1LL5A

X-ray crystal structure of ampc wt beta-lactamase in complex with covalently bound imipenem
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
358
structure length
351
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-lactamase
publication title Structural Basis for Imipenem Inhibition of Class C beta-lactamases
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 113
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ll5A00
3C4OA 5CTNA 4LCLA 1NY0A 3V3RA 3IWQA 1MXOA 4KZ6A 3SOIA 4OH0A 2XQZA 3UE1A 1GHIA 1K4EA 3BLSA 3G2ZA 3PAGA 3ZG0A 2EX8A 5GHXA 1FCMA 4R3BA 5GL9A 5HAPA 3Q07A 1KE3A 4WMCD 2HP9A 1IKIA 1HZOA 1TDLA 2CC1A 1YLJA 2EFXA 1IYQA 3A3JA 3D4FA 2G2UA 4C6YA 1LL5A 2P9VB 5FI7A 4S2PA 2WK0A 3GVBA 3VP2A 1DJBA 3TOIA 1GCEA 3FKVA 4WEKA 3IQAA 4KENB 2EX9A 4LV2A 2Y2KA 4ZJ1A 3HUOA 5HARA 2X02A 3FKWA 4GD8A 5J8XA 4DXBA 4ZDXA 3QHYA 4BL3A 5G18A 2ZC3B 1E4DA 4A5RA 4P87A 2QPNA 1XKZA 2WYXA 3P98A 4X53A 1HVBA 2J9PA 2EFUA 1DY6A 3VFHA 4JF5A 3MXRA 4IBXA 5TFQA 2WGWA 3LEZA 3M6BA 3CZDA 3HLBA 1KE4A 4MBKA 1I2SA 4FH2A 4JLFA 3E2KA 4OQ0A 3C7UA 5DTTA 2Y2MA 5AQAA 2Y2LA 2Z2LB 5FQMA 4C75A 3AGFA 2XDMA 3PBOA 4GN2A 5FQJA 1KDWA 4BL2A 4WZ5A 1VM1A 3NCKA 4ZJ3A 3G4PA 1QMEA 2Z2MB 5U47A 4OQIA 3UPPA 4OQHA 5FQIA 1IELA 3Q7VA 3VP0A 1CI8A 2JC7A 3VP4A 1K57A 3IT9A 1BTLA 1ZG4A 3Q81A 4GOGA 4OONA 2XFTA 5FAQA 1BT5A 3S1YA 4D2OA 3G30A 5KMWA 1KE0A 2XEPA 5EECA 4OOMA 1XGIA 2RCXA 1SKFA 3LY3A 4KQOA 1W8YA 4PM8A 4K0XA 5EVIA 3BFGA 1IYOA 3MFDA 4ZBEA 3WRTA 3ZHHA 1BUEA 4OVDA 5FAOA 1GA0A 4EWFA 1YM1A 5CEBA 1M40A 4H8RA 1K57C 1M6KA 3WS2A 4WELA 3UDFA 1ZKJA 1SHVA 3LY4A 2BLSA 4KZAA 5AQ9A 5CRFA 3ZFZA 1GHMA 3UE0A 3FV7A 2QZ6A 4UA7A 3O87A 4UHUA 2ZC6B 4M3KA 4WM9A 5F82A 3RXXA 2HDUA 1YLPA 4OPRA 3V3SA 4MNRA 3A3IA 2HPBA 1MPLA 3G31A 3V5MA 5A92A 2Q9NA 5A90A 2EX6A 5EOOA 3ZG5A 2ZM8A 1FR6A 3OZHA 4FSFA 2Y55A 2EXAA 3BM6A 3G34A 5CGXA 2C6WB 1N4OA 3RXWA 2ZQDA 3PBQA 4X55A 1ALQA 1H8YA 1WYCA 2WKEA 4DXCA 3HLWA 1BLSA 1YLZA 2XK1A 4KZ8A 4OOYA 2P74A 3VOYA 1L0GA 3GQZA 2HDSA 1JTGA 2FFFB 3IXBA 2ZQ7A 2OLUA 4S2JA 1KVMA 5CHUA 1Y54A 1LI0A 3IF6A 3NDEA 3A3FA 1CK3A 3WS1A 3DW0A 3C7VA 4UA6A 1W5DA 3DTMA 1ES3A 5EPHA 1K38A 5GLBA 5M1AA 4E3MA 1RP5A 5E2HA 2DRWA 3S4XA 1XA1A 3W4PA 1BLHA 4GNUA 3PBRA 3EQVA 3O3VA 2ZC5B 4RX3A 2OV5A 3MBZA 3M2KA 3IF6C 3PAEA 3ZDJA 4WZ4A 1PZPA 1KVLA 3A3DA 3MKFA 3NDGA 1MWTA 2Y59A 1SDEA 1XXMA 5HAQA 2RL3A 1IKGA 2V1ZA 5CHMA 3DWKA 3HLEA 3UPOA 3UDXA 3FYZA 1H8ZA 3TG9A 4BD1A 2HP6A 3M6HA 4KG5A 3VOZA 4LENA 2Y2HA 4K0WA 2XH9A 2ZJ9A 1H5XA 1PIOA 3VFFA 3W8KA 4JXWA 3IHBA 3EQUA 4R3JA 3SS3A 2ZMAA 3C4PA 4RX2A 4RYEA 3WS0A 5EVID 2WGVA 3QNCA 4MLLA 5EOEA 1Z6FA 4KZBA 1CEGA 1LHYA 1K55A 4P0MA 5A93A 1BULA 1Q2PA 3HLDA 3GMWA 5FQQA 3VP1A 1FSWA 1TVFA 1ESUA 5IHVA 5M18A 5CTMA 2JE5A 1K54A 2Y2OA 5FI2A 2Y2NA 4UA9A 4KQRA 4BLMA 2XR0A 2ZC7A 3FWLA 4S2OA 4FH4A 5HL1A 1EWZA 1C3BA 2J9OA 3UE3A 5DVAA 4IEDA 4LV1A 3HUMA 4OOLA 3UPNA 3VSKA 1PW1A 4GDNA 4P6BA 1PZOA 2JCHA 1HTZA 3OPHA 4EV4A 1FQGA 4N9KA 3Q7VB 3NY4A 5DF7A 3LO7A 5HFOA 4FCFA 4OP8A 5GHZA 5I94A 2ZD8A 2Y2GA 4N92A 4Y0OA 4XUXA 1GA9A 1SDNA 5EVIB 3UNWA 2Y2JA 5FASA 1JVJA 3HLFA 4S2IA 2OSUA 2H0TA 1XPBA 4S2LA 4GZBA 4GD6A 3N8LA 1K56A 4NETA 3VP3A 1N9BA 1L2SA 4JF4A 1E3UA 3IWIA 2Y91A 1MWUA 3GR2A 3Q82A 5FQ9A 4WZ5C 5FI6A 3SH8A 4PM9A 1W8QA 3IXHA 1BLPA 1PI5A 3O88A 3NIAA 3UN7A 2WKIA 4R4SA 2ZQAA 5E2EA 3IHAA 4JKTA 2R9XA 1MBLA 2EX2A 4KZ3A 4ZJ2A 4E3LA 1XA7A 3RJUA 1BSGA 1YQSA 1L0DA 1FSYA 3I7JA 2A49A 3MZDA 4S2NA 2XFSA 4CJNA 5E2FA 1LI9A 3ISGA 1JWVA 4MEZA 2H5SA 5F83A 2XD1A 1TDGA 4N9LA 1PW8A 5GLCA 4ZAMA 2XD5A 4OPYA 5EVIC 4B4XA 3P09A 2I72A 2X71A 4E3IA 2X01A 1L0FA 1RCJA 1YMXA 3VSLA 3G2YA 3OCNA 5F1GA 1BZAA 3IF6B 3WWXA 5EVLA 2VGKA 5CGWA 2G2WA 4GB7A 5JYPA 3GV9A 4PPRA 3N8RA 1EROA 2HDRA 3GRJA 5FAPA 4PMAA 1NYMA 4HESA 5DTKA 4QD4A 1E25A 4OLDA 4K91A 5KZHA 4KG2A 4N1XA 4S2KA 1NZOA 5BOHA 3GTCA 1ESIA 3PBTA 3S22A 2ZQ9A 1JWPA 2PBYA 3HREA 4Y0TA 3OCLA 1NXYA 4MBHA 5CXWA 4Q8IA 1JWZA 3HUNA 1ES5A 1K4FA 2V20A 3SS4A 3MKEA 2ZM0A 1QMFA 5HW3A 1W7FA 1HD8A 4R23A 4B88A 1TEMA 2V2FF 1Q2QA 3JYIA 1BLCA 4IVIA 3PTEA 4JF6A 1ONHA 4X56A 1L0EA 4S2MA 3ZVWA 4E6XA 4EBLA 4R4RA 1NZUA 2IWCA 3V39A 4BENA 2Y4AA 5KSHA 1NYYA 4BQMA 3SH9A 3BYDA 3G35A 1IYPA 3HLCA 4QB8A 2EXBA 4BJPA 1DJCA 2ZM2A 3ZG9B 3Q7ZA 4U3TA 4DRTA 1YLTA 1JTDA 2BG1A 4KZ5A 5AQBA 3HL9A 4DE2A 4DE0A 1J9MA 2PU2A 4DF6A 2DCFA 5DF8A 3IXGA 1I5QA 3OPRA 3CMZA 3IWOA 1PYYA 3OPPA 4LCMA 4Z9QA 1K56D 2ZQ8A 4XUZA 4UAAA 1IEMA 2WZXA 5TR7A 3BRMA 1MWRA 5FQKA 4YINA 5TGFA 1E3UD 2C5WB 4OLGA 5GLAA 4DKIA 4IBRA 5FA7A 3ZNYA 1KGFA 1LLBA 1IYSA 3HBRA 5FATA 2WUQA 3G32A 2QMIA 1MY8A 4Y7PA 5CGSA 4IVKA 5GLDA 4B4ZA 3UO9A 3BECA 4LV0A 4JBFA 4R1GA 1FR1A 4WBGA 4KG6A 4KQQA 1NRFA 2WGWB 1ERQA 1S0WA 5CHJA 4QHCA 3LCEA 4X6TA 4CPKA 2GDNA 5D3OA 3N8SA 5KSCA 1K25A 3FZCA 1KGGA 3N7WA 2XLNA 1S6RA 4QU3A 1K55C 1CI9A 4OPQA 5GHYA 4HEFA 1ES2A 2ZLYA 3MXSA 1KDSA 4E3KA 4ID4A 1K54C 1YLYA 4WYYA 1XX2A 3OC2A 4JXGA 3ZCZA 4GKUA 4E6WA 1SCWA 4ZTKA 4LV3A 1W79A 1XGJA 2UWXA 3IXDA 2J8YA 1WYBA 4HBUA 1RGYA 4DDSA 1G68A 1OMEA 2WKHA 1YMSA 2P9VA 2R9WA 3M2JA 1I2WA 4P85A 3W4OA 3E2LA 5AQ7A 1G6AA 1ERMA 1WE4A 3PBNA 1AXBA 2B5RA 3NC8A 4KZ4A 4EQIA 3NBLA 4KZ7A 5HX9A 4PM6A 2VGJA 3SS5A 1K6SA 2WAFA 3WRZA 2ZC4B 4QY6A 2IWDA 3VMAA 5FDHA 1PI4A 2FFYA 4U0XA 2JBFA 2ZQCA 3CJMA 1NJ4A 2H0YA 5EUAA 2DNSA 3HVFA 4JXVA 1FCNA 3UY6A 1ONGA 5FSRA 4HBTA 3WS5A 4OKPA 4DDYA 3MZFA 3AGEA 3BFFA 1MKIA 4F94A 1O7EA 1YT4A 3O86A 3BFCA 3BFEA 5JYOA 1XP4A 4NK3A 4EBPA 3DWZA 2J7VA 4WMCA 3ZG7B 2WGIA 4MBFA 2WAEA 4BD0A 3A3EA 4Y0UA 5CERA 3ZNTA 4DE1A 3OPLA 2Y2QA 5DF9A 2E8IA 3N4IA 4S2NC 3WS4A 1O07A 3GSGA 1PWGA 5M19A 3BLMA 4YFMA 2XF3A 4U0TA 4FD8A 5F1FA 5CECA 3W4QA 3AGDA 2IWBA 4QJGA 3MZEA 3V50A 3N6IA 1YLWA 1ZG6A 4RA7A 5EE8A 3ITBA 2Y2PA 4O7DA 5HAIA 1LL9A 4OPZA 1FOFA 1GHPA 3Q1FA 3ZVTA 2PU4A 4WEJA 4X69A 4E3NA 4EBNA 4JXSA 4N1HA 4R0QA 2XGNA 4L0LA 5L2FA 2Y2IA 5E2GA 4OQGA 3SH7A 4XXRA 1ZC2A 3ITAA 3QNBA 3B3XA 3HLGA 1PWDA 3PBSA 2OLVA 5DTSA 5A91A 3ZGAB 3TSGA 3ZG8B 3CG5A 1DJAA 3BFDA 3NI9A 3UDIA 4E3JA 1VQQA 4PM5A 4OP5A 1MWSA 1U60A 1FCOA 2H10A 3BEBA 2HDQA 4C3QA 4E3OA 4RVAA 2HP5A 4GDBA 2WADA 1CEFA 4EUZA 2Q9MA 3IH8A 3IF5A 1K6RA 4KZ9A 4DE3A 1ES4A 1PWCA 1EI5A 5CEDA 4PM7A 4X68A 5E43A 4QY5A 2A3UA 4JPMA 3IH9A 2WZZA 3C5AA 1KGEA 1RGZA
chains in the Genus database with same CATH superfamily
5CTNA 3V3RA 4OH0A 2PBDP 3UE1A 4CLCD 1GHIA 1MZUA 3BLSA 4IUKA 3ZG0A 2Z6DA 5HAPA 5IT5A 3Q07A 4FUWA 4WMCD 4CQHA 1TDLA 2CC1A 2GJ3A 1IYQA 4RQ9A 3UB8A 4HIAA 2WK0A 1FIKA 3DTKA 1N9LA 5DKKA 5HPIA 1SKOA 3T4LA 2X02A 1F9IA 4BL3A 3S7NA 2PD7A 2ZMFA 2WYXA 2J9PA 2EFUA 3KYEA 3LGOA 4JF5A 3UE6A 2WKQA 5TFQA 1AWIA 3LEQA 4FH2A 4Q0HA 5AQAA 2Y2MA 4Q0IA 2Y2LA 2Z2LB 5FQMA 4GN2A 4BL2A 1OTEA 1KDWA 4HP4A 4ZJ3A 4MCWA 3T4QA 2QYBA 4OQIA 2W1TB 3K3DA 3ULFA 5FQIA 3VP4A 1K57A 1ZG4A 3Q81A 4NKPA 3A0RA 3LUQA 3LY3A 1W8YA 4K0XA 4M4XA 1IYOA 4ZBEA 4OVDA 5FAOA 3WS2A 4WELA 1VEUB 3UE0A 3FV7A 2HZ5A 4UHUA 2ZC6B 3V3SA 2XA7S 1FR6A 3G34A 2ZQDA 4X55A 4DXCA 1H8YA 2WKEA 1BLSA 1YLZA 4Q0JA 3KYQA 3MXQA 1T19A 3DW0A 3C7VA 1XFQA 2XA7M 1UWPX 4UQIS 1XA1A 2MJ6A 5C5KA 2ZC5B 3CI6A 3JVVA 3MBZA 3PAEA 3IF6C 4WZ4A 1KVLA 3NDGA 1MWTA 1SDEA 5EM0A 3SW1A 3GDIA 1CQAA 2GX5A 2HP6A 4E04A 4UQIM 5L8MA 2Q0OA 4G3VA 3VFFA 3EQUA 2XRNA 3SS3A 4I5SA 3NULA 4RX2A 2YKHA 4KZBA 4PAUA 1TVFA 5J3WA 3LIDA 4WL9A 4KQRA 2XR0A 2ZC7A 4R3AA 5HL1A 1C3BA 2O0YA 4R70A 5DJUA 3HUMA 3LR0A 1SZVA 1PW1A 1HTZA 3Q7VB 5F68A 2V1BA 5DF7A 5HFOA 3LR5A 4OP8A 5I94A 2ZD8A 4N92A 5EVIB 3UNWA 5FASA 3LR4A 2G7UA 3N8LA 2OWHA 3VP3A 1L2SA 5FQ9A 1F2KA 4WZ5C 1W8QA 3LI8A 4JKTA 1MBLA 2EX2A 3RJUA 1BSGA 4Y3IA 3I7JA 3MZDA 4S2NA 4CJNA 3ISGA 4MEZA 5F83A 2H5SA 1TDGA 3K3CA 4HI4A 1PW8A 5F5YA 5GLCA 4ZAMA 4E3IA 3BQAA 2I72A 1L0FA 1RCJA 2W3FA 5F1GA 3IF6B 1ZTUA 3DTIA 5CGWA 3DTEA 2VV6A 3L7HA 3MSHA 3OOVA 4KUOA 3S7PA 5KZHA 1S67L 4BMWA 3GTCA 1ESIA 1P9WA 2PBYA 2NUTC 4Y0TA 5CXWA 3SS4A 1ES5A 1NWZA 1STZA 2ZM0A 3FG8A 1W7FA 1HD8A 2VV7A 1TEMA 3JYIA 1BLCA 4X56A 4E6XA 4S2MA 3ZVWA 2VKSA 1NZUA 2IWCA 4R4RA 1VEUA 4BJPA 4U3TA 3VV4A 1JTDA 2PYPA 4DE0A 5HWTA 3C30A 2DCFA 4LCMA 3QP8A 1K56D 4DJ2A 3H82A 1MWRA 4DKIA 2LB9A 5HPFA 5EV0A 1LLBA 5HD5A 2OOLA 2WUQA 3G32A 4Y7PA 2ZL1B 5L09A 4I38A 4B4ZA 2K2NA 4JBFA 4R1GA 5CHJA 3T12B 5HZHA 4QHCA 3NHQA 5KSCA 1KGGA 2J80A 1CI9A 4R38A 2ZLYA 2ZOHA 1KDSA 2KDKA 4WYYA 3OC2A 3ZCZA 4ZTKA 4LV3A 5HDCA 1XGJA 4O8GA 1OMEA 2WKHA 2R9WA 1I2WA 3W4OA 3PBNA 4L9EA 2PAVP 5FEFA 3NBLA 4PM6A 4QY6A 4KUKA 4ME4A 2FFYA 3LI9A 2V0WA 5FSRA 4HBTA 3WS5A 3PYPA 3AGEA 3BFFA 3P01A 4EBPA 2J7VA 3K2NA 4EEUA 2WAEA 1XJ4A 2WKPA 4R6LA 3OPLA 4CLCC 4I39A 1YSPA 3T4KA 5F1FA 2HGVA 3AGDA 3N6IA 1YLWA 5EE8A 3F1PA 3ICYA 1GHPA 4D60A 3Q1FA 2PU4A 1H0MA 3KSHA 4OQGA 4Y15A 3QNBA 1NLZA 3PBSA 4X1LA 3ZGAB 4LRXC 3ZG8B 4EEPA 1DJAA 3BFDA 1FCOA 5HDDA 4G3KA 1S66L 3IF5A 1K6RA 3H9WA 1ES4A 1PWCA 1J3WA 1WYBA 3W2ZA 1KGEA 1NY0A 3IWQA 1MXOA 3T1RA 3G2ZA 2EX8A 3CLOA 2A24A 1KE3A 2HP9A 2XSSA 1HZOA 2EFXA 4Y13A 3A3JA 1X0OA 1LL5A 5FI7A 4S2PA 3GVBA 1DJBA 3C2WA 1GCEA 3UMEA 3RFBA 1S4RA 3D3OA 4ZJ1A 5HARA 3SZTA 2ZC3B 1DY6A 4CLCB 4IBXA 3M6BA 3HLBA 4OQ0A 5DTTA 3QP4A 4C75A 2XDMA 4WZ5A 1VM1A 3NCKA 2W1RA 1TS8A 3EOIA 4HH2A 3UPPA 1PNEA 2LB5A 1IELA 2VGLS 1VETB 1D7EA 3S1YA 4GOGA 2EWWA 1XGIA 4KQOA 4H6JA 4HJ6A 3BFGA 1DP9A 3WRTA 2BTFP 2HF6A 4EWFA 4HQAA 3L9KA 2VA0A 2GNXA 1SHVA 3LY4A 2BLSA 4KZAA 3BW6A 3ZFZA 1GHMA 4CLCE 4UA7A 3F1OA 3RXXA 5DFYA 4MNRA 3A3IA 2HPBA 3T4TA 3G31A 5A92A 2Q9NA 2EX6A 3OZHA 2Y55A 3QP5A 2C6WB 3TJZC 1S1YA 4NEED 2V8CA 3GQZA 1HLUP 1JTGA 2FFFB 5HWWA 4S2JA 5CHUA 1LI0A 3NDEA 1CK3A 2QJ7A 1MKMA 5EPHA 2V8FA 5GLBA 1XJ3A 5M1AA 4EESA 3U4LP 3W4PA 3U2AA 2OV5A 4FTXA 3M2KA 3MKFA 1XXMA 2RL3A 3UDXA 3TG9A 4BD1A 3BWLA 5FEGA 5AVFA 1LSXA 1YPRA 4R3JA 2P7JA 2ZMAA 1DRMA 1EW0A 3C4PA 4YOFA 1XFNA 2WGVA 2QJ5A 2HJEA 4P0MA 1Q2PA 3HLDA 1LSWA 4EQ1A 5AVEA 3VP1A 5M18A 3BY8A 5CTMA 2Y2OA 5FI2A 4UA9A 1OTDA 1EWZA 4HOIA 3UE3A 5TBMB 3KYZA 3TW8A 4O01A 4GHIA 3MQ0A 2M7VA 1PZOA 2UV0E 2JCHA 4EV4A 1TF1A 2PD8A 4XUXA 5F6AA 2W3DA 2Y2JA 3HLFA 4S2IA 4WLAA 2H0TA 4GJ4A 4S2LA 2L1MA 4NG2A 4NETA 1UWNX 1E3UA 3IWIA 2Y91A 1MWUA 3GR2A 3IS2B 3Q82A 1W63Q 5FI6A 4PM9A 3O88A 2WKIA 4R4SA 5E2EA 1XA7A 2W3EA 1L0DA 3IX4A 2A49A 2XFSA 1PFLA 2XD5A 2O9BA 5EVIC 2J3WA 2VEAA 3OCNA 2HDRA 4Z1WA 1S4SA 4HESA 4QD4A 4S2KA 3T4SA 4Q8IA 3HUNA 1K4FA 1ZHHB 3IX3A 3BQ8A 1TS0A 4B88A 4R23A 4EUVA 4IVIA 4EBLA 4BENA 1NYYA 3SH9A 3BYDA 4QB8A 1DJCA 2VV8A 1OT9A 4KZ5A 3HL9A 1J9MA 1LT0A 5DF8A 3IXGA 1I5QA 1T18A 3UB6A 2ZQ8A 4UAAA 1IEMA 5TR7A 3BRMA 5FQKA 4YINA 3D72A 5G4ZA 4IBRA 3ZNYA 5FATA 1NLYA 1KOUA 2EWVA 3BECA 4LV0A 4KQQA 4F3LB 1NRFA 1S0WA 4X6TA 4CPKA 4EXOA 2GDNA 3B42A 3GECA 5FDSA 3FZCA 3N7WA 4QU3A 1ES2A 4E3KA 1IFQA 4WF0A 1K54C 4JXGA 3JPUA 1W79A 2UWXA 2J8YA 1G68A 3LIAA 3UB7A 3E2LA 5AQ7A 1WE4A 1ERMA 1AXBA 2R78A 4EQIA 2EA9A 3MMHA 2J3TC 4KZ7A 5HX9A 1N9NA 4GW9A 3SS5A 2WAFA 3WRZA 2AVXA 5FDHA 1PI4A 1OTBA 3CJMA 4JXVA 1FCNA 3UY6A 1ONGA 1OT6A 4OKPA 3MZFA 1O7EA 4PKYG 5HSQA 4NK3A 3DWZA 2WGIA 4DE1A 3T4JA 2B18A 4X25A 3ZQ5A 1TD5A 3WS4A 3KSIA 2W1TA 5M19A 4YFMA 2E8JA 4FD8A 4EETB 3W4QA 4QJGA 2W3GA 2M7UA 3ITBA 4GCZA 1YKDA 1PRQA 3TRCA 4L0LA 2Y2IA 5DTSA 3CG5A 2A2LA 3BEBA 2HDQA 1CEFA 2VX8A 3IBRA 4KZ9A 1WA9A 4QY5A 2A3UA 4JPMA 2FH5A 3C4OA 4NXBA 4KZ6A 1VHMA 1FCMA 4R3BA 4ZRRA 4GS9B 3A0SA 1IKIA 1YLJA 2BASA 1K0KA 2G2UA 2P9VB 2B95A 3VP2A 3TOIA 2O9CA 4WEKA 3IQAA 4HH3A 2EX9A 3B47A 2Y2KA 3HUOA 2KOIA 2ACGA 3FKWA 4GD8A 4DXBA 3QHYA 4YWZA 4P87A 2JHEA 2QPNA 1XKZA 3P98A 2XROA 4DN0A 3MXRA 4DMZA 1KE4A 5L10A 1I2SA 2DMWA 4JLFA 3E2KA 3C7UA 3IBJA 3LIEA 1P0ZA 3PBOA 5FQJA 4I3IA 2JKGA 5U47A 1CJFA 1W63M 3Q7VA 3EEAA 1CI8A 5HD3A 2JKTM 2KX6A 3MR0A 3IT9A 4LGWA 4D2OA 5KMWA 1KE0A 4WN5A 2XEPA 4XT2B 2K31A 1SKFA 4PM8A 5EVIA 3MFDA 1GA0A 2PYRA 1YM1A 5CEBA 1K57C 1M6KA 3KSFA 1DP8A 1ACFA 4HJ4A 3O87A 4M3KA 4WM9A 5F82A 2HDUA 4ESPA 1YLPA 3V5MA 5EOOA 3ZG5A 2ZM8A 4FSFA 2EXAA 3MF0A 1N4OA 3RXWA 3PBQA 1ALQA 1CF0A 3HLWA 4UEYA 5F69A 4KZ8A 4OOYA 1L0GA 2HDSA 3IXBA 3D9YA 3PXPA 3IF6A 2ZOIA 1G6OA 3WS1A 3S7QA 4LRYC 1ES3A 1K38A 4GLQA 1RP5A 1BLHA 3PBRA 3EQVA 3O3VA 4RX3A 1PZPA 3A3DA 2Y8HA 2K7SA 2Y59A 1BYWA 3RH8B 5HAQA 1D06A 3UPOA 3DWKA 3HLEA 2IA2A 1H8ZA 3M6HA 4LENA 2XH9A 3JVUA 4JGRA 3A0VA 3R7WB 1SKOB 4RYEA 3WS0A 3PR6A 2HJ9C 4MLLA 5EOEA 1LHYA 3CITA 1GSWA 5FQQA 5AJGA 4BBVA 1K54A 4L9GA 1H8MA 2L4RA 4BLMA 3FWLA 4S2OA 1P9RA 5IS1A 5DVAA 4IEDA 3NOPC 2D02A 4LV1A 4OOLA 2ZL1A 4GDNA 1FQGA 3NY4A 5EVEA 4HHDA 4FCFA 2QHKA 5GHZA 3KSGA 3LICA 2O9AA 1GA9A 1SDNA 2V1AA 3V67A 2OSUA 1XPBA 4GD6A 2YKFA 2PRFA 4JF4A 4JGOA 3UMDA 3O5YA 3IXHA 1BLPA 1PI5A 3UN7A 3NIAA 2ZQAA 3IHAA 5L07A 4KZ3A 4ARZB 4E3LA 4NXGA 1YQSA 1T1AA 4I3JA 1JWVA 3G6OA 4OPYA 5TJJA 4B4XA 2X71A 3T4OA 3VSLA 3WWXA 2PR5A 1OTIA 2G2WA 4GB7A 5JYPA 3GV9A 4QWOA 2FZ0A 4PPRA 3N8RA 1EROA 3GRJA 5FAPA 4PMAA 5I5LA 4B93A 5G4YA 4OLDA 4KG2A 4N1XA 1NZOA 2B02A 4XT2A 1L3LA 3PBTA 3S22A 3HREA 1NXYA 1JWZA 2INWA 3MKEA 5DJTA 5DFXA 5HDSA 4BWIA 2V2FF 1Q2QA 1LSVA 3PTEA 3V39A 2Y4AA 2JKRM 3HLCA 1IYPA 2EXBA 3F1NB 3EGXC 4DRTA 2BG1A 5EM1A 5AQBA 2H28A 1ODVA 1PYYA 4MN5A 4XUZA 3H7WB 5TGFA 1E3UD 2PR6A 3E0YA 5GLAA 5FA7A 3HBRA 3HJIA 3DAVA 5CGSA 4IVKA 4HP9A 4AFIA 2PHYA 4KG6A 1F98A 2WGWB 3LCEA 1JNUA 3DBAA 2XLNA 4Y17A 3S7OA 2HV1A 1K55C 4HEFA 3LYXA 1N9OA 4ID4A 1GSXA 2VJWA 3FPWA 1OPXA 1XX2A 4GKUA 3R7WA 1SCWA 1RGYA 4DDSA 1YMSA 4PKYA 3M2JA 2VK3A 1G6AA 1DP6A 3NC8A 4KZ4A 3CPTB 3E4OA 2OWJA 2GZAA 4I3AA 2IWDA 3BJNA 4U0XA 2ZQCA 1NJ4A 2H0YA 5EUAA 2DNSA 2QKPA 4CLCA 4F94A 1MKIA 1YT4A 3MJQA 1XP4A 4WMCA 3ZG7B 2VLGA 2JKTI 4NXFA 2NUPC 3A3EA 4Y0UA 3N4IA 1O07A 3GSGA 1PWGA 4BBTA 3BY9A 3BLMA 3E98A 5K5BA 4P6ZS 1VETA 4U0TA 1TS6A 2IWBA 3V50A 4DJ3A 2Y2PA 5HAIA 1LL9A 3VOLA 4NXEA 4ARZA 3ZVTA 4WEJA 4X69A 4JXSA 4N1HA 5E2GA 4P6ZM 4XXRA 3H82B 3R4KA 2OLVA 5A91A 3TSGA 3NECA 3CHWP 1H3QA 4OP5A 1MWSA 2H10A 4E3OA 4C3QA 3HCYA 2L0WA 3E4QA 2WADA 1OJGA 2OAQ1 1YAXA 4DE3A 3T1XA 1EI5A 4PM7A 5E43A 3T1QB 2D01A 2WZZA 4LCLA 3SOIA 2XQZA 1K4EA 3PAGA 2PT7A 5GHXA 2Y79A 5GL9A 5J4EA 3F1NA 2ZMVA 4LFUA 3D4FA 4C6YA 4MDZA 5IU1A 3FKVA 2V9AA 4KENB 4LV2A 3H7WA 3CUEC 1F5MA 4PHTA 5J8XA 4ZDXA 5G18A 1E4DA 4A5RA 4X53A 1HVBA 3VFHA 3EEHA 2OAP1 4II7A 4JGQA 2M1CA 2WGWA 3LEZA 3CZDA 2O99A 4MBKA 4HY8A 5TBMA 3AGFA 3LFVA 1NRJA 3G4PA 1QMEA 2Z2MB 4OQHA 3VP0A 2JC7A 3QP1A 3TE8A 1T1CA 3FPVA 1BTLA 3PHYA 4OONA 5FAQA 2XFTA 1BT5A 3G30A 1OTAA 5EECA 4OOMA 2RCXA 2JN7A 3F1PB 3MFXA 3ZHHA 2WKRA 1BUEA 1M40A 4H8RA 3UDFA 1ZKJA 4MN6A 5AQ9A 5CRFA 2QZ6A 2ZBBA 3CPTA 3IS2A 4OPRA 1MPLA 5A90A 3QP6A 4EU0A 5EFWA 3BM6A 5CGXA 4JGPA 3MQOA 1WYCA 2XK1A 2P74A 3VOYA 4Y5FA 2ZQ7A 2OLUA 1KVMA 1Y54A 3A3FA 3MQQA 4UA6A 1W5DA 3DTMA 4E3MA 1XJ2A 5E2HA 2DRWA 3S4XA 3NOUC 3C38A 4GNUA 2A24B 4O0PA 3ZDJA 4WUJA 3KX0X 2JKRI 1IKGA 2V1ZA 5CHMA 5CX7A 1A0KA 3RTYA 3FYZA 4LLOB 4KG5A 3VOZA 2Y2HA 4K0WA 2ZJ9A 1H5XA 1PIOA 3W8KA 4JXWA 3IHBA 5EVID 3QNCA 1Z6FA 3B33A 1CEGA 1K55A 5A93A 1BULA 3GMWA 1FSWA 1ESUA 5IHVA 2JE5A 2Y2NA 1G28A 4Y2FA 4FH4A 4IJGA 1S1ZA 2J9OA 3UPNA 3VSKA 3IX8A 4K08A 5HL6A 4P6BA 3OPHA 3LR3A 4N9KA 1Y28A 4F3LA 4BBUA 3LO7A 2QWSA 1YSQA 2Y2GA 4Y0OA 3LIFA 4H6JB 3E4PA 1JVJA 2W0NA 3C8CA 2P08A 4GZBA 2V0UA 1K56A 3FC7A 1N9BA 3F1OB 3SH8A 4X1MA 2R9XA 4ZJ2A 1FSYA 5E2FA 1LI9A 2XD1A 4N9LA 1FILA 1UGUA 3P09A 2X01A 1YMXA 3G2YA 1BZAA 5EVLA 4MN7A 2VGKA 1OJ5A 1NYMA 5DTKA 1E25A 4K91A 3UB5P 4L9FA 5BOHA 3KO6A 2ZQ9A 1JWPA 3OCLA 4MBHA 2V20A 1QMFA 5HW3A 3EWKA 4JF6A 1ONHA 1XJ6A 1L0EA 5KSHA 4BQMA 3G35A 2J3TD 2ZM2A 3ZG9B 3Q7ZA 1YLTA 1Y4OA 3ZYTA 2Z6CA 4LPZA 2W3HA 4DE2A 5A8BA 2PU2A 4HJ3A 4DF6A 3NOTC 3EGDC 3OPRA 3CMZA 3IWOA 3OPPA 4Z9QA 3VE4A 2WZXA 2VZWA 2C5WB 4OLGA 3HJKA 4YNRA 1KGFA 1IYSA 3CWFA 1VB6A 2QMIA 1MY8A 4GHIB 5GLDA 3UO9A 1FR1A 4WBGA 1ERQA 5D3OA 3N8SA 3VE3A 1K25A 4KQDA 2P04A 3CUEA 1S6RA 5DKLA 4OPQA 5GHYA 3MXSA 4IHQA 3MS6A 2JKFA 1YLYA 4E6WA 3UB9A 5KIZA 4ETZA 4GS9A 3IXDA 4HBUA 1P97A 1LL8A 2P9VA 4IUHA 4P85A 5LBRA 3QP2A 4EW7A 4MMNA 3T1SA 2B5RA 1IOUA 2CMNA 3T50A 4ETXA 2VGJA 4G3WA 1GSVA 1K6SA 1MC0A 2ZC4B 3VMAA 1TS7A 2JBFA 3HVFA 3LIBA 2KLIA 4QPRA 4DDYA 3P7NA 4FOFA 3O86A 4B9OA 3BFCA 3BFEA 5JYOA 3OLOA 4MBFA 4BD0A 5CERA 3ZNTA 2W27A 1T1BA 5DF9A 2Y2QA 3NJAA 1D1JA 2E8IA 4S2NC 2XF3A 4EERA 5CECA 2VGLM 4LRZE 3MZEA 1ZG6A 4RA7A 2I9VA 1G5UA 4O7DA 4OPZA 1FOFA 4HNBA 4E3NA 5MC7A 4EBNA 5J7EA 4R0QA 5L2FA 2XGNA 3SH7A 1ZC2A 3ITAA 3B3XA 3HLGA 1PWDA 1V9YA 1Z09A 3NI9A 3UDIA 4E3JA 1VQQA 4PM5A 1U60A 3OBFA 4RVAA 2HP5A 2PDRA 4GDBA 5HWVA 4EUZA 2Q9MA 3IH8A 1V9ZA 5CEDA 3CAXA 4X68A 5FL3A 3IH9A 3C5AA 1RGZA
chains in the Genus database with same CATH topology
3C4OA 5CTNA 4LCLA 1NY0A 3V3RA 3IWQA 1MXOA 4KZ6A 3SOIA 4OH0A 2XQZA 3UE1A 1GHIA 1K4EA 3BLSA 3G2ZA 3PAGA 3ZG0A 2EX8A 5GHXA 1FCMA 4R3BA 5GL9A 5HAPA 3Q07A 1KE3A 4WMCD 2HP9A 1IKIA 1HZOA 1TDLA 2CC1A 1YLJA 2EFXA 1IYQA 3A3JA 3D4FA 2G2UA 4C6YA 1LL5A 2P9VB 5FI7A 4S2PA 2WK0A 3GVBA 3VP2A 1DJBA 3TOIA 1GCEA 3FKVA 4WEKA 3IQAA 4KENB 2EX9A 4LV2A 2Y2KA 4ZJ1A 3HUOA 5HARA 2X02A 3FKWA 4GD8A 5J8XA 4DXBA 4ZDXA 3QHYA 4BL3A 5G18A 2ZC3B 1E4DA 4A5RA 4P87A 2QPNA 1XKZA 2WYXA 3P98A 4X53A 1HVBA 2J9PA 2EFUA 1DY6A 3VFHA 4JF5A 3MXRA 4IBXA 5TFQA 2WGWA 3LEZA 3M6BA 3CZDA 3HLBA 1KE4A 4MBKA 1I2SA 4FH2A 4JLFA 3E2KA 4OQ0A 3C7UA 5DTTA 2Y2MA 5AQAA 2Y2LA 2Z2LB 5FQMA 4C75A 3AGFA 2XDMA 3PBOA 4GN2A 5FQJA 1KDWA 4BL2A 4WZ5A 1VM1A 3NCKA 4ZJ3A 3G4PA 1QMEA 2Z2MB 5U47A 4OQIA 3UPPA 4OQHA 5FQIA 1IELA 3Q7VA 3VP0A 1CI8A 2JC7A 3VP4A 1K57A 3IT9A 1BTLA 1ZG4A 3Q81A 4GOGA 4OONA 2XFTA 5FAQA 1BT5A 3S1YA 4D2OA 3G30A 5KMWA 1KE0A 2XEPA 5EECA 4OOMA 1XGIA 2RCXA 1SKFA 3LY3A 4KQOA 1W8YA 4PM8A 4K0XA 5EVIA 3BFGA 1IYOA 3MFDA 4ZBEA 3WRTA 3ZHHA 1BUEA 4OVDA 5FAOA 1GA0A 4EWFA 1YM1A 5CEBA 1M40A 4H8RA 1K57C 1M6KA 3WS2A 4WELA 3UDFA 1ZKJA 1SHVA 3LY4A 2BLSA 4KZAA 5AQ9A 5CRFA 3ZFZA 1GHMA 3UE0A 3FV7A 2QZ6A 4UA7A 3O87A 4UHUA 2ZC6B 4M3KA 4WM9A 5F82A 3RXXA 2HDUA 1YLPA 4OPRA 3V3SA 4MNRA 3A3IA 2HPBA 1MPLA 3G31A 3V5MA 5A92A 2Q9NA 5A90A 2EX6A 5EOOA 3ZG5A 2ZM8A 1FR6A 3OZHA 4FSFA 2Y55A 2EXAA 3BM6A 3G34A 5CGXA 2C6WB 1N4OA 3RXWA 2ZQDA 3PBQA 4X55A 1ALQA 1H8YA 1WYCA 2WKEA 4DXCA 3HLWA 1BLSA 1YLZA 2XK1A 4KZ8A 4OOYA 2P74A 3VOYA 1L0GA 3GQZA 2HDSA 1JTGA 2FFFB 3IXBA 2ZQ7A 2OLUA 4S2JA 1KVMA 5CHUA 1Y54A 1LI0A 3IF6A 3NDEA 3A3FA 1CK3A 3WS1A 3DW0A 3C7VA 4UA6A 1W5DA 3DTMA 1ES3A 5EPHA 1K38A 5GLBA 5M1AA 4E3MA 1RP5A 5E2HA 2DRWA 3S4XA 1XA1A 3W4PA 1BLHA 4GNUA 3PBRA 3EQVA 3O3VA 2ZC5B 4RX3A 2OV5A 3MBZA 3M2KA 3IF6C 3PAEA 3ZDJA 4WZ4A 1PZPA 1KVLA 3A3DA 3MKFA 3NDGA 1MWTA 2Y59A 1SDEA 1XXMA 5HAQA 2RL3A 1IKGA 2V1ZA 5CHMA 3DWKA 3HLEA 3UPOA 3UDXA 3FYZA 1H8ZA 3TG9A 4BD1A 2HP6A 3M6HA 4KG5A 3VOZA 4LENA 2Y2HA 4K0WA 2XH9A 2ZJ9A 1H5XA 1PIOA 3VFFA 3W8KA 4JXWA 3IHBA 3EQUA 4R3JA 3SS3A 2ZMAA 3C4PA 4RX2A 4RYEA 3WS0A 5EVID 2WGVA 3QNCA 4MLLA 5EOEA 1Z6FA 4KZBA 1CEGA 1LHYA 1K55A 4P0MA 5A93A 1BULA 1Q2PA 3HLDA 3GMWA 5FQQA 3VP1A 1FSWA 1TVFA 1ESUA 5IHVA 5M18A 5CTMA 2JE5A 1K54A 2Y2OA 5FI2A 2Y2NA 4UA9A 4KQRA 4BLMA 2XR0A 2ZC7A 3FWLA 4S2OA 4FH4A 5HL1A 1EWZA 1C3BA 2J9OA 3UE3A 5DVAA 4IEDA 4LV1A 3HUMA 4OOLA 3UPNA 3VSKA 1PW1A 4GDNA 4P6BA 1PZOA 2JCHA 1HTZA 3OPHA 4EV4A 1FQGA 4N9KA 3Q7VB 3NY4A 5DF7A 3LO7A 5HFOA 4FCFA 4OP8A 5GHZA 5I94A 2ZD8A 2Y2GA 4N92A 4Y0OA 4XUXA 1GA9A 1SDNA 5EVIB 3UNWA 2Y2JA 5FASA 1JVJA 3HLFA 4S2IA 2OSUA 2H0TA 1XPBA 4S2LA 4GZBA 4GD6A 3N8LA 1K56A 4NETA 3VP3A 1N9BA 1L2SA 4JF4A 1E3UA 3IWIA 2Y91A 1MWUA 3GR2A 3Q82A 5FQ9A 4WZ5C 5FI6A 3SH8A 4PM9A 1W8QA 3IXHA 1BLPA 1PI5A 3O88A 3NIAA 3UN7A 2WKIA 4R4SA 2ZQAA 5E2EA 3IHAA 4JKTA 2R9XA 1MBLA 2EX2A 4KZ3A 4ZJ2A 4E3LA 1XA7A 3RJUA 1BSGA 1YQSA 1L0DA 1FSYA 3I7JA 2A49A 3MZDA 4S2NA 2XFSA 4CJNA 5E2FA 1LI9A 3ISGA 1JWVA 4MEZA 2H5SA 5F83A 2XD1A 1TDGA 4N9LA 1PW8A 5GLCA 4ZAMA 2XD5A 4OPYA 5EVIC 4B4XA 3P09A 2I72A 2X71A 4E3IA 2X01A 1L0FA 1RCJA 1YMXA 3VSLA 3G2YA 3OCNA 5F1GA 1BZAA 3IF6B 3WWXA 5EVLA 2VGKA 5CGWA 2G2WA 4GB7A 5JYPA 3GV9A 4PPRA 3N8RA 1EROA 2HDRA 3GRJA 5FAPA 4PMAA 1NYMA 4HESA 5DTKA 4QD4A 1E25A 4OLDA 4K91A 5KZHA 4KG2A 4N1XA 4S2KA 1NZOA 5BOHA 3GTCA 1ESIA 3PBTA 3S22A 2ZQ9A 1JWPA 2PBYA 3HREA 4Y0TA 3OCLA 1NXYA 4MBHA 5CXWA 4Q8IA 1JWZA 3HUNA 1ES5A 1K4FA 2V20A 3SS4A 3MKEA 2ZM0A 1QMFA 5HW3A 1W7FA 1HD8A 4R23A 4B88A 1TEMA 2V2FF 1Q2QA 3JYIA 1BLCA 4IVIA 3PTEA 4JF6A 1ONHA 4X56A 1L0EA 4S2MA 3ZVWA 4E6XA 4EBLA 4R4RA 1NZUA 2IWCA 3V39A 4BENA 2Y4AA 5KSHA 1NYYA 4BQMA 3SH9A 3BYDA 3G35A 1IYPA 3HLCA 4QB8A 2EXBA 4BJPA 1DJCA 2ZM2A 3ZG9B 3Q7ZA 4U3TA 4DRTA 1YLTA 1JTDA 2BG1A 4KZ5A 5AQBA 3HL9A 4DE2A 4DE0A 1J9MA 2PU2A 4DF6A 2DCFA 5DF8A 3IXGA 1I5QA 3OPRA 3CMZA 3IWOA 1PYYA 3OPPA 4LCMA 4Z9QA 1K56D 2ZQ8A 4XUZA 4UAAA 1IEMA 2WZXA 5TR7A 3BRMA 1MWRA 5FQKA 4YINA 5TGFA 1E3UD 2C5WB 4OLGA 5GLAA 4DKIA 4IBRA 5FA7A 3ZNYA 1KGFA 1LLBA 1IYSA 3HBRA 5FATA 2WUQA 3G32A 2QMIA 1MY8A 4Y7PA 5CGSA 4IVKA 5GLDA 4B4ZA 3UO9A 3BECA 4LV0A 4JBFA 4R1GA 1FR1A 4WBGA 4KG6A 4KQQA 1NRFA 2WGWB 1ERQA 1S0WA 5CHJA 4QHCA 3LCEA 4X6TA 4CPKA 2GDNA 5D3OA 3N8SA 5KSCA 1K25A 3FZCA 1KGGA 3N7WA 2XLNA 1S6RA 4QU3A 1K55C 1CI9A 4OPQA 5GHYA 4HEFA 1ES2A 2ZLYA 3MXSA 1KDSA 4E3KA 4ID4A 1K54C 1YLYA 4WYYA 1XX2A 3OC2A 4JXGA 3ZCZA 4GKUA 4E6WA 1SCWA 4ZTKA 4LV3A 1W79A 1XGJA 2UWXA 3IXDA 2J8YA 1WYBA 4HBUA 1RGYA 4DDSA 1G68A 1OMEA 2WKHA 1YMSA 2P9VA 2R9WA 3M2JA 1I2WA 4P85A 3W4OA 3E2LA 5AQ7A 1G6AA 1ERMA 1WE4A 3PBNA 1AXBA 2B5RA 3NC8A 4KZ4A 4EQIA 3NBLA 4KZ7A 5HX9A 4PM6A 2VGJA 3SS5A 1K6SA 2WAFA 3WRZA 2ZC4B 4QY6A 2IWDA 3VMAA 5FDHA 1PI4A 2FFYA 4U0XA 2JBFA 2ZQCA 3CJMA 1NJ4A 2H0YA 5EUAA 2DNSA 3HVFA 4JXVA 1FCNA 3UY6A 1ONGA 5FSRA 4HBTA 3WS5A 4OKPA 4DDYA 3MZFA 3AGEA 3BFFA 1MKIA 4F94A 1O7EA 1YT4A 3O86A 3BFCA 3BFEA 5JYOA 1XP4A 4NK3A 4EBPA 3DWZA 2J7VA 4WMCA 3ZG7B 2WGIA 4MBFA 2WAEA 4BD0A 3A3EA 4Y0UA 5CERA 3ZNTA 4DE1A 3OPLA 2Y2QA 5DF9A 2E8IA 3N4IA 4S2NC 3WS4A 1O07A 3GSGA 1PWGA 5M19A 3BLMA 4YFMA 2XF3A 4U0TA 4FD8A 5F1FA 5CECA 3W4QA 3AGDA 2IWBA 4QJGA 3MZEA 3V50A 3N6IA 1YLWA 1ZG6A 4RA7A 5EE8A 3ITBA 2Y2PA 4O7DA 5HAIA 1LL9A 4OPZA 1FOFA 1GHPA 3Q1FA 3ZVTA 2PU4A 4WEJA 4X69A 4E3NA 4EBNA 4JXSA 4N1HA 4R0QA 2XGNA 4L0LA 5L2FA 2Y2IA 5E2GA 4OQGA 3SH7A 4XXRA 1ZC2A 3ITAA 3QNBA 3B3XA 3HLGA 1PWDA 3PBSA 2OLVA 5DTSA 5A91A 3ZGAB 3TSGA 3ZG8B 3CG5A 1DJAA 3BFDA 3NI9A 3UDIA 4E3JA 1VQQA 4PM5A 4OP5A 1MWSA 1U60A 1FCOA 2H10A 3BEBA 2HDQA 4C3QA 4E3OA 4RVAA 2HP5A 4GDBA 2WADA 1CEFA 4EUZA 2Q9MA 3IH8A 3IF5A 1K6RA 4KZ9A 4DE3A 1ES4A 1PWCA 1EI5A 5CEDA 4PM7A 4X68A 5E43A 4QY5A 2A3UA 4JPMA 3IH9A 2WZZA 3C5AA 1KGEA 1RGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C4O A;  5CTN A;  4LCL A;  1NY0 A;  3V3R A;  3IWQ A;  1MXO A;  4KZ6 A;  3SOI A;  4OH0 A;  2XQZ A;  3UE1 A;  1GHI A;  1K4E A;  3BLS A;  3G2Z A;  3PAG A;  3ZG0 A;  2EX8 A;  5GHX A;  1FCM A;  4R3B A;  5GL9 A;  5HAP A;  3Q07 A;  1KE3 A;  4WMC D;  2HP9 A;  1IKI A;  1HZO A;  1TDL A;  2CC1 A;  1YLJ A;  2EFX A;  1IYQ A;  3A3J A;  3D4F A;  2G2U A;  4C6Y A;  1LL5 A;  2P9V B;  5FI7 A;  4S2P A;  2WK0 A;  3GVB A;  3VP2 A;  1DJB A;  3TOI A;  1GCE A;  3FKV A;  4WEK A;  3IQA A;  4KEN B;  2EX9 A;  4LV2 A;  2Y2K A;  4ZJ1 A;  3HUO A;  5HAR A;  2X02 A;  3FKW A;  4GD8 A;  5J8X A;  4DXB A;  4ZDX A;  3QHY A;  4BL3 A;  5G18 A;  2ZC3 B;  1E4D A;  4A5R A;  4P87 A;  2QPN A;  1XKZ A;  2WYX A;  3P98 A;  4X53 A;  1HVB A;  2J9P A;  2EFU A;  1DY6 A;  3VFH A;  4JF5 A;  3MXR A;  4IBX A;  5TFQ A;  2WGW A;  3LEZ A;  3M6B A;  3CZD A;  3HLB A;  1KE4 A;  4MBK A;  1I2S A;  4FH2 A;  4JLF A;  3E2K A;  4OQ0 A;  3C7U A;  5DTT A;  2Y2M A;  5AQA A;  2Y2L A;  2Z2L B;  5FQM A;  4C75 A;  3AGF A;  2XDM A;  3PBO A;  4GN2 A;  5FQJ A;  1KDW A;  4BL2 A;  4WZ5 A;  1VM1 A;  3NCK A;  4ZJ3 A;  3G4P A;  1QME A;  2Z2M B;  5U47 A;  4OQI A;  3UPP A;  4OQH A;  5FQI A;  1IEL A;  3Q7V A;  3VP0 A;  1CI8 A;  2JC7 A;  3VP4 A;  1K57 A;  3IT9 A;  1BTL A;  1ZG4 A;  3Q81 A;  4GOG A;  4OON A;  2XFT A;  5FAQ A;  1BT5 A;  3S1Y A;  4D2O A;  3G30 A;  5KMW A;  1KE0 A;  2XEP A;  5EEC A;  4OOM A;  1XGI A;  2RCX A;  1SKF A;  3LY3 A;  4KQO A;  1W8Y A;  4PM8 A;  4K0X A;  5EVI A;  3BFG A;  1IYO A;  3MFD A;  4ZBE A;  3WRT A;  3ZHH A;  1BUE A;  4OVD A;  5FAO A;  1GA0 A;  4EWF A;  1YM1 A;  5CEB A;  1M40 A;  4H8R A;  1K57 C;  1M6K A;  3WS2 A;  4WEL A;  3UDF A;  1ZKJ A;  1SHV A;  3LY4 A;  2BLS A;  4KZA A;  5AQ9 A;  5CRF A;  3ZFZ A;  1GHM A;  3UE0 A;  3FV7 A;  2QZ6 A;  4UA7 A;  3O87 A;  4UHU A;  2ZC6 B;  4M3K A;  4WM9 A;  5F82 A;  3RXX A;  2HDU A;  1YLP A;  4OPR A;  3V3S A;  4MNR A;  3A3I A;  2HPB A;  1MPL A;  3G31 A;  3V5M A;  5A92 A;  2Q9N A;  5A90 A;  2EX6 A;  5EOO A;  3ZG5 A;  2ZM8 A;  1FR6 A;  3OZH A;  4FSF A;  2Y55 A;  2EXA A;  3BM6 A;  3G34 A;  5CGX A;  2C6W B;  1N4O A;  3RXW A;  2ZQD A;  3PBQ A;  4X55 A;  1ALQ A;  1H8Y A;  1WYC A;  2WKE A;  4DXC A;  3HLW A;  1BLS A;  1YLZ A;  2XK1 A;  4KZ8 A;  4OOY A;  2P74 A;  3VOY A;  1L0G A;  3GQZ A;  2HDS A;  1JTG A;  2FFF B;  3IXB A;  2ZQ7 A;  2OLU A;  4S2J A;  1KVM A;  5CHU A;  1Y54 A;  1LI0 A;  3IF6 A;  3NDE A;  3A3F A;  1CK3 A;  3WS1 A;  3DW0 A;  3C7V A;  4UA6 A;  1W5D A;  3DTM A;  1ES3 A;  5EPH A;  1K38 A;  5GLB A;  5M1A A;  4E3M A;  1RP5 A;  5E2H A;  2DRW A;  3S4X A;  1XA1 A;  3W4P A;  1BLH A;  4GNU A;  3PBR A;  3EQV A;  3O3V A;  2ZC5 B;  4RX3 A;  2OV5 A;  3MBZ A;  3M2K A;  3IF6 C;  3PAE A;  3ZDJ A;  4WZ4 A;  1PZP A;  1KVL A;  3A3D A;  3MKF A;  3NDG A;  1MWT A;  2Y59 A;  1SDE A;  1XXM A;  5HAQ A;  2RL3 A;  1IKG A;  2V1Z A;  5CHM A;  3DWK A;  3HLE A;  3UPO A;  3UDX A;  3FYZ A;  1H8Z A;  3TG9 A;  4BD1 A;  2HP6 A;  3M6H A;  4KG5 A;  3VOZ A;  4LEN A;  2Y2H A;  4K0W A;  2XH9 A;  2ZJ9 A;  1H5X A;  1PIO A;  3VFF A;  3W8K A;  4JXW A;  3IHB A;  3EQU A;  4R3J A;  3SS3 A;  2ZMA A;  3C4P A;  4RX2 A;  4RYE A;  3WS0 A;  5EVI D;  2WGV A;  3QNC A;  4MLL A;  5EOE A;  1Z6F A;  4KZB A;  1CEG A;  1LHY A;  1K55 A;  4P0M A;  5A93 A;  1BUL A;  1Q2P A;  3HLD A;  3GMW A;  5FQQ A;  3VP1 A;  1FSW A;  1TVF A;  1ESU A;  5IHV A;  5M18 A;  5CTM A;  2JE5 A;  1K54 A;  2Y2O A;  5FI2 A;  2Y2N A;  4UA9 A;  4KQR A;  4BLM A;  2XR0 A;  2ZC7 A;  3FWL A;  4S2O A;  4FH4 A;  5HL1 A;  1EWZ A;  1C3B A;  2J9O A;  3UE3 A;  5DVA A;  4IED A;  4LV1 A;  3HUM A;  4OOL A;  3UPN A;  3VSK A;  1PW1 A;  4GDN A;  4P6B A;  1PZO A;  2JCH A;  1HTZ A;  3OPH A;  4EV4 A;  1FQG A;  4N9K A;  3Q7V B;  3NY4 A;  5DF7 A;  3LO7 A;  5HFO A;  4FCF A;  4OP8 A;  5GHZ A;  5I94 A;  2ZD8 A;  2Y2G A;  4N92 A;  4Y0O A;  4XUX A;  1GA9 A;  1SDN A;  5EVI B;  3UNW A;  2Y2J A;  5FAS A;  1JVJ A;  3HLF A;  4S2I A;  2OSU A;  2H0T A;  1XPB A;  4S2L A;  4GZB A;  4GD6 A;  3N8L A;  1K56 A;  4NET A;  3VP3 A;  1N9B A;  1L2S A;  4JF4 A;  1E3U A;  3IWI A;  2Y91 A;  1MWU A;  3GR2 A;  3Q82 A;  5FQ9 A;  4WZ5 C;  5FI6 A;  3SH8 A;  4PM9 A;  1W8Q A;  3IXH A;  1BLP A;  1PI5 A;  3O88 A;  3NIA A;  3UN7 A;  2WKI A;  4R4S A;  2ZQA A;  5E2E A;  3IHA A;  4JKT A;  2R9X A;  1MBL A;  2EX2 A;  4KZ3 A;  4ZJ2 A;  4E3L A;  1XA7 A;  3RJU A;  1BSG A;  1YQS A;  1L0D A;  1FSY A;  3I7J A;  2A49 A;  3MZD A;  4S2N A;  2XFS A;  4CJN A;  5E2F A;  1LI9 A;  3ISG A;  1JWV A;  4MEZ A;  2H5S A;  5F83 A;  2XD1 A;  1TDG A;  4N9L A;  1PW8 A;  5GLC A;  4ZAM A;  2XD5 A;  4OPY A;  5EVI C;  4B4X A;  3P09 A;  2I72 A;  2X71 A;  4E3I A;  2X01 A;  1L0F A;  1RCJ A;  1YMX A;  3VSL A;  3G2Y A;  3OCN A;  5F1G A;  1BZA A;  3IF6 B;  3WWX A;  5EVL A;  2VGK A;  5CGW A;  2G2W A;  4GB7 A;  5JYP A;  3GV9 A;  4PPR A;  3N8R A;  1ERO A;  2HDR A;  3GRJ A;  5FAP A;  4PMA A;  1NYM A;  4HES A;  5DTK A;  4QD4 A;  1E25 A;  4OLD A;  4K91 A;  5KZH A;  4KG2 A;  4N1X A;  4S2K A;  1NZO A;  5BOH A;  3GTC A;  1ESI A;  3PBT A;  3S22 A;  2ZQ9 A;  1JWP A;  2PBY A;  3HRE A;  4Y0T A;  3OCL A;  1NXY A;  4MBH A;  5CXW A;  4Q8I A;  1JWZ A;  3HUN A;  1ES5 A;  1K4F A;  2V20 A;  3SS4 A;  3MKE A;  2ZM0 A;  1QMF A;  5HW3 A;  1W7F A;  1HD8 A;  4R23 A;  4B88 A;  1TEM A;  2V2F F;  1Q2Q A;  3JYI A;  1BLC A;  4IVI A;  3PTE A;  4JF6 A;  1ONH A;  4X56 A;  1L0E A;  4S2M A;  3ZVW A;  4E6X A;  4EBL A;  4R4R A;  1NZU A;  2IWC A;  3V39 A;  4BEN A;  2Y4A A;  5KSH A;  1NYY A;  4BQM A;  3SH9 A;  3BYD A;  3G35 A;  1IYP A;  3HLC A;  4QB8 A;  2EXB A;  4BJP A;  1DJC A;  2ZM2 A;  3ZG9 B;  3Q7Z A;  4U3T A;  4DRT A;  1YLT A;  1JTD A;  2BG1 A;  4KZ5 A;  5AQB A;  3HL9 A;  4DE2 A;  4DE0 A;  1J9M A;  2PU2 A;  4DF6 A;  2DCF A;  5DF8 A;  3IXG A;  1I5Q A;  3OPR A;  3CMZ A;  3IWO A;  1PYY A;  3OPP A;  4LCM A;  4Z9Q A;  1K56 D;  2ZQ8 A;  4XUZ A;  4UAA A;  1IEM A;  2WZX A;  5TR7 A;  3BRM A;  1MWR A;  5FQK A;  4YIN A;  5TGF A;  1E3U D;  2C5W B;  4OLG A;  5GLA A;  4DKI A;  4IBR A;  5FA7 A;  3ZNY A;  1KGF A;  1LLB A;  1IYS A;  3HBR A;  5FAT A;  2WUQ A;  3G32 A;  2QMI A;  1MY8 A;  4Y7P A;  5CGS A;  4IVK A;  5GLD A;  4B4Z A;  3UO9 A;  3BEC A;  4LV0 A;  4JBF A;  4R1G A;  1FR1 A;  4WBG A;  4KG6 A;  4KQQ A;  1NRF A;  2WGW B;  1ERQ A;  1S0W A;  5CHJ A;  4QHC A;  3LCE A;  4X6T A;  4CPK A;  2GDN A;  5D3O A;  3N8S A;  5KSC A;  1K25 A;  3FZC A;  1KGG A;  3N7W A;  2XLN A;  1S6R A;  4QU3 A;  1K55 C;  1CI9 A;  4OPQ A;  5GHY A;  4HEF A;  1ES2 A;  2ZLY A;  3MXS A;  1KDS A;  4E3K A;  4ID4 A;  1K54 C;  1YLY A;  4WYY A;  1XX2 A;  3OC2 A;  4JXG A;  3ZCZ A;  4GKU A;  4E6W A;  1SCW A;  4ZTK A;  4LV3 A;  1W79 A;  1XGJ A;  2UWX A;  3IXD A;  2J8Y A;  1WYB A;  4HBU A;  1RGY A;  4DDS A;  1G68 A;  1OME A;  2WKH A;  1YMS A;  2P9V A;  2R9W A;  3M2J A;  1I2W A;  4P85 A;  3W4O A;  3E2L A;  5AQ7 A;  1G6A A;  1ERM A;  1WE4 A;  3PBN A;  1AXB A;  2B5R A;  3NC8 A;  4KZ4 A;  4EQI A;  3NBL A;  4KZ7 A;  5HX9 A;  4PM6 A;  2VGJ A;  3SS5 A;  1K6S A;  2WAF A;  3WRZ A;  2ZC4 B;  4QY6 A;  2IWD A;  3VMA A;  5FDH A;  1PI4 A;  2FFY A;  4U0X A;  2JBF A;  2ZQC A;  3CJM A;  1NJ4 A;  2H0Y A;  5EUA A;  2DNS A;  3HVF A;  4JXV A;  1FCN A;  3UY6 A;  1ONG A;  5FSR A;  4HBT A;  3WS5 A;  4OKP A;  4DDY A;  3MZF A;  3AGE A;  3BFF A;  1MKI A;  4F94 A;  1O7E A;  1YT4 A;  3O86 A;  3BFC A;  3BFE A;  5JYO A;  1XP4 A;  4NK3 A;  4EBP A;  3DWZ A;  2J7V A;  4WMC A;  3ZG7 B;  2WGI A;  4MBF A;  2WAE A;  4BD0 A;  3A3E A;  4Y0U A;  5CER A;  3ZNT A;  4DE1 A;  3OPL A;  2Y2Q A;  5DF9 A;  2E8I A;  3N4I A;  4S2N C;  3WS4 A;  1O07 A;  3GSG A;  1PWG A;  5M19 A;  3BLM A;  4YFM A;  2XF3 A;  4U0T A;  4FD8 A;  5F1F A;  5CEC A;  3W4Q A;  3AGD A;  2IWB A;  4QJG A;  3MZE A;  3V50 A;  3N6I A;  1YLW A;  1ZG6 A;  4RA7 A;  5EE8 A;  3ITB A;  2Y2P A;  4O7D A;  5HAI A;  1LL9 A;  4OPZ A;  1FOF A;  1GHP A;  3Q1F A;  3ZVT A;  2PU4 A;  4WEJ A;  4X69 A;  4E3N A;  4EBN A;  4JXS A;  4N1H A;  4R0Q A;  2XGN A;  4L0L A;  5L2F A;  2Y2I A;  5E2G A;  4OQG A;  3SH7 A;  4XXR A;  1ZC2 A;  3ITA A;  3QNB A;  3B3X A;  3HLG A;  1PWD A;  3PBS A;  2OLV A;  5DTS A;  5A91 A;  3ZGA B;  3TSG A;  3ZG8 B;  3CG5 A;  1DJA A;  3BFD A;  3NI9 A;  3UDI A;  4E3J A;  1VQQ A;  4PM5 A;  4OP5 A;  1MWS A;  1U60 A;  1FCO A;  2H10 A;  3BEB A;  2HDQ A;  4C3Q A;  4E3O A;  4RVA A;  2HP5 A;  4GDB A;  2WAD A;  1CEF A;  4EUZ A;  2Q9M A;  3IH8 A;  3IF5 A;  1K6R A;  4KZ9 A;  4DE3 A;  1ES4 A;  1PWC A;  1EI5 A;  5CED A;  4PM7 A;  4X68 A;  5E43 A;  4QY5 A;  2A3U A;  4JPM A;  3IH9 A;  2WZZ A;  3C5A A;  1KGE A;  1RGZ A; 
#chains in the Genus database with same CATH topology
 5CTN A;  3V3R A;  4OH0 A;  2PBD P;  3UE1 A;  4CLC D;  1GHI A;  1MZU A;  3BLS A;  4IUK A;  3ZG0 A;  2Z6D A;  5HAP A;  5IT5 A;  3Q07 A;  4FUW A;  4WMC D;  4CQH A;  1TDL A;  2CC1 A;  2GJ3 A;  1IYQ A;  4RQ9 A;  3UB8 A;  4HIA A;  2WK0 A;  1FIK A;  3DTK A;  1N9L A;  5DKK A;  5HPI A;  1SKO A;  3T4L A;  2X02 A;  1F9I A;  4BL3 A;  3S7N A;  2PD7 A;  2ZMF A;  2WYX A;  2J9P A;  2EFU A;  3KYE A;  3LGO A;  4JF5 A;  3UE6 A;  2WKQ A;  5TFQ A;  1AWI A;  3LEQ A;  4FH2 A;  4Q0H A;  5AQA A;  2Y2M A;  4Q0I A;  2Y2L A;  2Z2L B;  5FQM A;  4GN2 A;  4BL2 A;  1OTE A;  1KDW A;  4HP4 A;  4ZJ3 A;  4MCW A;  3T4Q A;  2QYB A;  4OQI A;  2W1T B;  3K3D A;  3ULF A;  5FQI A;  3VP4 A;  1K57 A;  1ZG4 A;  3Q81 A;  4NKP A;  3A0R A;  3LUQ A;  3LY3 A;  1W8Y A;  4K0X A;  4M4X A;  1IYO A;  4ZBE A;  4OVD A;  5FAO A;  3WS2 A;  4WEL A;  1VEU B;  3UE0 A;  3FV7 A;  2HZ5 A;  4UHU A;  2ZC6 B;  3V3S A;  2XA7 S;  1FR6 A;  3G34 A;  2ZQD A;  4X55 A;  4DXC A;  1H8Y A;  2WKE A;  1BLS A;  1YLZ A;  4Q0J A;  3KYQ A;  3MXQ A;  1T19 A;  3DW0 A;  3C7V A;  1XFQ A;  2XA7 M;  1UWP X;  4UQI S;  1XA1 A;  2MJ6 A;  5C5K A;  2ZC5 B;  3CI6 A;  3JVV A;  3MBZ A;  3PAE A;  3IF6 C;  4WZ4 A;  1KVL A;  3NDG A;  1MWT A;  1SDE A;  5EM0 A;  3SW1 A;  3GDI A;  1CQA A;  2GX5 A;  2HP6 A;  4E04 A;  4UQI M;  5L8M A;  2Q0O A;  4G3V A;  3VFF A;  3EQU A;  2XRN A;  3SS3 A;  4I5S A;  3NUL A;  4RX2 A;  2YKH A;  4KZB A;  4PAU A;  1TVF A;  5J3W A;  3LID A;  4WL9 A;  4KQR A;  2XR0 A;  2ZC7 A;  4R3A A;  5HL1 A;  1C3B A;  2O0Y A;  4R70 A;  5DJU A;  3HUM A;  3LR0 A;  1SZV A;  1PW1 A;  1HTZ A;  3Q7V B;  5F68 A;  2V1B A;  5DF7 A;  5HFO A;  3LR5 A;  4OP8 A;  5I94 A;  2ZD8 A;  4N92 A;  5EVI B;  3UNW A;  5FAS A;  3LR4 A;  2G7U A;  3N8L A;  2OWH A;  3VP3 A;  1L2S A;  5FQ9 A;  1F2K A;  4WZ5 C;  1W8Q A;  3LI8 A;  4JKT A;  1MBL A;  2EX2 A;  3RJU A;  1BSG A;  4Y3I A;  3I7J A;  3MZD A;  4S2N A;  4CJN A;  3ISG A;  4MEZ A;  5F83 A;  2H5S A;  1TDG A;  3K3C A;  4HI4 A;  1PW8 A;  5F5Y A;  5GLC A;  4ZAM A;  4E3I A;  3BQA A;  2I72 A;  1L0F A;  1RCJ A;  2W3F A;  5F1G A;  3IF6 B;  1ZTU A;  3DTI A;  5CGW A;  3DTE A;  2VV6 A;  3L7H A;  3MSH A;  3OOV A;  4KUO A;  3S7P A;  5KZH A;  1S67 L;  4BMW A;  3GTC A;  1ESI A;  1P9W A;  2PBY A;  2NUT C;  4Y0T A;  5CXW A;  3SS4 A;  1ES5 A;  1NWZ A;  1STZ A;  2ZM0 A;  3FG8 A;  1W7F A;  1HD8 A;  2VV7 A;  1TEM A;  3JYI A;  1BLC A;  4X56 A;  4E6X A;  4S2M A;  3ZVW A;  2VKS A;  1NZU A;  2IWC A;  4R4R A;  1VEU A;  4BJP A;  4U3T A;  3VV4 A;  1JTD A;  2PYP A;  4DE0 A;  5HWT A;  3C30 A;  2DCF A;  4LCM A;  3QP8 A;  1K56 D;  4DJ2 A;  3H82 A;  1MWR A;  4DKI A;  2LB9 A;  5HPF A;  5EV0 A;  1LLB A;  5HD5 A;  2OOL A;  2WUQ A;  3G32 A;  4Y7P A;  2ZL1 B;  5L09 A;  4I38 A;  4B4Z A;  2K2N A;  4JBF A;  4R1G A;  5CHJ A;  3T12 B;  5HZH A;  4QHC A;  3NHQ A;  5KSC A;  1KGG A;  2J80 A;  1CI9 A;  4R38 A;  2ZLY A;  2ZOH A;  1KDS A;  2KDK A;  4WYY A;  3OC2 A;  3ZCZ A;  4ZTK A;  4LV3 A;  5HDC A;  1XGJ A;  4O8G A;  1OME A;  2WKH A;  2R9W A;  1I2W A;  3W4O A;  3PBN A;  4L9E A;  2PAV P;  5FEF A;  3NBL A;  4PM6 A;  4QY6 A;  4KUK A;  4ME4 A;  2FFY A;  3LI9 A;  2V0W A;  5FSR A;  4HBT A;  3WS5 A;  3PYP A;  3AGE A;  3BFF A;  3P01 A;  4EBP A;  2J7V A;  3K2N A;  4EEU A;  2WAE A;  1XJ4 A;  2WKP A;  4R6L A;  3OPL A;  4CLC C;  4I39 A;  1YSP A;  3T4K A;  5F1F A;  2HGV A;  3AGD A;  3N6I A;  1YLW A;  5EE8 A;  3F1P A;  3ICY A;  1GHP A;  4D60 A;  3Q1F A;  2PU4 A;  1H0M A;  3KSH A;  4OQG A;  4Y15 A;  3QNB A;  1NLZ A;  3PBS A;  4X1L A;  3ZGA B;  4LRX C;  3ZG8 B;  4EEP A;  1DJA A;  3BFD A;  1FCO A;  5HDD A;  4G3K A;  1S66 L;  3IF5 A;  1K6R A;  3H9W A;  1ES4 A;  1PWC A;  1J3W A;  1WYB A;  3W2Z A;  1KGE A;  1NY0 A;  3IWQ A;  1MXO A;  3T1R A;  3G2Z A;  2EX8 A;  3CLO A;  2A24 A;  1KE3 A;  2HP9 A;  2XSS A;  1HZO A;  2EFX A;  4Y13 A;  3A3J A;  1X0O A;  1LL5 A;  5FI7 A;  4S2P A;  3GVB A;  1DJB A;  3C2W A;  1GCE A;  3UME A;  3RFB A;  1S4R A;  3D3O A;  4ZJ1 A;  5HAR A;  3SZT A;  2ZC3 B;  1DY6 A;  4CLC B;  4IBX A;  3M6B A;  3HLB A;  4OQ0 A;  5DTT A;  3QP4 A;  4C75 A;  2XDM A;  4WZ5 A;  1VM1 A;  3NCK A;  2W1R A;  1TS8 A;  3EOI A;  4HH2 A;  3UPP A;  1PNE A;  2LB5 A;  1IEL A;  2VGL S;  1VET B;  1D7E A;  3S1Y A;  4GOG A;  2EWW A;  1XGI A;  4KQO A;  4H6J A;  4HJ6 A;  3BFG A;  1DP9 A;  3WRT A;  2BTF P;  2HF6 A;  4EWF A;  4HQA A;  3L9K A;  2VA0 A;  2GNX A;  1SHV A;  3LY4 A;  2BLS A;  4KZA A;  3BW6 A;  3ZFZ A;  1GHM A;  4CLC E;  4UA7 A;  3F1O A;  3RXX A;  5DFY A;  4MNR A;  3A3I A;  2HPB A;  3T4T A;  3G31 A;  5A92 A;  2Q9N A;  2EX6 A;  3OZH A;  2Y55 A;  3QP5 A;  2C6W B;  3TJZ C;  1S1Y A;  4NEE D;  2V8C A;  3GQZ A;  1HLU P;  1JTG A;  2FFF B;  5HWW A;  4S2J A;  5CHU A;  1LI0 A;  3NDE A;  1CK3 A;  2QJ7 A;  1MKM A;  5EPH A;  2V8F A;  5GLB A;  1XJ3 A;  5M1A A;  4EES A;  3U4L P;  3W4P A;  3U2A A;  2OV5 A;  4FTX A;  3M2K A;  3MKF A;  1XXM A;  2RL3 A;  3UDX A;  3TG9 A;  4BD1 A;  3BWL A;  5FEG A;  5AVF A;  1LSX A;  1YPR A;  4R3J A;  2P7J A;  2ZMA A;  1DRM A;  1EW0 A;  3C4P A;  4YOF A;  1XFN A;  2WGV A;  2QJ5 A;  2HJE A;  4P0M A;  1Q2P A;  3HLD A;  1LSW A;  4EQ1 A;  5AVE A;  3VP1 A;  5M18 A;  3BY8 A;  5CTM A;  2Y2O A;  5FI2 A;  4UA9 A;  1OTD A;  1EWZ A;  4HOI A;  3UE3 A;  5TBM B;  3KYZ A;  3TW8 A;  4O01 A;  4GHI A;  3MQ0 A;  2M7V A;  1PZO A;  2UV0 E;  2JCH A;  4EV4 A;  1TF1 A;  2PD8 A;  4XUX A;  5F6A A;  2W3D A;  2Y2J A;  3HLF A;  4S2I A;  4WLA A;  2H0T A;  4GJ4 A;  4S2L A;  2L1M A;  4NG2 A;  4NET A;  1UWN X;  1E3U A;  3IWI A;  2Y91 A;  1MWU A;  3GR2 A;  3IS2 B;  3Q82 A;  1W63 Q;  5FI6 A;  4PM9 A;  3O88 A;  2WKI A;  4R4S A;  5E2E A;  1XA7 A;  2W3E A;  1L0D A;  3IX4 A;  2A49 A;  2XFS A;  1PFL A;  2XD5 A;  2O9B A;  5EVI C;  2J3W A;  2VEA A;  3OCN A;  2HDR A;  4Z1W A;  1S4S A;  4HES A;  4QD4 A;  4S2K A;  3T4S A;  4Q8I A;  3HUN A;  1K4F A;  1ZHH B;  3IX3 A;  3BQ8 A;  1TS0 A;  4B88 A;  4R23 A;  4EUV A;  4IVI A;  4EBL A;  4BEN A;  1NYY A;  3SH9 A;  3BYD A;  4QB8 A;  1DJC A;  2VV8 A;  1OT9 A;  4KZ5 A;  3HL9 A;  1J9M A;  1LT0 A;  5DF8 A;  3IXG A;  1I5Q A;  1T18 A;  3UB6 A;  2ZQ8 A;  4UAA A;  1IEM A;  5TR7 A;  3BRM A;  5FQK A;  4YIN A;  3D72 A;  5G4Z A;  4IBR A;  3ZNY A;  5FAT A;  1NLY A;  1KOU A;  2EWV A;  3BEC A;  4LV0 A;  4KQQ A;  4F3L B;  1NRF A;  1S0W A;  4X6T A;  4CPK A;  4EXO A;  2GDN A;  3B42 A;  3GEC A;  5FDS A;  3FZC A;  3N7W A;  4QU3 A;  1ES2 A;  4E3K A;  1IFQ A;  4WF0 A;  1K54 C;  4JXG A;  3JPU A;  1W79 A;  2UWX A;  2J8Y A;  1G68 A;  3LIA A;  3UB7 A;  3E2L A;  5AQ7 A;  1WE4 A;  1ERM A;  1AXB A;  2R78 A;  4EQI A;  2EA9 A;  3MMH A;  2J3T C;  4KZ7 A;  5HX9 A;  1N9N A;  4GW9 A;  3SS5 A;  2WAF A;  3WRZ A;  2AVX A;  5FDH A;  1PI4 A;  1OTB A;  3CJM A;  4JXV A;  1FCN A;  3UY6 A;  1ONG A;  1OT6 A;  4OKP A;  3MZF A;  1O7E A;  4PKY G;  5HSQ A;  4NK3 A;  3DWZ A;  2WGI A;  4DE1 A;  3T4J A;  2B18 A;  4X25 A;  3ZQ5 A;  1TD5 A;  3WS4 A;  3KSI A;  2W1T A;  5M19 A;  4YFM A;  2E8J A;  4FD8 A;  4EET B;  3W4Q A;  4QJG A;  2W3G A;  2M7U A;  3ITB A;  4GCZ A;  1YKD A;  1PRQ A;  3TRC A;  4L0L A;  2Y2I A;  5DTS A;  3CG5 A;  2A2L A;  3BEB A;  2HDQ A;  1CEF A;  2VX8 A;  3IBR A;  4KZ9 A;  1WA9 A;  4QY5 A;  2A3U A;  4JPM A;  2FH5 A;  3C4O A;  4NXB A;  4KZ6 A;  1VHM A;  1FCM A;  4R3B A;  4ZRR A;  4GS9 B;  3A0S A;  1IKI A;  1YLJ A;  2BAS A;  1K0K A;  2G2U A;  2P9V B;  2B95 A;  3VP2 A;  3TOI A;  2O9C A;  4WEK A;  3IQA A;  4HH3 A;  2EX9 A;  3B47 A;  2Y2K A;  3HUO A;  2KOI A;  2ACG A;  3FKW A;  4GD8 A;  4DXB A;  3QHY A;  4YWZ A;  4P87 A;  2JHE A;  2QPN A;  1XKZ A;  3P98 A;  2XRO A;  4DN0 A;  3MXR A;  4DMZ A;  1KE4 A;  5L10 A;  1I2S A;  2DMW A;  4JLF A;  3E2K A;  3C7U A;  3IBJ A;  3LIE A;  1P0Z A;  3PBO A;  5FQJ A;  4I3I A;  2JKG A;  5U47 A;  1CJF A;  1W63 M;  3Q7V A;  3EEA A;  1CI8 A;  5HD3 A;  2JKT M;  2KX6 A;  3MR0 A;  3IT9 A;  4LGW A;  4D2O A;  5KMW A;  1KE0 A;  4WN5 A;  2XEP A;  4XT2 B;  2K31 A;  1SKF A;  4PM8 A;  5EVI A;  3MFD A;  1GA0 A;  2PYR A;  1YM1 A;  5CEB A;  1K57 C;  1M6K A;  3KSF A;  1DP8 A;  1ACF A;  4HJ4 A;  3O87 A;  4M3K A;  4WM9 A;  5F82 A;  2HDU A;  4ESP A;  1YLP A;  3V5M A;  5EOO A;  3ZG5 A;  2ZM8 A;  4FSF A;  2EXA A;  3MF0 A;  1N4O A;  3RXW A;  3PBQ A;  1ALQ A;  1CF0 A;  3HLW A;  4UEY A;  5F69 A;  4KZ8 A;  4OOY A;  1L0G A;  2HDS A;  3IXB A;  3D9Y A;  3PXP A;  3IF6 A;  2ZOI A;  1G6O A;  3WS1 A;  3S7Q A;  4LRY C;  1ES3 A;  1K38 A;  4GLQ A;  1RP5 A;  1BLH A;  3PBR A;  3EQV A;  3O3V A;  4RX3 A;  1PZP A;  3A3D A;  2Y8H A;  2K7S A;  2Y59 A;  1BYW A;  3RH8 B;  5HAQ A;  1D06 A;  3UPO A;  3DWK A;  3HLE A;  2IA2 A;  1H8Z A;  3M6H A;  4LEN A;  2XH9 A;  3JVU A;  4JGR A;  3A0V A;  3R7W B;  1SKO B;  4RYE A;  3WS0 A;  3PR6 A;  2HJ9 C;  4MLL A;  5EOE A;  1LHY A;  3CIT A;  1GSW A;  5FQQ A;  5AJG A;  4BBV A;  1K54 A;  4L9G A;  1H8M A;  2L4R A;  4BLM A;  3FWL A;  4S2O A;  1P9R A;  5IS1 A;  5DVA A;  4IED A;  3NOP C;  2D02 A;  4LV1 A;  4OOL A;  2ZL1 A;  4GDN A;  1FQG A;  3NY4 A;  5EVE A;  4HHD A;  4FCF A;  2QHK A;  5GHZ A;  3KSG A;  3LIC A;  2O9A A;  1GA9 A;  1SDN A;  2V1A A;  3V67 A;  2OSU A;  1XPB A;  4GD6 A;  2YKF A;  2PRF A;  4JF4 A;  4JGO A;  3UMD A;  3O5Y A;  3IXH A;  1BLP A;  1PI5 A;  3UN7 A;  3NIA A;  2ZQA A;  3IHA A;  5L07 A;  4KZ3 A;  4ARZ B;  4E3L A;  4NXG A;  1YQS A;  1T1A A;  4I3J A;  1JWV A;  3G6O A;  4OPY A;  5TJJ A;  4B4X A;  2X71 A;  3T4O A;  3VSL A;  3WWX A;  2PR5 A;  1OTI A;  2G2W A;  4GB7 A;  5JYP A;  3GV9 A;  4QWO A;  2FZ0 A;  4PPR A;  3N8R A;  1ERO A;  3GRJ A;  5FAP A;  4PMA A;  5I5L A;  4B93 A;  5G4Y A;  4OLD A;  4KG2 A;  4N1X A;  1NZO A;  2B02 A;  4XT2 A;  1L3L A;  3PBT A;  3S22 A;  3HRE A;  1NXY A;  1JWZ A;  2INW A;  3MKE A;  5DJT A;  5DFX A;  5HDS A;  4BWI A;  2V2F F;  1Q2Q A;  1LSV A;  3PTE A;  3V39 A;  2Y4A A;  2JKR M;  3HLC A;  1IYP A;  2EXB A;  3F1N B;  3EGX C;  4DRT A;  2BG1 A;  5EM1 A;  5AQB A;  2H28 A;  1ODV A;  1PYY A;  4MN5 A;  4XUZ A;  3H7W B;  5TGF A;  1E3U D;  2PR6 A;  3E0Y A;  5GLA A;  5FA7 A;  3HBR A;  3HJI A;  3DAV A;  5CGS A;  4IVK A;  4HP9 A;  4AFI A;  2PHY A;  4KG6 A;  1F98 A;  2WGW B;  3LCE A;  1JNU A;  3DBA A;  2XLN A;  4Y17 A;  3S7O A;  2HV1 A;  1K55 C;  4HEF A;  3LYX A;  1N9O A;  4ID4 A;  1GSX A;  2VJW A;  3FPW A;  1OPX A;  1XX2 A;  4GKU A;  3R7W A;  1SCW A;  1RGY A;  4DDS A;  1YMS A;  4PKY A;  3M2J A;  2VK3 A;  1G6A A;  1DP6 A;  3NC8 A;  4KZ4 A;  3CPT B;  3E4O A;  2OWJ A;  2GZA A;  4I3A A;  2IWD A;  3BJN A;  4U0X A;  2ZQC A;  1NJ4 A;  2H0Y A;  5EUA A;  2DNS A;  2QKP A;  4CLC A;  4F94 A;  1MKI A;  1YT4 A;  3MJQ A;  1XP4 A;  4WMC A;  3ZG7 B;  2VLG A;  2JKT I;  4NXF A;  2NUP C;  3A3E A;  4Y0U A;  3N4I A;  1O07 A;  3GSG A;  1PWG A;  4BBT A;  3BY9 A;  3BLM A;  3E98 A;  5K5B A;  4P6Z S;  1VET A;  4U0T A;  1TS6 A;  2IWB A;  3V50 A;  4DJ3 A;  2Y2P A;  5HAI A;  1LL9 A;  3VOL A;  4NXE A;  4ARZ A;  3ZVT A;  4WEJ A;  4X69 A;  4JXS A;  4N1H A;  5E2G A;  4P6Z M;  4XXR A;  3H82 B;  3R4K A;  2OLV A;  5A91 A;  3TSG A;  3NEC A;  3CHW P;  1H3Q A;  4OP5 A;  1MWS A;  2H10 A;  4E3O A;  4C3Q A;  3HCY A;  2L0W A;  3E4Q A;  2WAD A;  1OJG A;  2OAQ 1;  1YAX A;  4DE3 A;  3T1X A;  1EI5 A;  4PM7 A;  5E43 A;  3T1Q B;  2D01 A;  2WZZ A;  4LCL A;  3SOI A;  2XQZ A;  1K4E A;  3PAG A;  2PT7 A;  5GHX A;  2Y79 A;  5GL9 A;  5J4E A;  3F1N A;  2ZMV A;  4LFU A;  3D4F A;  4C6Y A;  4MDZ A;  5IU1 A;  3FKV A;  2V9A A;  4KEN B;  4LV2 A;  3H7W A;  3CUE C;  1F5M A;  4PHT A;  5J8X A;  4ZDX A;  5G18 A;  1E4D A;  4A5R A;  4X53 A;  1HVB A;  3VFH A;  3EEH A;  2OAP 1;  4II7 A;  4JGQ A;  2M1C A;  2WGW A;  3LEZ A;  3CZD A;  2O99 A;  4MBK A;  4HY8 A;  5TBM A;  3AGF A;  3LFV A;  1NRJ A;  3G4P A;  1QME A;  2Z2M B;  4OQH A;  3VP0 A;  2JC7 A;  3QP1 A;  3TE8 A;  1T1C A;  3FPV A;  1BTL A;  3PHY A;  4OON A;  5FAQ A;  2XFT A;  1BT5 A;  3G30 A;  1OTA A;  5EEC A;  4OOM A;  2RCX A;  2JN7 A;  3F1P B;  3MFX A;  3ZHH A;  2WKR A;  1BUE A;  1M40 A;  4H8R A;  3UDF A;  1ZKJ A;  4MN6 A;  5AQ9 A;  5CRF A;  2QZ6 A;  2ZBB A;  3CPT A;  3IS2 A;  4OPR A;  1MPL A;  5A90 A;  3QP6 A;  4EU0 A;  5EFW A;  3BM6 A;  5CGX A;  4JGP A;  3MQO A;  1WYC A;  2XK1 A;  2P74 A;  3VOY A;  4Y5F A;  2ZQ7 A;  2OLU A;  1KVM A;  1Y54 A;  3A3F A;  3MQQ A;  4UA6 A;  1W5D A;  3DTM A;  4E3M A;  1XJ2 A;  5E2H A;  2DRW A;  3S4X A;  3NOU C;  3C38 A;  4GNU A;  2A24 B;  4O0P A;  3ZDJ A;  4WUJ A;  3KX0 X;  2JKR I;  1IKG A;  2V1Z A;  5CHM A;  5CX7 A;  1A0K A;  3RTY A;  3FYZ A;  4LLO B;  4KG5 A;  3VOZ A;  2Y2H A;  4K0W A;  2ZJ9 A;  1H5X A;  1PIO A;  3W8K A;  4JXW A;  3IHB A;  5EVI D;  3QNC A;  1Z6F A;  3B33 A;  1CEG A;  1K55 A;  5A93 A;  1BUL A;  3GMW A;  1FSW A;  1ESU A;  5IHV A;  2JE5 A;  2Y2N A;  1G28 A;  4Y2F A;  4FH4 A;  4IJG A;  1S1Z A;  2J9O A;  3UPN A;  3VSK A;  3IX8 A;  4K08 A;  5HL6 A;  4P6B A;  3OPH A;  3LR3 A;  4N9K A;  1Y28 A;  4F3L A;  4BBU A;  3LO7 A;  2QWS A;  1YSQ A;  2Y2G A;  4Y0O A;  3LIF A;  4H6J B;  3E4P A;  1JVJ A;  2W0N A;  3C8C A;  2P08 A;  4GZB A;  2V0U A;  1K56 A;  3FC7 A;  1N9B A;  3F1O B;  3SH8 A;  4X1M A;  2R9X A;  4ZJ2 A;  1FSY A;  5E2F A;  1LI9 A;  2XD1 A;  4N9L A;  1FIL A;  1UGU A;  3P09 A;  2X01 A;  1YMX A;  3G2Y A;  1BZA A;  5EVL A;  4MN7 A;  2VGK A;  1OJ5 A;  1NYM A;  5DTK A;  1E25 A;  4K91 A;  3UB5 P;  4L9F A;  5BOH A;  3KO6 A;  2ZQ9 A;  1JWP A;  3OCL A;  4MBH A;  2V20 A;  1QMF A;  5HW3 A;  3EWK A;  4JF6 A;  1ONH A;  1XJ6 A;  1L0E A;  5KSH A;  4BQM A;  3G35 A;  2J3T D;  2ZM2 A;  3ZG9 B;  3Q7Z A;  1YLT A;  1Y4O A;  3ZYT A;  2Z6C A;  4LPZ A;  2W3H A;  4DE2 A;  5A8B A;  2PU2 A;  4HJ3 A;  4DF6 A;  3NOT C;  3EGD C;  3OPR A;  3CMZ A;  3IWO A;  3OPP A;  4Z9Q A;  3VE4 A;  2WZX A;  2VZW A;  2C5W B;  4OLG A;  3HJK A;  4YNR A;  1KGF A;  1IYS A;  3CWF A;  1VB6 A;  2QMI A;  1MY8 A;  4GHI B;  5GLD A;  3UO9 A;  1FR1 A;  4WBG A;  1ERQ A;  5D3O A;  3N8S A;  3VE3 A;  1K25 A;  4KQD A;  2P04 A;  3CUE A;  1S6R A;  5DKL A;  4OPQ A;  5GHY A;  3MXS A;  4IHQ A;  3MS6 A;  2JKF A;  1YLY A;  4E6W A;  3UB9 A;  5KIZ A;  4ETZ A;  4GS9 A;  3IXD A;  4HBU A;  1P97 A;  1LL8 A;  2P9V A;  4IUH A;  4P85 A;  5LBR A;  3QP2 A;  4EW7 A;  4MMN A;  3T1S A;  2B5R A;  1IOU A;  2CMN A;  3T50 A;  4ETX A;  2VGJ A;  4G3W A;  1GSV A;  1K6S A;  1MC0 A;  2ZC4 B;  3VMA A;  1TS7 A;  2JBF A;  3HVF A;  3LIB A;  2KLI A;  4QPR A;  4DDY A;  3P7N A;  4FOF A;  3O86 A;  4B9O A;  3BFC A;  3BFE A;  5JYO A;  3OLO A;  4MBF A;  4BD0 A;  5CER A;  3ZNT A;  2W27 A;  1T1B A;  5DF9 A;  2Y2Q A;  3NJA A;  1D1J A;  2E8I A;  4S2N C;  2XF3 A;  4EER A;  5CEC A;  2VGL M;  4LRZ E;  3MZE A;  1ZG6 A;  4RA7 A;  2I9V A;  1G5U A;  4O7D A;  4OPZ A;  1FOF A;  4HNB A;  4E3N A;  5MC7 A;  4EBN A;  5J7E A;  4R0Q A;  5L2F A;  2XGN A;  3SH7 A;  1ZC2 A;  3ITA A;  3B3X A;  3HLG A;  1PWD A;  1V9Y A;  1Z09 A;  3NI9 A;  3UDI A;  4E3J A;  1VQQ A;  4PM5 A;  1U60 A;  3OBF A;  4RVA A;  2HP5 A;  2PDR A;  4GDB A;  5HWV A;  4EUZ A;  2Q9M A;  3IH8 A;  1V9Z A;  5CED A;  3CAX A;  4X68 A;  5FL3 A;  3IH9 A;  3C5A A;  1RGZ A; 
#chains in the Genus database with same CATH homology
 3C4O A;  5CTN A;  4LCL A;  1NY0 A;  3V3R A;  3IWQ A;  1MXO A;  4KZ6 A;  3SOI A;  4OH0 A;  2XQZ A;  3UE1 A;  1GHI A;  1K4E A;  3BLS A;  3G2Z A;  3PAG A;  3ZG0 A;  2EX8 A;  5GHX A;  1FCM A;  4R3B A;  5GL9 A;  5HAP A;  3Q07 A;  1KE3 A;  4WMC D;  2HP9 A;  1IKI A;  1HZO A;  1TDL A;  2CC1 A;  1YLJ A;  2EFX A;  1IYQ A;  3A3J A;  3D4F A;  2G2U A;  4C6Y A;  1LL5 A;  2P9V B;  5FI7 A;  4S2P A;  2WK0 A;  3GVB A;  3VP2 A;  1DJB A;  3TOI A;  1GCE A;  3FKV A;  4WEK A;  3IQA A;  4KEN B;  2EX9 A;  4LV2 A;  2Y2K A;  4ZJ1 A;  3HUO A;  5HAR A;  2X02 A;  3FKW A;  4GD8 A;  5J8X A;  4DXB A;  4ZDX A;  3QHY A;  4BL3 A;  5G18 A;  2ZC3 B;  1E4D A;  4A5R A;  4P87 A;  2QPN A;  1XKZ A;  2WYX A;  3P98 A;  4X53 A;  1HVB A;  2J9P A;  2EFU A;  1DY6 A;  3VFH A;  4JF5 A;  3MXR A;  4IBX A;  5TFQ A;  2WGW A;  3LEZ A;  3M6B A;  3CZD A;  3HLB A;  1KE4 A;  4MBK A;  1I2S A;  4FH2 A;  4JLF A;  3E2K A;  4OQ0 A;  3C7U A;  5DTT A;  2Y2M A;  5AQA A;  2Y2L A;  2Z2L B;  5FQM A;  4C75 A;  3AGF A;  2XDM A;  3PBO A;  4GN2 A;  5FQJ A;  1KDW A;  4BL2 A;  4WZ5 A;  1VM1 A;  3NCK A;  4ZJ3 A;  3G4P A;  1QME A;  2Z2M B;  5U47 A;  4OQI A;  3UPP A;  4OQH A;  5FQI A;  1IEL A;  3Q7V A;  3VP0 A;  1CI8 A;  2JC7 A;  3VP4 A;  1K57 A;  3IT9 A;  1BTL A;  1ZG4 A;  3Q81 A;  4GOG A;  4OON A;  2XFT A;  5FAQ A;  1BT5 A;  3S1Y A;  4D2O A;  3G30 A;  5KMW A;  1KE0 A;  2XEP A;  5EEC A;  4OOM A;  1XGI A;  2RCX A;  1SKF A;  3LY3 A;  4KQO A;  1W8Y A;  4PM8 A;  4K0X A;  5EVI A;  3BFG A;  1IYO A;  3MFD A;  4ZBE A;  3WRT A;  3ZHH A;  1BUE A;  4OVD A;  5FAO A;  1GA0 A;  4EWF A;  1YM1 A;  5CEB A;  1M40 A;  4H8R A;  1K57 C;  1M6K A;  3WS2 A;  4WEL A;  3UDF A;  1ZKJ A;  1SHV A;  3LY4 A;  2BLS A;  4KZA A;  5AQ9 A;  5CRF A;  3ZFZ A;  1GHM A;  3UE0 A;  3FV7 A;  2QZ6 A;  4UA7 A;  3O87 A;  4UHU A;  2ZC6 B;  4M3K A;  4WM9 A;  5F82 A;  3RXX A;  2HDU A;  1YLP A;  4OPR A;  3V3S A;  4MNR A;  3A3I A;  2HPB A;  1MPL A;  3G31 A;  3V5M A;  5A92 A;  2Q9N A;  5A90 A;  2EX6 A;  5EOO A;  3ZG5 A;  2ZM8 A;  1FR6 A;  3OZH A;  4FSF A;  2Y55 A;  2EXA A;  3BM6 A;  3G34 A;  5CGX A;  2C6W B;  1N4O A;  3RXW A;  2ZQD A;  3PBQ A;  4X55 A;  1ALQ A;  1H8Y A;  1WYC A;  2WKE A;  4DXC A;  3HLW A;  1BLS A;  1YLZ A;  2XK1 A;  4KZ8 A;  4OOY A;  2P74 A;  3VOY A;  1L0G A;  3GQZ A;  2HDS A;  1JTG A;  2FFF B;  3IXB A;  2ZQ7 A;  2OLU A;  4S2J A;  1KVM A;  5CHU A;  1Y54 A;  1LI0 A;  3IF6 A;  3NDE A;  3A3F A;  1CK3 A;  3WS1 A;  3DW0 A;  3C7V A;  4UA6 A;  1W5D A;  3DTM A;  1ES3 A;  5EPH A;  1K38 A;  5GLB A;  5M1A A;  4E3M A;  1RP5 A;  5E2H A;  2DRW A;  3S4X A;  1XA1 A;  3W4P A;  1BLH A;  4GNU A;  3PBR A;  3EQV A;  3O3V A;  2ZC5 B;  4RX3 A;  2OV5 A;  3MBZ A;  3M2K A;  3IF6 C;  3PAE A;  3ZDJ A;  4WZ4 A;  1PZP A;  1KVL A;  3A3D A;  3MKF A;  3NDG A;  1MWT A;  2Y59 A;  1SDE A;  1XXM A;  5HAQ A;  2RL3 A;  1IKG A;  2V1Z A;  5CHM A;  3DWK A;  3HLE A;  3UPO A;  3UDX A;  3FYZ A;  1H8Z A;  3TG9 A;  4BD1 A;  2HP6 A;  3M6H A;  4KG5 A;  3VOZ A;  4LEN A;  2Y2H A;  4K0W A;  2XH9 A;  2ZJ9 A;  1H5X A;  1PIO A;  3VFF A;  3W8K A;  4JXW A;  3IHB A;  3EQU A;  4R3J A;  3SS3 A;  2ZMA A;  3C4P A;  4RX2 A;  4RYE A;  3WS0 A;  5EVI D;  2WGV A;  3QNC A;  4MLL A;  5EOE A;  1Z6F A;  4KZB A;  1CEG A;  1LHY A;  1K55 A;  4P0M A;  5A93 A;  1BUL A;  1Q2P A;  3HLD A;  3GMW A;  5FQQ A;  3VP1 A;  1FSW A;  1TVF A;  1ESU A;  5IHV A;  5M18 A;  5CTM A;  2JE5 A;  1K54 A;  2Y2O A;  5FI2 A;  2Y2N A;  4UA9 A;  4KQR A;  4BLM A;  2XR0 A;  2ZC7 A;  3FWL A;  4S2O A;  4FH4 A;  5HL1 A;  1EWZ A;  1C3B A;  2J9O A;  3UE3 A;  5DVA A;  4IED A;  4LV1 A;  3HUM A;  4OOL A;  3UPN A;  3VSK A;  1PW1 A;  4GDN A;  4P6B A;  1PZO A;  2JCH A;  1HTZ A;  3OPH A;  4EV4 A;  1FQG A;  4N9K A;  3Q7V B;  3NY4 A;  5DF7 A;  3LO7 A;  5HFO A;  4FCF A;  4OP8 A;  5GHZ A;  5I94 A;  2ZD8 A;  2Y2G A;  4N92 A;  4Y0O A;  4XUX A;  1GA9 A;  1SDN A;  5EVI B;  3UNW A;  2Y2J A;  5FAS A;  1JVJ A;  3HLF A;  4S2I A;  2OSU A;  2H0T A;  1XPB A;  4S2L A;  4GZB A;  4GD6 A;  3N8L A;  1K56 A;  4NET A;  3VP3 A;  1N9B A;  1L2S A;  4JF4 A;  1E3U A;  3IWI A;  2Y91 A;  1MWU A;  3GR2 A;  3Q82 A;  5FQ9 A;  4WZ5 C;  5FI6 A;  3SH8 A;  4PM9 A;  1W8Q A;  3IXH A;  1BLP A;  1PI5 A;  3O88 A;  3NIA A;  3UN7 A;  2WKI A;  4R4S A;  2ZQA A;  5E2E A;  3IHA A;  4JKT A;  2R9X A;  1MBL A;  2EX2 A;  4KZ3 A;  4ZJ2 A;  4E3L A;  1XA7 A;  3RJU A;  1BSG A;  1YQS A;  1L0D A;  1FSY A;  3I7J A;  2A49 A;  3MZD A;  4S2N A;  2XFS A;  4CJN A;  5E2F A;  1LI9 A;  3ISG A;  1JWV A;  4MEZ A;  2H5S A;  5F83 A;  2XD1 A;  1TDG A;  4N9L A;  1PW8 A;  5GLC A;  4ZAM A;  2XD5 A;  4OPY A;  5EVI C;  4B4X A;  3P09 A;  2I72 A;  2X71 A;  4E3I A;  2X01 A;  1L0F A;  1RCJ A;  1YMX A;  3VSL A;  3G2Y A;  3OCN A;  5F1G A;  1BZA A;  3IF6 B;  3WWX A;  5EVL A;  2VGK A;  5CGW A;  2G2W A;  4GB7 A;  5JYP A;  3GV9 A;  4PPR A;  3N8R A;  1ERO A;  2HDR A;  3GRJ A;  5FAP A;  4PMA A;  1NYM A;  4HES A;  5DTK A;  4QD4 A;  1E25 A;  4OLD A;  4K91 A;  5KZH A;  4KG2 A;  4N1X A;  4S2K A;  1NZO A;  5BOH A;  3GTC A;  1ESI A;  3PBT A;  3S22 A;  2ZQ9 A;  1JWP A;  2PBY A;  3HRE A;  4Y0T A;  3OCL A;  1NXY A;  4MBH A;  5CXW A;  4Q8I A;  1JWZ A;  3HUN A;  1ES5 A;  1K4F A;  2V20 A;  3SS4 A;  3MKE A;  2ZM0 A;  1QMF A;  5HW3 A;  1W7F A;  1HD8 A;  4R23 A;  4B88 A;  1TEM A;  2V2F F;  1Q2Q A;  3JYI A;  1BLC A;  4IVI A;  3PTE A;  4JF6 A;  1ONH A;  4X56 A;  1L0E A;  4S2M A;  3ZVW A;  4E6X A;  4EBL A;  4R4R A;  1NZU A;  2IWC A;  3V39 A;  4BEN A;  2Y4A A;  5KSH A;  1NYY A;  4BQM A;  3SH9 A;  3BYD A;  3G35 A;  1IYP A;  3HLC A;  4QB8 A;  2EXB A;  4BJP A;  1DJC A;  2ZM2 A;  3ZG9 B;  3Q7Z A;  4U3T A;  4DRT A;  1YLT A;  1JTD A;  2BG1 A;  4KZ5 A;  5AQB A;  3HL9 A;  4DE2 A;  4DE0 A;  1J9M A;  2PU2 A;  4DF6 A;  2DCF A;  5DF8 A;  3IXG A;  1I5Q A;  3OPR A;  3CMZ A;  3IWO A;  1PYY A;  3OPP A;  4LCM A;  4Z9Q A;  1K56 D;  2ZQ8 A;  4XUZ A;  4UAA A;  1IEM A;  2WZX A;  5TR7 A;  3BRM A;  1MWR A;  5FQK A;  4YIN A;  5TGF A;  1E3U D;  2C5W B;  4OLG A;  5GLA A;  4DKI A;  4IBR A;  5FA7 A;  3ZNY A;  1KGF A;  1LLB A;  1IYS A;  3HBR A;  5FAT A;  2WUQ A;  3G32 A;  2QMI A;  1MY8 A;  4Y7P A;  5CGS A;  4IVK A;  5GLD A;  4B4Z A;  3UO9 A;  3BEC A;  4LV0 A;  4JBF A;  4R1G A;  1FR1 A;  4WBG A;  4KG6 A;  4KQQ A;  1NRF A;  2WGW B;  1ERQ A;  1S0W A;  5CHJ A;  4QHC A;  3LCE A;  4X6T A;  4CPK A;  2GDN A;  5D3O A;  3N8S A;  5KSC A;  1K25 A;  3FZC A;  1KGG A;  3N7W A;  2XLN A;  1S6R A;  4QU3 A;  1K55 C;  1CI9 A;  4OPQ A;  5GHY A;  4HEF A;  1ES2 A;  2ZLY A;  3MXS A;  1KDS A;  4E3K A;  4ID4 A;  1K54 C;  1YLY A;  4WYY A;  1XX2 A;  3OC2 A;  4JXG A;  3ZCZ A;  4GKU A;  4E6W A;  1SCW A;  4ZTK A;  4LV3 A;  1W79 A;  1XGJ A;  2UWX A;  3IXD A;  2J8Y A;  1WYB A;  4HBU A;  1RGY A;  4DDS A;  1G68 A;  1OME A;  2WKH A;  1YMS A;  2P9V A;  2R9W A;  3M2J A;  1I2W A;  4P85 A;  3W4O A;  3E2L A;  5AQ7 A;  1G6A A;  1ERM A;  1WE4 A;  3PBN A;  1AXB A;  2B5R A;  3NC8 A;  4KZ4 A;  4EQI A;  3NBL A;  4KZ7 A;  5HX9 A;  4PM6 A;  2VGJ A;  3SS5 A;  1K6S A;  2WAF A;  3WRZ A;  2ZC4 B;  4QY6 A;  2IWD A;  3VMA A;  5FDH A;  1PI4 A;  2FFY A;  4U0X A;  2JBF A;  2ZQC A;  3CJM A;  1NJ4 A;  2H0Y A;  5EUA A;  2DNS A;  3HVF A;  4JXV A;  1FCN A;  3UY6 A;  1ONG A;  5FSR A;  4HBT A;  3WS5 A;  4OKP A;  4DDY A;  3MZF A;  3AGE A;  3BFF A;  1MKI A;  4F94 A;  1O7E A;  1YT4 A;  3O86 A;  3BFC A;  3BFE A;  5JYO A;  1XP4 A;  4NK3 A;  4EBP A;  3DWZ A;  2J7V A;  4WMC A;  3ZG7 B;  2WGI A;  4MBF A;  2WAE A;  4BD0 A;  3A3E A;  4Y0U A;  5CER A;  3ZNT A;  4DE1 A;  3OPL A;  2Y2Q A;  5DF9 A;  2E8I A;  3N4I A;  4S2N C;  3WS4 A;  1O07 A;  3GSG A;  1PWG A;  5M19 A;  3BLM A;  4YFM A;  2XF3 A;  4U0T A;  4FD8 A;  5F1F A;  5CEC A;  3W4Q A;  3AGD A;  2IWB A;  4QJG A;  3MZE A;  3V50 A;  3N6I A;  1YLW A;  1ZG6 A;  4RA7 A;  5EE8 A;  3ITB A;  2Y2P A;  4O7D A;  5HAI A;  1LL9 A;  4OPZ A;  1FOF A;  1GHP A;  3Q1F A;  3ZVT A;  2PU4 A;  4WEJ A;  4X69 A;  4E3N A;  4EBN A;  4JXS A;  4N1H A;  4R0Q A;  2XGN A;  4L0L A;  5L2F A;  2Y2I A;  5E2G A;  4OQG A;  3SH7 A;  4XXR A;  1ZC2 A;  3ITA A;  3QNB A;  3B3X A;  3HLG A;  1PWD A;  3PBS A;  2OLV A;  5DTS A;  5A91 A;  3ZGA B;  3TSG A;  3ZG8 B;  3CG5 A;  1DJA A;  3BFD A;  3NI9 A;  3UDI A;  4E3J A;  1VQQ A;  4PM5 A;  4OP5 A;  1MWS A;  1U60 A;  1FCO A;  2H10 A;  3BEB A;  2HDQ A;  4C3Q A;  4E3O A;  4RVA A;  2HP5 A;  4GDB A;  2WAD A;  1CEF A;  4EUZ A;  2Q9M A;  3IH8 A;  3IF5 A;  1K6R A;  4KZ9 A;  4DE3 A;  1ES4 A;  1PWC A;  1EI5 A;  5CED A;  4PM7 A;  4X68 A;  5E43 A;  4QY5 A;  2A3U A;  4JPM A;  3IH9 A;  2WZZ A;  3C5A A;  1KGE A;  1RGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...