1LL5A

X-ray crystal structure of ampc wt beta-lactamase in complex with covalently bound imipenem
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
358
structure length
351
Chain Sequence
b'APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-lactamase
molecule tags Hydrolase
source organism Escherichia coli
publication title Structural Basis for Imipenem Inhibition of Class C beta-lactamases
pubmed doi rcsb
total genus 113
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ll5A00
3A3EA 1XA1A 1K56D 1L0GA 3SS3A 5CGSA 4MBHA 3NDEA 3C4OA 2ZLYA 5DTKA 4P87A 4GD6A 4ZJ2A 4WZ4A 1W8YA 3A3JA 3HBRA 3Q81A 5JYPA 3GSGA 5DTSA 1Z6FA 4LV3A 4YINA 1MPLA 2ZJ9A 4PM9A 2FFYA 3OZHA 5EOOA 2G2UA 3PBTA 3IWQA 4BL3A 4PM5A 1HZOA 4ID4A 1DJCA 2QZ6A 2Y2PA 3SOIA 2Y2JA 2Q9MA 1ALQA 2WZXA 2EX6A 5FDHA 4CJNA 1EWZA 1KE3A 2XH9A 4PM6A 2X71A 3IF6A 2DCFA 3G30A 1BLCA 2Z2LB 5FQJA 2Q9NA 1FCOA 1K6RA 1BLPA 3ZVWA 2PU2A 4CPKA 2EFXA 3N8SA 1HTZA 4U0XA 4K0XA 5FAQA 5U47A 1FR6A 4KQQA 4DKIA 2ZC4B 1ES4A 4OLGA 2I72A 3MZEA 3IF6B 3G35A 4XUZA 1GA0A 3M6HA 4D2OA 4P6BA 1SCWA 5CTNA 1KGGA 3AGFA 5GHYA 4ZDXA 4Y0TA 1IKIA 1NZUA 4R1GA 4E3NA 4DDSA 4HESA 4XXRA 4PM7A 5GHZA 5F1GA 2ZQ8A 1ES5A 3ZVTA 3IHBA 1VQQA 5CEBA 5EVIC 5G18A 3WRZA 1YMSA 1K25A 5GL9A 2J8YA 1FCMA 3NCKA 3UNWA 1CI8A 1PYYA 3A3IA 3IXGA 4UA6A 3ZFZA 2EXAA 3NI9A 3ZNYA 4NETA 3I7JA 1AXBA 4MLLA 5FI2A 1L0FA 1KVMA 3NDGA 4UA7A 4EBLA 1NZOA 4X68A 1DJAA 3Q7VA 1NXYA 1IYQA 5A91A 3S1YA 4DXCA 4LCLA 3VP2A 2EX8A 2HPBA 4U0TA 2P74A 4DXBA 4EUZA 1K54C 3GR2A 2CC1A 1N9BA 3P09A 4WM9A 5FATA 1WYCA 4R4SA 2EX9A 4FH4A 4OQHA 5FQIA 4HEFA 3PBSA 5HX9A 5M18A 3G31A 2J9OA 1XGIA 1ONHA 5I94A 2ZQ7A 1IYPA 1BTLA 3O87A 5AQ7A 4MBKA 5EOEA 5GLCA 1E25A 4GD8A 4Y0UA 2BG1A 4JPMA 3LO7A 4E6XA 4YFMA 3PBOA 4U3TA 2V2FF 1PWGA 1MWTA 1YLZA 2WK0A 1PI5A 1NYYA 5EVIA 3V39A 3VP0A 3LEZA 1MY8A 3LY3A 4ZJ3A 3FWLA 2R9XA 1E3UD 1BLHA 1MKIA 2WGWA 4E6WA 4R4RA 4N9LA 2JCHA 3Q7VB 4S2KA 4BQMA 4BENA 4Y7PA 1K57C 4Z9QA 1LI0A 2PU4A 1IKGA 1RCJA 4KZ9A 5A93A 3BEBA 3IXBA 4HBTA 4OPYA 4BD0A 3UE0A 1DJBA 2WGWB 3ZG7B 2HP6A 4DRTA 1RGZA 3OPLA 3ITAA 1SDEA 3Q82A 4IBRA 4EBPA 2Y91A 4JBFA 3SH9A 1L2SA 1PW8A 4QD4A 1KGFA 3HUOA 3BFCA 4KG5A 3W8KA 3VP4A 1ESUA 4LCMA 4UA9A 1ZC2A 5DVAA 3IT9A 5CERA 2Y2LA 4E3MA 2X01A 1TVFA 3MXSA 1XX2A 2XD1A 5E2EA 3P98A 2G2WA 3SS4A 1MWRA 1KE4A 3IWIA 1BSGA 4K0WA 4LV2A 4R23A 3IF5A 4WEKA 2WAEA 1W5DA 1H8ZA 1KVLA 1MBLA 3MZDA 3IF6C 4S2OA 5EVLA 4E3JA 4X69A 3CG5A 4WYYA 5A92A 4LV1A 3ZG8B 5FQQA 1C3BA 3VSKA 4O7DA 2A3UA 3WWXA 4KZ6A 2UWXA 3B3XA 3UY6A 1PWCA 3DW0A 1W79A 5KSCA 4P0MA 1CK3A 1Q2QA 4E3LA 1TDLA 3E2LA 2ZQCA 2WADA 3CZDA 1IEMA 3A3FA 4OPRA 1ZG6A 2XDMA 4MBFA 5FA7A 5AQ9A 3UPPA 4S2NC 3HUMA 4R3BA 2OSUA 3N6IA 2VGKA 2HDUA 3WS5A 4BL2A 5D3OA 5FQ9A 1ES3A 5E43A 4N92A 4GNUA 5AQBA 3ISGA 1PW1A 3HLCA 4WMCD 1FSYA 2ZMAA 1YLYA 2XEPA 1BT5A 3Q1FA 1PZPA 3VP1A 5F82A 3UO9A 1JWVA 3ZCZA 2Y2QA 3VFFA 2Y2OA 1CEGA 1G6AA 1MXOA 1RP5A 4NK3A 3GRJA 4KZBA 1GCEA 4DDYA 4A5RA 1S6RA 1ONGA 3NIAA 4RA7A 5CEDA 2ZC3B 2JC7A 3BRMA 1YLWA 3O86A 1K55A 1JWZA 1LLBA 2A49A 3PAGA 4GZBA 5TFQA 5KMWA 1VM1A 3IH8A 3HVFA 1NJ4A 4ZBEA 3OC2A 5HFOA 3C7VA 4FSFA 4KG6A 5DF8A 5E2FA 3O88A 5GLDA 3UDIA 3VP3A 4BD1A 1DY6A 3QHYA 1GHIA 2XQZA 4UHUA 3OPHA 5CGWA 4X53A 3EQUA 1NY0A 1JVJA 2ZQAA 4KZ7A 1ERQA 4GKUA 2V20A 2WAFA 3FV7A 3W4OA 2HP9A 5AQAA 5CECA 1XKZA 3ITBA 4P85A 1GHMA 3C4PA 4QB8A 3DWKA 3DTMA 5EUAA 3VOZA 5A90A 1KDWA 3OCLA 2WKHA 1SHVA 4OP5A 4X55A 4EV4A 3G2ZA 3IH9A 3JYIA 3NY4A 4KZ4A 5HARA 3GV9A 3N7WA 3VFHA 4RX3A 5HL1A 1WYBA 4IVIA 4QHCA 4WZ5A 2XR0A 1QMEA 4PPRA 1JTGA 3E2KA 1IYOA 1ES2A 1O7EA 5M1AA 3UPNA 1LL5A 1I2SA 3BLMA 4JXGA 3IXDA 5CTMA 3V3RA 3OPPA 3D4FA 3VOYA 5HW3A 4GB7A 2XK1A 2Y55A 1GHPA 1Q2PA 1W8QA 1K54A 2WGIA 4EBNA 4MNRA 4C6YA 4OH0A 1BUEA 4PM8A 4RYEA 5FQKA 3TG9A 4WELA 4C3QA 4K91A 4UAAA 5CGXA 2H5SA 3QNCA 4S2NA 1U60A 2IWBA 2H10A 4FCFA 2OV5A 2Y4AA 4IEDA 4S2LA 3MXRA 2C5WB 1L0EA 3WS4A 4S2PA 3VMAA 4JF5A 2JBFA 2WUQA 1S0WA 3M2KA 2Y2IA 4OLDA 1GA9A 3DWZA 1FQGA 1K56A 2Y2HA 4KG2A 1W7FA 3M6BA 4H8RA 5FASA 1EI5A 4BLMA 2ZC7A 4QY5A 4WMCA 2WGVA 4JXVA 3WRTA 4BJPA 1FR1A 1WE4A 1K38A 1TEMA 1YLTA 2Y2KA 3IHAA 3BFEA 3IXHA 1LL9A 5FI7A 1YMXA 3ZG9B 2EFUA 1NYMA 3MKEA 5CHMA 4JF4A 2QPNA 4S2IA 1RGYA 2H0TA 1KE0A 3UPOA 3MBZA 2ZM8A 4OQ0A 4QJGA 1O07A 3BFDA 1HVBA 1PI4A 5EVID 1YLJA 4JLFA 2VGJA 1CEFA 2ZM0A 3QNBA 4RVAA 4WZ5C 5KSHA 4N9KA 3BFGA 3RXWA 2EXBA 2QMIA 3G32A 2DRWA 3IWOA 2P9VA 4GN2A 4KENB 1YT4A 3O3VA 4IBXA 2HDQA 2ZC5B 3BLSA 5J8XA 5EECA 3OCNA 3G2YA 2WYXA 1XA7A 1ZKJA 2ZQDA 3WS0A 2BLSA 2Z2MB 2X02A 2RL3A 3C7UA 4OQIA 5TGFA 3UDXA 3VSLA 1E3UA 5BOHA 3HLFA 1CI9A 4FD8A 4GDNA 4OPQA 2Y59A 2J7VA 3TOIA 3W4PA 2B5RA 4PMAA 5CHUA 3V5MA 3FKVA 2XD5A 2WKEA 4QY6A 3ZG5A 4OKPA 4X6TA 4JXSA 1SDNA 1ERMA 4L0LA 2Y2GA 4MEZA 3HREA 3GTCA 4LENA 4OP8A 5E2GA 3AGDA 1BLSA 5KZHA 3WS1A 4OONA 3AGEA 4E3KA 2ZQ9A 3WS2A 4LV0A 3PBRA 5L2FA 4Y0OA 2XGNA 1YLPA 3PAEA 4JKTA 4GOGA 4OOLA 4X56A 2C6WB 4GDBA 4KZAA 2XLNA 3GMWA 5F1FA 5FAOA 2P9VB 4OVDA 5GLAA 4FH2A 2EX2A 1XGJA 3GVBA 5FSRA 1QMFA 1G68A 1ESIA 3M2JA 5DF9A 4R3JA 3SS5A 1ZG4A 3ZG0A 2ZC6B 4S2MA 5EPHA 5CXWA 4EWFA 3PBNA 1YQSA 4DE0A 1N4OA 2XFTA 2ZD8A 4KZ8A 1K4EA 4ZJ1A 1YM1A 1J9MA 4KZ3A 1E4DA 2E8IA 5E2HA 4N1XA 2RCXA 2DNSA 4ZAMA 2WZZA 4XUXA 2GDNA 3ZNTA 4DE1A 3MFDA 1FCNA 4KZ5A 1TDGA 3LY4A 1PZOA 2IWCA 2Y2MA 3FKWA 1H5XA 1HD8A 3S22A 1EROA 4OOMA 3RXXA 1MWUA 4C75A 2WKIA 1K6SA 4QU3A 1SKFA 5FQMA 3PBQA 4JXWA 5IHVA 3EQVA 4OOYA 3HLEA 1I2WA 2OLUA 3BFFA 4N1HA 3ZGAB 1NRFA 3G4PA 3UE1A 3HLDA 5EVIB 4EQIA 1FSWA 5HAQA 3W4QA 4WEJA 3HLGA 2Y2NA 2XF3A 4B88A 5HAIA 3UN7A 3TSGA 4DE3A 1L0DA 3IQAA 4KQRA 3UDFA 4JF6A 1BULA 3BM6A 3HLBA 2J9PA 3N4IA 4IVKA 2PBYA 1PIOA 1K4FA 5DF7A 1K57A 2HP5A 1BZAA 5GHXA 5CRFA 3ZDJA 5GLBA 1IYSA 5F83A 4OQGA 3SH7A 3V50A 4OPZA 1LI9A 3CJMA 1JTDA 5JYOA 2R9WA 3A3DA 4ZTKA 5DTTA 3Q7ZA 4M3KA 4B4XA 3HL9A 3V3SA 4B4ZA 2IWDA 4R0QA 4RX2A 4DF6A 2XFSA 1OMEA 3PTEA 4S2JA 3NC8A 1H8YA 1JWPA 3FZCA 3GQZA 3MKFA 5CHJA 1XXMA 5M19A 4WBGA 1M6KA 2FFFB 3HLWA 3NBLA 3G34A 1LHYA 2JE5A 3LCEA 3BYDA 5EE8A 3ZHHA 1KGEA 4HBUA 1XPBA 1I5QA 4KQOA 3BECA 3MZFA 3RJUA 3SH8A 1M40A 2H0YA 4E3OA 4F94A 2HDSA 5FI6A 3FYZA 1XP4A 2V1ZA 2HDRA 1K55C 5FAPA 1MWSA 1FOFA 3N8RA 3Q07A 1Y54A 1KDSA 4Q8IA 2OLVA 3UE3A 4DE2A 3S4XA 3HUNA 3C5AA 5TR7A 4E3IA 3OPRA 1PWDA 1IELA 5HAPA 2ZM2A 3N8LA 3CMZA
chains in the Genus database with same CATH superfamily
3A3EA 1K56D 4L9EA 3B42A 4HJ6A 2ZLYA 4WZ4A 4R3AA 1Z6FA 3S7QA 2J3TD 4LV3A 4B93A 4HQAA 4LRYC 3IX4A 4YINA 4PM9A 2G2UA 3PBTA 4JGRA 3RTYA 4UQIM 1ALQA 3IS2A 2KLIA 4CJNA 1EWZA 3UE6A 5C5KA 2Z2LB 2W0NA 2Q9NA 1FCOA 3ZVWA 3N8SA 3OBFA 5J7EA 4U0XA 4DKIA 3BW6A 5G4ZA 2ZC4B 3EOIA 1GA0A 3M6HA 4P6BA 1SCWA 4IHQA 4ZDXA 4DDSA 5MC7A 4XXRA 1MKMA 5CEBA 5G18A 1K25A 1CI8A 3IXGA 4G3WA 4X68A 1NXYA 5A91A 3R7WB 3MQOA 3GR2A 2CC1A 1N9BA 2B02A 1WYCA 4R4SA 3PBSA 2J9OA 1XGIA 2ZQ7A 2JN7A 5AQ7A 4LLOB 4MBKA 1XJ4A 5GLCA 2AVXA 4Y0UA 2BG1A 4RQ9A 1PWGA 2PAVP 2WK0A 1NLZA 3LEZA 3LY3A 3FWLA 5HWTA 1T18A 4GCZA 1BLHA 4E6WA 4BMWA 4FOFA 2K7SA 5J4EA 5TJJA 3U4LP 1RCJA 3IXBA 2WGWB 4DRTA 4LPZA 3Q82A 3VE3A 2JKTI 4JBFA 4KG5A 3W8KA 4P6ZS 4M4XA 1ESUA 2I9VA 5DVAA 2XA7M 2Y2LA 1YSQA 4EQ1A 1N9LA 1XX2A 3NULA 5E2EA 3SS4A 3KYZA 1BSGA 4WEKA 2WAEA 1H8ZA 1KVLA 3BQ8A 1OJGA 3VSKA 4ARZA 4O7DA 2V0UA 3DBAA 5DFXA 1PWCA 3DW0A 2HGVA 5HWVA 4DMZA 4E3LA 1TDLA 3E2LA 3MS6A 1ZG6A 2XDMA 5FA7A 4DJ2A 5AQ9A 1NLYA 3E4QA 4B9OA 2W1TA 4BL2A 5E43A 4N92A 2ZMAA 3NOPC 4EW7A 2QJ5A 1CF0A 3VFFA 2P7JA 1ONGA 3BRMA 3PAGA 5KMWA 2GZAA 4FSFA 3UDIA 2OAP1 1GHIA 4UHUA 3C30A 4BWIA 4X53A 1NY0A 3KSFA 3CITA 4GKUA 3FV7A 3W4OA 1FIKA 4R6LA 4EEUA 5AQAA 3BJNA 3ITBA 3T12B 1P97A 5EUAA 2WKHA 4O0PA 1SHVA 1H0MA 3G2ZA 1Y28A 3N7WA 5HL1A 1WYBA 4IVIA 2XR0A 1JTGA 1LL5A 1I2SA 3VOYA 4JXGA 3V3RA 5HW3A 3OPPA 3D4FA 3PYPA 4BBTA 3T4TA 4EBNA 2VGLS 4OH0A 4PM8A 4C6YA 4WELA 2P04A 3W2ZA 1YSPA 2H10A 2VEAA 3D9YA 4YNRA 2OV5A 5F69A 4S2PA 2B18A 2WUQA 1S0WA 2Y2IA 3KSIA 1H3QA 1W7FA 4YOFA 5CX7A 1ZHHB 4BJPA 3F1OA 1YMXA 2EFUA 1NYMA 2HF6A 3UPOA 2ZMVA 2ZM8A 4OQ0A 3BFDA 3NHQA 1HVBA 1PI4A 2L1MA 1CEFA 3QNBA 3CUEA 2W3HA 2QJ7A 3RXWA 2QMIA 3LGOA 4DN0A 4IBXA 2HDQA 5J8XA 2V1AA 1ZKJA 3RFBA 3WS0A 1IOUA 3CPTA 1PNEA 3TE8A 1CI9A 1VETB 2Y59A 2DMWA 2B5RA 3V5MA 1SDNA 4MEZA 1BLSA 3EEHA 4OONA 1STZA 3PBRA 2XSSA 5HDDA 2XGNA 4OOLA 4WN5A 4GOGA 4KZAA 2XLNA 5FAOA 2JKTM 5GLAA 3T1RA 2W3FA 4II7A 1G68A 3DTIA 3LUQA 5DF9A 5HDSA 1H8MA 2ZC6B 3PBNA 3LR4A 3C2WA 1N9NA 3VOLA 4ZAMA 4WF0A 4MN5A 3ZNTA 4KZ5A 3LY4A 5DFYA 5G4YA 4G3VA 3VV4A 5AVEA 1HD8A 4OOMA 3R7WA 1MWUA 1OT9A 3MJQA 1K6SA 4QU3A 5FQMA 5IHVA 2VK3A 3BFFA 4N1HA 3ZGAB 1TD5A 2O0YA 3LR3A 2Y2NA 2XF3A 4KQDA 4DE3A 2GX5A 4JF6A 1BULA 3KYEA 1G28A 2PBYA 1K4FA 1K57A 1LSWA 2HP5A 1BZAA 3P01A 5AJGA 4F3LA 4DJ3A 5F83A 4O8GA 1NWZA 3LI9A 1TS0A 3S7OA 1JTDA 3F1NA 3Q7ZA 2R78A 4M3KA 4B4XA 3D3OA 2XFSA 1CJFA 1IFQA 1OMEA 1H8YA 4HH2A 5M19A 2V0WA 2FFFB 1LHYA 1S1ZA 5EE8A 4BBVA 3GECA 1I5QA 4KQOA 3MZFA 1M40A 3FYZA 4GHIA 2V1ZA 2HDRA 1K55C 1AWIA 1Y54A 1TS8A 4Q8IA 4BBUA 4DE2A 4XT2A 2O9AA 4HJ4A 3N8LA 3BY8A 4F3LB 4WUJA 5CGSA 3C4OA 4P87A 4GD6A 5HD5A 3ZQ5A 3HBRA 1XJ6A 5DTSA 2ZJ9A 2FFYA 2XRNA 5EOOA 4QPRA 4P6ZM 2Y2PA 1YPRA 4PAUA 4Q0HA 2Y2JA 2Q9MA 4NKPA 2EX6A 2YKHA 3IF6A 2DCFA 3FG8A 4ZRRA 1BLPA 2PR6A 5FAQA 4WLAA 3MZEA 3IF6B 4XUZA 1KGGA 3JVUA 4HESA 1LSVA 5GHZA 2ZOHA 3A0RA 3IHBA 1V9ZA 1FCMA 3NCKA 3UNWA 5IT5A 1OJ5A 3A3IA 4UA6A 2EXAA 2NUTC 5TBMB 3ZNYA 2A2LA 4MLLA 1NZOA 4I3JA 1IYQA 3S1YA 4DXCA 2EX8A 2P74A 4KUKA 5FATA 4FH4A 3LR0A 5FQIA 5M18A 5I94A 1BTLA 1IYPA 5EOEA 1E25A 4GD8A 4KUOA 3LO7A 3LIBA 1MWTA 1NYYA 1YKDA 3NJAA 5HPIA 4BQMA 4BENA 1K57C 4KZ9A 4BD0A 4JGOA 2L0WA 3ZG7B 2HP6A 5DKKA 1MZUA 1SDEA 4UQIS 3SH9A 4QD4A 2L4RA 3HUOA 3VP4A 4LCMA 1UWNX 1ZC2A 2VKSA 1TVFA 1S1YA 2V1BA 3P98A 1ZTUA 3IWIA 4R23A 4GJ4A 1G6OA 3MZDA 3IF6C 4X69A 3MQ0A 4IUHA 4ME4A 2UWXA 3UY6A 5KSCA 1LT0A 1Q2QA 3TJZC 2WADA 1IEMA 3A3FA 4I3AA 4S2NC 3HUMA 3FC7A 2OSUA 3P7NA 4K08A 2GJ3A 5FQ9A 1ES3A 5AQBA 3GDIA 1PW1A 4WMCD 2XEPA 1BT5A 4I3IA 1JWVA 3ZCZA 2Y2QA 1MXOA 4DDYA 3C8CA 4KZBA 2W3GA 4CLCE 1S6RA 3NIAA 5CEDA 1K55A 1JWZA 1LLBA 4HP4A 5TFQA 1VETA 3IH8A 3HVFA 1NJ4A 1W63Q 4ZBEA 5DF8A 5GLDA 3O88A 1DY6A 3QHYA 4MDZA 3OPHA 1FILA 1TS7A 1VEUB 4FTXA 2HP9A 4O01A 3T4KA 3T50A 4L9GA 3OCLA 4EV4A 3IH9A 3NY4A 5HARA 3R4KA 3E2KA 3UPNA 3BLMA 3QP4A 4LRXC 5TBMA 3MFXA 3UB8A 4MNRA 1BUEA 4RYEA 3TG9A 2IWBA 1T19A 2LB5A 2O9CA 4IEDA 2BASA 3MXRA 1L0EA 3VMAA 2JBFA 3PHYA 1GA9A 3ULFA 1FQGA 3E98A 3F1NB 4KG2A 5FASA 3M6BA 4BLMA 2ZC7A 4WMCA 3IXHA 1K38A 3IHAA 1TEMA 2PYRA 2Y2KA 3BFEA 5HZHA 2K2NA 5CHMA 4JF4A 4Q0IA 4HH3A 2KDKA 1K0KA 4JLFA 1LSXA 2PBDP 2W1RA 3IS2B 1BYWA 4PHTA 3IWOA 2P9VA 1YT4A 5I5LA 2MJ6A 2ZC5B 2WYXA 3QP2A 1XA7A 3MSHA 2WKQA 3LIDA 4EETB 3C7UA 2RL3A 4OQIA 1E3UA 5BOHA 4FD8A 4GS9B 2J7VA 4GHIB 4PMAA 3CWFA 3FKVA 3DTEA 2XD5A 4OKPA 1DP9A 4JXSA 4L0LA 4X25A 4LENA 3GTCA 4OP8A 4CLCA 1KOUA 2V8CA 3WS1A 3AGEA 2ZQ9A 2WKRA 1YLPA 4JKTA 2P9VB 3GVBA 3T4QA 1QMFA 2HV1A 1OTIA 4G3KA 4R3JA 1ZG4A 5CXWA 4EWFA 1LL8A 2HJEA 2XFTA 4KZ3A 2K31A 2E8IA 4N1XA 2DNSA 2WZZA 4XUXA 2GDNA 1S67L 4DE1A 2Y2MA 4MN7A 3S22A 4HHDA 1I2WA 3G4PA 3HLDA 5EV0A 5EM0A 5EVIB 5HAQA 4WEJA 4B88A 3TSGA 1S66L 1L0DA 3UDFA 2J9PA 4IVKA 4ARZB 5CRFA 5FL3A 1T1CA 4JGQA 1SKOB 3CJMA 3PXPA 5JYOA 3CPTB 5DTTA 3HL9A 2IWDA 4R0QA 4RX2A 3UB9A 3PTEA 1S4SA 1P9RA 1UGUA 3G34A 3MXQA 2HZ5A 3BYDA 3ZHHA 1KGEA 4HBUA 1XPBA 1XJ3A 3U2AA 4F94A 1HLUP 1MWSA 1FOFA 3N8RA 2V9AA 2A24B 3C5AA 5TR7A 4HY8A 1IELA 2YKFA 4MN6A 1XA1A 3B47A 3CLOA 4Z1WA 3H82B 1OPXA 4MBHA 3NDEA 2O9BA 5EFWA 5DTKA 4ZJ2A 3T1QB 1W8YA 5JYPA 3GSGA 5IU1A 4NXGA 1MPLA 3T4JA 3V67A 3T4OA 5LBRA 3IWQA 4BL3A 5HSQA 3SOIA 5HWWA 1KE3A 4MCWA 3G30A 4CQHA 1L3LA 2KOIA 2EFXA 5K5BA 1HTZA 2OWJA 5U47A 4KQQA 1SZVA 1ES4A 5IS1A 4OLGA 4JGPA 3G35A 4D2OA 3AGFA 3H7WB 2M7UA 4Y0TA 4E3NA 1XFNA 4PM7A 2QWSA 1ES5A 3WRZA 2LB9A 3H7WA 5GL9A 2J8YA 1WA9A 1AXBA 5FI2A 1KVMA 3LIEA 4UA7A 4EBLA 4QWOA 1PRQA 3RH8B 2PDRA 4LCLA 3VP2A 5KIZA 4U0TA 2VA0A 3A0SA 1K54C 3QP1A 4LRZE 4EUZA 4WM9A 4OQHA 5HX9A 3G31A 3O87A 3DAVA 4JPMA 4E6XA 4FUWA 3PBOA 2V2FF 1PI5A 5EVIA 3V39A 1MY8A 4ZJ3A 2WGWA 3CUEC 4HOIA 2JCHA 5L09A 4Y7PA 5F6AA 1LI0A 4UEYA 2PU4A 1IKGA 2VGLM 4HBTA 3G6OA 3UE0A 3ITAA 3UB6A 3F1PB 4EBPA 3O5YA 2Y91A 4CLCD 4AFIA 3BFCA 3NECA 3OOVA 1ACFA 3MXSA 2XD1A 5DJTA 1KE4A 4LV2A 3IF5A 1W5DA 3UMDA 4S2OA 3CG5A 2PT7A 4LV1A 5FQQA 1C3BA 2EWWA 2A3UA 3D72A 1D7EA 3WWXA 4KZ6A 4Y15A 3B3XA 1W79A 1N9OA 2J80A 3CZDA 3LR5A 4OPRA 2Z6DA 4R3BA 3TRCA 2VGKA 2HDUA 3UB7A 5D3OA 4GNUA 4MMNA 3HLCA 1FSYA 2UV0E 5EVEA 3Q1FA 1PZPA 4NK3A 1CEGA 1G6AA 3GRJA 1GCEA 3T1XA 3EGXC 2JC7A 2ZC3B 1YLWA 4GS9A 3OC2A 3IBRA 3VP3A 3T4LA 4NXBA 3KSGA 4BD1A 1CQAA 2ZQAA 4KZ7A 1ERQA 2V20A 2WAFA 5CECA 3NOTC 4P85A 1GHMA 4QB8A 1DP6A 3DTMA 3DWKA 4OP5A 3JYIA 4GLQA 1QMEA 1ES2A 1O7EA 5M1AA 5CTMA 3KO6A 2Y55A 1GHPA 1W8QA 2WGIA 1K54A 4NG2A 5FQKA 1T1AA 4C3QA 4K91A 4UAAA 5CGXA 3IX8A 2H5SA 3QNCA 4S2NA 2HJ9C 1U60A 3LEQA 2Y4AA 4L9FA 1OTAA 4S2LA 2C5WB 3FPVA 4JF5A 1PFLA 3VE4A 3M2KA 2Y2HA 1EI5A 3NOUC 4CLCB 4JXVA 1FR1A 1WE4A 1XJ2A 1YLTA 1LL9A 2INWA 5FI7A 2WKPA 1RGYA 5FEGA 1O07A 1GSXA 3E0YA 5KSHA 3BFGA 4NXEA 2DRWA 4KENB 4ESPA 1A0KA 1Y4OA 5EECA 3OCNA 3TW8A 2ZQDA 2EA9A 5TGFA 3VSLA 4GDNA 4OPQA 3TOIA 5CHUA 4X6TA 2A24A 2QHKA 1ERMA 2Y2GA 5E2GA 3HREA 3MQQA 3WS2A 4LV0A 1X0OA 4R70A 5L2FA 1OTBA 3PAEA 3T1SA 4X56A 5F1FA 3KX0X 4OVDA 1OTEA 2Y79A 4FH2A 2EX2A 1XGJA 1ESIA 2E8JA 3EGDC 4LFUA 3M2JA 1XFQA 2VV7A 5EPHA 4DE0A 1K4EA 2QKPA 1J9MA 3HCYA 1E4DA 4Y5FA 5E2HA 2FZ0A 2Z6CA 4YWZA 3FPWA 3S7PA 3MFDA 1FCNA 1TDGA 4WL9A 3A0VA 1EROA 4C75A 3PBQA 1EW0A 2OLUA 1NRFA 4EXOA 1FSWA 3LIFA 4CLCC 3IQAA 3BM6A 3KSHA 2OAQ1 4D60A 2W3DA 1F98A 1P9WA 5DF7A 3ZDJA 2GNXA 5GLBA 3F1OB 3SZTA 4OQGA 3SH7A 1OT6A 1LI9A 3OLOA 2R9WA 3JVVA 3IBJA 3IX3A 4B4ZA 3V3SA 4DF6A 5L07A 5CHJA 3GQZA 3MKFA 1XXMA 3HLWA 2PR5A 4EEPA 1D06A 2JE5A 2JHEA 5J3WA 3SH8A 3RJUA 4E3OA 2HDSA 1MC0A 1TF1A 1KDSA 3S4XA 3OPRA 1F2KA 5HAPA 2ZM2A 5L10A 3CMZA 1L0GA 3SS3A 3ICYA 1DRMA 2KX6A 5F68A 4HIAA 1OTDA 4H6JA 3A3JA 3Q81A 1UWPX 3UMEA 4Y17A 2OWHA 5HDCA 3OZHA 4PM5A 1HZOA 4ID4A 1DJCA 2QZ6A 5AVFA 2WZXA 5FDHA 2XH9A 4PM6A 2X71A 1VHMA 1BLCA 3MMHA 5FQJA 4CPKA 1K6RA 2PU2A 4K0XA 5DKLA 1FR6A 4LGWA 2I72A 3QP5A 3HJKA 1SKOA 1TS6A 5CTNA 5GHYA 1IKIA 1NZUA 2CMNA 4HI4A 4R1GA 4NXFA 5F1GA 2PRFA 2ZQ8A 3ZVTA 3LIAA 1VQQA 5EVIC 1YMSA 1PYYA 3CI6A 3ZFZA 2JKFA 3NI9A 2JKRI 4NETA 2ZBBA 3I7JA 1GSVA 1L0FA 3NDGA 3UB5P 1D1JA 1DJAA 2Q0OA 3Q7VA 4Y3IA 2M1CA 2HPBA 4DXBA 3P09A 2VV6A 2M7VA 2EX9A 4HEFA 1ODVA 1ONHA 4R38A 4Y2FA 4HNBA 4YFMA 4U3TA 3H82A 1YLZA 3VP0A 1F9IA 3K3DA 2R9XA 1E3UD 1T1BA 5A8BA 2G7UA 1MKIA 4R4RA 4N9LA 4I38A 3Q7VB 4S2KA 4X1LA 4Z9QA 5A93A 1GSWA 3BEBA 4OPYA 1DJBA 4HP9A 2Y8HA 4I5SA 1RGZA 3OPLA 4EESA 5FEFA 4IBRA 1L2SA 1PW8A 3LFVA 1KGFA 2XROA 4IJGA 2D01A 4UA9A 3IT9A 5CERA 4E3MA 2X01A 3LYXA 2G2WA 1MWRA 4K0WA 3E4PA 4ETZA 1MBLA 5EVLA 4E3JA 4WYYA 5A92A 5HL6A 3ZG8B 3T4SA 3DTKA 3KYQA 5F5YA 4P0MA 1CK3A 2ZMFA 2ZQCA 3LICA 4MBFA 3UPPA 3K3CA 3C38A 3N6IA 2XA7S 2PD8A 3WS5A 4ETXA 1G5UA 3F1PA 3ISGA 2FH5A 1J3WA 1YLYA 1V9YA 2NUPC 3VP1A 1DP8A 5F82A 3UO9A 2PHYA 2ZOIA 2Y2OA 1RP5A 4A5RA 4RA7A 3O86A 2A49A 4GZBA 1VM1A 3JPUA 5HFOA 3C7VA 4KG6A 5E2FA 5HPFA 2XQZA 5CGWA 3EQUA 1JVJA 2B95A 2VV8A 3MF0A 1XKZA 4HJ3A 3C4PA 3MR0A 3VOZA 5A90A 1KDWA 5EM1A 2H28A 4X55A 4KZ4A 3GV9A 3VFHA 4RX3A 4QHCA 4WZ5A 4PPRA 1IYOA 3IXDA 1NRJA 4GB7A 2XK1A 1Q2PA 2IA2A 5HD3A 4EERA 4IUKA 3E4OA 3S7NA 2D02A 4FCFA 3WS4A 1VEUA 4OLDA 3DWZA 1K56A 4H8RA 3B33A 4QY5A 2WGVA 3WRTA 1YAXA 4Y13A 2W27A 3EEAA 3ZG9B 3PR6A 3MKEA 2QPNA 4S2IA 2H0TA 1KE0A 3H9WA 3MBZA 3BQAA 2PYPA 4QJGA 5EVID 1YLJA 4RVAA 2VGJA 2ZM0A 2JKGA 4WZ5C 2OOLA 4N9KA 2W1TB 2EXBA 2EWVA 3G32A 4GN2A 1Z09A 3CHWP 3O3VA 4EUVA 3BLSA 2VJWA 3G2YA 2BLSA 2Z2MB 2X02A 4Q0JA 3UDXA 2ZL1B 1S4RA 3HLFA 3QP8A 2VZWA 3L7HA 2W3EA 3W4PA 2ZL1A 2WKEA 4QY6A 3ZG5A 2VX8A 4XT2B 3SW1A 3AGDA 2V8FA 5KZHA 4E3KA 2J3TC 4Y0OA 2QYBA 4PKYA 2C6WB 4GDBA 3GMWA 4H6JB 5FSRA 5FDSA 3BWLA 3CAXA 3SS5A 3ZG0A 4S2MA 4NEED 3K2NA 4I39A 1YQSA 1N4OA 2ZD8A 4KZ8A 4ZJ1A 1YM1A 2RCXA 1JNUA 5DJUA 3LI8A 1PZOA 4X1MA 2VLGA 2IWCA 3FKWA 1H5XA 4PKYG 3RXXA 2WKIA 1SKFA 4JXWA 3EQVA 4OOYA 3HLEA 1F5MA 3UE1A 4EQIA 1P0ZA 3W4QA 3HLGA 5HAIA 3UN7A 3ZYTA 4EU0A 2BTFP 4KQRA 3HLBA 3N4IA 3EWKA 1PIOA 5GHXA 1IYSA 2ACGA 3V50A 4OPZA 3QP6A 2J3WA 3A3DA 3BY9A 4ZTKA 2JKRM 4GW9A 5L8MA 4S2JA 3NC8A 1JWPA 3FZCA 4WBGA 1M6KA 3NBLA 2O99A 2P08A 3LCEA 3BECA 2H0YA 3HJIA 1W63M 5FI6A 1XP4A 5FAPA 1VB6A 3Q07A 3L9KA 2OLVA 3UE3A 3HUNA 4E3IA 1PWDA 2PD7A 4E04A
chains in the Genus database with same CATH topology
3A3EA 1XA1A 1K56D 1L0GA 3SS3A 5CGSA 4MBHA 3NDEA 3C4OA 2ZLYA 5DTKA 4P87A 4GD6A 4ZJ2A 4WZ4A 1W8YA 3A3JA 3HBRA 3Q81A 5JYPA 3GSGA 5DTSA 1Z6FA 4LV3A 4YINA 1MPLA 2ZJ9A 4PM9A 2FFYA 3OZHA 5EOOA 2G2UA 3PBTA 3IWQA 4BL3A 4PM5A 1HZOA 4ID4A 1DJCA 2QZ6A 2Y2PA 3SOIA 2Y2JA 2Q9MA 1ALQA 2WZXA 2EX6A 5FDHA 4CJNA 1EWZA 1KE3A 2XH9A 4PM6A 2X71A 3IF6A 2DCFA 3G30A 1BLCA 2Z2LB 5FQJA 2Q9NA 1FCOA 1K6RA 1BLPA 3ZVWA 2PU2A 4CPKA 2EFXA 3N8SA 1HTZA 4U0XA 4K0XA 5FAQA 5U47A 1FR6A 4KQQA 4DKIA 2ZC4B 1ES4A 4OLGA 2I72A 3MZEA 3IF6B 3G35A 4XUZA 1GA0A 3M6HA 4D2OA 4P6BA 1SCWA 5CTNA 1KGGA 3AGFA 5GHYA 4ZDXA 4Y0TA 1IKIA 1NZUA 4R1GA 4E3NA 4DDSA 4HESA 4XXRA 4PM7A 5GHZA 5F1GA 2ZQ8A 1ES5A 3ZVTA 3IHBA 1VQQA 5CEBA 5EVIC 5G18A 3WRZA 1YMSA 1K25A 5GL9A 2J8YA 1FCMA 3NCKA 3UNWA 1CI8A 1PYYA 3A3IA 3IXGA 4UA6A 3ZFZA 2EXAA 3NI9A 3ZNYA 4NETA 3I7JA 1AXBA 4MLLA 5FI2A 1L0FA 1KVMA 3NDGA 4UA7A 4EBLA 1NZOA 4X68A 1DJAA 3Q7VA 1NXYA 1IYQA 5A91A 3S1YA 4DXCA 4LCLA 3VP2A 2EX8A 2HPBA 4U0TA 2P74A 4DXBA 4EUZA 1K54C 3GR2A 2CC1A 1N9BA 3P09A 4WM9A 5FATA 1WYCA 4R4SA 2EX9A 4FH4A 4OQHA 5FQIA 4HEFA 3PBSA 5HX9A 5M18A 3G31A 2J9OA 1XGIA 1ONHA 5I94A 2ZQ7A 1IYPA 1BTLA 3O87A 5AQ7A 4MBKA 5EOEA 5GLCA 1E25A 4GD8A 4Y0UA 2BG1A 4JPMA 3LO7A 4E6XA 4YFMA 3PBOA 4U3TA 2V2FF 1PWGA 1MWTA 1YLZA 2WK0A 1PI5A 1NYYA 5EVIA 3V39A 3VP0A 3LEZA 1MY8A 3LY3A 4ZJ3A 3FWLA 2R9XA 1E3UD 1BLHA 1MKIA 2WGWA 4E6WA 4R4RA 4N9LA 2JCHA 3Q7VB 4S2KA 4BQMA 4BENA 4Y7PA 1K57C 4Z9QA 1LI0A 2PU4A 1IKGA 1RCJA 4KZ9A 5A93A 3BEBA 3IXBA 4HBTA 4OPYA 4BD0A 3UE0A 1DJBA 2WGWB 3ZG7B 2HP6A 4DRTA 1RGZA 3OPLA 3ITAA 1SDEA 3Q82A 4IBRA 4EBPA 2Y91A 4JBFA 3SH9A 1L2SA 1PW8A 4QD4A 1KGFA 3HUOA 3BFCA 4KG5A 3W8KA 3VP4A 1ESUA 4LCMA 4UA9A 1ZC2A 5DVAA 3IT9A 5CERA 2Y2LA 4E3MA 2X01A 1TVFA 3MXSA 1XX2A 2XD1A 5E2EA 3P98A 2G2WA 3SS4A 1MWRA 1KE4A 3IWIA 1BSGA 4K0WA 4LV2A 4R23A 3IF5A 4WEKA 2WAEA 1W5DA 1H8ZA 1KVLA 1MBLA 3MZDA 3IF6C 4S2OA 5EVLA 4E3JA 4X69A 3CG5A 4WYYA 5A92A 4LV1A 3ZG8B 5FQQA 1C3BA 3VSKA 4O7DA 2A3UA 3WWXA 4KZ6A 2UWXA 3B3XA 3UY6A 1PWCA 3DW0A 1W79A 5KSCA 4P0MA 1CK3A 1Q2QA 4E3LA 1TDLA 3E2LA 2ZQCA 2WADA 3CZDA 1IEMA 3A3FA 4OPRA 1ZG6A 2XDMA 4MBFA 5FA7A 5AQ9A 3UPPA 4S2NC 3HUMA 4R3BA 2OSUA 3N6IA 2VGKA 2HDUA 3WS5A 4BL2A 5D3OA 5FQ9A 1ES3A 5E43A 4N92A 4GNUA 5AQBA 3ISGA 1PW1A 3HLCA 4WMCD 1FSYA 2ZMAA 1YLYA 2XEPA 1BT5A 3Q1FA 1PZPA 3VP1A 5F82A 3UO9A 1JWVA 3ZCZA 2Y2QA 3VFFA 2Y2OA 1CEGA 1G6AA 1MXOA 1RP5A 4NK3A 3GRJA 4KZBA 1GCEA 4DDYA 4A5RA 1S6RA 1ONGA 3NIAA 4RA7A 5CEDA 2ZC3B 2JC7A 3BRMA 1YLWA 3O86A 1K55A 1JWZA 1LLBA 2A49A 3PAGA 4GZBA 5TFQA 5KMWA 1VM1A 3IH8A 3HVFA 1NJ4A 4ZBEA 3OC2A 5HFOA 3C7VA 4FSFA 4KG6A 5DF8A 5E2FA 3O88A 5GLDA 3UDIA 3VP3A 4BD1A 1DY6A 3QHYA 1GHIA 2XQZA 4UHUA 3OPHA 5CGWA 4X53A 3EQUA 1NY0A 1JVJA 2ZQAA 4KZ7A 1ERQA 4GKUA 2V20A 2WAFA 3FV7A 3W4OA 2HP9A 5AQAA 5CECA 1XKZA 3ITBA 4P85A 1GHMA 3C4PA 4QB8A 3DWKA 3DTMA 5EUAA 3VOZA 5A90A 1KDWA 3OCLA 2WKHA 1SHVA 4OP5A 4X55A 4EV4A 3G2ZA 3IH9A 3JYIA 3NY4A 4KZ4A 5HARA 3GV9A 3N7WA 3VFHA 4RX3A 5HL1A 1WYBA 4IVIA 4QHCA 4WZ5A 2XR0A 1QMEA 4PPRA 1JTGA 3E2KA 1IYOA 1ES2A 1O7EA 5M1AA 3UPNA 1LL5A 1I2SA 3BLMA 4JXGA 3IXDA 5CTMA 3V3RA 3OPPA 3D4FA 3VOYA 5HW3A 4GB7A 2XK1A 2Y55A 1GHPA 1Q2PA 1W8QA 1K54A 2WGIA 4EBNA 4MNRA 4C6YA 4OH0A 1BUEA 4PM8A 4RYEA 5FQKA 3TG9A 4WELA 4C3QA 4K91A 4UAAA 5CGXA 2H5SA 3QNCA 4S2NA 1U60A 2IWBA 2H10A 4FCFA 2OV5A 2Y4AA 4IEDA 4S2LA 3MXRA 2C5WB 1L0EA 3WS4A 4S2PA 3VMAA 4JF5A 2JBFA 2WUQA 1S0WA 3M2KA 2Y2IA 4OLDA 1GA9A 3DWZA 1FQGA 1K56A 2Y2HA 4KG2A 1W7FA 3M6BA 4H8RA 5FASA 1EI5A 4BLMA 2ZC7A 4QY5A 4WMCA 2WGVA 4JXVA 3WRTA 4BJPA 1FR1A 1WE4A 1K38A 1TEMA 1YLTA 2Y2KA 3IHAA 3BFEA 3IXHA 1LL9A 5FI7A 1YMXA 3ZG9B 2EFUA 1NYMA 3MKEA 5CHMA 4JF4A 2QPNA 4S2IA 1RGYA 2H0TA 1KE0A 3UPOA 3MBZA 2ZM8A 4OQ0A 4QJGA 1O07A 3BFDA 1HVBA 1PI4A 5EVID 1YLJA 4JLFA 2VGJA 1CEFA 2ZM0A 3QNBA 4RVAA 4WZ5C 5KSHA 4N9KA 3BFGA 3RXWA 2EXBA 2QMIA 3G32A 2DRWA 3IWOA 2P9VA 4GN2A 4KENB 1YT4A 3O3VA 4IBXA 2HDQA 2ZC5B 3BLSA 5J8XA 5EECA 3OCNA 3G2YA 2WYXA 1XA7A 1ZKJA 2ZQDA 3WS0A 2BLSA 2Z2MB 2X02A 2RL3A 3C7UA 4OQIA 5TGFA 3UDXA 3VSLA 1E3UA 5BOHA 3HLFA 1CI9A 4FD8A 4GDNA 4OPQA 2Y59A 2J7VA 3TOIA 3W4PA 2B5RA 4PMAA 5CHUA 3V5MA 3FKVA 2XD5A 2WKEA 4QY6A 3ZG5A 4OKPA 4X6TA 4JXSA 1SDNA 1ERMA 4L0LA 2Y2GA 4MEZA 3HREA 3GTCA 4LENA 4OP8A 5E2GA 3AGDA 1BLSA 5KZHA 3WS1A 4OONA 3AGEA 4E3KA 2ZQ9A 3WS2A 4LV0A 3PBRA 5L2FA 4Y0OA 2XGNA 1YLPA 3PAEA 4JKTA 4GOGA 4OOLA 4X56A 2C6WB 4GDBA 4KZAA 2XLNA 3GMWA 5F1FA 5FAOA 2P9VB 4OVDA 5GLAA 4FH2A 2EX2A 1XGJA 3GVBA 5FSRA 1QMFA 1G68A 1ESIA 3M2JA 5DF9A 4R3JA 3SS5A 1ZG4A 3ZG0A 2ZC6B 4S2MA 5EPHA 5CXWA 4EWFA 3PBNA 1YQSA 4DE0A 1N4OA 2XFTA 2ZD8A 4KZ8A 1K4EA 4ZJ1A 1YM1A 1J9MA 4KZ3A 1E4DA 2E8IA 5E2HA 4N1XA 2RCXA 2DNSA 4ZAMA 2WZZA 4XUXA 2GDNA 3ZNTA 4DE1A 3MFDA 1FCNA 4KZ5A 1TDGA 3LY4A 1PZOA 2IWCA 2Y2MA 3FKWA 1H5XA 1HD8A 3S22A 1EROA 4OOMA 3RXXA 1MWUA 4C75A 2WKIA 1K6SA 4QU3A 1SKFA 5FQMA 3PBQA 4JXWA 5IHVA 3EQVA 4OOYA 3HLEA 1I2WA 2OLUA 3BFFA 4N1HA 3ZGAB 1NRFA 3G4PA 3UE1A 3HLDA 5EVIB 4EQIA 1FSWA 5HAQA 3W4QA 4WEJA 3HLGA 2Y2NA 2XF3A 4B88A 5HAIA 3UN7A 3TSGA 4DE3A 1L0DA 3IQAA 4KQRA 3UDFA 4JF6A 1BULA 3BM6A 3HLBA 2J9PA 3N4IA 4IVKA 2PBYA 1PIOA 1K4FA 5DF7A 1K57A 2HP5A 1BZAA 5GHXA 5CRFA 3ZDJA 5GLBA 1IYSA 5F83A 4OQGA 3SH7A 3V50A 4OPZA 1LI9A 3CJMA 1JTDA 5JYOA 2R9WA 3A3DA 4ZTKA 5DTTA 3Q7ZA 4M3KA 4B4XA 3HL9A 3V3SA 4B4ZA 2IWDA 4R0QA 4RX2A 4DF6A 2XFSA 1OMEA 3PTEA 4S2JA 3NC8A 1H8YA 1JWPA 3FZCA 3GQZA 3MKFA 5CHJA 1XXMA 5M19A 4WBGA 1M6KA 2FFFB 3HLWA 3NBLA 3G34A 1LHYA 2JE5A 3LCEA 3BYDA 5EE8A 3ZHHA 1KGEA 4HBUA 1XPBA 1I5QA 4KQOA 3BECA 3MZFA 3RJUA 3SH8A 1M40A 2H0YA 4E3OA 4F94A 2HDSA 5FI6A 3FYZA 1XP4A 2V1ZA 2HDRA 1K55C 5FAPA 1MWSA 1FOFA 3N8RA 3Q07A 1Y54A 1KDSA 4Q8IA 2OLVA 3UE3A 4DE2A 3S4XA 3HUNA 3C5AA 5TR7A 4E3IA 3OPRA 1PWDA 1IELA 5HAPA 2ZM2A 3N8LA 3CMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A3E A;  1XA1 A;  1K56 D;  1L0G A;  3SS3 A;  5CGS A;  4MBH A;  3NDE A;  3C4O A;  2ZLY A;  5DTK A;  4P87 A;  4GD6 A;  4ZJ2 A;  4WZ4 A;  1W8Y A;  3A3J A;  3HBR A;  3Q81 A;  5JYP A;  3GSG A;  5DTS A;  1Z6F A;  4LV3 A;  4YIN A;  1MPL A;  2ZJ9 A;  4PM9 A;  2FFY A;  3OZH A;  5EOO A;  2G2U A;  3PBT A;  3IWQ A;  4BL3 A;  4PM5 A;  1HZO A;  4ID4 A;  1DJC A;  2QZ6 A;  2Y2P A;  3SOI A;  2Y2J A;  2Q9M A;  1ALQ A;  2WZX A;  2EX6 A;  5FDH A;  4CJN A;  1EWZ A;  1KE3 A;  2XH9 A;  4PM6 A;  2X71 A;  3IF6 A;  2DCF A;  3G30 A;  1BLC A;  2Z2L B;  5FQJ A;  2Q9N A;  1FCO A;  1K6R A;  1BLP A;  3ZVW A;  2PU2 A;  4CPK A;  2EFX A;  3N8S A;  1HTZ A;  4U0X A;  4K0X A;  5FAQ A;  5U47 A;  1FR6 A;  4KQQ A;  4DKI A;  2ZC4 B;  1ES4 A;  4OLG A;  2I72 A;  3MZE A;  3IF6 B;  3G35 A;  4XUZ A;  1GA0 A;  3M6H A;  4D2O A;  4P6B A;  1SCW A;  5CTN A;  1KGG A;  3AGF A;  5GHY A;  4ZDX A;  4Y0T A;  1IKI A;  1NZU A;  4R1G A;  4E3N A;  4DDS A;  4HES A;  4XXR A;  4PM7 A;  5GHZ A;  5F1G A;  2ZQ8 A;  1ES5 A;  3ZVT A;  3IHB A;  1VQQ A;  5CEB A;  5EVI C;  5G18 A;  3WRZ A;  1YMS A;  1K25 A;  5GL9 A;  2J8Y A;  1FCM A;  3NCK A;  3UNW A;  1CI8 A;  1PYY A;  3A3I A;  3IXG A;  4UA6 A;  3ZFZ A;  2EXA A;  3NI9 A;  3ZNY A;  4NET A;  3I7J A;  1AXB A;  4MLL A;  5FI2 A;  1L0F A;  1KVM A;  3NDG A;  4UA7 A;  4EBL A;  1NZO A;  4X68 A;  1DJA A;  3Q7V A;  1NXY A;  1IYQ A;  5A91 A;  3S1Y A;  4DXC A;  4LCL A;  3VP2 A;  2EX8 A;  2HPB A;  4U0T A;  2P74 A;  4DXB A;  4EUZ A;  1K54 C;  3GR2 A;  2CC1 A;  1N9B A;  3P09 A;  4WM9 A;  5FAT A;  1WYC A;  4R4S A;  2EX9 A;  4FH4 A;  4OQH A;  5FQI A;  4HEF A;  3PBS A;  5HX9 A;  5M18 A;  3G31 A;  2J9O A;  1XGI A;  1ONH A;  5I94 A;  2ZQ7 A;  1IYP A;  1BTL A;  3O87 A;  5AQ7 A;  4MBK A;  5EOE A;  5GLC A;  1E25 A;  4GD8 A;  4Y0U A;  2BG1 A;  4JPM A;  3LO7 A;  4E6X A;  4YFM A;  3PBO A;  4U3T A;  2V2F F;  1PWG A;  1MWT A;  1YLZ A;  2WK0 A;  1PI5 A;  1NYY A;  5EVI A;  3V39 A;  3VP0 A;  3LEZ A;  1MY8 A;  3LY3 A;  4ZJ3 A;  3FWL A;  2R9X A;  1E3U D;  1BLH A;  1MKI A;  2WGW A;  4E6W A;  4R4R A;  4N9L A;  2JCH A;  3Q7V B;  4S2K A;  4BQM A;  4BEN A;  4Y7P A;  1K57 C;  4Z9Q A;  1LI0 A;  2PU4 A;  1IKG A;  1RCJ A;  4KZ9 A;  5A93 A;  3BEB A;  3IXB A;  4HBT A;  4OPY A;  4BD0 A;  3UE0 A;  1DJB A;  2WGW B;  3ZG7 B;  2HP6 A;  4DRT A;  1RGZ A;  3OPL A;  3ITA A;  1SDE A;  3Q82 A;  4IBR A;  4EBP A;  2Y91 A;  4JBF A;  3SH9 A;  1L2S A;  1PW8 A;  4QD4 A;  1KGF A;  3HUO A;  3BFC A;  4KG5 A;  3W8K A;  3VP4 A;  1ESU A;  4LCM A;  4UA9 A;  1ZC2 A;  5DVA A;  3IT9 A;  5CER A;  2Y2L A;  4E3M A;  2X01 A;  1TVF A;  3MXS A;  1XX2 A;  2XD1 A;  5E2E A;  3P98 A;  2G2W A;  3SS4 A;  1MWR A;  1KE4 A;  3IWI A;  1BSG A;  4K0W A;  4LV2 A;  4R23 A;  3IF5 A;  4WEK A;  2WAE A;  1W5D A;  1H8Z A;  1KVL A;  1MBL A;  3MZD A;  3IF6 C;  4S2O A;  5EVL A;  4E3J A;  4X69 A;  3CG5 A;  4WYY A;  5A92 A;  4LV1 A;  3ZG8 B;  5FQQ A;  1C3B A;  3VSK A;  4O7D A;  2A3U A;  3WWX A;  4KZ6 A;  2UWX A;  3B3X A;  3UY6 A;  1PWC A;  3DW0 A;  1W79 A;  5KSC A;  4P0M A;  1CK3 A;  1Q2Q A;  4E3L A;  1TDL A;  3E2L A;  2ZQC A;  2WAD A;  3CZD A;  1IEM A;  3A3F A;  4OPR A;  1ZG6 A;  2XDM A;  4MBF A;  5FA7 A;  5AQ9 A;  3UPP A;  4S2N C;  3HUM A;  4R3B A;  2OSU A;  3N6I A;  2VGK A;  2HDU A;  3WS5 A;  4BL2 A;  5D3O A;  5FQ9 A;  1ES3 A;  5E43 A;  4N92 A;  4GNU A;  5AQB A;  3ISG A;  1PW1 A;  3HLC A;  4WMC D;  1FSY A;  2ZMA A;  1YLY A;  2XEP A;  1BT5 A;  3Q1F A;  1PZP A;  3VP1 A;  5F82 A;  3UO9 A;  1JWV A;  3ZCZ A;  2Y2Q A;  3VFF A;  2Y2O A;  1CEG A;  1G6A A;  1MXO A;  1RP5 A;  4NK3 A;  3GRJ A;  4KZB A;  1GCE A;  4DDY A;  4A5R A;  1S6R A;  1ONG A;  3NIA A;  4RA7 A;  5CED A;  2ZC3 B;  2JC7 A;  3BRM A;  1YLW A;  3O86 A;  1K55 A;  1JWZ A;  1LLB A;  2A49 A;  3PAG A;  4GZB A;  5TFQ A;  5KMW A;  1VM1 A;  3IH8 A;  3HVF A;  1NJ4 A;  4ZBE A;  3OC2 A;  5HFO A;  3C7V A;  4FSF A;  4KG6 A;  5DF8 A;  5E2F A;  3O88 A;  5GLD A;  3UDI A;  3VP3 A;  4BD1 A;  1DY6 A;  3QHY A;  1GHI A;  2XQZ A;  4UHU A;  3OPH A;  5CGW A;  4X53 A;  3EQU A;  1NY0 A;  1JVJ A;  2ZQA A;  4KZ7 A;  1ERQ A;  4GKU A;  2V20 A;  2WAF A;  3FV7 A;  3W4O A;  2HP9 A;  5AQA A;  5CEC A;  1XKZ A;  3ITB A;  4P85 A;  1GHM A;  3C4P A;  4QB8 A;  3DWK A;  3DTM A;  5EUA A;  3VOZ A;  5A90 A;  1KDW A;  3OCL A;  2WKH A;  1SHV A;  4OP5 A;  4X55 A;  4EV4 A;  3G2Z A;  3IH9 A;  3JYI A;  3NY4 A;  4KZ4 A;  5HAR A;  3GV9 A;  3N7W A;  3VFH A;  4RX3 A;  5HL1 A;  1WYB A;  4IVI A;  4QHC A;  4WZ5 A;  2XR0 A;  1QME A;  4PPR A;  1JTG A;  3E2K A;  1IYO A;  1ES2 A;  1O7E A;  5M1A A;  3UPN A;  1LL5 A;  1I2S A;  3BLM A;  4JXG A;  3IXD A;  5CTM A;  3V3R A;  3OPP A;  3D4F A;  3VOY A;  5HW3 A;  4GB7 A;  2XK1 A;  2Y55 A;  1GHP A;  1Q2P A;  1W8Q A;  1K54 A;  2WGI A;  4EBN A;  4MNR A;  4C6Y A;  4OH0 A;  1BUE A;  4PM8 A;  4RYE A;  5FQK A;  3TG9 A;  4WEL A;  4C3Q A;  4K91 A;  4UAA A;  5CGX A;  2H5S A;  3QNC A;  4S2N A;  1U60 A;  2IWB A;  2H10 A;  4FCF A;  2OV5 A;  2Y4A A;  4IED A;  4S2L A;  3MXR A;  2C5W B;  1L0E A;  3WS4 A;  4S2P A;  3VMA A;  4JF5 A;  2JBF A;  2WUQ A;  1S0W A;  3M2K A;  2Y2I A;  4OLD A;  1GA9 A;  3DWZ A;  1FQG A;  1K56 A;  2Y2H A;  4KG2 A;  1W7F A;  3M6B A;  4H8R A;  5FAS A;  1EI5 A;  4BLM A;  2ZC7 A;  4QY5 A;  4WMC A;  2WGV A;  4JXV A;  3WRT A;  4BJP A;  1FR1 A;  1WE4 A;  1K38 A;  1TEM A;  1YLT A;  2Y2K A;  3IHA A;  3BFE A;  3IXH A;  1LL9 A;  5FI7 A;  1YMX A;  3ZG9 B;  2EFU A;  1NYM A;  3MKE A;  5CHM A;  4JF4 A;  2QPN A;  4S2I A;  1RGY A;  2H0T A;  1KE0 A;  3UPO A;  3MBZ A;  2ZM8 A;  4OQ0 A;  4QJG A;  1O07 A;  3BFD A;  1HVB A;  1PI4 A;  5EVI D;  1YLJ A;  4JLF A;  2VGJ A;  1CEF A;  2ZM0 A;  3QNB A;  4RVA A;  4WZ5 C;  5KSH A;  4N9K A;  3BFG A;  3RXW A;  2EXB A;  2QMI A;  3G32 A;  2DRW A;  3IWO A;  2P9V A;  4GN2 A;  4KEN B;  1YT4 A;  3O3V A;  4IBX A;  2HDQ A;  2ZC5 B;  3BLS A;  5J8X A;  5EEC A;  3OCN A;  3G2Y A;  2WYX A;  1XA7 A;  1ZKJ A;  2ZQD A;  3WS0 A;  2BLS A;  2Z2M B;  2X02 A;  2RL3 A;  3C7U A;  4OQI A;  5TGF A;  3UDX A;  3VSL A;  1E3U A;  5BOH A;  3HLF A;  1CI9 A;  4FD8 A;  4GDN A;  4OPQ A;  2Y59 A;  2J7V A;  3TOI A;  3W4P A;  2B5R A;  4PMA A;  5CHU A;  3V5M A;  3FKV A;  2XD5 A;  2WKE A;  4QY6 A;  3ZG5 A;  4OKP A;  4X6T A;  4JXS A;  1SDN A;  1ERM A;  4L0L A;  2Y2G A;  4MEZ A;  3HRE A;  3GTC A;  4LEN A;  4OP8 A;  5E2G A;  3AGD A;  1BLS A;  5KZH A;  3WS1 A;  4OON A;  3AGE A;  4E3K A;  2ZQ9 A;  3WS2 A;  4LV0 A;  3PBR A;  5L2F A;  4Y0O A;  2XGN A;  1YLP A;  3PAE A;  4JKT A;  4GOG A;  4OOL A;  4X56 A;  2C6W B;  4GDB A;  4KZA A;  2XLN A;  3GMW A;  5F1F A;  5FAO A;  2P9V B;  4OVD A;  5GLA A;  4FH2 A;  2EX2 A;  1XGJ A;  3GVB A;  5FSR A;  1QMF A;  1G68 A;  1ESI A;  3M2J A;  5DF9 A;  4R3J A;  3SS5 A;  1ZG4 A;  3ZG0 A;  2ZC6 B;  4S2M A;  5EPH A;  5CXW A;  4EWF A;  3PBN A;  1YQS A;  4DE0 A;  1N4O A;  2XFT A;  2ZD8 A;  4KZ8 A;  1K4E A;  4ZJ1 A;  1YM1 A;  1J9M A;  4KZ3 A;  1E4D A;  2E8I A;  5E2H A;  4N1X A;  2RCX A;  2DNS A;  4ZAM A;  2WZZ A;  4XUX A;  2GDN A;  3ZNT A;  4DE1 A;  3MFD A;  1FCN A;  4KZ5 A;  1TDG A;  3LY4 A;  1PZO A;  2IWC A;  2Y2M A;  3FKW A;  1H5X A;  1HD8 A;  3S22 A;  1ERO A;  4OOM A;  3RXX A;  1MWU A;  4C75 A;  2WKI A;  1K6S A;  4QU3 A;  1SKF A;  5FQM A;  3PBQ A;  4JXW A;  5IHV A;  3EQV A;  4OOY A;  3HLE A;  1I2W A;  2OLU A;  3BFF A;  4N1H A;  3ZGA B;  1NRF A;  3G4P A;  3UE1 A;  3HLD A;  5EVI B;  4EQI A;  1FSW A;  5HAQ A;  3W4Q A;  4WEJ A;  3HLG A;  2Y2N A;  2XF3 A;  4B88 A;  5HAI A;  3UN7 A;  3TSG A;  4DE3 A;  1L0D A;  3IQA A;  4KQR A;  3UDF A;  4JF6 A;  1BUL A;  3BM6 A;  3HLB A;  2J9P A;  3N4I A;  4IVK A;  2PBY A;  1PIO A;  1K4F A;  5DF7 A;  1K57 A;  2HP5 A;  1BZA A;  5GHX A;  5CRF A;  3ZDJ A;  5GLB A;  1IYS A;  5F83 A;  4OQG A;  3SH7 A;  3V50 A;  4OPZ A;  1LI9 A;  3CJM A;  1JTD A;  5JYO A;  2R9W A;  3A3D A;  4ZTK A;  5DTT A;  3Q7Z A;  4M3K A;  4B4X A;  3HL9 A;  3V3S A;  4B4Z A;  2IWD A;  4R0Q A;  4RX2 A;  4DF6 A;  2XFS A;  1OME A;  3PTE A;  4S2J A;  3NC8 A;  1H8Y A;  1JWP A;  3FZC A;  3GQZ A;  3MKF A;  5CHJ A;  1XXM A;  5M19 A;  4WBG A;  1M6K A;  2FFF B;  3HLW A;  3NBL A;  3G34 A;  1LHY A;  2JE5 A;  3LCE A;  3BYD A;  5EE8 A;  3ZHH A;  1KGE A;  4HBU A;  1XPB A;  1I5Q A;  4KQO A;  3BEC A;  3MZF A;  3RJU A;  3SH8 A;  1M40 A;  2H0Y A;  4E3O A;  4F94 A;  2HDS A;  5FI6 A;  3FYZ A;  1XP4 A;  2V1Z A;  2HDR A;  1K55 C;  5FAP A;  1MWS A;  1FOF A;  3N8R A;  3Q07 A;  1Y54 A;  1KDS A;  4Q8I A;  2OLV A;  3UE3 A;  4DE2 A;  3S4X A;  3HUN A;  3C5A A;  5TR7 A;  4E3I A;  3OPR A;  1PWD A;  1IEL A;  5HAP A;  2ZM2 A;  3N8L A;  3CMZ A; 
#chains in the Genus database with same CATH topology
 3A3E A;  1K56 D;  4L9E A;  3B42 A;  4HJ6 A;  2ZLY A;  4WZ4 A;  4R3A A;  1Z6F A;  3S7Q A;  2J3T D;  4LV3 A;  4B93 A;  4HQA A;  4LRY C;  3IX4 A;  4YIN A;  4PM9 A;  2G2U A;  3PBT A;  4JGR A;  3RTY A;  4UQI M;  1ALQ A;  3IS2 A;  2KLI A;  4CJN A;  1EWZ A;  3UE6 A;  5C5K A;  2Z2L B;  2W0N A;  2Q9N A;  1FCO A;  3ZVW A;  3N8S A;  3OBF A;  5J7E A;  4U0X A;  4DKI A;  3BW6 A;  5G4Z A;  2ZC4 B;  3EOI A;  1GA0 A;  3M6H A;  4P6B A;  1SCW A;  4IHQ A;  4ZDX A;  4DDS A;  5MC7 A;  4XXR A;  1MKM A;  5CEB A;  5G18 A;  1K25 A;  1CI8 A;  3IXG A;  4G3W A;  4X68 A;  1NXY A;  5A91 A;  3R7W B;  3MQO A;  3GR2 A;  2CC1 A;  1N9B A;  2B02 A;  1WYC A;  4R4S A;  3PBS A;  2J9O A;  1XGI A;  2ZQ7 A;  2JN7 A;  5AQ7 A;  4LLO B;  4MBK A;  1XJ4 A;  5GLC A;  2AVX A;  4Y0U A;  2BG1 A;  4RQ9 A;  1PWG A;  2PAV P;  2WK0 A;  1NLZ A;  3LEZ A;  3LY3 A;  3FWL A;  5HWT A;  1T18 A;  4GCZ A;  1BLH A;  4E6W A;  4BMW A;  4FOF A;  2K7S A;  5J4E A;  5TJJ A;  3U4L P;  1RCJ A;  3IXB A;  2WGW B;  4DRT A;  4LPZ A;  3Q82 A;  3VE3 A;  2JKT I;  4JBF A;  4KG5 A;  3W8K A;  4P6Z S;  4M4X A;  1ESU A;  2I9V A;  5DVA A;  2XA7 M;  2Y2L A;  1YSQ A;  4EQ1 A;  1N9L A;  1XX2 A;  3NUL A;  5E2E A;  3SS4 A;  3KYZ A;  1BSG A;  4WEK A;  2WAE A;  1H8Z A;  1KVL A;  3BQ8 A;  1OJG A;  3VSK A;  4ARZ A;  4O7D A;  2V0U A;  3DBA A;  5DFX A;  1PWC A;  3DW0 A;  2HGV A;  5HWV A;  4DMZ A;  4E3L A;  1TDL A;  3E2L A;  3MS6 A;  1ZG6 A;  2XDM A;  5FA7 A;  4DJ2 A;  5AQ9 A;  1NLY A;  3E4Q A;  4B9O A;  2W1T A;  4BL2 A;  5E43 A;  4N92 A;  2ZMA A;  3NOP C;  4EW7 A;  2QJ5 A;  1CF0 A;  3VFF A;  2P7J A;  1ONG A;  3BRM A;  3PAG A;  5KMW A;  2GZA A;  4FSF A;  3UDI A;  2OAP 1;  1GHI A;  4UHU A;  3C30 A;  4BWI A;  4X53 A;  1NY0 A;  3KSF A;  3CIT A;  4GKU A;  3FV7 A;  3W4O A;  1FIK A;  4R6L A;  4EEU A;  5AQA A;  3BJN A;  3ITB A;  3T12 B;  1P97 A;  5EUA A;  2WKH A;  4O0P A;  1SHV A;  1H0M A;  3G2Z A;  1Y28 A;  3N7W A;  5HL1 A;  1WYB A;  4IVI A;  2XR0 A;  1JTG A;  1LL5 A;  1I2S A;  3VOY A;  4JXG A;  3V3R A;  5HW3 A;  3OPP A;  3D4F A;  3PYP A;  4BBT A;  3T4T A;  4EBN A;  2VGL S;  4OH0 A;  4PM8 A;  4C6Y A;  4WEL A;  2P04 A;  3W2Z A;  1YSP A;  2H10 A;  2VEA A;  3D9Y A;  4YNR A;  2OV5 A;  5F69 A;  4S2P A;  2B18 A;  2WUQ A;  1S0W A;  2Y2I A;  3KSI A;  1H3Q A;  1W7F A;  4YOF A;  5CX7 A;  1ZHH B;  4BJP A;  3F1O A;  1YMX A;  2EFU A;  1NYM A;  2HF6 A;  3UPO A;  2ZMV A;  2ZM8 A;  4OQ0 A;  3BFD A;  3NHQ A;  1HVB A;  1PI4 A;  2L1M A;  1CEF A;  3QNB A;  3CUE A;  2W3H A;  2QJ7 A;  3RXW A;  2QMI A;  3LGO A;  4DN0 A;  4IBX A;  2HDQ A;  5J8X A;  2V1A A;  1ZKJ A;  3RFB A;  3WS0 A;  1IOU A;  3CPT A;  1PNE A;  3TE8 A;  1CI9 A;  1VET B;  2Y59 A;  2DMW A;  2B5R A;  3V5M A;  1SDN A;  4MEZ A;  1BLS A;  3EEH A;  4OON A;  1STZ A;  3PBR A;  2XSS A;  5HDD A;  2XGN A;  4OOL A;  4WN5 A;  4GOG A;  4KZA A;  2XLN A;  5FAO A;  2JKT M;  5GLA A;  3T1R A;  2W3F A;  4II7 A;  1G68 A;  3DTI A;  3LUQ A;  5DF9 A;  5HDS A;  1H8M A;  2ZC6 B;  3PBN A;  3LR4 A;  3C2W A;  1N9N A;  3VOL A;  4ZAM A;  4WF0 A;  4MN5 A;  3ZNT A;  4KZ5 A;  3LY4 A;  5DFY A;  5G4Y A;  4G3V A;  3VV4 A;  5AVE A;  1HD8 A;  4OOM A;  3R7W A;  1MWU A;  1OT9 A;  3MJQ A;  1K6S A;  4QU3 A;  5FQM A;  5IHV A;  2VK3 A;  3BFF A;  4N1H A;  3ZGA B;  1TD5 A;  2O0Y A;  3LR3 A;  2Y2N A;  2XF3 A;  4KQD A;  4DE3 A;  2GX5 A;  4JF6 A;  1BUL A;  3KYE A;  1G28 A;  2PBY A;  1K4F A;  1K57 A;  1LSW A;  2HP5 A;  1BZA A;  3P01 A;  5AJG A;  4F3L A;  4DJ3 A;  5F83 A;  4O8G A;  1NWZ A;  3LI9 A;  1TS0 A;  3S7O A;  1JTD A;  3F1N A;  3Q7Z A;  2R78 A;  4M3K A;  4B4X A;  3D3O A;  2XFS A;  1CJF A;  1IFQ A;  1OME A;  1H8Y A;  4HH2 A;  5M19 A;  2V0W A;  2FFF B;  1LHY A;  1S1Z A;  5EE8 A;  4BBV A;  3GEC A;  1I5Q A;  4KQO A;  3MZF A;  1M40 A;  3FYZ A;  4GHI A;  2V1Z A;  2HDR A;  1K55 C;  1AWI A;  1Y54 A;  1TS8 A;  4Q8I A;  4BBU A;  4DE2 A;  4XT2 A;  2O9A A;  4HJ4 A;  3N8L A;  3BY8 A;  4F3L B;  4WUJ A;  5CGS A;  3C4O A;  4P87 A;  4GD6 A;  5HD5 A;  3ZQ5 A;  3HBR A;  1XJ6 A;  5DTS A;  2ZJ9 A;  2FFY A;  2XRN A;  5EOO A;  4QPR A;  4P6Z M;  2Y2P A;  1YPR A;  4PAU A;  4Q0H A;  2Y2J A;  2Q9M A;  4NKP A;  2EX6 A;  2YKH A;  3IF6 A;  2DCF A;  3FG8 A;  4ZRR A;  1BLP A;  2PR6 A;  5FAQ A;  4WLA A;  3MZE A;  3IF6 B;  4XUZ A;  1KGG A;  3JVU A;  4HES A;  1LSV A;  5GHZ A;  2ZOH A;  3A0R A;  3IHB A;  1V9Z A;  1FCM A;  3NCK A;  3UNW A;  5IT5 A;  1OJ5 A;  3A3I A;  4UA6 A;  2EXA A;  2NUT C;  5TBM B;  3ZNY A;  2A2L A;  4MLL A;  1NZO A;  4I3J A;  1IYQ A;  3S1Y A;  4DXC A;  2EX8 A;  2P74 A;  4KUK A;  5FAT A;  4FH4 A;  3LR0 A;  5FQI A;  5M18 A;  5I94 A;  1BTL A;  1IYP A;  5EOE A;  1E25 A;  4GD8 A;  4KUO A;  3LO7 A;  3LIB A;  1MWT A;  1NYY A;  1YKD A;  3NJA A;  5HPI A;  4BQM A;  4BEN A;  1K57 C;  4KZ9 A;  4BD0 A;  4JGO A;  2L0W A;  3ZG7 B;  2HP6 A;  5DKK A;  1MZU A;  1SDE A;  4UQI S;  3SH9 A;  4QD4 A;  2L4R A;  3HUO A;  3VP4 A;  4LCM A;  1UWN X;  1ZC2 A;  2VKS A;  1TVF A;  1S1Y A;  2V1B A;  3P98 A;  1ZTU A;  3IWI A;  4R23 A;  4GJ4 A;  1G6O A;  3MZD A;  3IF6 C;  4X69 A;  3MQ0 A;  4IUH A;  4ME4 A;  2UWX A;  3UY6 A;  5KSC A;  1LT0 A;  1Q2Q A;  3TJZ C;  2WAD A;  1IEM A;  3A3F A;  4I3A A;  4S2N C;  3HUM A;  3FC7 A;  2OSU A;  3P7N A;  4K08 A;  2GJ3 A;  5FQ9 A;  1ES3 A;  5AQB A;  3GDI A;  1PW1 A;  4WMC D;  2XEP A;  1BT5 A;  4I3I A;  1JWV A;  3ZCZ A;  2Y2Q A;  1MXO A;  4DDY A;  3C8C A;  4KZB A;  2W3G A;  4CLC E;  1S6R A;  3NIA A;  5CED A;  1K55 A;  1JWZ A;  1LLB A;  4HP4 A;  5TFQ A;  1VET A;  3IH8 A;  3HVF A;  1NJ4 A;  1W63 Q;  4ZBE A;  5DF8 A;  5GLD A;  3O88 A;  1DY6 A;  3QHY A;  4MDZ A;  3OPH A;  1FIL A;  1TS7 A;  1VEU B;  4FTX A;  2HP9 A;  4O01 A;  3T4K A;  3T50 A;  4L9G A;  3OCL A;  4EV4 A;  3IH9 A;  3NY4 A;  5HAR A;  3R4K A;  3E2K A;  3UPN A;  3BLM A;  3QP4 A;  4LRX C;  5TBM A;  3MFX A;  3UB8 A;  4MNR A;  1BUE A;  4RYE A;  3TG9 A;  2IWB A;  1T19 A;  2LB5 A;  2O9C A;  4IED A;  2BAS A;  3MXR A;  1L0E A;  3VMA A;  2JBF A;  3PHY A;  1GA9 A;  3ULF A;  1FQG A;  3E98 A;  3F1N B;  4KG2 A;  5FAS A;  3M6B A;  4BLM A;  2ZC7 A;  4WMC A;  3IXH A;  1K38 A;  3IHA A;  1TEM A;  2PYR A;  2Y2K A;  3BFE A;  5HZH A;  2K2N A;  5CHM A;  4JF4 A;  4Q0I A;  4HH3 A;  2KDK A;  1K0K A;  4JLF A;  1LSX A;  2PBD P;  2W1R A;  3IS2 B;  1BYW A;  4PHT A;  3IWO A;  2P9V A;  1YT4 A;  5I5L A;  2MJ6 A;  2ZC5 B;  2WYX A;  3QP2 A;  1XA7 A;  3MSH A;  2WKQ A;  3LID A;  4EET B;  3C7U A;  2RL3 A;  4OQI A;  1E3U A;  5BOH A;  4FD8 A;  4GS9 B;  2J7V A;  4GHI B;  4PMA A;  3CWF A;  3FKV A;  3DTE A;  2XD5 A;  4OKP A;  1DP9 A;  4JXS A;  4L0L A;  4X25 A;  4LEN A;  3GTC A;  4OP8 A;  4CLC A;  1KOU A;  2V8C A;  3WS1 A;  3AGE A;  2ZQ9 A;  2WKR A;  1YLP A;  4JKT A;  2P9V B;  3GVB A;  3T4Q A;  1QMF A;  2HV1 A;  1OTI A;  4G3K A;  4R3J A;  1ZG4 A;  5CXW A;  4EWF A;  1LL8 A;  2HJE A;  2XFT A;  4KZ3 A;  2K31 A;  2E8I A;  4N1X A;  2DNS A;  2WZZ A;  4XUX A;  2GDN A;  1S67 L;  4DE1 A;  2Y2M A;  4MN7 A;  3S22 A;  4HHD A;  1I2W A;  3G4P A;  3HLD A;  5EV0 A;  5EM0 A;  5EVI B;  5HAQ A;  4WEJ A;  4B88 A;  3TSG A;  1S66 L;  1L0D A;  3UDF A;  2J9P A;  4IVK A;  4ARZ B;  5CRF A;  5FL3 A;  1T1C A;  4JGQ A;  1SKO B;  3CJM A;  3PXP A;  5JYO A;  3CPT B;  5DTT A;  3HL9 A;  2IWD A;  4R0Q A;  4RX2 A;  3UB9 A;  3PTE A;  1S4S A;  1P9R A;  1UGU A;  3G34 A;  3MXQ A;  2HZ5 A;  3BYD A;  3ZHH A;  1KGE A;  4HBU A;  1XPB A;  1XJ3 A;  3U2A A;  4F94 A;  1HLU P;  1MWS A;  1FOF A;  3N8R A;  2V9A A;  2A24 B;  3C5A A;  5TR7 A;  4HY8 A;  1IEL A;  2YKF A;  4MN6 A;  1XA1 A;  3B47 A;  3CLO A;  4Z1W A;  3H82 B;  1OPX A;  4MBH A;  3NDE A;  2O9B A;  5EFW A;  5DTK A;  4ZJ2 A;  3T1Q B;  1W8Y A;  5JYP A;  3GSG A;  5IU1 A;  4NXG A;  1MPL A;  3T4J A;  3V67 A;  3T4O A;  5LBR A;  3IWQ A;  4BL3 A;  5HSQ A;  3SOI A;  5HWW A;  1KE3 A;  4MCW A;  3G30 A;  4CQH A;  1L3L A;  2KOI A;  2EFX A;  5K5B A;  1HTZ A;  2OWJ A;  5U47 A;  4KQQ A;  1SZV A;  1ES4 A;  5IS1 A;  4OLG A;  4JGP A;  3G35 A;  4D2O A;  3AGF A;  3H7W B;  2M7U A;  4Y0T A;  4E3N A;  1XFN A;  4PM7 A;  2QWS A;  1ES5 A;  3WRZ A;  2LB9 A;  3H7W A;  5GL9 A;  2J8Y A;  1WA9 A;  1AXB A;  5FI2 A;  1KVM A;  3LIE A;  4UA7 A;  4EBL A;  4QWO A;  1PRQ A;  3RH8 B;  2PDR A;  4LCL A;  3VP2 A;  5KIZ A;  4U0T A;  2VA0 A;  3A0S A;  1K54 C;  3QP1 A;  4LRZ E;  4EUZ A;  4WM9 A;  4OQH A;  5HX9 A;  3G31 A;  3O87 A;  3DAV A;  4JPM A;  4E6X A;  4FUW A;  3PBO A;  2V2F F;  1PI5 A;  5EVI A;  3V39 A;  1MY8 A;  4ZJ3 A;  2WGW A;  3CUE C;  4HOI A;  2JCH A;  5L09 A;  4Y7P A;  5F6A A;  1LI0 A;  4UEY A;  2PU4 A;  1IKG A;  2VGL M;  4HBT A;  3G6O A;  3UE0 A;  3ITA A;  3UB6 A;  3F1P B;  4EBP A;  3O5Y A;  2Y91 A;  4CLC D;  4AFI A;  3BFC A;  3NEC A;  3OOV A;  1ACF A;  3MXS A;  2XD1 A;  5DJT A;  1KE4 A;  4LV2 A;  3IF5 A;  1W5D A;  3UMD A;  4S2O A;  3CG5 A;  2PT7 A;  4LV1 A;  5FQQ A;  1C3B A;  2EWW A;  2A3U A;  3D72 A;  1D7E A;  3WWX A;  4KZ6 A;  4Y15 A;  3B3X A;  1W79 A;  1N9O A;  2J80 A;  3CZD A;  3LR5 A;  4OPR A;  2Z6D A;  4R3B A;  3TRC A;  2VGK A;  2HDU A;  3UB7 A;  5D3O A;  4GNU A;  4MMN A;  3HLC A;  1FSY A;  2UV0 E;  5EVE A;  3Q1F A;  1PZP A;  4NK3 A;  1CEG A;  1G6A A;  3GRJ A;  1GCE A;  3T1X A;  3EGX C;  2JC7 A;  2ZC3 B;  1YLW A;  4GS9 A;  3OC2 A;  3IBR A;  3VP3 A;  3T4L A;  4NXB A;  3KSG A;  4BD1 A;  1CQA A;  2ZQA A;  4KZ7 A;  1ERQ A;  2V20 A;  2WAF A;  5CEC A;  3NOT C;  4P85 A;  1GHM A;  4QB8 A;  1DP6 A;  3DTM A;  3DWK A;  4OP5 A;  3JYI A;  4GLQ A;  1QME A;  1ES2 A;  1O7E A;  5M1A A;  5CTM A;  3KO6 A;  2Y55 A;  1GHP A;  1W8Q A;  2WGI A;  1K54 A;  4NG2 A;  5FQK A;  1T1A A;  4C3Q A;  4K91 A;  4UAA A;  5CGX A;  3IX8 A;  2H5S A;  3QNC A;  4S2N A;  2HJ9 C;  1U60 A;  3LEQ A;  2Y4A A;  4L9F A;  1OTA A;  4S2L A;  2C5W B;  3FPV A;  4JF5 A;  1PFL A;  3VE4 A;  3M2K A;  2Y2H A;  1EI5 A;  3NOU C;  4CLC B;  4JXV A;  1FR1 A;  1WE4 A;  1XJ2 A;  1YLT A;  1LL9 A;  2INW A;  5FI7 A;  2WKP A;  1RGY A;  5FEG A;  1O07 A;  1GSX A;  3E0Y A;  5KSH A;  3BFG A;  4NXE A;  2DRW A;  4KEN B;  4ESP A;  1A0K A;  1Y4O A;  5EEC A;  3OCN A;  3TW8 A;  2ZQD A;  2EA9 A;  5TGF A;  3VSL A;  4GDN A;  4OPQ A;  3TOI A;  5CHU A;  4X6T A;  2A24 A;  2QHK A;  1ERM A;  2Y2G A;  5E2G A;  3HRE A;  3MQQ A;  3WS2 A;  4LV0 A;  1X0O A;  4R70 A;  5L2F A;  1OTB A;  3PAE A;  3T1S A;  4X56 A;  5F1F A;  3KX0 X;  4OVD A;  1OTE A;  2Y79 A;  4FH2 A;  2EX2 A;  1XGJ A;  1ESI A;  2E8J A;  3EGD C;  4LFU A;  3M2J A;  1XFQ A;  2VV7 A;  5EPH A;  4DE0 A;  1K4E A;  2QKP A;  1J9M A;  3HCY A;  1E4D A;  4Y5F A;  5E2H A;  2FZ0 A;  2Z6C A;  4YWZ A;  3FPW A;  3S7P A;  3MFD A;  1FCN A;  1TDG A;  4WL9 A;  3A0V A;  1ERO A;  4C75 A;  3PBQ A;  1EW0 A;  2OLU A;  1NRF A;  4EXO A;  1FSW A;  3LIF A;  4CLC C;  3IQA A;  3BM6 A;  3KSH A;  2OAQ 1;  4D60 A;  2W3D A;  1F98 A;  1P9W A;  5DF7 A;  3ZDJ A;  2GNX A;  5GLB A;  3F1O B;  3SZT A;  4OQG A;  3SH7 A;  1OT6 A;  1LI9 A;  3OLO A;  2R9W A;  3JVV A;  3IBJ A;  3IX3 A;  4B4Z A;  3V3S A;  4DF6 A;  5L07 A;  5CHJ A;  3GQZ A;  3MKF A;  1XXM A;  3HLW A;  2PR5 A;  4EEP A;  1D06 A;  2JE5 A;  2JHE A;  5J3W A;  3SH8 A;  3RJU A;  4E3O A;  2HDS A;  1MC0 A;  1TF1 A;  1KDS A;  3S4X A;  3OPR A;  1F2K A;  5HAP A;  2ZM2 A;  5L10 A;  3CMZ A;  1L0G A;  3SS3 A;  3ICY A;  1DRM A;  2KX6 A;  5F68 A;  4HIA A;  1OTD A;  4H6J A;  3A3J A;  3Q81 A;  1UWP X;  3UME A;  4Y17 A;  2OWH A;  5HDC A;  3OZH A;  4PM5 A;  1HZO A;  4ID4 A;  1DJC A;  2QZ6 A;  5AVF A;  2WZX A;  5FDH A;  2XH9 A;  4PM6 A;  2X71 A;  1VHM A;  1BLC A;  3MMH A;  5FQJ A;  4CPK A;  1K6R A;  2PU2 A;  4K0X A;  5DKL A;  1FR6 A;  4LGW A;  2I72 A;  3QP5 A;  3HJK A;  1SKO A;  1TS6 A;  5CTN A;  5GHY A;  1IKI A;  1NZU A;  2CMN A;  4HI4 A;  4R1G A;  4NXF A;  5F1G A;  2PRF A;  2ZQ8 A;  3ZVT A;  3LIA A;  1VQQ A;  5EVI C;  1YMS A;  1PYY A;  3CI6 A;  3ZFZ A;  2JKF A;  3NI9 A;  2JKR I;  4NET A;  2ZBB A;  3I7J A;  1GSV A;  1L0F A;  3NDG A;  3UB5 P;  1D1J A;  1DJA A;  2Q0O A;  3Q7V A;  4Y3I A;  2M1C A;  2HPB A;  4DXB A;  3P09 A;  2VV6 A;  2M7V A;  2EX9 A;  4HEF A;  1ODV A;  1ONH A;  4R38 A;  4Y2F A;  4HNB A;  4YFM A;  4U3T A;  3H82 A;  1YLZ A;  3VP0 A;  1F9I A;  3K3D A;  2R9X A;  1E3U D;  1T1B A;  5A8B A;  2G7U A;  1MKI A;  4R4R A;  4N9L A;  4I38 A;  3Q7V B;  4S2K A;  4X1L A;  4Z9Q A;  5A93 A;  1GSW A;  3BEB A;  4OPY A;  1DJB A;  4HP9 A;  2Y8H A;  4I5S A;  1RGZ A;  3OPL A;  4EES A;  5FEF A;  4IBR A;  1L2S A;  1PW8 A;  3LFV A;  1KGF A;  2XRO A;  4IJG A;  2D01 A;  4UA9 A;  3IT9 A;  5CER A;  4E3M A;  2X01 A;  3LYX A;  2G2W A;  1MWR A;  4K0W A;  3E4P A;  4ETZ A;  1MBL A;  5EVL A;  4E3J A;  4WYY A;  5A92 A;  5HL6 A;  3ZG8 B;  3T4S A;  3DTK A;  3KYQ A;  5F5Y A;  4P0M A;  1CK3 A;  2ZMF A;  2ZQC A;  3LIC A;  4MBF A;  3UPP A;  3K3C A;  3C38 A;  3N6I A;  2XA7 S;  2PD8 A;  3WS5 A;  4ETX A;  1G5U A;  3F1P A;  3ISG A;  2FH5 A;  1J3W A;  1YLY A;  1V9Y A;  2NUP C;  3VP1 A;  1DP8 A;  5F82 A;  3UO9 A;  2PHY A;  2ZOI A;  2Y2O A;  1RP5 A;  4A5R A;  4RA7 A;  3O86 A;  2A49 A;  4GZB A;  1VM1 A;  3JPU A;  5HFO A;  3C7V A;  4KG6 A;  5E2F A;  5HPF A;  2XQZ A;  5CGW A;  3EQU A;  1JVJ A;  2B95 A;  2VV8 A;  3MF0 A;  1XKZ A;  4HJ3 A;  3C4P A;  3MR0 A;  3VOZ A;  5A90 A;  1KDW A;  5EM1 A;  2H28 A;  4X55 A;  4KZ4 A;  3GV9 A;  3VFH A;  4RX3 A;  4QHC A;  4WZ5 A;  4PPR A;  1IYO A;  3IXD A;  1NRJ A;  4GB7 A;  2XK1 A;  1Q2P A;  2IA2 A;  5HD3 A;  4EER A;  4IUK A;  3E4O A;  3S7N A;  2D02 A;  4FCF A;  3WS4 A;  1VEU A;  4OLD A;  3DWZ A;  1K56 A;  4H8R A;  3B33 A;  4QY5 A;  2WGV A;  3WRT A;  1YAX A;  4Y13 A;  2W27 A;  3EEA A;  3ZG9 B;  3PR6 A;  3MKE A;  2QPN A;  4S2I A;  2H0T A;  1KE0 A;  3H9W A;  3MBZ A;  3BQA A;  2PYP A;  4QJG A;  5EVI D;  1YLJ A;  4RVA A;  2VGJ A;  2ZM0 A;  2JKG A;  4WZ5 C;  2OOL A;  4N9K A;  2W1T B;  2EXB A;  2EWV A;  3G32 A;  4GN2 A;  1Z09 A;  3CHW P;  3O3V A;  4EUV A;  3BLS A;  2VJW A;  3G2Y A;  2BLS A;  2Z2M B;  2X02 A;  4Q0J A;  3UDX A;  2ZL1 B;  1S4R A;  3HLF A;  3QP8 A;  2VZW A;  3L7H A;  2W3E A;  3W4P A;  2ZL1 A;  2WKE A;  4QY6 A;  3ZG5 A;  2VX8 A;  4XT2 B;  3SW1 A;  3AGD A;  2V8F A;  5KZH A;  4E3K A;  2J3T C;  4Y0O A;  2QYB A;  4PKY A;  2C6W B;  4GDB A;  3GMW A;  4H6J B;  5FSR A;  5FDS A;  3BWL A;  3CAX A;  3SS5 A;  3ZG0 A;  4S2M A;  4NEE D;  3K2N A;  4I39 A;  1YQS A;  1N4O A;  2ZD8 A;  4KZ8 A;  4ZJ1 A;  1YM1 A;  2RCX A;  1JNU A;  5DJU A;  3LI8 A;  1PZO A;  4X1M A;  2VLG A;  2IWC A;  3FKW A;  1H5X A;  4PKY G;  3RXX A;  2WKI A;  1SKF A;  4JXW A;  3EQV A;  4OOY A;  3HLE A;  1F5M A;  3UE1 A;  4EQI A;  1P0Z A;  3W4Q A;  3HLG A;  5HAI A;  3UN7 A;  3ZYT A;  4EU0 A;  2BTF P;  4KQR A;  3HLB A;  3N4I A;  3EWK A;  1PIO A;  5GHX A;  1IYS A;  2ACG A;  3V50 A;  4OPZ A;  3QP6 A;  2J3W A;  3A3D A;  3BY9 A;  4ZTK A;  2JKR M;  4GW9 A;  5L8M A;  4S2J A;  3NC8 A;  1JWP A;  3FZC A;  4WBG A;  1M6K A;  3NBL A;  2O99 A;  2P08 A;  3LCE A;  3BEC A;  2H0Y A;  3HJI A;  1W63 M;  5FI6 A;  1XP4 A;  5FAP A;  1VB6 A;  3Q07 A;  3L9K A;  2OLV A;  3UE3 A;  3HUN A;  4E3I A;  1PWD A;  2PD7 A;  4E04 A; 
#chains in the Genus database with same CATH homology
 3A3E A;  1XA1 A;  1K56 D;  1L0G A;  3SS3 A;  5CGS A;  4MBH A;  3NDE A;  3C4O A;  2ZLY A;  5DTK A;  4P87 A;  4GD6 A;  4ZJ2 A;  4WZ4 A;  1W8Y A;  3A3J A;  3HBR A;  3Q81 A;  5JYP A;  3GSG A;  5DTS A;  1Z6F A;  4LV3 A;  4YIN A;  1MPL A;  2ZJ9 A;  4PM9 A;  2FFY A;  3OZH A;  5EOO A;  2G2U A;  3PBT A;  3IWQ A;  4BL3 A;  4PM5 A;  1HZO A;  4ID4 A;  1DJC A;  2QZ6 A;  2Y2P A;  3SOI A;  2Y2J A;  2Q9M A;  1ALQ A;  2WZX A;  2EX6 A;  5FDH A;  4CJN A;  1EWZ A;  1KE3 A;  2XH9 A;  4PM6 A;  2X71 A;  3IF6 A;  2DCF A;  3G30 A;  1BLC A;  2Z2L B;  5FQJ A;  2Q9N A;  1FCO A;  1K6R A;  1BLP A;  3ZVW A;  2PU2 A;  4CPK A;  2EFX A;  3N8S A;  1HTZ A;  4U0X A;  4K0X A;  5FAQ A;  5U47 A;  1FR6 A;  4KQQ A;  4DKI A;  2ZC4 B;  1ES4 A;  4OLG A;  2I72 A;  3MZE A;  3IF6 B;  3G35 A;  4XUZ A;  1GA0 A;  3M6H A;  4D2O A;  4P6B A;  1SCW A;  5CTN A;  1KGG A;  3AGF A;  5GHY A;  4ZDX A;  4Y0T A;  1IKI A;  1NZU A;  4R1G A;  4E3N A;  4DDS A;  4HES A;  4XXR A;  4PM7 A;  5GHZ A;  5F1G A;  2ZQ8 A;  1ES5 A;  3ZVT A;  3IHB A;  1VQQ A;  5CEB A;  5EVI C;  5G18 A;  3WRZ A;  1YMS A;  1K25 A;  5GL9 A;  2J8Y A;  1FCM A;  3NCK A;  3UNW A;  1CI8 A;  1PYY A;  3A3I A;  3IXG A;  4UA6 A;  3ZFZ A;  2EXA A;  3NI9 A;  3ZNY A;  4NET A;  3I7J A;  1AXB A;  4MLL A;  5FI2 A;  1L0F A;  1KVM A;  3NDG A;  4UA7 A;  4EBL A;  1NZO A;  4X68 A;  1DJA A;  3Q7V A;  1NXY A;  1IYQ A;  5A91 A;  3S1Y A;  4DXC A;  4LCL A;  3VP2 A;  2EX8 A;  2HPB A;  4U0T A;  2P74 A;  4DXB A;  4EUZ A;  1K54 C;  3GR2 A;  2CC1 A;  1N9B A;  3P09 A;  4WM9 A;  5FAT A;  1WYC A;  4R4S A;  2EX9 A;  4FH4 A;  4OQH A;  5FQI A;  4HEF A;  3PBS A;  5HX9 A;  5M18 A;  3G31 A;  2J9O A;  1XGI A;  1ONH A;  5I94 A;  2ZQ7 A;  1IYP A;  1BTL A;  3O87 A;  5AQ7 A;  4MBK A;  5EOE A;  5GLC A;  1E25 A;  4GD8 A;  4Y0U A;  2BG1 A;  4JPM A;  3LO7 A;  4E6X A;  4YFM A;  3PBO A;  4U3T A;  2V2F F;  1PWG A;  1MWT A;  1YLZ A;  2WK0 A;  1PI5 A;  1NYY A;  5EVI A;  3V39 A;  3VP0 A;  3LEZ A;  1MY8 A;  3LY3 A;  4ZJ3 A;  3FWL A;  2R9X A;  1E3U D;  1BLH A;  1MKI A;  2WGW A;  4E6W A;  4R4R A;  4N9L A;  2JCH A;  3Q7V B;  4S2K A;  4BQM A;  4BEN A;  4Y7P A;  1K57 C;  4Z9Q A;  1LI0 A;  2PU4 A;  1IKG A;  1RCJ A;  4KZ9 A;  5A93 A;  3BEB A;  3IXB A;  4HBT A;  4OPY A;  4BD0 A;  3UE0 A;  1DJB A;  2WGW B;  3ZG7 B;  2HP6 A;  4DRT A;  1RGZ A;  3OPL A;  3ITA A;  1SDE A;  3Q82 A;  4IBR A;  4EBP A;  2Y91 A;  4JBF A;  3SH9 A;  1L2S A;  1PW8 A;  4QD4 A;  1KGF A;  3HUO A;  3BFC A;  4KG5 A;  3W8K A;  3VP4 A;  1ESU A;  4LCM A;  4UA9 A;  1ZC2 A;  5DVA A;  3IT9 A;  5CER A;  2Y2L A;  4E3M A;  2X01 A;  1TVF A;  3MXS A;  1XX2 A;  2XD1 A;  5E2E A;  3P98 A;  2G2W A;  3SS4 A;  1MWR A;  1KE4 A;  3IWI A;  1BSG A;  4K0W A;  4LV2 A;  4R23 A;  3IF5 A;  4WEK A;  2WAE A;  1W5D A;  1H8Z A;  1KVL A;  1MBL A;  3MZD A;  3IF6 C;  4S2O A;  5EVL A;  4E3J A;  4X69 A;  3CG5 A;  4WYY A;  5A92 A;  4LV1 A;  3ZG8 B;  5FQQ A;  1C3B A;  3VSK A;  4O7D A;  2A3U A;  3WWX A;  4KZ6 A;  2UWX A;  3B3X A;  3UY6 A;  1PWC A;  3DW0 A;  1W79 A;  5KSC A;  4P0M A;  1CK3 A;  1Q2Q A;  4E3L A;  1TDL A;  3E2L A;  2ZQC A;  2WAD A;  3CZD A;  1IEM A;  3A3F A;  4OPR A;  1ZG6 A;  2XDM A;  4MBF A;  5FA7 A;  5AQ9 A;  3UPP A;  4S2N C;  3HUM A;  4R3B A;  2OSU A;  3N6I A;  2VGK A;  2HDU A;  3WS5 A;  4BL2 A;  5D3O A;  5FQ9 A;  1ES3 A;  5E43 A;  4N92 A;  4GNU A;  5AQB A;  3ISG A;  1PW1 A;  3HLC A;  4WMC D;  1FSY A;  2ZMA A;  1YLY A;  2XEP A;  1BT5 A;  3Q1F A;  1PZP A;  3VP1 A;  5F82 A;  3UO9 A;  1JWV A;  3ZCZ A;  2Y2Q A;  3VFF A;  2Y2O A;  1CEG A;  1G6A A;  1MXO A;  1RP5 A;  4NK3 A;  3GRJ A;  4KZB A;  1GCE A;  4DDY A;  4A5R A;  1S6R A;  1ONG A;  3NIA A;  4RA7 A;  5CED A;  2ZC3 B;  2JC7 A;  3BRM A;  1YLW A;  3O86 A;  1K55 A;  1JWZ A;  1LLB A;  2A49 A;  3PAG A;  4GZB A;  5TFQ A;  5KMW A;  1VM1 A;  3IH8 A;  3HVF A;  1NJ4 A;  4ZBE A;  3OC2 A;  5HFO A;  3C7V A;  4FSF A;  4KG6 A;  5DF8 A;  5E2F A;  3O88 A;  5GLD A;  3UDI A;  3VP3 A;  4BD1 A;  1DY6 A;  3QHY A;  1GHI A;  2XQZ A;  4UHU A;  3OPH A;  5CGW A;  4X53 A;  3EQU A;  1NY0 A;  1JVJ A;  2ZQA A;  4KZ7 A;  1ERQ A;  4GKU A;  2V20 A;  2WAF A;  3FV7 A;  3W4O A;  2HP9 A;  5AQA A;  5CEC A;  1XKZ A;  3ITB A;  4P85 A;  1GHM A;  3C4P A;  4QB8 A;  3DWK A;  3DTM A;  5EUA A;  3VOZ A;  5A90 A;  1KDW A;  3OCL A;  2WKH A;  1SHV A;  4OP5 A;  4X55 A;  4EV4 A;  3G2Z A;  3IH9 A;  3JYI A;  3NY4 A;  4KZ4 A;  5HAR A;  3GV9 A;  3N7W A;  3VFH A;  4RX3 A;  5HL1 A;  1WYB A;  4IVI A;  4QHC A;  4WZ5 A;  2XR0 A;  1QME A;  4PPR A;  1JTG A;  3E2K A;  1IYO A;  1ES2 A;  1O7E A;  5M1A A;  3UPN A;  1LL5 A;  1I2S A;  3BLM A;  4JXG A;  3IXD A;  5CTM A;  3V3R A;  3OPP A;  3D4F A;  3VOY A;  5HW3 A;  4GB7 A;  2XK1 A;  2Y55 A;  1GHP A;  1Q2P A;  1W8Q A;  1K54 A;  2WGI A;  4EBN A;  4MNR A;  4C6Y A;  4OH0 A;  1BUE A;  4PM8 A;  4RYE A;  5FQK A;  3TG9 A;  4WEL A;  4C3Q A;  4K91 A;  4UAA A;  5CGX A;  2H5S A;  3QNC A;  4S2N A;  1U60 A;  2IWB A;  2H10 A;  4FCF A;  2OV5 A;  2Y4A A;  4IED A;  4S2L A;  3MXR A;  2C5W B;  1L0E A;  3WS4 A;  4S2P A;  3VMA A;  4JF5 A;  2JBF A;  2WUQ A;  1S0W A;  3M2K A;  2Y2I A;  4OLD A;  1GA9 A;  3DWZ A;  1FQG A;  1K56 A;  2Y2H A;  4KG2 A;  1W7F A;  3M6B A;  4H8R A;  5FAS A;  1EI5 A;  4BLM A;  2ZC7 A;  4QY5 A;  4WMC A;  2WGV A;  4JXV A;  3WRT A;  4BJP A;  1FR1 A;  1WE4 A;  1K38 A;  1TEM A;  1YLT A;  2Y2K A;  3IHA A;  3BFE A;  3IXH A;  1LL9 A;  5FI7 A;  1YMX A;  3ZG9 B;  2EFU A;  1NYM A;  3MKE A;  5CHM A;  4JF4 A;  2QPN A;  4S2I A;  1RGY A;  2H0T A;  1KE0 A;  3UPO A;  3MBZ A;  2ZM8 A;  4OQ0 A;  4QJG A;  1O07 A;  3BFD A;  1HVB A;  1PI4 A;  5EVI D;  1YLJ A;  4JLF A;  2VGJ A;  1CEF A;  2ZM0 A;  3QNB A;  4RVA A;  4WZ5 C;  5KSH A;  4N9K A;  3BFG A;  3RXW A;  2EXB A;  2QMI A;  3G32 A;  2DRW A;  3IWO A;  2P9V A;  4GN2 A;  4KEN B;  1YT4 A;  3O3V A;  4IBX A;  2HDQ A;  2ZC5 B;  3BLS A;  5J8X A;  5EEC A;  3OCN A;  3G2Y A;  2WYX A;  1XA7 A;  1ZKJ A;  2ZQD A;  3WS0 A;  2BLS A;  2Z2M B;  2X02 A;  2RL3 A;  3C7U A;  4OQI A;  5TGF A;  3UDX A;  3VSL A;  1E3U A;  5BOH A;  3HLF A;  1CI9 A;  4FD8 A;  4GDN A;  4OPQ A;  2Y59 A;  2J7V A;  3TOI A;  3W4P A;  2B5R A;  4PMA A;  5CHU A;  3V5M A;  3FKV A;  2XD5 A;  2WKE A;  4QY6 A;  3ZG5 A;  4OKP A;  4X6T A;  4JXS A;  1SDN A;  1ERM A;  4L0L A;  2Y2G A;  4MEZ A;  3HRE A;  3GTC A;  4LEN A;  4OP8 A;  5E2G A;  3AGD A;  1BLS A;  5KZH A;  3WS1 A;  4OON A;  3AGE A;  4E3K A;  2ZQ9 A;  3WS2 A;  4LV0 A;  3PBR A;  5L2F A;  4Y0O A;  2XGN A;  1YLP A;  3PAE A;  4JKT A;  4GOG A;  4OOL A;  4X56 A;  2C6W B;  4GDB A;  4KZA A;  2XLN A;  3GMW A;  5F1F A;  5FAO A;  2P9V B;  4OVD A;  5GLA A;  4FH2 A;  2EX2 A;  1XGJ A;  3GVB A;  5FSR A;  1QMF A;  1G68 A;  1ESI A;  3M2J A;  5DF9 A;  4R3J A;  3SS5 A;  1ZG4 A;  3ZG0 A;  2ZC6 B;  4S2M A;  5EPH A;  5CXW A;  4EWF A;  3PBN A;  1YQS A;  4DE0 A;  1N4O A;  2XFT A;  2ZD8 A;  4KZ8 A;  1K4E A;  4ZJ1 A;  1YM1 A;  1J9M A;  4KZ3 A;  1E4D A;  2E8I A;  5E2H A;  4N1X A;  2RCX A;  2DNS A;  4ZAM A;  2WZZ A;  4XUX A;  2GDN A;  3ZNT A;  4DE1 A;  3MFD A;  1FCN A;  4KZ5 A;  1TDG A;  3LY4 A;  1PZO A;  2IWC A;  2Y2M A;  3FKW A;  1H5X A;  1HD8 A;  3S22 A;  1ERO A;  4OOM A;  3RXX A;  1MWU A;  4C75 A;  2WKI A;  1K6S A;  4QU3 A;  1SKF A;  5FQM A;  3PBQ A;  4JXW A;  5IHV A;  3EQV A;  4OOY A;  3HLE A;  1I2W A;  2OLU A;  3BFF A;  4N1H A;  3ZGA B;  1NRF A;  3G4P A;  3UE1 A;  3HLD A;  5EVI B;  4EQI A;  1FSW A;  5HAQ A;  3W4Q A;  4WEJ A;  3HLG A;  2Y2N A;  2XF3 A;  4B88 A;  5HAI A;  3UN7 A;  3TSG A;  4DE3 A;  1L0D A;  3IQA A;  4KQR A;  3UDF A;  4JF6 A;  1BUL A;  3BM6 A;  3HLB A;  2J9P A;  3N4I A;  4IVK A;  2PBY A;  1PIO A;  1K4F A;  5DF7 A;  1K57 A;  2HP5 A;  1BZA A;  5GHX A;  5CRF A;  3ZDJ A;  5GLB A;  1IYS A;  5F83 A;  4OQG A;  3SH7 A;  3V50 A;  4OPZ A;  1LI9 A;  3CJM A;  1JTD A;  5JYO A;  2R9W A;  3A3D A;  4ZTK A;  5DTT A;  3Q7Z A;  4M3K A;  4B4X A;  3HL9 A;  3V3S A;  4B4Z A;  2IWD A;  4R0Q A;  4RX2 A;  4DF6 A;  2XFS A;  1OME A;  3PTE A;  4S2J A;  3NC8 A;  1H8Y A;  1JWP A;  3FZC A;  3GQZ A;  3MKF A;  5CHJ A;  1XXM A;  5M19 A;  4WBG A;  1M6K A;  2FFF B;  3HLW A;  3NBL A;  3G34 A;  1LHY A;  2JE5 A;  3LCE A;  3BYD A;  5EE8 A;  3ZHH A;  1KGE A;  4HBU A;  1XPB A;  1I5Q A;  4KQO A;  3BEC A;  3MZF A;  3RJU A;  3SH8 A;  1M40 A;  2H0Y A;  4E3O A;  4F94 A;  2HDS A;  5FI6 A;  3FYZ A;  1XP4 A;  2V1Z A;  2HDR A;  1K55 C;  5FAP A;  1MWS A;  1FOF A;  3N8R A;  3Q07 A;  1Y54 A;  1KDS A;  4Q8I A;  2OLV A;  3UE3 A;  4DE2 A;  3S4X A;  3HUN A;  3C5A A;  5TR7 A;  4E3I A;  3OPR A;  1PWD A;  1IEL A;  5HAP A;  2ZM2 A;  3N8L A;  3CMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...