1LL5A

X-ray crystal structure of ampc wt beta-lactamase in complex with covalently bound imipenem
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
358
structure length
351
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-lactamase
publication title Structural Basis for Imipenem Inhibition of Class C beta-lactamases
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 113
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ll5A00
2P9VB 3MFDA 2WAFA 3G4PA 2HDUA 2XFTA 4OONA 5FI7A 4IVKA 1IYPA 3FYZA 5CHJA 4FH4A 5JYPA 2ZD8A 5EOOA 3N4IA 3ZG9B 2VGKA 3BRMA 1G6AA 1JWVA 5F82A 1ES2A 4DXBA 4GDBA 4MEZA 4OPQA 3ITBA 4LV2A 2XD1A 4GD6A 1PW8A 2WZXA 5DTTA 4FCFA 1K57C 5EE8A 4RA7A 1K55C 4BLMA 2ZQ9A 3VSLA 4DE0A 1RCJA 1GHMA 5E43A 4MBFA 2Y2JA 3O87A 1LHYA 3I7JA 5CEDA 1YLJA 1DJAA 1N4OA 4GD8A 4KZ8A 4FD8A 3GSGA 4BENA 1W7FA 3SH7A 5HARA 2QMIA 3A3JA 1H5XA 3VSKA 1GCEA 5KZHA 4ID4A 5M19A 2ZM8A 2XGNA 1GHIA 3IF6A 1E25A 4E6XA 1WE4A 1HD8A 2Y91A 4PM8A 4UHUA 5CGXA 3BM6A 4R3BA 3OPRA 1LL9A 3IXGA 2HDSA 1XP4A 3UE1A 1O7EA 2HPBA 3G35A 3ZDJA 1Y54A 1YMSA 4HESA 3TG9A 2ZC6B 3IXDA 2A49A 5D3OA 4OOYA 1PI5A 2I72A 2G2WA 3N7WA 4DF6A 3NDGA 1K4EA 5FSRA 4EUZA 3UDXA 4ZJ2A 5F1FA 3CJMA 4DKIA 1ERMA 2J9OA 4X56A 4C75A 2Y2NA 3IWQA 3PBOA 1QMFA 4JF6A 5GLBA 2IWCA 4LV1A 1ZG4A 1JWZA 3HLDA 1BLPA 1U60A 5JYOA 3VOYA 1Q2PA 4OP5A 1TDLA 2Z2MB 5AQBA 3WS0A 2EX8A 4K91A 5HL1A 3Q81A 4PMAA 3CG5A 3V5MA 1YQSA 2XH9A 4JPMA 4OLDA 4PM6A 4XXRA 2RL3A 1ES3A 4GKUA 4LCLA 1BUEA 1L0GA 3GRJA 1JWPA 1PYYA 1VM1A 3OPPA 5KSCA 4U0TA 4R23A 3BECA 4GB7A 2OLUA 1TDGA 2PBYA 5BOHA 4WEKA 2Q9MA 3M6HA 3O3VA 3ZNYA 2Y2IA 4E6WA 1YLZA 3WS4A 3VP2A 5I94A 1SKFA 1RP5A 3M2JA 3BFEA 5EUAA 1NZUA 3C7UA 2XDMA 2EXBA 1FSYA 1J9MA 4OQ0A 4WMCA 4YFMA 3VP0A 3ZG5A 5KSHA 2E8IA 2B5RA 3NC8A 5FAQA 4R4SA 3FV7A 4ZDXA 3VFHA 4EBPA 3IH9A 5DF7A 4NETA 4WMCD 2WZZA 3Q7VB 1XA7A 4YINA 3A3IA 1AXBA 4S2LA 4WZ5C 5GHXA 4BL3A 4P6BA 2C6WB 1WYCA 3V3SA 3NCKA 3LO7A 1NY0A 3G2YA 4PPRA 1PZOA 1KVMA 3IF6C 3HLEA 3BLMA 3O88A 4GOGA 4N1XA 4R4RA 4C3QA 3G34A 5EVIB 2OV5A 1RGZA 1CK3A 3QNBA 4Y0TA 1FR1A 4ZAMA 1W8QA 5FQIA 5G18A 1K54C 4QJGA 3AGFA 5GLAA 4DXCA 4B88A 3G31A 4EBLA 1H8YA 1XXMA 1KE3A 2Y4AA 2ZQ7A 1W5DA 3IWOA 2Y2PA 3PBSA 5FQ9A 2WYXA 3DWKA 1DY6A 4OPRA 4WEJA 3RXWA 2J7VA 4K0XA 3UPOA 3UO9A 1YLYA 1DJCA 1IYOA 2WADA 2ZM2A 4N9KA 2X02A 4X55A 3MXRA 2CC1A 1K4FA 3HLCA 3QHYA 4MBKA 1CEGA 1GA9A 4PM9A 4Y0OA 4E3OA 3GV9A 3D4FA 1E3UD 1NZOA 3G32A 4ZTKA 3HREA 4BD1A 3UDIA 1RGYA 4JKTA 3DTMA 3ZCZA 5E2HA 4P85A 4S2NA 4Y7PA 1HVBA 1KGEA 2WGWA 3FKVA 3IH8A 5FQJA 3TSGA 3ZG8B 2DRWA 3NY4A 1BULA 2BG1A 1Q2QA 3UN7A 3IWIA 1FCNA 5TGFA 1KGGA 5FQKA 3A3DA 5HW3A 2DNSA 4U0XA 1I5QA 5CERA 4KZBA 3BYDA 3FKWA 3FZCA 3EQVA 4RX2A 4QU3A 4EQIA 3Q07A 1SDNA 5CHMA 2ZC3B 3LY3A 5FAOA 5A92A 1KDWA 2WK0A 4S2IA 3PTEA 1ESUA 3C5AA 3VP3A 4Q8IA 2HP9A 4UA7A 1OMEA 5EVIC 3WS1A 3HUMA 3WS2A 2PU4A 4WZ4A 2JE5A 4N9LA 5CGSA 4S2PA 2FFFB 1BLSA 1BT5A 3BFGA 1PI4A 3E2LA 4B4XA 4DE3A 2ZC7A 4JBFA 1I2WA 2ZQCA 3MBZA 4IEDA 1NYMA 1HTZA 3N8SA 3IQAA 4H8RA 4FH2A 1CI9A 4X69A 5GHZA 3EQUA 4JXWA 5GLDA 1FSWA 3MKEA 3IF6B 1BTLA 4LENA 1ES5A 2XQZA 2ZQ8A 3HLBA 3UPNA 4IBRA 3SS4A 3BFDA 1SCWA 1LI9A 2HP5A 1L0DA 2VGJA 3OZHA 4MLLA 3SS3A 4QY6A 3V50A 3UNWA 2C5WB 5F83A 1S0WA 4KZ4A 2J8YA 5HX9A 3BFFA 4QB8A 4QHCA 1EROA 5A91A 3OC2A 4M3KA 4DE2A 1MWRA 4DDYA 5E2GA 5EOEA 4E3NA 5FA7A 1K6SA 2EXAA 2JCHA 2ZC5B 3WS5A 1IELA 1IYQA 1Z6FA 1MPLA 1ZG6A 3UPPA 4S2NC 1JVJA 3O86A 1H8ZA 4IVIA 4EBNA 1DJBA 1MWTA 5E2EA 1TEMA 4JXVA 3HLGA 4KG2A 1S6RA 4OOMA 3G30A 3NBLA 4P0MA 3IF5A 5FQMA 3VOZA 2XFSA 3AGDA 5AQAA 5KMWA 3WWXA 2FFYA 2QPNA 3GMWA 4KQRA 4DE1A 3ZNTA 1TVFA 1HZOA 1VQQA 1PWGA 5M18A 2WAEA 1EWZA 3A3EA 3ZGAB 3VFFA 3BEBA 2ZLYA 5L2FA 2IWDA 3BLSA 4OVDA 2G2UA 1W79A 4OH0A 1YLPA 2XF3A 3QNCA 4X68A 3HVFA 3PBNA 1PWCA 1G68A 3UDFA 1LLBA 3MZDA 2R9WA 2Y2GA 4L0LA 1YT4A 4F94A 1K57A 1K38A 1K55A 5DF8A 3S4XA 3TOIA 3OPLA 1KE0A 4GZBA 2V1ZA 1M6KA 1PIOA 2EFXA 1W8YA 3S1YA 4GNUA 2WGIA 1GA0A 1I2SA 1E3UA 3Q7ZA 3ZVTA 1IKGA 1MWSA 4JLFA 4E3IA 2Y2HA 3CMZA 4O7DA 5FI6A 4S2KA 5DTKA 1IKIA 1L0EA 3GR2A 4BQMA 5FASA 3M2KA 4E3MA 3HBRA 1WYBA 3HUNA 4WM9A 4XUZA 5FI2A 5CECA 3OCNA 2EX9A 3PBTA 4KG6A 3ZG0A 5HFOA 1PW1A 3VMAA 5GLCA 3IXBA 3ITAA 4KZ9A 3MXSA 4N1HA 4ZBEA 3HUOA 5U47A 3GVBA 2H5SA 2WUQA 3N6IA 5TR7A 3WRTA 2H10A 1BSGA 5GHYA 3NI9A 3VP4A 1FOFA 3ZVWA 1MBLA 3RJUA 3JYIA 3OCLA 2WKEA 4KZ3A 4GN2A 1NYYA 2P9VA 2V2FF 1LL5A 3DWZA 1K56D 4LV0A 4LV3A 5CXWA 1XGIA 5CGWA 5FAPA 3UE3A 3UE0A 4N92A 2ZMAA 2ZQAA 2Z2LB 2WKHA 4WYYA 2QZ6A 1PWDA 4HBTA 5CTNA 5DF9A 5GL9A 2WGWB 2Y2LA 3IXHA 1XPBA 3PBQA 4E3KA 2ZC4B 2XD5A 3HLFA 3MKFA 3M6BA 2WKIA 2UWXA 4UA9A 4ZJ1A 3RXXA 3WRZA 4B4ZA 5EECA 4UAAA 1E4DA 4JXGA 4DRTA 3Q82A 1IEMA 4C6YA 4QY5A 4HBUA 5IHVA 3P09A 1ZC2A 4OLGA 4JXSA 2J9PA 2EX6A 5DVAA 1C3BA 2X71A 4KZ6A 5HAQA 1N9BA 5HAIA 3W4OA 2Y2KA 2IWBA 2HP6A 4OQIA 1K25A 5AQ9A 3N8RA 4A5RA 1K6RA 4KZAA 1IYSA 4KQOA 3ISGA 1FCOA 4QD4A 1ES4A 3MZFA 5E2FA 1BLHA 5FDHA 4WZ5A 1MXOA 4EV4A 4S2MA 3S22A 2OSUA 5DTSA 4S2JA 5CTMA 3N8LA 4P87A 2EX2A 4OP8A 4ZJ3A 1NJ4A 1NXYA 3IT9A 4OPYA 3Q1FA 5EPHA 1ZKJA 4OOLA 4MNRA 4MBHA 3ZFZA 4E3LA 3SH9A 3V39A 2RCXA 1K54A 1EI5A 4IBXA 1SHVA 3LCEA 4K0WA 4OQHA 4RX3A 4U3TA 3W4QA 2V20A 4KG5A 5M1AA 3ZHHA 1XGJA 4CPKA 1GHPA 3IHAA 4OKPA 3CZDA 3AGEA 4D2OA 1BZAA 2Y59A 3UY6A 2XR0A 3G2ZA 2XEPA 2R9XA 3A3FA 3HL9A 5EVLA 3SS5A 1CEFA 1YLTA 4WELA 4BL2A 4S2OA 1KDSA 1YLWA 3PBRA 1NRFA 1ESIA 4X53A 2H0YA 2Y2OA 2EFUA 3LY4A 4FSFA 4X6TA 3DW0A 3SH8A 1JTGA 3VP1A 1CI8A 4Y0UA 4OQGA 2ZJ9A 2HDQA 4XUXA 2XLNA 1FR6A 4DDSA 1SDEA 1XA1A 1MWUA 4NK3A 5AQ7A 5J8XA 1KGFA 1L2SA 1ALQA 3C7VA 2Y2QA 3B3XA 3P98A 3Q7VA 4CJNA 4PM7A 5CHUA 1QMEA 1BLCA 4BJPA 1MKIA 3PAEA 3OPHA 5HAPA 4EWFA 5EVIA 2Y2MA 3NIAA 4KQQA 3GQZA 3ZG7B 1ONGA 2H0TA 2A3UA 4HEFA 2JC7A 5CRFA 2ZQDA 1PZPA 3BFCA 4Z9QA 3W8KA 3W4PA 5A93A 2JBFA 1JTDA 5EVID 4R1GA 1FQGA 1XKZA 4GDNA 2DCFA 1KE4A 3PAGA 2X01A 4E3JA 1LI0A 4UA6A 2GDNA 4BD0A 1L0FA 1K56A 4PM5A 2BLSA 3NDEA 1XX2A 4LCMA 4R3JA 4KZ7A 3E2KA 3IHBA 4JF4A 1O07A 1KVLA 5CEBA 1YMXA 1ONHA 2Q9NA 2Y55A 5FQQA 1YM1A 5F1GA 2OLVA 3GTCA 3V3RA 2ZM0A 4WBGA 2P74A 4R0QA 3MZEA 4JF5A 2HDRA 2WGVA 3FWLA 2XK1A 3C4PA 4RYEA 4KZ5A 3SOIA 5A90A 1FCMA 3LEZA 4KENB 5FATA 5TFQA 1M40A 3C4OA 1ERQA 1MY8A 4RVAA 2PU2A 3HLWA 4OPZA
chains in the Genus database with same CATH superfamily
3G4PA 2XFTA 4OONA 2JKTI 1IYPA 2WKQA 2HF6A 3N4IA 1JWVA 5F82A 1ES2A 3ITBA 4HQAA 1PW8A 5EE8A 4RA7A 4DE0A 1RCJA 3I7JA 4KZ8A 1N4OA 4GD8A 1SKOB 2QMIA 4BWIA 1H5XA 3VSKA 4ID4A 2HV1A 2ZM8A 4E6XA 2INWA 2HDSA 1XP4A 2HPBA 3G35A 3IS2A 2O9CA 1TS0A 1TF1A 1X0OA 2A49A 1YKDA 5D3OA 3DTKA 3CJMA 4IUKA 3LIDA 3PBOA 2IWCA 4LV1A 1JWZA 3DAVA 2B02A 4XT2B 3B33A 4ARZA 3CPTB 5TJJA 5EFWA 3VOLA 3V5MA 1YQSA 3SW1A 4GKUA 1BUEA 1L0GA 3GRJA 1TDGA 5BOHA 4WEKA 3O3VA 2OWHA 3M6HA 3MR0A 4Q0JA 4JGOA 3VP2A 4LRZE 1RP5A 2ZL1A 4WL9A 2EXBA 1J9MA 5MC7A 4YFMA 3ZG5A 5KSHA 1VEUA 2GX5A 5FAQA 4EQ1A 3FV7A 5DKKA 3VFHA 5HD5A 1XA7A 1VETA 4YINA 4S2LA 5GHXA 1DRMA 2ZOIA 5HPIA 3HLEA 2OV5A 1W8QA 3AGFA 4DXCA 2VGLS 1XXMA 2Y4AA 2JN7A 2WYXA 3DWKA 3RXWA 2J7VA 2ZM2A 3FC7A 3MXRA 4Y13A 1E3UD 3G32A 4WN5A 3T4QA 1TS6A 5E2HA 4P85A 1HVBA 3IH8A 3TSGA 2VGLM 2BG1A 1FCNA 1OTBA 5FQKA 2V1AA 4U0XA 1I5QA 4X1MA 4EQIA 4QU3A 3Q07A 3QP1A 5FAOA 2GJ3A 3PTEA 3C5AA 1OMEA 2V9AA 3MS6A 3A0VA 3QP8A 3ZQ5A 3K3DA 5G4ZA 1BT5A 4WLAA 1PI4A 4B4XA 4DE3A 2ZC7A 3IBRA 2OOLA 1MKMA 1TD5A 1NYMA 4Y2FA 2LB9A 3LI9A 1CI9A 5GLDA 1FSWA 2JKGA 4MN7A 2IA2A 3HLBA 3UMEA 2JKFA 4QY6A 3UNWA 3IS2B 5F83A 1EROA 5J4EA 1MWRA 5E2GA 2H28A 5FA7A 2JCHA 1Z6FA 4O8GA 4EBNA 4ARZB 1H8ZA 1DJBA 1TEMA 4JXVA 5J3WA 4KG2A 1OT6A 4P0MA 5FQMA 1Y4OA 3QP4A 5AQAA 3RH8B 3DTEA 3BY9A 1HZOA 2VA0A 5LBRA 2WAEA 4NXEA 2ZL1B 3BEBA 3RFBA 1YLPA 1SZVA 4UEYA 1G68A 1VEUB 1P9WA 2XA7S 4NXBA 3OPLA 4GZBA 1M6KA 1PIOA 4LFUA 1W8YA 2YKFA 1VETB 4GNUA 2WGIA 1MWSA 4JLFA 4O7DA 5FASA 2VLGA 1L0EA 5IS1A 1WYBA 2Z6DA 1S66L 3JPUA 5HFOA 5GLCA 4N1HA 1OTIA 4KZ9A 1H8MA 3N6IA 3MSHA 2H10A 2XA7M 1Y28A 3NI9A 3VP4A 4MN5A 2WKEA 4GN2A 2V2FF 1K56D 3UE3A 2ZMAA 4WYYA 2QZ6A 4Q0HA 4GS9A 3IXHA 4LLOB 2NUTC 2HJEA 4EXOA 2VKSA 1CF0A 3M6BA 1E4DA 4JXGA 4C6YA 5IHVA 4ETZA 1ZC2A 2EX6A 4KQDA 1C3BA 2X71A 5HAQA 3TE8A 3VE3A 2HP6A 1LL8A 1UWNX 5E2FA 1BLHA 5CTMA 4MNRA 3V39A 2QWSA 4IBXA 4HH3A 2AVXA 2V20A 4KG5A 5M1AA 4IUHA 3ZHHA 1XGJA 4CPKA 1VB6A 3IHAA 3CUEC 3MXQA 3S7NA 1XJ2A 3A3FA 5EVLA 4WELA 4S2OA 1XJ3A 1OJGA 4X53A 4JGQA 2EFUA 5F6AA 2E8JA 4X6TA 3C30A 1CI8A 2ZJ9A 1FR6A 1YSQA 3B3XA 1NLYA 5HAPA 3SZTA 5EVIA 3NIAA 3ZG7B 3DTIA 2WKPA 5CRFA 2ZQDA 3BFCA 3W8KA 1IOUA 3KSFA 5EVID 3V67A 4R1GA 1FQGA 1YSPA 1XKZA 2X01A 4UA6A 4Y5FA 4HJ4A 1XX2A 3T4JA 2OWJA 2PYRA 1YPRA 4JF4A 2L4RA 1KVLA 2Q9NA 5F1GA 2OLVA 3GTCA 2V0WA 3W2ZA 3C4PA 4RYEA 1FCMA 2L0WA 5FATA 3C4OA 2EA9A 4RVAA 3MFDA 1PRQA 2VX8A 5EV0A 4IVKA 4YWZA 4CLCD 5EOOA 4GS9B 2VGKA 3BRMA 1S1ZA 4DXBA 3EEHA 1GSWA 4LV2A 5DTTA 3OOVA 3BW6A 2ZQ9A 4L9FA 1T1BA 1GHMA 5E43A 4MBFA 2Y2JA 1DJAA 1ZTUA 3MMHA 4GLQA 5G4YA 5KZHA 5FEFA 5HD3A 3UB5P 3T4KA 1WE4A 4IHQA 4BBUA 2Y91A 3ICYA 5FDSA 3U4LP 3BM6A 4R3BA 1LL9A 3BY8A 3UE1A 3T1QB 1Y54A 4OOYA 3C38A 1PI5A 2QJ7A 4EUZA 4ZJ2A 5F1FA 4DKIA 3O5YA 2Y2NA 1QMFA 1ZG4A 5JYOA 1BLPA 1TDLA 5L09A 4F3LA 4PMAA 3CG5A 4BBVA 2XH9A 4OLDA 4XXRA 2RL3A 4LCLA 3R7WA 3HJKA 3BECA 4GB7A 4R3AA 2Q9MA 2Y2IA 2OAQ1 1YLZA 5I94A 1SKFA 4HI4A 3CAXA 3KYEA 5EUAA 1NZUA 3T4OA 3NOUC 1FSYA 4WMCA 3VP0A 2Q0OA 4PHTA 4ZDXA 4EBPA 4ZRRA 4NETA 4WMCD 3A3IA 4P6BA 3LO7A 1XJ6A 1NY0A 4PPRA 3IF6C 3BLMA 5HPFA 5EVIB 3QNBA 1FR1A 4ZAMA 1P0ZA 1N9LA 2NUPC 2K31A 4B88A 4EBLA 1H8YA 2JKRM 1KE3A 2ZQ7A 2FZ0A 1DY6A 3UPOA 3UO9A 2WADA 1IYOA 4N9KA 2JHEA 2CC1A 3QHYA 4PM9A 1NZOA 1G6OA 3S7QA 2D01A 3GECA 4JKTA 4Y7PA 1KGEA 1DP8A 2M1CA 3NY4A 1CJFA 5TGFA 1S4RA 3LR5A 5CERA 2ZC3B 4S2IA 4Q8IA 3VP3A 3P01A 5EVIC 3KYQA 1T1AA 3DBAA 4WZ4A 4N9LA 1KOUA 5CGSA 4S2PA 2LB5A 5L07A 3BFGA 3E2LA 4R6LA 1HTZA 5GHZA 1D1JA 1TS7A 2W3FA 1BTLA 3D3OA 2XQZA 2ZQ8A 4IBRA 3SS4A 1SCWA 1LI9A 3OZHA 2W27A 4MN6A 3B47A 1S0WA 4X1LA 3OBFA 4CLCC 4DMZA 4M3KA 4E3NA 1K6SA 2EXAA 2ZC5B 3WS5A 1IELA 1ZG6A 4S2NC 1JVJA 2CMNA 4F3LB 3NBLA 3VOZA 2XFSA 3R7WB 3WWXA 2FFYA 4DE1A 4G3VA 3OLOA 1VQQA 1PWGA 4Q0IA 3ZYTA 3A3EA 2GNXA 3EOIA 5L2FA 2IWDA 1J3WA 3H9WA 2XF3A 4X68A 3HVFA 1PWCA 1LLBA 4R70A 1K57A 1K38A 1K55A 3TOIA 2W1TA 1LSXA 2W1RA 1E3UA 2FH5A 1IKGA 4RQ9A 2ZMVA 3CMZA 4CLCE 5DTKA 4BQMA 4GCZA 3HBRA 4WM9A 3EGXC 2EX9A 3PBTA 2K2NA 1PW1A 5L8MA 3ITAA 5F69A 5FL3A 2WUQA 5TR7A 4MMNA 4Y17A 1T19A 3UMDA 3LIBA 5C5KA 1S4SA 3OCLA 1V9YA 3DWZA 2BTFP 5CXWA 3CUEA 3UE0A 4N92A 2WKHA 5CTNA 3LIFA 3CLOA 2Y2LA 3TJZC 2XD5A 2VEAA 3MKFA 3RXXA 3WRZA 4B4ZA 4WUJA 4I38A 4UAAA 1IEMA 5FEGA 1CQAA 3P09A 2L1MA 3UB9A 3W4OA 2IWBA 4EUVA 3N8RA 1FCOA 4NXGA 3MZFA 1MXOA 4EV4A 3S22A 2OSUA 5KIZA 5DJUA 4DJ3A 4FOFA 4OP8A 4OPYA 4OOLA 1F9IA 4E3LA 4E04A 2EWWA 3LFVA 1SHVA 1V9ZA 4K0WA 3LUQA 3BJNA 4OQHA 4RX3A 4U3TA 5HDCA 2ACGA 4D2OA 4JGPA 2Y59A 2XR0A 3G2ZA 4P6ZS 2R9XA 4BL2A 1KDSA 3PBRA 4BBTA 1F98A 1NRFA 3LY4A 3DW0A 3T50A 4I3JA 4Y0UA 5L10A 4OQGA 5I5LA 2HDQA 4XUXA 1SDEA 1MWUA 5AQ7A 5J8XA 1XFNA 3C7VA 3C8CA 1QMEA 3LGOA 4P6ZM 4R38A 1N9NA 3PAEA 3OPHA 4EWFA 5J7EA 1WA9A 5DKLA 2H0TA 2VK3A 4G3WA 4Z9QA 3W4PA 5A93A 2W1TB 3KSIA 3T12B 1JTDA 3E0YA 4GDNA 3MQ0A 5AJGA 3PAGA 4E3JA 1LI0A 4PKYG 3KSHA 4BD0A 1K56A 2D02A 3F1OA 2KDKA 2BLSA 4O01A 4PAUA 4LCMA 1O07A 1YAXA 2Y55A 1YM1A 2ZM0A 3S7OA 2HDRA 2VV8A 3FWLA 3QP6A 5TFQA 1M40A 3HLWA 4OPZA 1Z09A 2WAFA 2HDUA 5FI7A 3FYZA 5JYPA 2ZD8A 3ZG9B 1G6AA 4GDBA 4OPQA 4II7A 2XD1A 4GD6A 3CWFA 3NJAA 1K57C 4BLMA 1K55C 3O87A 2B18A 1LHYA 3H82A 5CEDA 2XSSA 3GSGA 4BENA 1W7FA 5HARA 3A3JA 1K0KA 4HJ6A 3IF6A 2XGNA 1GHIA 5HSQA 1E25A 3ZDJA 1YMSA 3RTYA 3N7WA 2J80A 5HDSA 5FSRA 1ERMA 2J9OA 4X56A 4C75A 3IWQA 4JF6A 5GLBA 1U60A 3VOYA 1Q2PA 4OP5A 3WS0A 2EX8A 4K91A 3IX3A 5TBMA 4X25A 4EETB 2Y79A 4PM6A 1ES3A 3P7NA 1PYYA 2PBYA 4E6WA 3KYZA 3WS4A 3BFEA 1FILA 2XDMA 3MQOA 2PYPA 4OQ0A 2E8IA 3NC8A 4R4SA 3BQ8A 3MQQA 2O9AA 3K2NA 3NOPC 3IH9A 4HP4A 5DF7A 2WZZA 3F1PA 1AXBA 4BL3A 1WYCA 3NCKA 3G2YA 4GOGA 3S7PA 3G34A 1RGZA 5G18A 3PBSA 3IWOA 3T4SA 5EM0A 4OPRA 4PKYA 4K0XA 2Z6CA 1DJCA 2W3GA 3D72A 3HLCA 3CI6A 4E3OA 1OT9A 3GV9A 3F1OB 2QHKA 4ZTKA 4CLCA 4HOIA 3JVVA 1OTAA 3BWLA 4S2NA 4I5SA 3FKVA 2BASA 2JKRI 3ZG8B 4Z1WA 1Q2QA 5HW3A 2DNSA 2O0YA 3EQVA 3QP5A 1SDNA 3ULFA 4DN0A 3LY3A 2ZBBA 5A92A 1KDWA 2WK0A 5HDDA 4UA7A 3HUMA 2PU4A 3IX4A 2PAVP 1ODVA 2XROA 3H82B 2ZQCA 3MBZA 4IEDA 3PR6A 3IQAA 4H8RA 4FH2A 4X69A 3EQUA 2XRNA 4JXWA 3L7HA 3MKEA 3IF6B 2WKRA 3L9KA 4LENA 1ES5A 3UPNA 3BFDA 2HP5A 3UB6A 3SS3A 2C5WB 1F5MA 5CX7A 4KZ4A 4K08A 4QB8A 5A91A 3C2WA 4DE2A 5EOEA 1MPLA 3O86A 1MWTA 3NHQA 1S6RA 3G30A 5TBMB 3LR4A 4FTXA 5HZHA 5KMWA 4KQRA 2QPNA 3GMWA 4EESA 3EWKA 3VFFA 3BLSA 4OVDA 2G2UA 1W79A 4O0PA 3UDFA 3MZDA 1W63M 4F94A 5DF8A 3S1YA 1KE0A 2EFXA 3F1PB 3LI8A 4QPRA 1I2SA 2PRFA 5IT5A 2Y2HA 1IKIA 4E3MA 3HUNA 5CECA 2YKHA 3OCNA 3E4OA 3VMAA 1TS8A 3IXBA 3GVBA 5DFXA 5GHYA 4M4XA 1FOFA 3RJUA 3JYIA 1DP6A 3T1XA 4LV3A 5HX9A 1NYYA 2P9VA 1LL5A 4CLCB 1XGIA 5CGWA 2PT7A 1HLUP 2Z2LB 2ZQAA 1FIKA 2V1BA 5DF9A 1L3LA 5GL9A 5F68A 3PBQA 1XPBA 5AVEA 2M7UA 2KX6A 2WKIA 3EGDC 2UWXA 2M7VA 2HJ9C 4DJ2A 4DRTA 4QY5A 3A0RA 4EEUA 4I3AA 4OLGA 4Y3IA 4JXSA 4KZ6A 1N9BA 4LPZA 4HY8A 4G3KA 4YOFA 3QP2A 1K25A 4A5RA 1K6RA 4KZAA 1IYSA 4KQOA 3ISGA 1ES4A 3E4PA 4WZ5A 1XJ4A 3N8LA 4BMWA 2EX2A 1NJ4A 1ZKJA 3SH9A 2RCXA 1K54A 1EI5A 1P97A 3W4QA 4I39A 4ESPA 2QJ5A 1GHPA 1S67L 1BZAA 2Y8HA 2XEPA 4MDZA 4NKPA 4ETXA 1YLTA 2PD7A 1A0KA 1GSXA 1YLWA 1ESIA 5HWTA 3SH8A 3VP1A 4ME4A 1UGUA 4DDSA 1XA1A 5HWVA 2V0UA 1ALQA 3E4QA 3P98A 3Q7VA 1NRJA 4PM7A 4HP9A 1BLCA 4BJPA 1NLZA 1G28A 1T1CA 4KQQA 3VE4A 3FPWA 2A3UA 4HEFA 4HJ3A 5DJTA 5F5YA 2W3HA 4MCWA 1KE4A 2K7SA 1P9RA 2GDNA 2JKTM 2P7JA 4KZ7A 3E2KA 1ONHA 2DMWA 3PHYA 3V3RA 1GSVA 4JF5A 2WGVA 2KOIA 2XK1A 5A90A 4KENB 2J3TD 1ERQA 3LR0A 4MLLA 2PU2A 4WF0A 2P9VB 4HH2A 5CHJA 4FH4A 1W63Q 1N9OA 4MEZA 2WZXA 4FCFA 3TRCA 3B42A 3VSLA 4EERA 2I9VA 1YLJA 4FD8A 3SH7A 4B93A 1GCEA 2VJWA 5M19A 1HD8A 4PM8A 4UHUA 5CGXA 3OPRA 3IXGA 1O7EA 4Y15A 4LGWA 3PYPA 4HESA 3TG9A 2ZC6B 3IXDA 4IJGA 2I72A 4DF6A 2G2WA 1H3QA 1K4EA 3NDGA 3UDXA 3UB7A 1BYWA 2OAP1 5GLAA 3HLDA 4CQHA 3BQAA 5AQBA 2Z2MB 1EW0A 5HL1A 3Q81A 4JPMA 1JWPA 1VM1A 2B95A 3OPPA 4U0TA 1UWPX 4R23A 5KSCA 2OLUA 3ZNYA 2PDRA 3M2JA 3C7UA 2B5RA 2PBDP 2QYBA 2G7UA 5A8BA 2O9BA 3Q7VB 3JVUA 4WZ5C 1ZHHB 2C6WB 3NULA 3V3SA 4KUKA 4R4RA 1PZOA 1KVMA 4N1XA 4C3QA 3O88A 1CK3A 4Y0TA 2MJ6A 3F1NA 5FQIA 1K54C 2ZMFA 4QJGA 3G31A 1W5DA 2Y2PA 5FQ9A 3MFXA 1OPXA 4WEJA 1YLYA 2X02A 4X55A 1MZUA 4L9EA 1K4FA 4MBKA 1CEGA 1GA9A 4Y0OA 3D4FA 1STZA 2P08A 3HREA 2PD8A 4I3IA 4BD1A 1H0MA 3UDIA 1RGYA 3DTMA 3ZCZA 3UE6A 5FQJA 2WGWA 4HHDA 2DRWA 3CHWP 4NEED 1BULA 1OTDA 3UN7A 3IWIA 1T18A 1KGGA 3A3DA 3LICA 3KSGA 4KZBA 3BYDA 3FKWA 3FZCA 3LR3A 5EM1A 4RX2A 2O99A 5CHMA 1IFQA 3GDIA 1ESUA 2HP9A 2V8CA 3WS1A 3WS2A 2JE5A 2FFFB 1BLSA 4JBFA 1I2WA 2PR5A 3N8SA 2W0NA 2PR6A 4L9GA 2J3TC 1L0DA 2VGJA 3V50A 4NXFA 4GHIA 2J8YA 3BFFA 4QHCA 4JGRA 3OC2A 3VV4A 4DDYA 3MJQA 3R4KA 3KO6A 1IYQA 3UPPA 1D06A 3UB8A 4IVIA 1D7EA 1F2KA 5E2EA 4OOMA 3HLGA 2HZ5A 2VV7A 3IF5A 3LIAA 1S1YA 3AGDA 5IU1A 5DFYA 1G5UA 3ZNTA 1TVFA 5M18A 2W3DA 1EWZA 3ZGAB 2HGVA 2ZLYA 2A24A 1PNEA 4D60A 4OH0A 3QNCA 1OJ5A 3PBNA 3PXPA 4FUWA 2R9WA 2V8FA 2Y2GA 4L0LA 1YT4A 5K5BA 4LRYC 3S4XA 2V1ZA 1GA0A 2KLIA 3Q7ZA 3ZVTA 3NOTC 2EWVA 4E3IA 3H7WA 3K3CA 5FI6A 4S2KA 3GR2A 3M2KA 3F1NB 5EVEA 4XUZA 5FI2A 4KG6A 3ZG0A 3T1RA 1ACFA 4ZBEA 5U47A 3MXSA 3HUOA 4H6JA 2H5SA 2VZWA 3WRTA 1BSGA 3FG8A 3TW8A 4EU0A 3ZVWA 1MBLA 1NWZA 2J3WA 3HCYA 4KZ3A 1JNUA 4LV0A 4UQIS 5FAPA 3LIEA 3LEQA 1LSWA 1PWDA 4HBTA 3U2AA 4GW9A 2WGWB 1MC0A 2ZOHA 4E3KA 2ZC4B 3HLFA 2W3EA 4UA9A 4ZJ1A 5EECA 3MF0A 3Q82A 3HJIA 4NG2A 4HBUA 4UQIM 1SKOA 2J9PA 5DVAA 5HAIA 1XFQA 2Y2KA 4OQIA 3NECA 5AQ9A 4YNRA 3CITA 4QD4A 5FDHA 5HL6A 4S2MA 5DTSA 4S2JA 4P87A 3T4TA 2P04A 2UV0E 4ZJ3A 1NXYA 3IT9A 3Q1FA 5EPHA 4MBHA 3ZFZA 1PFLA 5HWWA 3LCEA 4XT2A 3CPTA 4B9OA 2GZAA 2A2LA 4GHIB 1VHMA 4EEPA 3E98A 4OKPA 3CZDA 3AGEA 1DP9A 3UY6A 3HL9A 3SS5A 1CEFA 1AWIA 1LSVA 2H0YA 2Y2OA 3KX0X 4FSFA 1JTGA 3G6OA 4LRXC 2XLNA 4HIAA 4NK3A 4KUOA 1KGFA 1L2SA 2Y2QA 5AVFA 4CJNA 5CHUA 1OTEA 2A24B 1MKIA 3T4LA 3D9YA 2Y2MA 3GQZA 3LYXA 1ONGA 4EW7A 3EEAA 1LT0A 3FPVA 4GJ4A 2PHYA 2JC7A 3IBJA 4QWOA 1PZPA 4AFIA 2JBFA 2R78A 3A0SA 2VV6A 4HNBA 2DCFA 3IX8A 3H7WB 1L0FA 3T1SA 4PM5A 3NDEA 4R3JA 3IHBA 5CEBA 1YMXA 5FQQA 4H6JB 4WBGA 2P74A 2QKPA 4R0QA 3MZEA 3SOIA 4KZ5A 3LEZA 1MY8A
chains in the Genus database with same CATH topology
2P9VB 3MFDA 2WAFA 3G4PA 2HDUA 2XFTA 4OONA 5FI7A 4IVKA 1IYPA 3FYZA 5CHJA 4FH4A 5JYPA 2ZD8A 5EOOA 3N4IA 3ZG9B 2VGKA 3BRMA 1G6AA 1JWVA 5F82A 1ES2A 4DXBA 4GDBA 4MEZA 4OPQA 3ITBA 4LV2A 2XD1A 4GD6A 1PW8A 2WZXA 5DTTA 4FCFA 1K57C 5EE8A 4RA7A 1K55C 4BLMA 2ZQ9A 3VSLA 4DE0A 1RCJA 1GHMA 5E43A 4MBFA 2Y2JA 3O87A 1LHYA 3I7JA 5CEDA 1YLJA 1DJAA 1N4OA 4GD8A 4KZ8A 4FD8A 3GSGA 4BENA 1W7FA 3SH7A 5HARA 2QMIA 3A3JA 1H5XA 3VSKA 1GCEA 5KZHA 4ID4A 5M19A 2ZM8A 2XGNA 1GHIA 3IF6A 1E25A 4E6XA 1WE4A 1HD8A 2Y91A 4PM8A 4UHUA 5CGXA 3BM6A 4R3BA 3OPRA 1LL9A 3IXGA 2HDSA 1XP4A 3UE1A 1O7EA 2HPBA 3G35A 3ZDJA 1Y54A 1YMSA 4HESA 3TG9A 2ZC6B 3IXDA 2A49A 5D3OA 4OOYA 1PI5A 2I72A 2G2WA 3N7WA 4DF6A 3NDGA 1K4EA 5FSRA 4EUZA 3UDXA 4ZJ2A 5F1FA 3CJMA 4DKIA 1ERMA 2J9OA 4X56A 4C75A 2Y2NA 3IWQA 3PBOA 1QMFA 4JF6A 5GLBA 2IWCA 4LV1A 1ZG4A 1JWZA 3HLDA 1BLPA 1U60A 5JYOA 3VOYA 1Q2PA 4OP5A 1TDLA 2Z2MB 5AQBA 3WS0A 2EX8A 4K91A 5HL1A 3Q81A 4PMAA 3CG5A 3V5MA 1YQSA 2XH9A 4JPMA 4OLDA 4PM6A 4XXRA 2RL3A 1ES3A 4GKUA 4LCLA 1BUEA 1L0GA 3GRJA 1JWPA 1PYYA 1VM1A 3OPPA 5KSCA 4U0TA 4R23A 3BECA 4GB7A 2OLUA 1TDGA 2PBYA 5BOHA 4WEKA 2Q9MA 3M6HA 3O3VA 3ZNYA 2Y2IA 4E6WA 1YLZA 3WS4A 3VP2A 5I94A 1SKFA 1RP5A 3M2JA 3BFEA 5EUAA 1NZUA 3C7UA 2XDMA 2EXBA 1FSYA 1J9MA 4OQ0A 4WMCA 4YFMA 3VP0A 3ZG5A 5KSHA 2E8IA 2B5RA 3NC8A 5FAQA 4R4SA 3FV7A 4ZDXA 3VFHA 4EBPA 3IH9A 5DF7A 4NETA 4WMCD 2WZZA 3Q7VB 1XA7A 4YINA 3A3IA 1AXBA 4S2LA 4WZ5C 5GHXA 4BL3A 4P6BA 2C6WB 1WYCA 3V3SA 3NCKA 3LO7A 1NY0A 3G2YA 4PPRA 1PZOA 1KVMA 3IF6C 3HLEA 3BLMA 3O88A 4GOGA 4N1XA 4R4RA 4C3QA 3G34A 5EVIB 2OV5A 1RGZA 1CK3A 3QNBA 4Y0TA 1FR1A 4ZAMA 1W8QA 5FQIA 5G18A 1K54C 4QJGA 3AGFA 5GLAA 4DXCA 4B88A 3G31A 4EBLA 1H8YA 1XXMA 1KE3A 2Y4AA 2ZQ7A 1W5DA 3IWOA 2Y2PA 3PBSA 5FQ9A 2WYXA 3DWKA 1DY6A 4OPRA 4WEJA 3RXWA 2J7VA 4K0XA 3UPOA 3UO9A 1YLYA 1DJCA 1IYOA 2WADA 2ZM2A 4N9KA 2X02A 4X55A 3MXRA 2CC1A 1K4FA 3HLCA 3QHYA 4MBKA 1CEGA 1GA9A 4PM9A 4Y0OA 4E3OA 3GV9A 3D4FA 1E3UD 1NZOA 3G32A 4ZTKA 3HREA 4BD1A 3UDIA 1RGYA 4JKTA 3DTMA 3ZCZA 5E2HA 4P85A 4S2NA 4Y7PA 1HVBA 1KGEA 2WGWA 3FKVA 3IH8A 5FQJA 3TSGA 3ZG8B 2DRWA 3NY4A 1BULA 2BG1A 1Q2QA 3UN7A 3IWIA 1FCNA 5TGFA 1KGGA 5FQKA 3A3DA 5HW3A 2DNSA 4U0XA 1I5QA 5CERA 4KZBA 3BYDA 3FKWA 3FZCA 3EQVA 4RX2A 4QU3A 4EQIA 3Q07A 1SDNA 5CHMA 2ZC3B 3LY3A 5FAOA 5A92A 1KDWA 2WK0A 4S2IA 3PTEA 1ESUA 3C5AA 3VP3A 4Q8IA 2HP9A 4UA7A 1OMEA 5EVIC 3WS1A 3HUMA 3WS2A 2PU4A 4WZ4A 2JE5A 4N9LA 5CGSA 4S2PA 2FFFB 1BLSA 1BT5A 3BFGA 1PI4A 3E2LA 4B4XA 4DE3A 2ZC7A 4JBFA 1I2WA 2ZQCA 3MBZA 4IEDA 1NYMA 1HTZA 3N8SA 3IQAA 4H8RA 4FH2A 1CI9A 4X69A 5GHZA 3EQUA 4JXWA 5GLDA 1FSWA 3MKEA 3IF6B 1BTLA 4LENA 1ES5A 2XQZA 2ZQ8A 3HLBA 3UPNA 4IBRA 3SS4A 3BFDA 1SCWA 1LI9A 2HP5A 1L0DA 2VGJA 3OZHA 4MLLA 3SS3A 4QY6A 3V50A 3UNWA 2C5WB 5F83A 1S0WA 4KZ4A 2J8YA 5HX9A 3BFFA 4QB8A 4QHCA 1EROA 5A91A 3OC2A 4M3KA 4DE2A 1MWRA 4DDYA 5E2GA 5EOEA 4E3NA 5FA7A 1K6SA 2EXAA 2JCHA 2ZC5B 3WS5A 1IELA 1IYQA 1Z6FA 1MPLA 1ZG6A 3UPPA 4S2NC 1JVJA 3O86A 1H8ZA 4IVIA 4EBNA 1DJBA 1MWTA 5E2EA 1TEMA 4JXVA 3HLGA 4KG2A 1S6RA 4OOMA 3G30A 3NBLA 4P0MA 3IF5A 5FQMA 3VOZA 2XFSA 3AGDA 5AQAA 5KMWA 3WWXA 2FFYA 2QPNA 3GMWA 4KQRA 4DE1A 3ZNTA 1TVFA 1HZOA 1VQQA 1PWGA 5M18A 2WAEA 1EWZA 3A3EA 3ZGAB 3VFFA 3BEBA 2ZLYA 5L2FA 2IWDA 3BLSA 4OVDA 2G2UA 1W79A 4OH0A 1YLPA 2XF3A 3QNCA 4X68A 3HVFA 3PBNA 1PWCA 1G68A 3UDFA 1LLBA 3MZDA 2R9WA 2Y2GA 4L0LA 1YT4A 4F94A 1K57A 1K38A 1K55A 5DF8A 3S4XA 3TOIA 3OPLA 1KE0A 4GZBA 2V1ZA 1M6KA 1PIOA 2EFXA 1W8YA 3S1YA 4GNUA 2WGIA 1GA0A 1I2SA 1E3UA 3Q7ZA 3ZVTA 1IKGA 1MWSA 4JLFA 4E3IA 2Y2HA 3CMZA 4O7DA 5FI6A 4S2KA 5DTKA 1IKIA 1L0EA 3GR2A 4BQMA 5FASA 3M2KA 4E3MA 3HBRA 1WYBA 3HUNA 4WM9A 4XUZA 5FI2A 5CECA 3OCNA 2EX9A 3PBTA 4KG6A 3ZG0A 5HFOA 1PW1A 3VMAA 5GLCA 3IXBA 3ITAA 4KZ9A 3MXSA 4N1HA 4ZBEA 3HUOA 5U47A 3GVBA 2H5SA 2WUQA 3N6IA 5TR7A 3WRTA 2H10A 1BSGA 5GHYA 3NI9A 3VP4A 1FOFA 3ZVWA 1MBLA 3RJUA 3JYIA 3OCLA 2WKEA 4KZ3A 4GN2A 1NYYA 2P9VA 2V2FF 1LL5A 3DWZA 1K56D 4LV0A 4LV3A 5CXWA 1XGIA 5CGWA 5FAPA 3UE3A 3UE0A 4N92A 2ZMAA 2ZQAA 2Z2LB 2WKHA 4WYYA 2QZ6A 1PWDA 4HBTA 5CTNA 5DF9A 5GL9A 2WGWB 2Y2LA 3IXHA 1XPBA 3PBQA 4E3KA 2ZC4B 2XD5A 3HLFA 3MKFA 3M6BA 2WKIA 2UWXA 4UA9A 4ZJ1A 3RXXA 3WRZA 4B4ZA 5EECA 4UAAA 1E4DA 4JXGA 4DRTA 3Q82A 1IEMA 4C6YA 4QY5A 4HBUA 5IHVA 3P09A 1ZC2A 4OLGA 4JXSA 2J9PA 2EX6A 5DVAA 1C3BA 2X71A 4KZ6A 5HAQA 1N9BA 5HAIA 3W4OA 2Y2KA 2IWBA 2HP6A 4OQIA 1K25A 5AQ9A 3N8RA 4A5RA 1K6RA 4KZAA 1IYSA 4KQOA 3ISGA 1FCOA 4QD4A 1ES4A 3MZFA 5E2FA 1BLHA 5FDHA 4WZ5A 1MXOA 4EV4A 4S2MA 3S22A 2OSUA 5DTSA 4S2JA 5CTMA 3N8LA 4P87A 2EX2A 4OP8A 4ZJ3A 1NJ4A 1NXYA 3IT9A 4OPYA 3Q1FA 5EPHA 1ZKJA 4OOLA 4MNRA 4MBHA 3ZFZA 4E3LA 3SH9A 3V39A 2RCXA 1K54A 1EI5A 4IBXA 1SHVA 3LCEA 4K0WA 4OQHA 4RX3A 4U3TA 3W4QA 2V20A 4KG5A 5M1AA 3ZHHA 1XGJA 4CPKA 1GHPA 3IHAA 4OKPA 3CZDA 3AGEA 4D2OA 1BZAA 2Y59A 3UY6A 2XR0A 3G2ZA 2XEPA 2R9XA 3A3FA 3HL9A 5EVLA 3SS5A 1CEFA 1YLTA 4WELA 4BL2A 4S2OA 1KDSA 1YLWA 3PBRA 1NRFA 1ESIA 4X53A 2H0YA 2Y2OA 2EFUA 3LY4A 4FSFA 4X6TA 3DW0A 3SH8A 1JTGA 3VP1A 1CI8A 4Y0UA 4OQGA 2ZJ9A 2HDQA 4XUXA 2XLNA 1FR6A 4DDSA 1SDEA 1XA1A 1MWUA 4NK3A 5AQ7A 5J8XA 1KGFA 1L2SA 1ALQA 3C7VA 2Y2QA 3B3XA 3P98A 3Q7VA 4CJNA 4PM7A 5CHUA 1QMEA 1BLCA 4BJPA 1MKIA 3PAEA 3OPHA 5HAPA 4EWFA 5EVIA 2Y2MA 3NIAA 4KQQA 3GQZA 3ZG7B 1ONGA 2H0TA 2A3UA 4HEFA 2JC7A 5CRFA 2ZQDA 1PZPA 3BFCA 4Z9QA 3W8KA 3W4PA 5A93A 2JBFA 1JTDA 5EVID 4R1GA 1FQGA 1XKZA 4GDNA 2DCFA 1KE4A 3PAGA 2X01A 4E3JA 1LI0A 4UA6A 2GDNA 4BD0A 1L0FA 1K56A 4PM5A 2BLSA 3NDEA 1XX2A 4LCMA 4R3JA 4KZ7A 3E2KA 3IHBA 4JF4A 1O07A 1KVLA 5CEBA 1YMXA 1ONHA 2Q9NA 2Y55A 5FQQA 1YM1A 5F1GA 2OLVA 3GTCA 3V3RA 2ZM0A 4WBGA 2P74A 4R0QA 3MZEA 4JF5A 2HDRA 2WGVA 3FWLA 2XK1A 3C4PA 4RYEA 4KZ5A 3SOIA 5A90A 1FCMA 3LEZA 4KENB 5FATA 5TFQA 1M40A 3C4OA 1ERQA 1MY8A 4RVAA 2PU2A 3HLWA 4OPZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9V B;  3MFD A;  2WAF A;  3G4P A;  2HDU A;  2XFT A;  4OON A;  5FI7 A;  4IVK A;  1IYP A;  3FYZ A;  5CHJ A;  4FH4 A;  5JYP A;  2ZD8 A;  5EOO A;  3N4I A;  3ZG9 B;  2VGK A;  3BRM A;  1G6A A;  1JWV A;  5F82 A;  1ES2 A;  4DXB A;  4GDB A;  4MEZ A;  4OPQ A;  3ITB A;  4LV2 A;  2XD1 A;  4GD6 A;  1PW8 A;  2WZX A;  5DTT A;  4FCF A;  1K57 C;  5EE8 A;  4RA7 A;  1K55 C;  4BLM A;  2ZQ9 A;  3VSL A;  4DE0 A;  1RCJ A;  1GHM A;  5E43 A;  4MBF A;  2Y2J A;  3O87 A;  1LHY A;  3I7J A;  5CED A;  1YLJ A;  1DJA A;  1N4O A;  4GD8 A;  4KZ8 A;  4FD8 A;  3GSG A;  4BEN A;  1W7F A;  3SH7 A;  5HAR A;  2QMI A;  3A3J A;  1H5X A;  3VSK A;  1GCE A;  5KZH A;  4ID4 A;  5M19 A;  2ZM8 A;  2XGN A;  1GHI A;  3IF6 A;  1E25 A;  4E6X A;  1WE4 A;  1HD8 A;  2Y91 A;  4PM8 A;  4UHU A;  5CGX A;  3BM6 A;  4R3B A;  3OPR A;  1LL9 A;  3IXG A;  2HDS A;  1XP4 A;  3UE1 A;  1O7E A;  2HPB A;  3G35 A;  3ZDJ A;  1Y54 A;  1YMS A;  4HES A;  3TG9 A;  2ZC6 B;  3IXD A;  2A49 A;  5D3O A;  4OOY A;  1PI5 A;  2I72 A;  2G2W A;  3N7W A;  4DF6 A;  3NDG A;  1K4E A;  5FSR A;  4EUZ A;  3UDX A;  4ZJ2 A;  5F1F A;  3CJM A;  4DKI A;  1ERM A;  2J9O A;  4X56 A;  4C75 A;  2Y2N A;  3IWQ A;  3PBO A;  1QMF A;  4JF6 A;  5GLB A;  2IWC A;  4LV1 A;  1ZG4 A;  1JWZ A;  3HLD A;  1BLP A;  1U60 A;  5JYO A;  3VOY A;  1Q2P A;  4OP5 A;  1TDL A;  2Z2M B;  5AQB A;  3WS0 A;  2EX8 A;  4K91 A;  5HL1 A;  3Q81 A;  4PMA A;  3CG5 A;  3V5M A;  1YQS A;  2XH9 A;  4JPM A;  4OLD A;  4PM6 A;  4XXR A;  2RL3 A;  1ES3 A;  4GKU A;  4LCL A;  1BUE A;  1L0G A;  3GRJ A;  1JWP A;  1PYY A;  1VM1 A;  3OPP A;  5KSC A;  4U0T A;  4R23 A;  3BEC A;  4GB7 A;  2OLU A;  1TDG A;  2PBY A;  5BOH A;  4WEK A;  2Q9M A;  3M6H A;  3O3V A;  3ZNY A;  2Y2I A;  4E6W A;  1YLZ A;  3WS4 A;  3VP2 A;  5I94 A;  1SKF A;  1RP5 A;  3M2J A;  3BFE A;  5EUA A;  1NZU A;  3C7U A;  2XDM A;  2EXB A;  1FSY A;  1J9M A;  4OQ0 A;  4WMC A;  4YFM A;  3VP0 A;  3ZG5 A;  5KSH A;  2E8I A;  2B5R A;  3NC8 A;  5FAQ A;  4R4S A;  3FV7 A;  4ZDX A;  3VFH A;  4EBP A;  3IH9 A;  5DF7 A;  4NET A;  4WMC D;  2WZZ A;  3Q7V B;  1XA7 A;  4YIN A;  3A3I A;  1AXB A;  4S2L A;  4WZ5 C;  5GHX A;  4BL3 A;  4P6B A;  2C6W B;  1WYC A;  3V3S A;  3NCK A;  3LO7 A;  1NY0 A;  3G2Y A;  4PPR A;  1PZO A;  1KVM A;  3IF6 C;  3HLE A;  3BLM A;  3O88 A;  4GOG A;  4N1X A;  4R4R A;  4C3Q A;  3G34 A;  5EVI B;  2OV5 A;  1RGZ A;  1CK3 A;  3QNB A;  4Y0T A;  1FR1 A;  4ZAM A;  1W8Q A;  5FQI A;  5G18 A;  1K54 C;  4QJG A;  3AGF A;  5GLA A;  4DXC A;  4B88 A;  3G31 A;  4EBL A;  1H8Y A;  1XXM A;  1KE3 A;  2Y4A A;  2ZQ7 A;  1W5D A;  3IWO A;  2Y2P A;  3PBS A;  5FQ9 A;  2WYX A;  3DWK A;  1DY6 A;  4OPR A;  4WEJ A;  3RXW A;  2J7V A;  4K0X A;  3UPO A;  3UO9 A;  1YLY A;  1DJC A;  1IYO A;  2WAD A;  2ZM2 A;  4N9K A;  2X02 A;  4X55 A;  3MXR A;  2CC1 A;  1K4F A;  3HLC A;  3QHY A;  4MBK A;  1CEG A;  1GA9 A;  4PM9 A;  4Y0O A;  4E3O A;  3GV9 A;  3D4F A;  1E3U D;  1NZO A;  3G32 A;  4ZTK A;  3HRE A;  4BD1 A;  3UDI A;  1RGY A;  4JKT A;  3DTM A;  3ZCZ A;  5E2H A;  4P85 A;  4S2N A;  4Y7P A;  1HVB A;  1KGE A;  2WGW A;  3FKV A;  3IH8 A;  5FQJ A;  3TSG A;  3ZG8 B;  2DRW A;  3NY4 A;  1BUL A;  2BG1 A;  1Q2Q A;  3UN7 A;  3IWI A;  1FCN A;  5TGF A;  1KGG A;  5FQK A;  3A3D A;  5HW3 A;  2DNS A;  4U0X A;  1I5Q A;  5CER A;  4KZB A;  3BYD A;  3FKW A;  3FZC A;  3EQV A;  4RX2 A;  4QU3 A;  4EQI A;  3Q07 A;  1SDN A;  5CHM A;  2ZC3 B;  3LY3 A;  5FAO A;  5A92 A;  1KDW A;  2WK0 A;  4S2I A;  3PTE A;  1ESU A;  3C5A A;  3VP3 A;  4Q8I A;  2HP9 A;  4UA7 A;  1OME A;  5EVI C;  3WS1 A;  3HUM A;  3WS2 A;  2PU4 A;  4WZ4 A;  2JE5 A;  4N9L A;  5CGS A;  4S2P A;  2FFF B;  1BLS A;  1BT5 A;  3BFG A;  1PI4 A;  3E2L A;  4B4X A;  4DE3 A;  2ZC7 A;  4JBF A;  1I2W A;  2ZQC A;  3MBZ A;  4IED A;  1NYM A;  1HTZ A;  3N8S A;  3IQA A;  4H8R A;  4FH2 A;  1CI9 A;  4X69 A;  5GHZ A;  3EQU A;  4JXW A;  5GLD A;  1FSW A;  3MKE A;  3IF6 B;  1BTL A;  4LEN A;  1ES5 A;  2XQZ A;  2ZQ8 A;  3HLB A;  3UPN A;  4IBR A;  3SS4 A;  3BFD A;  1SCW A;  1LI9 A;  2HP5 A;  1L0D A;  2VGJ A;  3OZH A;  4MLL A;  3SS3 A;  4QY6 A;  3V50 A;  3UNW A;  2C5W B;  5F83 A;  1S0W A;  4KZ4 A;  2J8Y A;  5HX9 A;  3BFF A;  4QB8 A;  4QHC A;  1ERO A;  5A91 A;  3OC2 A;  4M3K A;  4DE2 A;  1MWR A;  4DDY A;  5E2G A;  5EOE A;  4E3N A;  5FA7 A;  1K6S A;  2EXA A;  2JCH A;  2ZC5 B;  3WS5 A;  1IEL A;  1IYQ A;  1Z6F A;  1MPL A;  1ZG6 A;  3UPP A;  4S2N C;  1JVJ A;  3O86 A;  1H8Z A;  4IVI A;  4EBN A;  1DJB A;  1MWT A;  5E2E A;  1TEM A;  4JXV A;  3HLG A;  4KG2 A;  1S6R A;  4OOM A;  3G30 A;  3NBL A;  4P0M A;  3IF5 A;  5FQM A;  3VOZ A;  2XFS A;  3AGD A;  5AQA A;  5KMW A;  3WWX A;  2FFY A;  2QPN A;  3GMW A;  4KQR A;  4DE1 A;  3ZNT A;  1TVF A;  1HZO A;  1VQQ A;  1PWG A;  5M18 A;  2WAE A;  1EWZ A;  3A3E A;  3ZGA B;  3VFF A;  3BEB A;  2ZLY A;  5L2F A;  2IWD A;  3BLS A;  4OVD A;  2G2U A;  1W79 A;  4OH0 A;  1YLP A;  2XF3 A;  3QNC A;  4X68 A;  3HVF A;  3PBN A;  1PWC A;  1G68 A;  3UDF A;  1LLB A;  3MZD A;  2R9W A;  2Y2G A;  4L0L A;  1YT4 A;  4F94 A;  1K57 A;  1K38 A;  1K55 A;  5DF8 A;  3S4X A;  3TOI A;  3OPL A;  1KE0 A;  4GZB A;  2V1Z A;  1M6K A;  1PIO A;  2EFX A;  1W8Y A;  3S1Y A;  4GNU A;  2WGI A;  1GA0 A;  1I2S A;  1E3U A;  3Q7Z A;  3ZVT A;  1IKG A;  1MWS A;  4JLF A;  4E3I A;  2Y2H A;  3CMZ A;  4O7D A;  5FI6 A;  4S2K A;  5DTK A;  1IKI A;  1L0E A;  3GR2 A;  4BQM A;  5FAS A;  3M2K A;  4E3M A;  3HBR A;  1WYB A;  3HUN A;  4WM9 A;  4XUZ A;  5FI2 A;  5CEC A;  3OCN A;  2EX9 A;  3PBT A;  4KG6 A;  3ZG0 A;  5HFO A;  1PW1 A;  3VMA A;  5GLC A;  3IXB A;  3ITA A;  4KZ9 A;  3MXS A;  4N1H A;  4ZBE A;  3HUO A;  5U47 A;  3GVB A;  2H5S A;  2WUQ A;  3N6I A;  5TR7 A;  3WRT A;  2H10 A;  1BSG A;  5GHY A;  3NI9 A;  3VP4 A;  1FOF A;  3ZVW A;  1MBL A;  3RJU A;  3JYI A;  3OCL A;  2WKE A;  4KZ3 A;  4GN2 A;  1NYY A;  2P9V A;  2V2F F;  1LL5 A;  3DWZ A;  1K56 D;  4LV0 A;  4LV3 A;  5CXW A;  1XGI A;  5CGW A;  5FAP A;  3UE3 A;  3UE0 A;  4N92 A;  2ZMA A;  2ZQA A;  2Z2L B;  2WKH A;  4WYY A;  2QZ6 A;  1PWD A;  4HBT A;  5CTN A;  5DF9 A;  5GL9 A;  2WGW B;  2Y2L A;  3IXH A;  1XPB A;  3PBQ A;  4E3K A;  2ZC4 B;  2XD5 A;  3HLF A;  3MKF A;  3M6B A;  2WKI A;  2UWX A;  4UA9 A;  4ZJ1 A;  3RXX A;  3WRZ A;  4B4Z A;  5EEC A;  4UAA A;  1E4D A;  4JXG A;  4DRT A;  3Q82 A;  1IEM A;  4C6Y A;  4QY5 A;  4HBU A;  5IHV A;  3P09 A;  1ZC2 A;  4OLG A;  4JXS A;  2J9P A;  2EX6 A;  5DVA A;  1C3B A;  2X71 A;  4KZ6 A;  5HAQ A;  1N9B A;  5HAI A;  3W4O A;  2Y2K A;  2IWB A;  2HP6 A;  4OQI A;  1K25 A;  5AQ9 A;  3N8R A;  4A5R A;  1K6R A;  4KZA A;  1IYS A;  4KQO A;  3ISG A;  1FCO A;  4QD4 A;  1ES4 A;  3MZF A;  5E2F A;  1BLH A;  5FDH A;  4WZ5 A;  1MXO A;  4EV4 A;  4S2M A;  3S22 A;  2OSU A;  5DTS A;  4S2J A;  5CTM A;  3N8L A;  4P87 A;  2EX2 A;  4OP8 A;  4ZJ3 A;  1NJ4 A;  1NXY A;  3IT9 A;  4OPY A;  3Q1F A;  5EPH A;  1ZKJ A;  4OOL A;  4MNR A;  4MBH A;  3ZFZ A;  4E3L A;  3SH9 A;  3V39 A;  2RCX A;  1K54 A;  1EI5 A;  4IBX A;  1SHV A;  3LCE A;  4K0W A;  4OQH A;  4RX3 A;  4U3T A;  3W4Q A;  2V20 A;  4KG5 A;  5M1A A;  3ZHH A;  1XGJ A;  4CPK A;  1GHP A;  3IHA A;  4OKP A;  3CZD A;  3AGE A;  4D2O A;  1BZA A;  2Y59 A;  3UY6 A;  2XR0 A;  3G2Z A;  2XEP A;  2R9X A;  3A3F A;  3HL9 A;  5EVL A;  3SS5 A;  1CEF A;  1YLT A;  4WEL A;  4BL2 A;  4S2O A;  1KDS A;  1YLW A;  3PBR A;  1NRF A;  1ESI A;  4X53 A;  2H0Y A;  2Y2O A;  2EFU A;  3LY4 A;  4FSF A;  4X6T A;  3DW0 A;  3SH8 A;  1JTG A;  3VP1 A;  1CI8 A;  4Y0U A;  4OQG A;  2ZJ9 A;  2HDQ A;  4XUX A;  2XLN A;  1FR6 A;  4DDS A;  1SDE A;  1XA1 A;  1MWU A;  4NK3 A;  5AQ7 A;  5J8X A;  1KGF A;  1L2S A;  1ALQ A;  3C7V A;  2Y2Q A;  3B3X A;  3P98 A;  3Q7V A;  4CJN A;  4PM7 A;  5CHU A;  1QME A;  1BLC A;  4BJP A;  1MKI A;  3PAE A;  3OPH A;  5HAP A;  4EWF A;  5EVI A;  2Y2M A;  3NIA A;  4KQQ A;  3GQZ A;  3ZG7 B;  1ONG A;  2H0T A;  2A3U A;  4HEF A;  2JC7 A;  5CRF A;  2ZQD A;  1PZP A;  3BFC A;  4Z9Q A;  3W8K A;  3W4P A;  5A93 A;  2JBF A;  1JTD A;  5EVI D;  4R1G A;  1FQG A;  1XKZ A;  4GDN A;  2DCF A;  1KE4 A;  3PAG A;  2X01 A;  4E3J A;  1LI0 A;  4UA6 A;  2GDN A;  4BD0 A;  1L0F A;  1K56 A;  4PM5 A;  2BLS A;  3NDE A;  1XX2 A;  4LCM A;  4R3J A;  4KZ7 A;  3E2K A;  3IHB A;  4JF4 A;  1O07 A;  1KVL A;  5CEB A;  1YMX A;  1ONH A;  2Q9N A;  2Y55 A;  5FQQ A;  1YM1 A;  5F1G A;  2OLV A;  3GTC A;  3V3R A;  2ZM0 A;  4WBG A;  2P74 A;  4R0Q A;  3MZE A;  4JF5 A;  2HDR A;  2WGV A;  3FWL A;  2XK1 A;  3C4P A;  4RYE A;  4KZ5 A;  3SOI A;  5A90 A;  1FCM A;  3LEZ A;  4KEN B;  5FAT A;  5TFQ A;  1M40 A;  3C4O A;  1ERQ A;  1MY8 A;  4RVA A;  2PU2 A;  3HLW A;  4OPZ A; 
#chains in the Genus database with same CATH topology
 3G4P A;  2XFT A;  4OON A;  2JKT I;  1IYP A;  2WKQ A;  2HF6 A;  3N4I A;  1JWV A;  5F82 A;  1ES2 A;  3ITB A;  4HQA A;  1PW8 A;  5EE8 A;  4RA7 A;  4DE0 A;  1RCJ A;  3I7J A;  4KZ8 A;  1N4O A;  4GD8 A;  1SKO B;  2QMI A;  4BWI A;  1H5X A;  3VSK A;  4ID4 A;  2HV1 A;  2ZM8 A;  4E6X A;  2INW A;  2HDS A;  1XP4 A;  2HPB A;  3G35 A;  3IS2 A;  2O9C A;  1TS0 A;  1TF1 A;  1X0O A;  2A49 A;  1YKD A;  5D3O A;  3DTK A;  3CJM A;  4IUK A;  3LID A;  3PBO A;  2IWC A;  4LV1 A;  1JWZ A;  3DAV A;  2B02 A;  4XT2 B;  3B33 A;  4ARZ A;  3CPT B;  5TJJ A;  5EFW A;  3VOL A;  3V5M A;  1YQS A;  3SW1 A;  4GKU A;  1BUE A;  1L0G A;  3GRJ A;  1TDG A;  5BOH A;  4WEK A;  3O3V A;  2OWH A;  3M6H A;  3MR0 A;  4Q0J A;  4JGO A;  3VP2 A;  4LRZ E;  1RP5 A;  2ZL1 A;  4WL9 A;  2EXB A;  1J9M A;  5MC7 A;  4YFM A;  3ZG5 A;  5KSH A;  1VEU A;  2GX5 A;  5FAQ A;  4EQ1 A;  3FV7 A;  5DKK A;  3VFH A;  5HD5 A;  1XA7 A;  1VET A;  4YIN A;  4S2L A;  5GHX A;  1DRM A;  2ZOI A;  5HPI A;  3HLE A;  2OV5 A;  1W8Q A;  3AGF A;  4DXC A;  2VGL S;  1XXM A;  2Y4A A;  2JN7 A;  2WYX A;  3DWK A;  3RXW A;  2J7V A;  2ZM2 A;  3FC7 A;  3MXR A;  4Y13 A;  1E3U D;  3G32 A;  4WN5 A;  3T4Q A;  1TS6 A;  5E2H A;  4P85 A;  1HVB A;  3IH8 A;  3TSG A;  2VGL M;  2BG1 A;  1FCN A;  1OTB A;  5FQK A;  2V1A A;  4U0X A;  1I5Q A;  4X1M A;  4EQI A;  4QU3 A;  3Q07 A;  3QP1 A;  5FAO A;  2GJ3 A;  3PTE A;  3C5A A;  1OME A;  2V9A A;  3MS6 A;  3A0V A;  3QP8 A;  3ZQ5 A;  3K3D A;  5G4Z A;  1BT5 A;  4WLA A;  1PI4 A;  4B4X A;  4DE3 A;  2ZC7 A;  3IBR A;  2OOL A;  1MKM A;  1TD5 A;  1NYM A;  4Y2F A;  2LB9 A;  3LI9 A;  1CI9 A;  5GLD A;  1FSW A;  2JKG A;  4MN7 A;  2IA2 A;  3HLB A;  3UME A;  2JKF A;  4QY6 A;  3UNW A;  3IS2 B;  5F83 A;  1ERO A;  5J4E A;  1MWR A;  5E2G A;  2H28 A;  5FA7 A;  2JCH A;  1Z6F A;  4O8G A;  4EBN A;  4ARZ B;  1H8Z A;  1DJB A;  1TEM A;  4JXV A;  5J3W A;  4KG2 A;  1OT6 A;  4P0M A;  5FQM A;  1Y4O A;  3QP4 A;  5AQA A;  3RH8 B;  3DTE A;  3BY9 A;  1HZO A;  2VA0 A;  5LBR A;  2WAE A;  4NXE A;  2ZL1 B;  3BEB A;  3RFB A;  1YLP A;  1SZV A;  4UEY A;  1G68 A;  1VEU B;  1P9W A;  2XA7 S;  4NXB A;  3OPL A;  4GZB A;  1M6K A;  1PIO A;  4LFU A;  1W8Y A;  2YKF A;  1VET B;  4GNU A;  2WGI A;  1MWS A;  4JLF A;  4O7D A;  5FAS A;  2VLG A;  1L0E A;  5IS1 A;  1WYB A;  2Z6D A;  1S66 L;  3JPU A;  5HFO A;  5GLC A;  4N1H A;  1OTI A;  4KZ9 A;  1H8M A;  3N6I A;  3MSH A;  2H10 A;  2XA7 M;  1Y28 A;  3NI9 A;  3VP4 A;  4MN5 A;  2WKE A;  4GN2 A;  2V2F F;  1K56 D;  3UE3 A;  2ZMA A;  4WYY A;  2QZ6 A;  4Q0H A;  4GS9 A;  3IXH A;  4LLO B;  2NUT C;  2HJE A;  4EXO A;  2VKS A;  1CF0 A;  3M6B A;  1E4D A;  4JXG A;  4C6Y A;  5IHV A;  4ETZ A;  1ZC2 A;  2EX6 A;  4KQD A;  1C3B A;  2X71 A;  5HAQ A;  3TE8 A;  3VE3 A;  2HP6 A;  1LL8 A;  1UWN X;  5E2F A;  1BLH A;  5CTM A;  4MNR A;  3V39 A;  2QWS A;  4IBX A;  4HH3 A;  2AVX A;  2V20 A;  4KG5 A;  5M1A A;  4IUH A;  3ZHH A;  1XGJ A;  4CPK A;  1VB6 A;  3IHA A;  3CUE C;  3MXQ A;  3S7N A;  1XJ2 A;  3A3F A;  5EVL A;  4WEL A;  4S2O A;  1XJ3 A;  1OJG A;  4X53 A;  4JGQ A;  2EFU A;  5F6A A;  2E8J A;  4X6T A;  3C30 A;  1CI8 A;  2ZJ9 A;  1FR6 A;  1YSQ A;  3B3X A;  1NLY A;  5HAP A;  3SZT A;  5EVI A;  3NIA A;  3ZG7 B;  3DTI A;  2WKP A;  5CRF A;  2ZQD A;  3BFC A;  3W8K A;  1IOU A;  3KSF A;  5EVI D;  3V67 A;  4R1G A;  1FQG A;  1YSP A;  1XKZ A;  2X01 A;  4UA6 A;  4Y5F A;  4HJ4 A;  1XX2 A;  3T4J A;  2OWJ A;  2PYR A;  1YPR A;  4JF4 A;  2L4R A;  1KVL A;  2Q9N A;  5F1G A;  2OLV A;  3GTC A;  2V0W A;  3W2Z A;  3C4P A;  4RYE A;  1FCM A;  2L0W A;  5FAT A;  3C4O A;  2EA9 A;  4RVA A;  3MFD A;  1PRQ A;  2VX8 A;  5EV0 A;  4IVK A;  4YWZ A;  4CLC D;  5EOO A;  4GS9 B;  2VGK A;  3BRM A;  1S1Z A;  4DXB A;  3EEH A;  1GSW A;  4LV2 A;  5DTT A;  3OOV A;  3BW6 A;  2ZQ9 A;  4L9F A;  1T1B A;  1GHM A;  5E43 A;  4MBF A;  2Y2J A;  1DJA A;  1ZTU A;  3MMH A;  4GLQ A;  5G4Y A;  5KZH A;  5FEF A;  5HD3 A;  3UB5 P;  3T4K A;  1WE4 A;  4IHQ A;  4BBU A;  2Y91 A;  3ICY A;  5FDS A;  3U4L P;  3BM6 A;  4R3B A;  1LL9 A;  3BY8 A;  3UE1 A;  3T1Q B;  1Y54 A;  4OOY A;  3C38 A;  1PI5 A;  2QJ7 A;  4EUZ A;  4ZJ2 A;  5F1F A;  4DKI A;  3O5Y A;  2Y2N A;  1QMF A;  1ZG4 A;  5JYO A;  1BLP A;  1TDL A;  5L09 A;  4F3L A;  4PMA A;  3CG5 A;  4BBV A;  2XH9 A;  4OLD A;  4XXR A;  2RL3 A;  4LCL A;  3R7W A;  3HJK A;  3BEC A;  4GB7 A;  4R3A A;  2Q9M A;  2Y2I A;  2OAQ 1;  1YLZ A;  5I94 A;  1SKF A;  4HI4 A;  3CAX A;  3KYE A;  5EUA A;  1NZU A;  3T4O A;  3NOU C;  1FSY A;  4WMC A;  3VP0 A;  2Q0O A;  4PHT A;  4ZDX A;  4EBP A;  4ZRR A;  4NET A;  4WMC D;  3A3I A;  4P6B A;  3LO7 A;  1XJ6 A;  1NY0 A;  4PPR A;  3IF6 C;  3BLM A;  5HPF A;  5EVI B;  3QNB A;  1FR1 A;  4ZAM A;  1P0Z A;  1N9L A;  2NUP C;  2K31 A;  4B88 A;  4EBL A;  1H8Y A;  2JKR M;  1KE3 A;  2ZQ7 A;  2FZ0 A;  1DY6 A;  3UPO A;  3UO9 A;  2WAD A;  1IYO A;  4N9K A;  2JHE A;  2CC1 A;  3QHY A;  4PM9 A;  1NZO A;  1G6O A;  3S7Q A;  2D01 A;  3GEC A;  4JKT A;  4Y7P A;  1KGE A;  1DP8 A;  2M1C A;  3NY4 A;  1CJF A;  5TGF A;  1S4R A;  3LR5 A;  5CER A;  2ZC3 B;  4S2I A;  4Q8I A;  3VP3 A;  3P01 A;  5EVI C;  3KYQ A;  1T1A A;  3DBA A;  4WZ4 A;  4N9L A;  1KOU A;  5CGS A;  4S2P A;  2LB5 A;  5L07 A;  3BFG A;  3E2L A;  4R6L A;  1HTZ A;  5GHZ A;  1D1J A;  1TS7 A;  2W3F A;  1BTL A;  3D3O A;  2XQZ A;  2ZQ8 A;  4IBR A;  3SS4 A;  1SCW A;  1LI9 A;  3OZH A;  2W27 A;  4MN6 A;  3B47 A;  1S0W A;  4X1L A;  3OBF A;  4CLC C;  4DMZ A;  4M3K A;  4E3N A;  1K6S A;  2EXA A;  2ZC5 B;  3WS5 A;  1IEL A;  1ZG6 A;  4S2N C;  1JVJ A;  2CMN A;  4F3L B;  3NBL A;  3VOZ A;  2XFS A;  3R7W B;  3WWX A;  2FFY A;  4DE1 A;  4G3V A;  3OLO A;  1VQQ A;  1PWG A;  4Q0I A;  3ZYT A;  3A3E A;  2GNX A;  3EOI A;  5L2F A;  2IWD A;  1J3W A;  3H9W A;  2XF3 A;  4X68 A;  3HVF A;  1PWC A;  1LLB A;  4R70 A;  1K57 A;  1K38 A;  1K55 A;  3TOI A;  2W1T A;  1LSX A;  2W1R A;  1E3U A;  2FH5 A;  1IKG A;  4RQ9 A;  2ZMV A;  3CMZ A;  4CLC E;  5DTK A;  4BQM A;  4GCZ A;  3HBR A;  4WM9 A;  3EGX C;  2EX9 A;  3PBT A;  2K2N A;  1PW1 A;  5L8M A;  3ITA A;  5F69 A;  5FL3 A;  2WUQ A;  5TR7 A;  4MMN A;  4Y17 A;  1T19 A;  3UMD A;  3LIB A;  5C5K A;  1S4S A;  3OCL A;  1V9Y A;  3DWZ A;  2BTF P;  5CXW A;  3CUE A;  3UE0 A;  4N92 A;  2WKH A;  5CTN A;  3LIF A;  3CLO A;  2Y2L A;  3TJZ C;  2XD5 A;  2VEA A;  3MKF A;  3RXX A;  3WRZ A;  4B4Z A;  4WUJ A;  4I38 A;  4UAA A;  1IEM A;  5FEG A;  1CQA A;  3P09 A;  2L1M A;  3UB9 A;  3W4O A;  2IWB A;  4EUV A;  3N8R A;  1FCO A;  4NXG A;  3MZF A;  1MXO A;  4EV4 A;  3S22 A;  2OSU A;  5KIZ A;  5DJU A;  4DJ3 A;  4FOF A;  4OP8 A;  4OPY A;  4OOL A;  1F9I A;  4E3L A;  4E04 A;  2EWW A;  3LFV A;  1SHV A;  1V9Z A;  4K0W A;  3LUQ A;  3BJN A;  4OQH A;  4RX3 A;  4U3T A;  5HDC A;  2ACG A;  4D2O A;  4JGP A;  2Y59 A;  2XR0 A;  3G2Z A;  4P6Z S;  2R9X A;  4BL2 A;  1KDS A;  3PBR A;  4BBT A;  1F98 A;  1NRF A;  3LY4 A;  3DW0 A;  3T50 A;  4I3J A;  4Y0U A;  5L10 A;  4OQG A;  5I5L A;  2HDQ A;  4XUX A;  1SDE A;  1MWU A;  5AQ7 A;  5J8X A;  1XFN A;  3C7V A;  3C8C A;  1QME A;  3LGO A;  4P6Z M;  4R38 A;  1N9N A;  3PAE A;  3OPH A;  4EWF A;  5J7E A;  1WA9 A;  5DKL A;  2H0T A;  2VK3 A;  4G3W A;  4Z9Q A;  3W4P A;  5A93 A;  2W1T B;  3KSI A;  3T12 B;  1JTD A;  3E0Y A;  4GDN A;  3MQ0 A;  5AJG A;  3PAG A;  4E3J A;  1LI0 A;  4PKY G;  3KSH A;  4BD0 A;  1K56 A;  2D02 A;  3F1O A;  2KDK A;  2BLS A;  4O01 A;  4PAU A;  4LCM A;  1O07 A;  1YAX A;  2Y55 A;  1YM1 A;  2ZM0 A;  3S7O A;  2HDR A;  2VV8 A;  3FWL A;  3QP6 A;  5TFQ A;  1M40 A;  3HLW A;  4OPZ A;  1Z09 A;  2WAF A;  2HDU A;  5FI7 A;  3FYZ A;  5JYP A;  2ZD8 A;  3ZG9 B;  1G6A A;  4GDB A;  4OPQ A;  4II7 A;  2XD1 A;  4GD6 A;  3CWF A;  3NJA A;  1K57 C;  4BLM A;  1K55 C;  3O87 A;  2B18 A;  1LHY A;  3H82 A;  5CED A;  2XSS A;  3GSG A;  4BEN A;  1W7F A;  5HAR A;  3A3J A;  1K0K A;  4HJ6 A;  3IF6 A;  2XGN A;  1GHI A;  5HSQ A;  1E25 A;  3ZDJ A;  1YMS A;  3RTY A;  3N7W A;  2J80 A;  5HDS A;  5FSR A;  1ERM A;  2J9O A;  4X56 A;  4C75 A;  3IWQ A;  4JF6 A;  5GLB A;  1U60 A;  3VOY A;  1Q2P A;  4OP5 A;  3WS0 A;  2EX8 A;  4K91 A;  3IX3 A;  5TBM A;  4X25 A;  4EET B;  2Y79 A;  4PM6 A;  1ES3 A;  3P7N A;  1PYY A;  2PBY A;  4E6W A;  3KYZ A;  3WS4 A;  3BFE A;  1FIL A;  2XDM A;  3MQO A;  2PYP A;  4OQ0 A;  2E8I A;  3NC8 A;  4R4S A;  3BQ8 A;  3MQQ A;  2O9A A;  3K2N A;  3NOP C;  3IH9 A;  4HP4 A;  5DF7 A;  2WZZ A;  3F1P A;  1AXB A;  4BL3 A;  1WYC A;  3NCK A;  3G2Y A;  4GOG A;  3S7P A;  3G34 A;  1RGZ A;  5G18 A;  3PBS A;  3IWO A;  3T4S A;  5EM0 A;  4OPR A;  4PKY A;  4K0X A;  2Z6C A;  1DJC A;  2W3G A;  3D72 A;  3HLC A;  3CI6 A;  4E3O A;  1OT9 A;  3GV9 A;  3F1O B;  2QHK A;  4ZTK A;  4CLC A;  4HOI A;  3JVV A;  1OTA A;  3BWL A;  4S2N A;  4I5S A;  3FKV A;  2BAS A;  2JKR I;  3ZG8 B;  4Z1W A;  1Q2Q A;  5HW3 A;  2DNS A;  2O0Y A;  3EQV A;  3QP5 A;  1SDN A;  3ULF A;  4DN0 A;  3LY3 A;  2ZBB A;  5A92 A;  1KDW A;  2WK0 A;  5HDD A;  4UA7 A;  3HUM A;  2PU4 A;  3IX4 A;  2PAV P;  1ODV A;  2XRO A;  3H82 B;  2ZQC A;  3MBZ A;  4IED A;  3PR6 A;  3IQA A;  4H8R A;  4FH2 A;  4X69 A;  3EQU A;  2XRN A;  4JXW A;  3L7H A;  3MKE A;  3IF6 B;  2WKR A;  3L9K A;  4LEN A;  1ES5 A;  3UPN A;  3BFD A;  2HP5 A;  3UB6 A;  3SS3 A;  2C5W B;  1F5M A;  5CX7 A;  4KZ4 A;  4K08 A;  4QB8 A;  5A91 A;  3C2W A;  4DE2 A;  5EOE A;  1MPL A;  3O86 A;  1MWT A;  3NHQ A;  1S6R A;  3G30 A;  5TBM B;  3LR4 A;  4FTX A;  5HZH A;  5KMW A;  4KQR A;  2QPN A;  3GMW A;  4EES A;  3EWK A;  3VFF A;  3BLS A;  4OVD A;  2G2U A;  1W79 A;  4O0P A;  3UDF A;  3MZD A;  1W63 M;  4F94 A;  5DF8 A;  3S1Y A;  1KE0 A;  2EFX A;  3F1P B;  3LI8 A;  4QPR A;  1I2S A;  2PRF A;  5IT5 A;  2Y2H A;  1IKI A;  4E3M A;  3HUN A;  5CEC A;  2YKH A;  3OCN A;  3E4O A;  3VMA A;  1TS8 A;  3IXB A;  3GVB A;  5DFX A;  5GHY A;  4M4X A;  1FOF A;  3RJU A;  3JYI A;  1DP6 A;  3T1X A;  4LV3 A;  5HX9 A;  1NYY A;  2P9V A;  1LL5 A;  4CLC B;  1XGI A;  5CGW A;  2PT7 A;  1HLU P;  2Z2L B;  2ZQA A;  1FIK A;  2V1B A;  5DF9 A;  1L3L A;  5GL9 A;  5F68 A;  3PBQ A;  1XPB A;  5AVE A;  2M7U A;  2KX6 A;  2WKI A;  3EGD C;  2UWX A;  2M7V A;  2HJ9 C;  4DJ2 A;  4DRT A;  4QY5 A;  3A0R A;  4EEU A;  4I3A A;  4OLG A;  4Y3I A;  4JXS A;  4KZ6 A;  1N9B A;  4LPZ A;  4HY8 A;  4G3K A;  4YOF A;  3QP2 A;  1K25 A;  4A5R A;  1K6R A;  4KZA A;  1IYS A;  4KQO A;  3ISG A;  1ES4 A;  3E4P A;  4WZ5 A;  1XJ4 A;  3N8L A;  4BMW A;  2EX2 A;  1NJ4 A;  1ZKJ A;  3SH9 A;  2RCX A;  1K54 A;  1EI5 A;  1P97 A;  3W4Q A;  4I39 A;  4ESP A;  2QJ5 A;  1GHP A;  1S67 L;  1BZA A;  2Y8H A;  2XEP A;  4MDZ A;  4NKP A;  4ETX A;  1YLT A;  2PD7 A;  1A0K A;  1GSX A;  1YLW A;  1ESI A;  5HWT A;  3SH8 A;  3VP1 A;  4ME4 A;  1UGU A;  4DDS A;  1XA1 A;  5HWV A;  2V0U A;  1ALQ A;  3E4Q A;  3P98 A;  3Q7V A;  1NRJ A;  4PM7 A;  4HP9 A;  1BLC A;  4BJP A;  1NLZ A;  1G28 A;  1T1C A;  4KQQ A;  3VE4 A;  3FPW A;  2A3U A;  4HEF A;  4HJ3 A;  5DJT A;  5F5Y A;  2W3H A;  4MCW A;  1KE4 A;  2K7S A;  1P9R A;  2GDN A;  2JKT M;  2P7J A;  4KZ7 A;  3E2K A;  1ONH A;  2DMW A;  3PHY A;  3V3R A;  1GSV A;  4JF5 A;  2WGV A;  2KOI A;  2XK1 A;  5A90 A;  4KEN B;  2J3T D;  1ERQ A;  3LR0 A;  4MLL A;  2PU2 A;  4WF0 A;  2P9V B;  4HH2 A;  5CHJ A;  4FH4 A;  1W63 Q;  1N9O A;  4MEZ A;  2WZX A;  4FCF A;  3TRC A;  3B42 A;  3VSL A;  4EER A;  2I9V A;  1YLJ A;  4FD8 A;  3SH7 A;  4B93 A;  1GCE A;  2VJW A;  5M19 A;  1HD8 A;  4PM8 A;  4UHU A;  5CGX A;  3OPR A;  3IXG A;  1O7E A;  4Y15 A;  4LGW A;  3PYP A;  4HES A;  3TG9 A;  2ZC6 B;  3IXD A;  4IJG A;  2I72 A;  4DF6 A;  2G2W A;  1H3Q A;  1K4E A;  3NDG A;  3UDX A;  3UB7 A;  1BYW A;  2OAP 1;  5GLA A;  3HLD A;  4CQH A;  3BQA A;  5AQB A;  2Z2M B;  1EW0 A;  5HL1 A;  3Q81 A;  4JPM A;  1JWP A;  1VM1 A;  2B95 A;  3OPP A;  4U0T A;  1UWP X;  4R23 A;  5KSC A;  2OLU A;  3ZNY A;  2PDR A;  3M2J A;  3C7U A;  2B5R A;  2PBD P;  2QYB A;  2G7U A;  5A8B A;  2O9B A;  3Q7V B;  3JVU A;  4WZ5 C;  1ZHH B;  2C6W B;  3NUL A;  3V3S A;  4KUK A;  4R4R A;  1PZO A;  1KVM A;  4N1X A;  4C3Q A;  3O88 A;  1CK3 A;  4Y0T A;  2MJ6 A;  3F1N A;  5FQI A;  1K54 C;  2ZMF A;  4QJG A;  3G31 A;  1W5D A;  2Y2P A;  5FQ9 A;  3MFX A;  1OPX A;  4WEJ A;  1YLY A;  2X02 A;  4X55 A;  1MZU A;  4L9E A;  1K4F A;  4MBK A;  1CEG A;  1GA9 A;  4Y0O A;  3D4F A;  1STZ A;  2P08 A;  3HRE A;  2PD8 A;  4I3I A;  4BD1 A;  1H0M A;  3UDI A;  1RGY A;  3DTM A;  3ZCZ A;  3UE6 A;  5FQJ A;  2WGW A;  4HHD A;  2DRW A;  3CHW P;  4NEE D;  1BUL A;  1OTD A;  3UN7 A;  3IWI A;  1T18 A;  1KGG A;  3A3D A;  3LIC A;  3KSG A;  4KZB A;  3BYD A;  3FKW A;  3FZC A;  3LR3 A;  5EM1 A;  4RX2 A;  2O99 A;  5CHM A;  1IFQ A;  3GDI A;  1ESU A;  2HP9 A;  2V8C A;  3WS1 A;  3WS2 A;  2JE5 A;  2FFF B;  1BLS A;  4JBF A;  1I2W A;  2PR5 A;  3N8S A;  2W0N A;  2PR6 A;  4L9G A;  2J3T C;  1L0D A;  2VGJ A;  3V50 A;  4NXF A;  4GHI A;  2J8Y A;  3BFF A;  4QHC A;  4JGR A;  3OC2 A;  3VV4 A;  4DDY A;  3MJQ A;  3R4K A;  3KO6 A;  1IYQ A;  3UPP A;  1D06 A;  3UB8 A;  4IVI A;  1D7E A;  1F2K A;  5E2E A;  4OOM A;  3HLG A;  2HZ5 A;  2VV7 A;  3IF5 A;  3LIA A;  1S1Y A;  3AGD A;  5IU1 A;  5DFY A;  1G5U A;  3ZNT A;  1TVF A;  5M18 A;  2W3D A;  1EWZ A;  3ZGA B;  2HGV A;  2ZLY A;  2A24 A;  1PNE A;  4D60 A;  4OH0 A;  3QNC A;  1OJ5 A;  3PBN A;  3PXP A;  4FUW A;  2R9W A;  2V8F A;  2Y2G A;  4L0L A;  1YT4 A;  5K5B A;  4LRY C;  3S4X A;  2V1Z A;  1GA0 A;  2KLI A;  3Q7Z A;  3ZVT A;  3NOT C;  2EWV A;  4E3I A;  3H7W A;  3K3C A;  5FI6 A;  4S2K A;  3GR2 A;  3M2K A;  3F1N B;  5EVE A;  4XUZ A;  5FI2 A;  4KG6 A;  3ZG0 A;  3T1R A;  1ACF A;  4ZBE A;  5U47 A;  3MXS A;  3HUO A;  4H6J A;  2H5S A;  2VZW A;  3WRT A;  1BSG A;  3FG8 A;  3TW8 A;  4EU0 A;  3ZVW A;  1MBL A;  1NWZ A;  2J3W A;  3HCY A;  4KZ3 A;  1JNU A;  4LV0 A;  4UQI S;  5FAP A;  3LIE A;  3LEQ A;  1LSW A;  1PWD A;  4HBT A;  3U2A A;  4GW9 A;  2WGW B;  1MC0 A;  2ZOH A;  4E3K A;  2ZC4 B;  3HLF A;  2W3E A;  4UA9 A;  4ZJ1 A;  5EEC A;  3MF0 A;  3Q82 A;  3HJI A;  4NG2 A;  4HBU A;  4UQI M;  1SKO A;  2J9P A;  5DVA A;  5HAI A;  1XFQ A;  2Y2K A;  4OQI A;  3NEC A;  5AQ9 A;  4YNR A;  3CIT A;  4QD4 A;  5FDH A;  5HL6 A;  4S2M A;  5DTS A;  4S2J A;  4P87 A;  3T4T A;  2P04 A;  2UV0 E;  4ZJ3 A;  1NXY A;  3IT9 A;  3Q1F A;  5EPH A;  4MBH A;  3ZFZ A;  1PFL A;  5HWW A;  3LCE A;  4XT2 A;  3CPT A;  4B9O A;  2GZA A;  2A2L A;  4GHI B;  1VHM A;  4EEP A;  3E98 A;  4OKP A;  3CZD A;  3AGE A;  1DP9 A;  3UY6 A;  3HL9 A;  3SS5 A;  1CEF A;  1AWI A;  1LSV A;  2H0Y A;  2Y2O A;  3KX0 X;  4FSF A;  1JTG A;  3G6O A;  4LRX C;  2XLN A;  4HIA A;  4NK3 A;  4KUO A;  1KGF A;  1L2S A;  2Y2Q A;  5AVF A;  4CJN A;  5CHU A;  1OTE A;  2A24 B;  1MKI A;  3T4L A;  3D9Y A;  2Y2M A;  3GQZ A;  3LYX A;  1ONG A;  4EW7 A;  3EEA A;  1LT0 A;  3FPV A;  4GJ4 A;  2PHY A;  2JC7 A;  3IBJ A;  4QWO A;  1PZP A;  4AFI A;  2JBF A;  2R78 A;  3A0S A;  2VV6 A;  4HNB A;  2DCF A;  3IX8 A;  3H7W B;  1L0F A;  3T1S A;  4PM5 A;  3NDE A;  4R3J A;  3IHB A;  5CEB A;  1YMX A;  5FQQ A;  4H6J B;  4WBG A;  2P74 A;  2QKP A;  4R0Q A;  3MZE A;  3SOI A;  4KZ5 A;  3LEZ A;  1MY8 A; 
#chains in the Genus database with same CATH homology
 2P9V B;  3MFD A;  2WAF A;  3G4P A;  2HDU A;  2XFT A;  4OON A;  5FI7 A;  4IVK A;  1IYP A;  3FYZ A;  5CHJ A;  4FH4 A;  5JYP A;  2ZD8 A;  5EOO A;  3N4I A;  3ZG9 B;  2VGK A;  3BRM A;  1G6A A;  1JWV A;  5F82 A;  1ES2 A;  4DXB A;  4GDB A;  4MEZ A;  4OPQ A;  3ITB A;  4LV2 A;  2XD1 A;  4GD6 A;  1PW8 A;  2WZX A;  5DTT A;  4FCF A;  1K57 C;  5EE8 A;  4RA7 A;  1K55 C;  4BLM A;  2ZQ9 A;  3VSL A;  4DE0 A;  1RCJ A;  1GHM A;  5E43 A;  4MBF A;  2Y2J A;  3O87 A;  1LHY A;  3I7J A;  5CED A;  1YLJ A;  1DJA A;  1N4O A;  4GD8 A;  4KZ8 A;  4FD8 A;  3GSG A;  4BEN A;  1W7F A;  3SH7 A;  5HAR A;  2QMI A;  3A3J A;  1H5X A;  3VSK A;  1GCE A;  5KZH A;  4ID4 A;  5M19 A;  2ZM8 A;  2XGN A;  1GHI A;  3IF6 A;  1E25 A;  4E6X A;  1WE4 A;  1HD8 A;  2Y91 A;  4PM8 A;  4UHU A;  5CGX A;  3BM6 A;  4R3B A;  3OPR A;  1LL9 A;  3IXG A;  2HDS A;  1XP4 A;  3UE1 A;  1O7E A;  2HPB A;  3G35 A;  3ZDJ A;  1Y54 A;  1YMS A;  4HES A;  3TG9 A;  2ZC6 B;  3IXD A;  2A49 A;  5D3O A;  4OOY A;  1PI5 A;  2I72 A;  2G2W A;  3N7W A;  4DF6 A;  3NDG A;  1K4E A;  5FSR A;  4EUZ A;  3UDX A;  4ZJ2 A;  5F1F A;  3CJM A;  4DKI A;  1ERM A;  2J9O A;  4X56 A;  4C75 A;  2Y2N A;  3IWQ A;  3PBO A;  1QMF A;  4JF6 A;  5GLB A;  2IWC A;  4LV1 A;  1ZG4 A;  1JWZ A;  3HLD A;  1BLP A;  1U60 A;  5JYO A;  3VOY A;  1Q2P A;  4OP5 A;  1TDL A;  2Z2M B;  5AQB A;  3WS0 A;  2EX8 A;  4K91 A;  5HL1 A;  3Q81 A;  4PMA A;  3CG5 A;  3V5M A;  1YQS A;  2XH9 A;  4JPM A;  4OLD A;  4PM6 A;  4XXR A;  2RL3 A;  1ES3 A;  4GKU A;  4LCL A;  1BUE A;  1L0G A;  3GRJ A;  1JWP A;  1PYY A;  1VM1 A;  3OPP A;  5KSC A;  4U0T A;  4R23 A;  3BEC A;  4GB7 A;  2OLU A;  1TDG A;  2PBY A;  5BOH A;  4WEK A;  2Q9M A;  3M6H A;  3O3V A;  3ZNY A;  2Y2I A;  4E6W A;  1YLZ A;  3WS4 A;  3VP2 A;  5I94 A;  1SKF A;  1RP5 A;  3M2J A;  3BFE A;  5EUA A;  1NZU A;  3C7U A;  2XDM A;  2EXB A;  1FSY A;  1J9M A;  4OQ0 A;  4WMC A;  4YFM A;  3VP0 A;  3ZG5 A;  5KSH A;  2E8I A;  2B5R A;  3NC8 A;  5FAQ A;  4R4S A;  3FV7 A;  4ZDX A;  3VFH A;  4EBP A;  3IH9 A;  5DF7 A;  4NET A;  4WMC D;  2WZZ A;  3Q7V B;  1XA7 A;  4YIN A;  3A3I A;  1AXB A;  4S2L A;  4WZ5 C;  5GHX A;  4BL3 A;  4P6B A;  2C6W B;  1WYC A;  3V3S A;  3NCK A;  3LO7 A;  1NY0 A;  3G2Y A;  4PPR A;  1PZO A;  1KVM A;  3IF6 C;  3HLE A;  3BLM A;  3O88 A;  4GOG A;  4N1X A;  4R4R A;  4C3Q A;  3G34 A;  5EVI B;  2OV5 A;  1RGZ A;  1CK3 A;  3QNB A;  4Y0T A;  1FR1 A;  4ZAM A;  1W8Q A;  5FQI A;  5G18 A;  1K54 C;  4QJG A;  3AGF A;  5GLA A;  4DXC A;  4B88 A;  3G31 A;  4EBL A;  1H8Y A;  1XXM A;  1KE3 A;  2Y4A A;  2ZQ7 A;  1W5D A;  3IWO A;  2Y2P A;  3PBS A;  5FQ9 A;  2WYX A;  3DWK A;  1DY6 A;  4OPR A;  4WEJ A;  3RXW A;  2J7V A;  4K0X A;  3UPO A;  3UO9 A;  1YLY A;  1DJC A;  1IYO A;  2WAD A;  2ZM2 A;  4N9K A;  2X02 A;  4X55 A;  3MXR A;  2CC1 A;  1K4F A;  3HLC A;  3QHY A;  4MBK A;  1CEG A;  1GA9 A;  4PM9 A;  4Y0O A;  4E3O A;  3GV9 A;  3D4F A;  1E3U D;  1NZO A;  3G32 A;  4ZTK A;  3HRE A;  4BD1 A;  3UDI A;  1RGY A;  4JKT A;  3DTM A;  3ZCZ A;  5E2H A;  4P85 A;  4S2N A;  4Y7P A;  1HVB A;  1KGE A;  2WGW A;  3FKV A;  3IH8 A;  5FQJ A;  3TSG A;  3ZG8 B;  2DRW A;  3NY4 A;  1BUL A;  2BG1 A;  1Q2Q A;  3UN7 A;  3IWI A;  1FCN A;  5TGF A;  1KGG A;  5FQK A;  3A3D A;  5HW3 A;  2DNS A;  4U0X A;  1I5Q A;  5CER A;  4KZB A;  3BYD A;  3FKW A;  3FZC A;  3EQV A;  4RX2 A;  4QU3 A;  4EQI A;  3Q07 A;  1SDN A;  5CHM A;  2ZC3 B;  3LY3 A;  5FAO A;  5A92 A;  1KDW A;  2WK0 A;  4S2I A;  3PTE A;  1ESU A;  3C5A A;  3VP3 A;  4Q8I A;  2HP9 A;  4UA7 A;  1OME A;  5EVI C;  3WS1 A;  3HUM A;  3WS2 A;  2PU4 A;  4WZ4 A;  2JE5 A;  4N9L A;  5CGS A;  4S2P A;  2FFF B;  1BLS A;  1BT5 A;  3BFG A;  1PI4 A;  3E2L A;  4B4X A;  4DE3 A;  2ZC7 A;  4JBF A;  1I2W A;  2ZQC A;  3MBZ A;  4IED A;  1NYM A;  1HTZ A;  3N8S A;  3IQA A;  4H8R A;  4FH2 A;  1CI9 A;  4X69 A;  5GHZ A;  3EQU A;  4JXW A;  5GLD A;  1FSW A;  3MKE A;  3IF6 B;  1BTL A;  4LEN A;  1ES5 A;  2XQZ A;  2ZQ8 A;  3HLB A;  3UPN A;  4IBR A;  3SS4 A;  3BFD A;  1SCW A;  1LI9 A;  2HP5 A;  1L0D A;  2VGJ A;  3OZH A;  4MLL A;  3SS3 A;  4QY6 A;  3V50 A;  3UNW A;  2C5W B;  5F83 A;  1S0W A;  4KZ4 A;  2J8Y A;  5HX9 A;  3BFF A;  4QB8 A;  4QHC A;  1ERO A;  5A91 A;  3OC2 A;  4M3K A;  4DE2 A;  1MWR A;  4DDY A;  5E2G A;  5EOE A;  4E3N A;  5FA7 A;  1K6S A;  2EXA A;  2JCH A;  2ZC5 B;  3WS5 A;  1IEL A;  1IYQ A;  1Z6F A;  1MPL A;  1ZG6 A;  3UPP A;  4S2N C;  1JVJ A;  3O86 A;  1H8Z A;  4IVI A;  4EBN A;  1DJB A;  1MWT A;  5E2E A;  1TEM A;  4JXV A;  3HLG A;  4KG2 A;  1S6R A;  4OOM A;  3G30 A;  3NBL A;  4P0M A;  3IF5 A;  5FQM A;  3VOZ A;  2XFS A;  3AGD A;  5AQA A;  5KMW A;  3WWX A;  2FFY A;  2QPN A;  3GMW A;  4KQR A;  4DE1 A;  3ZNT A;  1TVF A;  1HZO A;  1VQQ A;  1PWG A;  5M18 A;  2WAE A;  1EWZ A;  3A3E A;  3ZGA B;  3VFF A;  3BEB A;  2ZLY A;  5L2F A;  2IWD A;  3BLS A;  4OVD A;  2G2U A;  1W79 A;  4OH0 A;  1YLP A;  2XF3 A;  3QNC A;  4X68 A;  3HVF A;  3PBN A;  1PWC A;  1G68 A;  3UDF A;  1LLB A;  3MZD A;  2R9W A;  2Y2G A;  4L0L A;  1YT4 A;  4F94 A;  1K57 A;  1K38 A;  1K55 A;  5DF8 A;  3S4X A;  3TOI A;  3OPL A;  1KE0 A;  4GZB A;  2V1Z A;  1M6K A;  1PIO A;  2EFX A;  1W8Y A;  3S1Y A;  4GNU A;  2WGI A;  1GA0 A;  1I2S A;  1E3U A;  3Q7Z A;  3ZVT A;  1IKG A;  1MWS A;  4JLF A;  4E3I A;  2Y2H A;  3CMZ A;  4O7D A;  5FI6 A;  4S2K A;  5DTK A;  1IKI A;  1L0E A;  3GR2 A;  4BQM A;  5FAS A;  3M2K A;  4E3M A;  3HBR A;  1WYB A;  3HUN A;  4WM9 A;  4XUZ A;  5FI2 A;  5CEC A;  3OCN A;  2EX9 A;  3PBT A;  4KG6 A;  3ZG0 A;  5HFO A;  1PW1 A;  3VMA A;  5GLC A;  3IXB A;  3ITA A;  4KZ9 A;  3MXS A;  4N1H A;  4ZBE A;  3HUO A;  5U47 A;  3GVB A;  2H5S A;  2WUQ A;  3N6I A;  5TR7 A;  3WRT A;  2H10 A;  1BSG A;  5GHY A;  3NI9 A;  3VP4 A;  1FOF A;  3ZVW A;  1MBL A;  3RJU A;  3JYI A;  3OCL A;  2WKE A;  4KZ3 A;  4GN2 A;  1NYY A;  2P9V A;  2V2F F;  1LL5 A;  3DWZ A;  1K56 D;  4LV0 A;  4LV3 A;  5CXW A;  1XGI A;  5CGW A;  5FAP A;  3UE3 A;  3UE0 A;  4N92 A;  2ZMA A;  2ZQA A;  2Z2L B;  2WKH A;  4WYY A;  2QZ6 A;  1PWD A;  4HBT A;  5CTN A;  5DF9 A;  5GL9 A;  2WGW B;  2Y2L A;  3IXH A;  1XPB A;  3PBQ A;  4E3K A;  2ZC4 B;  2XD5 A;  3HLF A;  3MKF A;  3M6B A;  2WKI A;  2UWX A;  4UA9 A;  4ZJ1 A;  3RXX A;  3WRZ A;  4B4Z A;  5EEC A;  4UAA A;  1E4D A;  4JXG A;  4DRT A;  3Q82 A;  1IEM A;  4C6Y A;  4QY5 A;  4HBU A;  5IHV A;  3P09 A;  1ZC2 A;  4OLG A;  4JXS A;  2J9P A;  2EX6 A;  5DVA A;  1C3B A;  2X71 A;  4KZ6 A;  5HAQ A;  1N9B A;  5HAI A;  3W4O A;  2Y2K A;  2IWB A;  2HP6 A;  4OQI A;  1K25 A;  5AQ9 A;  3N8R A;  4A5R A;  1K6R A;  4KZA A;  1IYS A;  4KQO A;  3ISG A;  1FCO A;  4QD4 A;  1ES4 A;  3MZF A;  5E2F A;  1BLH A;  5FDH A;  4WZ5 A;  1MXO A;  4EV4 A;  4S2M A;  3S22 A;  2OSU A;  5DTS A;  4S2J A;  5CTM A;  3N8L A;  4P87 A;  2EX2 A;  4OP8 A;  4ZJ3 A;  1NJ4 A;  1NXY A;  3IT9 A;  4OPY A;  3Q1F A;  5EPH A;  1ZKJ A;  4OOL A;  4MNR A;  4MBH A;  3ZFZ A;  4E3L A;  3SH9 A;  3V39 A;  2RCX A;  1K54 A;  1EI5 A;  4IBX A;  1SHV A;  3LCE A;  4K0W A;  4OQH A;  4RX3 A;  4U3T A;  3W4Q A;  2V20 A;  4KG5 A;  5M1A A;  3ZHH A;  1XGJ A;  4CPK A;  1GHP A;  3IHA A;  4OKP A;  3CZD A;  3AGE A;  4D2O A;  1BZA A;  2Y59 A;  3UY6 A;  2XR0 A;  3G2Z A;  2XEP A;  2R9X A;  3A3F A;  3HL9 A;  5EVL A;  3SS5 A;  1CEF A;  1YLT A;  4WEL A;  4BL2 A;  4S2O A;  1KDS A;  1YLW A;  3PBR A;  1NRF A;  1ESI A;  4X53 A;  2H0Y A;  2Y2O A;  2EFU A;  3LY4 A;  4FSF A;  4X6T A;  3DW0 A;  3SH8 A;  1JTG A;  3VP1 A;  1CI8 A;  4Y0U A;  4OQG A;  2ZJ9 A;  2HDQ A;  4XUX A;  2XLN A;  1FR6 A;  4DDS A;  1SDE A;  1XA1 A;  1MWU A;  4NK3 A;  5AQ7 A;  5J8X A;  1KGF A;  1L2S A;  1ALQ A;  3C7V A;  2Y2Q A;  3B3X A;  3P98 A;  3Q7V A;  4CJN A;  4PM7 A;  5CHU A;  1QME A;  1BLC A;  4BJP A;  1MKI A;  3PAE A;  3OPH A;  5HAP A;  4EWF A;  5EVI A;  2Y2M A;  3NIA A;  4KQQ A;  3GQZ A;  3ZG7 B;  1ONG A;  2H0T A;  2A3U A;  4HEF A;  2JC7 A;  5CRF A;  2ZQD A;  1PZP A;  3BFC A;  4Z9Q A;  3W8K A;  3W4P A;  5A93 A;  2JBF A;  1JTD A;  5EVI D;  4R1G A;  1FQG A;  1XKZ A;  4GDN A;  2DCF A;  1KE4 A;  3PAG A;  2X01 A;  4E3J A;  1LI0 A;  4UA6 A;  2GDN A;  4BD0 A;  1L0F A;  1K56 A;  4PM5 A;  2BLS A;  3NDE A;  1XX2 A;  4LCM A;  4R3J A;  4KZ7 A;  3E2K A;  3IHB A;  4JF4 A;  1O07 A;  1KVL A;  5CEB A;  1YMX A;  1ONH A;  2Q9N A;  2Y55 A;  5FQQ A;  1YM1 A;  5F1G A;  2OLV A;  3GTC A;  3V3R A;  2ZM0 A;  4WBG A;  2P74 A;  4R0Q A;  3MZE A;  4JF5 A;  2HDR A;  2WGV A;  3FWL A;  2XK1 A;  3C4P A;  4RYE A;  4KZ5 A;  3SOI A;  5A90 A;  1FCM A;  3LEZ A;  4KEN B;  5FAT A;  5TFQ A;  1M40 A;  3C4O A;  1ERQ A;  1MY8 A;  4RVA A;  2PU2 A;  3HLW A;  4OPZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...