  2BCU A;  8ICN A;  1TAQ A;  1FO4 A;  3SAF A;  4C0Z A;  1ZQP A;  4DSE A;  4EEY A;  4BXO B;  4Q43 A;  2ZJ5 A;  1ARO P;  4CRX A;  1BVS A;  5J2D A;  3QZ8 A;  2AU0 A;  4KLH A;  3H0M B;  8ICU A;  2LM1 A;  4R65 A;  5ALQ A;  3UQ2 A;  4DFP A;  1ZQT A;  9ICW A;  4PZN A;  1X9M A;  3HW8 A;  2WF5 A;  1XSP A;  3ZD8 A;  4B9V A;  4ECU A;  3UMG A;  1DRG A;  2HHT A;  2ZIU A;  4JV1 A;  1PK1 B;  4F4K A;  3RH4 A;  4YXJ A;  4FFD A;  4R63 A;  2G5I B;  2KZ3 A;  2XO7 A;  3O0F A;  1XO1 A;  4UB1 A;  2KJ8 A;  2A1J B;  2W54 A;  4NLC A;  8ICE A;  1LV5 A;  4TQS A;  5HR6 A;  4ELV A;  5KFY A;  2XVT A;  3QEB Z;  1RQL A;  5J0Y A;  8ICO A;  2KZZ A;  4C7Z A;  2RLT A;  3SEN A;  3NVW A;  1NI3 A;  1TVA A;  2E8O A;  3PSF A;  4DL2 A;  4RPZ A;  4QWA A;  5AM0 A;  2PMZ C;  5L1M A;  4P2H A;  2W9A A;  2OHF A;  2P66 A;  1K1Q A;  3KZX A;  3KZI U;  3Q8L A;  3VC8 A;  1M6Y A;  1S0N A;  4DF8 A;  1MSW D;  1BNO A;  3BS5 A;  3HWT A;  5KT3 A;  1XWL A;  4UAR A;  2HI0 A;  3PMN A;  1IM4 A;  4ED8 A;  2PKE A;  3E58 A;  2YX8 A;  4QW8 A;  2MA1 A;  3M6Z A;  4UAU A;  5KT5 A;  3R9K A;  2BZF A;  7ICJ A;  4FZM A;  4QZ9 A;  1U48 A;  1MA7 A;  3MFI A;  4NWI A;  4BXO A;  1ZD2 P;  1SV0 C;  1IV8 A; 
#chains in the Genus database with same CATH homology
 2EAN A;  2Y9T A;  2EAO A;  2EAM A;  5JRT A;  2KSO B;  1UCV A;  1F0M A;  3HIL A;  2D3D A;  4PZN A;  1X40 A;  4NL9 C;  1B0X A;  2FE9 A;  1PK1 A;  4RQM A;  1B4F A;  1PK1 B;  2JV3 A;  1V85 A;  1UQV A;  1SXE A;  2D8C A;  2QB0 A;  3H8M A;  5F3X B;  3TAD A;  2K60 A;  3KKA A;  1SV4 A;  2Y9U A;  4PZO A;  2DKX A;  3K1R B;  2QAR A;  5KNI A;  3BS7 A;  2ESE A;  2QKQ A;  1COK A;  3SEN A;  2QAR B;  5JU5 A;  2E8O A;  1JI7 A;  1SGG A;  1SXD A;  4RQN A;  3IDW A;  1RG6 A;  1LKY A;  2B6G A;  1DXS A;  2LMR A;  2E8N A;  3TAD C;  5L1M A;  2DKZ A;  3KKA C;  1LKY B;  2EAP A;  1Z1V A;  2QB0 B;  1PK3 A;  2DL0 A;  2KMD A;  1WWV A;  2K4P A;  1V38 A;  1X9X A;  2ES6 A;  2F3N A;  1X66 A;  1KW4 A;  3BS5 A;  1SV0 A;  2LPE A;  4MHV A;  3BS5 B;  2KSO A;  2KIV A;  2L5Y A;  2KE7 A;  1WWU A;  2QB1 A;  2E8P A;  3BQ7 A;  3SEI A;  2GLE A;  4NL9 A;  1OXJ A;  4IS7 A;  1OW5 A;  2F8K A;  2YTU A;  2E8M A;  2KG5 A;  4NJ8 A;  2F44 A;  3TAC B;  5JTI A;  5J8Y C;  5J8Y A;  1SV0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...