1LL5A

X-ray crystal structure of ampc wt beta-lactamase in complex with covalently bound imipenem
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
358
structure length
351
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Imipenem Inhibition of Class C beta-lactamases
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords beta-lactamase
total genus 113
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2002-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 1ll5A00
5FQJA 5HL1A 1YT4A 2WAEA 3ZG0A 4BL2A 2XF3A 1K4FA 3ITBA 5EVIB 2ZM2A 5BOHA 2JBFA 4A5RA 2Y2NA 1FSWA 3G30A 1ES5A 2P9VB 4R0QA 1ONHA 2ZQ8A 3NBLA 1YQSA 4OH0A 5L2FA 2Y2JA 4GDBA 1DY6A 1PZOA 3BLSA 4KQOA 1PI5A 1KVMA 3OCNA 4ZAMA 1JWVA 5GLBA 3BFEA 1YM1A 2I72A 2WZXA 4FH4A 2RCXA 5GHXA 3HBRA 1XPBA 3WWXA 2QMIA 3FKVA 5FI7A 2IWDA 4GD6A 3IXHA 3N4IA 3WRZA 1K25A 3N7WA 2A3UA 4WM9A 3ZG9B 3Q81A 4C6YA 4GD8A 2HDUA 4OOMA 1OMEA 1TDGA 3MKEA 3OPHA 1KDWA 5FASA 3GR2A 3HLFA 2ZQAA 2EX6A 3S22A 3FYZA 4R3BA 1XXMA 2ZC7A 4BD1A 2JC7A 4LCMA 5TR7A 3O3VA 2Y2MA 1KGGA 3FV7A 2E8IA 5M1AA 4KZAA 1SKFA 3GQZA 4RX2A 3SS3A 4OQGA 4E3IA 4EUZA 2EXBA 4EBNA 4KZ3A 3IF6A 5IHVA 3VFFA 5DTKA 2GDNA 4OLDA 3ZDJA 1W5DA 3G4PA 3FKWA 5DF8A 2ZLYA 2BLSA 2EX9A 3IWQA 1SDNA 2PBYA 5J8XA 1IKIA 4YFMA 4EV4A 3WS4A 4X55A 4MBFA 4DXBA 4XXRA 2HDSA 1NXYA 4LV2A 5EUAA 3LCEA 2VGJA 3W4QA 4EQIA 1DJAA 3NIAA 1K57C 3WS5A 3SOIA 2H0TA 4Z9QA 3SH8A 4ZTKA 4LV1A 5CGWA 3C4OA 4S2PA 2ZQDA 1KE3A 3G35A 3BFGA 4Y0OA 2OLVA 2WGWA 1K55C 3O88A 4C75A 3OPPA 3Q07A 2WZZA 4DE3A 3AGEA 1MWUA 4H8RA 3VOZA 1IEMA 1GHMA 1S0WA 1PWGA 4Y0UA 4WEKA 3SH9A 3VMAA 1BLPA 5GLAA 1MWTA 1PWCA 1MWRA 3VFHA 3V39A 1L0DA 4FH2A 1EROA 5HAQA 2XLNA 4L0LA 1U60A 3IF6C 4RVAA 3SS4A 4LCLA 2WKHA 5DF9A 3A3DA 1XP4A 3FZCA 1RGZA 2Y2LA 2JCHA 1IYSA 4XUZA 5AQBA 1MXOA 1FQGA 5A93A 2J9PA 1BLSA 4IEDA 5CRFA 5M18A 1W8YA 4RA7A 4OPQA 1NYMA 3E2KA 3MBZA 2EXAA 4FSFA 4KG2A 3PBNA 4NK3A 4P87A 4PM9A 3GMWA 3NY4A 2Y2IA 5DF7A 3A3IA 3M2KA 5D3OA 3TG9A 1L2SA 1KGFA 1SHVA 3Q7VB 1I5QA 1YLJA 5DTTA 1K6RA 2JE5A 3DW0A 3LY3A 3QNCA 4O7DA 5FQ9A 4K0XA 1GCEA 3IF6B 5FQMA 3CJMA 4MBHA 4PPRA 4OPYA 2HDQA 1HZOA 4PM6A 2IWCA 4ZJ3A 4QJGA 5CTMA 2H0YA 5FAQA 3EQUA 3QNBA 3NDGA 3VSKA 1K56D 1BZAA 2WGVA 5DVAA 1O7EA 3BM6A 5CHJA 3SH7A 3ZG8B 1N9BA 1W79A 1VQQA 5HFOA 5AQ7A 3N8RA 4KQRA 3V50A 3HUOA 3UDXA 3ZVTA 4GKUA 1QMFA 1IYOA 1JVJA 3Q1FA 4IVKA 1L0GA 5HAPA 2ZM0A 4R1GA 4GN2A 3OPLA 1JTGA 5I94A 5FSRA 5FQKA 2QZ6A 3C7UA 1WE4A 4UHUA 5GLDA 3OZHA 5A90A 3HREA 3EQVA 4KZ9A 4OONA 4JF5A 5KMWA 1LL9A 4WMCD 2G2WA 2EFUA 3N8SA 4WZ5C 4S2IA 4E3NA 4E6XA 4DE2A 3UPNA 1JWPA 1TDLA 4X6TA 4N92A 2DCFA 3WS1A 3NDEA 4OPZA 3VP0A 2WADA 3M6BA 2X71A 5JYOA 4DE0A 4JXVA 5GL9A 3DTMA 4GOGA 3DWKA 2H10A 1ALQA 4K0WA 4BL3A 2ZMAA 1CEGA 2WYXA 3RXXA 4KQQA 3Q7ZA 2OV5A 1YLPA 5M19A 2V1ZA 4RYEA 2J8YA 5CXWA 2XD5A 3PAGA 4QY5A 2HP5A 3MZDA 4P0MA 3ZNTA 4LV3A 1ZKJA 5HARA 1BTLA 2XQZA 2Y2PA 3VSLA 1ERQA 2Y91A 1ZG4A 4E3JA 3S4XA 1PW1A 4RX3A 2H5SA 4N9LA 2X01A 3LY4A 4PM7A 3WS2A 2XGNA 1XX2A 4IBRA 4Y7PA 2XR0A 3IF5A 1XGIA 5E2EA 4E3MA 4S2OA 3G2ZA 1FCNA 2XDMA 4CJNA 2B5RA 1XA7A 4OLGA 2BG1A 5CERA 4E3KA 1M40A 4X56A 3HL9A 2X02A 5F1GA 3IHAA 1BSGA 4JXSA 4S2MA 1IELA 1Y54A 3N6IA 1ERMA 4JXWA 3BEBA 5TGFA 1YMXA 4QU3A 3V5MA 2QPNA 5FA7A 1K56A 2UWXA 1XGJA 2ZC5B 4WEJA 3A3EA 3FWLA 4K91A 4OQIA 4JBFA 3ZG7B 1KVLA 1BLHA 5KZHA 4QY6A 2VGKA 4KZ6A 3G32A 1XKZA 2ZC4B 3NC8A 4N1HA 4BQMA 3N8LA 4Y0TA 4IBXA 1Z6FA 2Z2LB 1BLCA 3PBSA 5HAIA 4X68A 2WKEA 1PIOA 2PU4A 5CGXA 5E2HA 3HLGA 4EWFA 3GSGA 3P09A 3G34A 2FFFB 5F1FA 4FCFA 3ISGA 2G2UA 3BLMA 3W8KA 3PBTA 3LO7A 3UPPA 4KG5A 1LI0A 2Q9NA 3O86A 4N1XA 4R23A 2R9WA 4KZBA 4KZ5A 3B3XA 4U0TA 1O07A 1AXBA 2Y2GA 1FOFA 4E6WA 1G6AA 1TVFA 3MFDA 1G68A 2Y2QA 1GA9A 5EVIC 1PI4A 2ZQCA 3GTCA 4EBPA 1ZC2A 5GLCA 4JPMA 3MXRA 4OKPA 3GV9A 4LENA 4M3KA 5EECA 1Q2PA 3IH8A 5F82A 3TOIA 4S2LA 1H8ZA 1K55A 4R4SA 3O87A 4B88A 1HVBA 1GHPA 4U3TA 2CC1A 2HPBA 5CECA 3HLWA 4DE1A 3AGFA 3P98A 4S2NC 3ZCZA 5CHUA 4ZBEA 3IWOA 3VP4A 1J9MA 3IQAA 5KSCA 1RP5A 3ZFZA 5CEDA 2WGWB 3NI9A 4LV0A 1YLWA 1PZPA 4DXCA 5CHMA 3JYIA 5FI2A 4FD8A 5CGSA 3HUMA 1GA0A 3MKFA 4MLLA 1JWZA 4OPRA 4KENB 3VP3A 3ZGAB 1PYYA 1HD8A 2HP9A 1H5XA 1KGEA 4EBLA 4HBTA 2XFTA 1FR6A 1LLBA 2C6WB 1K54C 2ZJ9A 3M2JA 4Q8IA 3UE1A 5JYPA 5EPHA 3UE0A 5A91A 1YMSA 4KZ8A 1ES4A 4JKTA 2XD1A 2XK1A 4MEZA 1E3UD 1RCJA 3C5AA 4DKIA 2WKIA 3Q7VA 3OPRA 1NZUA 2PU2A 2Y2HA 1BULA 4JXGA 1W8QA 1K57A 2HP6A 2J9OA 3GVBA 4IVIA 1M6KA 3UN7A 3UNWA 5AQ9A 1KE0A 1XA1A 5F83A 4OOLA 1RGYA 3QHYA 4B4ZA 2WGIA 2V20A 3V3SA 1LL5A 3PBRA 1ESUA 4DDSA 2Z2MB 3PBQA 3ZG5A 4DDYA 2ZM8A 3G31A 2R9XA 1CI9A 3CG5A 2EFXA 3OCLA 4DRTA 2RL3A 4HBUA 5HW3A 3IXBA 1FSYA 3ITAA 3TSGA 3UDFA 1NZOA 4DF6A 2XH9A 3I7JA 1EI5A 5FDHA 3IXDA 1K54A 3ZHHA 1FCMA 1WYCA 3DWZA 1I2WA 3BFFA 4OVDA 5FI6A 5EE8A 3VOYA 4WZ5A 3C7VA 5FATA 2DNSA 4WYYA 2OSUA 1L0FA 2HDRA 3HLBA 4OOYA 3V3RA 3WS0A 1MWSA 4UA7A 2P9VA 2ZC3B 1NRFA 4E3OA 2ZQ7A 4BLMA 4BENA 1YLTA 3PBOA 3D4FA 1QMEA 1I2SA 1MBLA 2V2FF 3IT9A 1IKGA 1ESIA 4P6BA 3MXSA 4GB7A 4OQ0A 1NYYA 4YINA 3Q82A 1C3BA 3PTEA 5CTNA 2XFSA 4JF6A 1K4EA 2Y2KA 5EOOA 1CI8A 4X69A 1DJCA 1FCOA 4MNRA 1S6RA 1ONGA 1H8YA 2ZC6B 4X53A 4XUXA 4WZ4A 4BJPA 5KSHA 1BUEA 2C5WB 4KG6A 3AGDA 3G2YA 4OP8A 1Q2QA 4UA9A 2ZQ9A 3A3FA 4S2NA 4OQHA 3PAEA 4HEFA 3ZNYA 4PM8A 4KZ4A 1TEMA 3MZEA 5FQQA 1YLYA 4U0XA 5GHYA 5HX9A 3IH9A 3UDIA 1IYPA 4PM5A 5CEBA 4E3LA 2FFYA 4B4XA 3C4PA 1ES3A 4C3QA 5AQAA 2Y59A 1K6SA 1BT5A 4WMCA 4R4RA 2XEPA 1E25A 4UAAA 4ZJ1A 1CEFA 3E2LA 4S2JA 2OLUA 3RXWA 5E2GA 4R3JA 3BECA 2P74A 3LEZA 4HESA 4OP5A 4WBGA 3NCKA 1NY0A 4S2KA 3RJUA 2J7VA 1MPLA 2EX8A 3A3JA 4D2OA 1VM1A 3BFDA 3UO9A 1NJ4A 5TFQA 4GDNA 4KZ7A 4ID4A 4N9KA 4QB8A 1HTZA 5U47A 3VP1A 4ZDXA 1E4DA 4P85A 4PMAA 1KE4A 4JF4A 4QHCA 1JTDA 5G18A 3CZDA 2A49A 1PW8A 3GRJA 5EVLA 4JLFA 5FAPA 3UY6A 3OC2A 3HLCA 1CK3A 3IXGA 2Y4AA 3BFCA 3WRTA 5E2FA 3UPOA 3SS5A 1MY8A 3W4OA 3HLDA 4MBKA 1K38A 3CMZA 3M6HA 3MZFA 4ZJ2A 1SDEA 1ZG6A 1FR1A 3W4PA 5EOEA 1EWZA 1KDSA 4F94A 5EVID 4UA6A 5EVIA 2Q9MA 3IHBA 1LI9A 5FAOA 4CPKA 2WK0A 1PWDA 1GHIA 2WAFA 2Y2OA 3BYDA 3UE3A 1N4OA 1WYBA 2Y55A 1ES2A 5GHZA 4GNUA 5E43A 3VP2A 3BRMA 3HLEA 4QD4A 4GZBA 3HVFA 3IWIA 5FQIA 3S1YA 4WELA 1L0EA 1E3UA 1DJBA 1LHYA 3HUNA 1MKIA 2ZD8A 2WUQA 4NETA 2EX2A 5A92A 1W7FA 1IYQA 2DRWA 4BD0A 5DTSA 3ZVWA 2IWBA 1SCWA 1YLZA
chains in the Genus database with same CATH superfamily
3CLOA 1YT4A 3ITBA 5EVIB 3KSFA 4A5RA 1FSWA 3PHYA 4I3JA 1YAXA 4CLCB 4GHIB 2P9VB 4M4XA 2ZQ8A 4NXGA 1T18A 1PZOA 4KQOA 1KVMA 4KQDA 4D60A 4EXOA 1YM1A 2I72A 2VEAA 2W1TB 3P01A 2V1AA 5FI7A 4GD6A 5C5KA 4Q0HA 3EGXC 4EEUA 4JGOA 3C8CA 2ZQAA 4R3BA 2K2NA 1XXMA 2ZC7A 2JC7A 1KGGA 2VV8A 1SKFA 3GQZA 3CITA 4EUZA 2OWHA 5HSQA 2GDNA 4OLDA 3FKWA 5DF8A 3T1QB 2PBYA 3WS4A 4LV2A 5EUAA 3QP2A 2BTFP 3W4QA 2O9BA 4EQIA 4ZTKA 3C4OA 2OLVA 1K55C 2VGLS 3OPPA 3AGEA 3VOZA 5GLAA 1PWCA 1MWRA 1L0DA 4FOFA 5HDSA 4Y3IA 3DTKA 5AQBA 3LR0A 2QKPA 1NYMA 3E2KA 2EXAA 2V8FA 3PBNA 4EW7A 3GMWA 2QJ5A 3M2KA 1L2SA 3Q7VB 1YLJA 1TF1A 4O7DA 4GS9B 4K0XA 1GCEA 3QP4A 3BW6A 3IX4A 5G4YA 2HDQA 4PM6A 3LGOA 4ZJ3A 3VSKA 3EQUA 5JYOA 3BM6A 5CHJA 2O9CA 1W79A 2GNXA 4ESPA 3B47A 4KQRA 1S66L 5EV0A 3V50A 2FH5A 3MS6A 3FPVA 3Q1FA 4IVKA 1L0GA 2ZM0A 1GSVA 3OPLA 2ZMVA 1VEUB 2QZ6A 5A90A 1LL9A 4WMCD 3RFBA 2G2WA 3N8SA 2ZOIA 4S2IA 4E3NA 4DE2A 5DKLA 1L3LA 4OPZA 2X71A 3K2NA 5GL9A 1PRQA 2Z6DA 5EM1A 2ZBBA 2YKHA 4K0WA 1JNUA 1CEGA 4X1MA 3EGDC 4KQQA 1OJ5A 2JN7A 1IOUA 3ZNTA 1NWZA 2XQZA 3U4LP 2Y2PA 3T1SA 4AFIA 1GSWA 4FTXA 4PM7A 3LYXA 5AJGA 3IF5A 4E3MA 3C2WA 4CJNA 1XA7A 4OLGA 5CERA 1M40A 3HL9A 5F1GA 3T4QA 2PHYA 3MF0A 1Y54A 1ERMA 4HH2A 3BY8A 3K3DA 1LL8A 2UWXA 1XGJA 3SZTA 1W63Q 3D9YA 1SKOA 4WUJA 3ZG7B 1KVLA 4QY6A 4KZ6A 4ARZA 3G32A 2ZC4B 3NC8A 3VOLA 3ZYTA 4N1HA 3N8LA 4NXEA 1BLCA 3S7PA 4X68A 2PU4A 5CGXA 5E2HA 5F1FA 3GSGA 2G2UA 3W8KA 3NECA 3H9WA 2JKRM 2FZ0A 3NOPC 1AXBA 4PAUA 1V9YA 4E6WA 1GA9A 3GTCA 3MXRA 4OKPA 4M3KA 1Q2PA 5F82A 1K55A 4R4SA 4B88A 3IBRA 3AGFA 2GX5A 4HI4A 2B02A 1VEUA 5CEDA 3MSHA 1PZPA 3T4JA 5CGSA 3MKFA 1PYYA 1XJ4A 1KGEA 4EBLA 2XFTA 3LIEA 4Q8IA 5EPHA 4KZ8A 2M1CA 1E3UD 1RCJA 1S4SA 3Q7VA 3OPRA 2PU2A 2Y2HA 2PYRA 5TBMB 4JXGA 3UN7A 1M6KA 4CLCE 1RGYA 2WGIA 3V3SA 3F1PB 3PBQA 4PHTA 2ZM8A 4X25A 3IXBA 3TSGA 1OT6A 5HPFA 1I2WA 5J4EA 1UWNX 2DNSA 2VX8A 4R6LA 4K08A 2PR5A 4BLMA 4BENA 3D4FA 1I2SA 1MBLA 4Y2FA 3IT9A 4P6BA 4YINA 3A0SA 4MCWA 2XFSA 4JF6A 1CI8A 1FCOA 4XUXA 1S6RA 5TJJA 3T4TA 2W3EA 4X53A 2A24B 4BJPA 5KSHA 3G2YA 1G6OA 5L07A 4OP8A 1Q2QA 2ZQ9A 3PAEA 4HEFA 4LPZA 3QP8A 3MZEA 5FQQA 3T50A 5GHYA 4PM5A 3IH9A 1IYPA 2R78A 4E3LA 3C4PA 4C3QA 5AQAA 4WMCA 4UAAA 3RXWA 5E2GA 2PDRA 5HDDA 2Q0OA 3RJUA 4BBTA 3PYPA 3RH8B 3BFDA 3UO9A 1NJ4A 2W1TA 5TFQA 4N9KA 1E4DA 4FUWA 4JF4A 5EVLA 5FAPA 3OC2A 1CK3A 4EERA 3WRTA 3HLDA 4GHIA 4ME4A 2Z6CA 1LSXA 3EEHA 3CI6A 5EVIA 2Q9MA 2KX6A 2WAFA 3IX3A 1WYBA 1ES2A 4GNUA 5E43A 3D3OA 4QD4A 1P9RA 3HVFA 3IWIA 5EM0A 3V67A 1DJBA 1MKIA 2ZD8A 4P6ZS 1F98A 2ZMFA 1OTIA 4I39A 5FQJA 2WAEA 2XF3A 1K4FA 1LSVA 4NXBA 2ZM2A 5BOHA 3G30A 4HJ4A 1YPRA 1Y4OA 4IUKA 3ULFA 4IJGA 1ES5A 4R0QA 2K31A 1ONHA 4GDBA 1DY6A 1PI5A 3OCNA 1JWVA 2WZXA 4FH4A 3WWXA 2A3UA 4WM9A 3ZG9B 1TDGA 3VE3A 1OT9A 5FASA 3S22A 3UB8A 4R70A 1MC0A 4LCMA 3O3VA 5M1AA 1Z09A 4RX2A 4HH3A 4EBNA 3BQAA 3ZDJA 1W5DA 2ZLYA 1SDNA 4EV4A 4MBFA 2HDSA 2J80A 1DJAA 3WS5A 1K57C 4EU0A 4HOIA 5CGWA 4NKPA 2JHEA 2WGWA 4NG2A 3SH9A 3VMAA 4WEKA 2JKTI 3VFHA 1MZUA 4L0LA 3IF6C 5EFWA 2VKSA 1RGZA 2Y2LA 5A93A 3KYEA 2J9PA 1BLSA 4IEDA 5CRFA 5IT5A 4RA7A 4HHDA 4NK3A 4FSFA 3NY4A 2Y2IA 5D3OA 1KGFA 5DTTA 2JE5A 5FQ9A 2UV0E 3IF6B 5FQMA 1MKMA 2P08A 4GS9A 1HZOA 2JKRI 4QJGA 1S1YA 1O7EA 3ZG8B 4BMWA 2KDKA 1Y28A 3HUOA 3MR0A 3CHWP 5HAPA 4R1GA 5FQKA 5LBRA 3ICYA 3C7UA 5GLDA 1DRMA 4KZ9A 5KMWA 4JF5A 3KYQA 4B9OA 2EFUA 4O0PA 4MDZA 1P97A 3UPNA 1OJGA 4X6TA 5HPIA 2WADA 1BYWA 3IX8A 4HP9A 1NLZA 2ZMAA 2WYXA 2V8CA 2OV5A 5M19A 2V1ZA 4RYEA 4IUHA 3PAGA 3MZDA 3PR6A 2EA9A 3EWKA 5HARA 4LRYC 3UMDA 2VA0A 2K7SA 4E3JA 2H5SA 4N9LA 3NJAA 4Y7PA 2O99A 2LB5A 3G2ZA 2XDMA 4LLOB 2B5RA 4E3KA 3IHAA 1BSGA 1TS7A 2BASA 4JXSA 4S2MA 1IELA 1YMXA 4MN6A 3HCYA 3S7NA 3VV4A 4K91A 4OQIA 2VGKA 5I5LA 3MFXA 3E4QA 4G3VA 4IBXA 1Z6FA 1PIOA 1UGUA 3HLGA 3P09A 2FFFB 4FCFA 4CLCA 3BLMA 3C38A 3O86A 4XT2A 4LRXC 4KZBA 4U0TA 1O07A 1G6AA 1TVFA 1PFLA 4EBPA 4JPMA 5EECA 3IH8A 4S2LA 1GHPA 4U3TA 2CC1A 1PNEA 3HLWA 3P98A 1CQAA 3IWOA 2MJ6A 3VP4A 3IQAA 5FEGA 2JKGA 5KSCA 1RP5A 1OTDA 1FIKA 4BBVA 4DXCA 3IS2A 1YSPA 1P0ZA 3HUMA 4OPRA 3T1RA 4KENB 3ZGAB 1FR6A 1LLBA 2C6WB 3UE1A 5JYPA 4KUOA 3A0VA 1YMSA 2HGVA 2XA7S 2WKIA 1NZUA 3NOTC 1BULA 1W8QA 1XJ2A 2J9OA 3GVBA 1UWPX 3E98A 4OOLA 4B4ZA 2V20A 1IFQA 1LL5A 4Z1WA 2Z2MB 2R9XA 1CI9A 5DKKA 1HLUP 3OCLA 4H6JB 1EW0A 1FSYA 4UEYA 4YNRA 4BBUA 3I7JA 1FCMA 3DWZA 4OVDA 3C7VA 3LIDA 5FATA 2OSUA 1L0FA 3HLBA 4OOYA 3V3RA 3WS0A 1MWSA 4UA7A 4GJ4A 2ZQ7A 1OTEA 3DBAA 5IU1A 2EWVA 2V2FF 1IKGA 3MXSA 3S7OA 5HWWA 2PD7A 2VZWA 4MNRA 1VETB 3UMEA 3MJQA 4EEPA 5FEFA 1WA9A 3A3FA 3ZNYA 1ODVA 1YLYA 5HX9A 5CEBA 1BT5A 3MMHA 3NCKA 3HJKA 3OBFA 4PKYA 2J7VA 1MPLA 2EX8A 3GECA 4QB8A 4ID4A 2QJ7A 1HTZA 5U47A 2IA2A 4P85A 3CZDA 1F5MA 3GRJA 2PBDP 3UY6A 2Y4AA 5A8BA 3BFCA 3UPOA 3SS5A 1MY8A 4MBKA 3GDIA 3M6HA 4ZJ2A 1CJFA 3KSGA 1KDSA 4F94A 5EVID 2NUTC 5FAOA 1PWDA 1F9IA 1GHIA 2WKPA 5HWTA 2Y55A 3LUQA 3BRMA 3HLEA 4GZBA 2CMNA 2OAP1 3S1YA 1S1ZA 1E3UA 1J3WA 1W7FA 1IYQA 2P7JA 1YLZA 5HL1A 1D06A 3ZG0A 4BL2A 3R7WA 2JBFA 2Y2NA 2HJEA 5MC7A 3VE4A 3NBLA 3H82B 5L2FA 2Y2JA 2J3TD 4WLAA 4ZAMA 1GSXA 5GLBA 3BFEA 2VV7A 3UE6A 3BJNA 2QMIA 3FKVA 4H6JA 2ZL1A 3IXHA 3KSIA 1K25A 3Q81A 4C6YA 2HDUA 1OMEA 3LI8A 3GR2A 2EX6A 3FYZA 3A0RA 2M7UA 4BD1A 3CPTB 5TR7A 2Y2MA 3F1NA 3FV7A 2E8IA 2I9VA 3SS3A 4OQGA 2EXBA 1VB6A 5IHVA 2BLSA 1IKIA 4YFMA 4X55A 4DXBA 1KOUA 3JVUA 1OPXA 5K5BA 1NXYA 4QWOA 3LCEA 1T19A 3IBJA 4Z9QA 3SH8A 4S2PA 2ZQDA 3O88A 3BQ8A 1MWUA 1N9OA 1N9NA 1IEMA 3DTIA 4DN0A 1BLPA 3NULA 4ETZA 3V39A 2PD8A 4FH2A 1EROA 4GW9A 5HAQA 3T4SA 1U60A 4RVAA 3C30A 5DF9A 4UQIM 3A3DA 3FZCA 1IYSA 3EEAA 1MXOA 1P9WA 1W8YA 4XT2B 4P87A 3MBZA 4PM9A 4KG2A 3TG9A 5DFYA 1SHVA 1I5QA 3RTYA 1K6RA 3DW0A 3QNCA 2A2LA 5F6AA 4WN5A 4MBHA 4PPRA 4OPYA 2IWCA 5CTMA 2H0YA 2B95A 3F1NB 3QNBA 3FPWA 3NDGA 1K56D 1BZAA 4LRZE 5DVAA 1VQQA 5HFOA 5AQ7A 3N8RA 2XROA 4YWZA 1JVJA 4GN2A 1JTGA 5FSRA 4I3AA 1WE4A 4NXFA 3OZHA 3EQVA 2V0WA 2YKFA 4E6XA 1JWPA 1TDLA 4N92A 2DCFA 3WS1A 3NDEA 3VP0A 3M6BA 4JXVA 2VK3A 1W63M 4GOGA 2H10A 2PR6A 3KYZA 1YLPA 1XJ6A 2VLGA 2J8YA 5CXWA 4HJ3A 1YKDA 2XD5A 4QY5A 2HP5A 4LV3A 1V9ZA 1H0MA 1BTLA 2L1MA 4II7A 2XA7M 3O5YA 1ERQA 1TS6A 2VGLM 1PW1A 4RX3A 2Y8HA 2X01A 3LY4A 4I38A 1XX2A 5HWVA 4MN7A 1XGIA 5E2EA 4S2OA 1FCNA 4HQAA 4HY8A 4X56A 2X02A 4YOFA 3LIAA 4JXWA 3BEBA 2B18A 4QU3A 2QPNA 4G3WA 4Q0JA 5AVFA 2ZC5B 4WEJA 2V0UA 4EQ1A 4JBFA 5KZHA 1BLHA 1XKZA 4Y0TA 1A0KA 3PBSA 4RQ9A 1YSQA 3BY9A 2WKEA 4ZRRA 4CLCC 3MXQA 3PBTA 3LO7A 4KG5A 1LI0A 2Q9NA 2R9WA 2ZOHA 3B3XA 4DJ3A 2PRFA 2XSSA 2Y2QA 5EVIC 2ZQCA 3TRCA 5AVEA 5GLCA 3L9KA 3LFVA 4LENA 1D1JA 3O87A 2O9AA 1OTBA 4DE1A 3F1OA 4S2NC 3ZCZA 5HL6A 1VETA 3ZFZA 2WGWB 3NI9A 2GZAA 3UB5P 4LV0A 1YLWA 3LICA 5CHMA 4FD8A 2G7UA 1N9LA 3T4KA 3VP3A 5L09A 2HP9A 4HBTA 3T4LA 3H7WA 1K54C 3DAVA 3M2JA 2E8JA 5A91A 2XD1A 2XK1A 4MEZA 5FDSA 4DKIA 3C5AA 2QWSA 1K57A 2HP6A 3UNWA 4L9EA 3E4OA 3JVVA 1K0KA 3UB7A 3PBRA 4DDSA 1ESUA 3ZG5A 4DDYA 3G31A 3CG5A 4DRTA 2RL3A 4HBUA 3EOIA 4CLCD 5HW3A 3LIBA 5F69A 3ITAA 3CWFA 3UDFA 1NZOA 4DF6A 1EI5A 2QYBA 3B33A 4GLQA 5HD3A 3ZHHA 3W2ZA 3BFFA 5FI6A 3VOYA 2L0WA 4L9GA 4WYYA 2HDRA 4Q0IA 3LR5A 2W3GA 2ZC3B 1NRFA 3G6OA 3S7QA 5J3WA 3U2AA 2OWJA 1YLTA 3PBOA 1QMEA 1CF0A 3Q82A 1DP8A 2L4RA 5CTNA 2W3DA 5FL3A 1K4EA 1TD5A 2PAVP 4X69A 1DJCA 4JGPA 5EOOA 1ONGA 2W3FA 4WZ4A 4O01A 4JGRA 1NLYA 2O0YA 1BUEA 4HIAA 4KG6A 3AGDA 4UA9A 4S2NA 4NEED 4PM8A 4MMNA 4KZ4A 1TEMA 2FFYA 4B4XA 3CPTA 1DP9A 2Y59A 1K6SA 3KO6A 4R4RA 5HZHA 4S2JA 2OLUA 4R3JA 3BECA 3LEZA 4HESA 4OP5A 4S2KA 4G3KA 3A3JA 3D72A 5DJTA 4D2OA 1VM1A 2ZL1B 3SW1A 4GDNA 4KZ7A 4KUKA 4PMAA 1KE4A 5F68A 4QHCA 5G18A 2A49A 4JLFA 1TS8A 3H7WB 1K38A 1SDEA 5HDCA 5EOEA 4WF0A 1EWZA 2WKRA 5L8MA 4LFUA 4UA6A 3IHBA 2HZ5A 2Y2OA 3BYDA 3UE3A 2DMWA 1N4OA 5GHZA 3VP2A 3F1OB 2XRNA 1T1CA 1L0EA 1LHYA 5A92A 2A24A 4L9FA 3OLOA 4BD0A 5DTSA 3ZVWA 2IWBA 3ZQ5A 2AVXA 4IHQA 2HJ9C 2OOLA 2ACGA 1ACFA 3E4PA 4EUVA 4OH0A 1YQSA 1G5UA 3BLSA 2QHKA 3DTEA 2RCXA 5GHXA 3HBRA 1XPBA 1NRJA 2PYPA 2IWDA 3N4IA 3WRZA 1ZTUA 3N7WA 4PKYG 5L10A 4GD8A 1S4RA 4OOMA 3MKEA 3OPHA 3T4OA 1KDWA 3HLFA 2W27A 4CQHA 5TBMA 4P6ZM 4KZAA 3MQOA 4E3IA 1ZHHB 4KZ3A 3IF6A 3VFFA 5DTKA 3G4PA 2EX9A 3IWQA 5J8XA 5EVEA 4I5SA 4XXRA 5J7EA 2KLIA 2VGJA 5DJUA 3NIAA 3UB6A 3SOIA 2H0TA 2LB9A 4LV1A 3LR4A 5F5YA 1KE3A 3G35A 3BFGA 4Y0OA 4Y13A 4C75A 3Q07A 2WZZA 4DE3A 4QPRA 3CUEA 4H8RA 2W0NA 1GHMA 1S0WA 1PWGA 4Y0UA 1MWTA 4LGWA 2XLNA 2J3WA 3SS4A 4LCLA 2WKHA 1XP4A 2JCHA 4XUZA 2HV1A 1FQGA 5M18A 4O8GA 3LR3A 4OPQA 2Y79A 5DF7A 3A3IA 3LY3A 4HJ6A 5KIZA 4UQIS 2HF6A 3CJMA 4JGQA 3KX0X 3TJZC 5FAQA 2WGVA 3SH7A 3TE8A 1N9BA 3HJIA 2P04A 1F2KA 3UDXA 3LEQA 4GKUA 3ZVTA 1QMFA 1IYOA 4GCZA 5I94A 3P7NA 3FC7A 4UHUA 1XFNA 3HREA 4OONA 4WZ5C 4R38A 5CX7A 4DE0A 4I3IA 3DTMA 3DWKA 1ALQA 4BL3A 3RXXA 4HNBA 3Q7ZA 1TS0A 1SZVA 4P0MA 1ZKJA 1OTAA 4ETXA 3OOVA 3VSLA 2Y91A 1ZG4A 3S4XA 3MQQA 3WS2A 2XGNA 4IBRA 5G4ZA 2XR0A 1FILA 2BG1A 2W1RA 2JKTM 3N6IA 5TGFA 3V5MA 5FA7A 2KOIA 1K56A 2H28A 3A3EA 3FWLA 1LSWA 4BQMA 3QP6A 4Y17A 3R4KA 2Z2LB 2VJWA 3H82A 5HAIA 1STZA 4EWFA 1T1AA 3G34A 3ISGA 3UPPA 2WKQA 4N1XA 4R23A 3R7WB 4KZ5A 1X0OA 2Y2GA 1FOFA 3MFDA 1H8MA 1G68A 1PI4A 1ZC2A 3GV9A 3TOIA 1H8ZA 2VV6A 1HVBA 1DP6A 4EETB 2HPBA 5CECA 1XFQA 5CHUA 4ZBEA 3FG8A 1J9MA 4WL9A 4BWIA 3MQ0A 2V1BA 4DMZA 3KSHA 2EWWA 3JYIA 5FI2A 1GA0A 4MLLA 1JWZA 1HD8A 1H5XA 2NUPC 4X1LA 3QP1A 3BWLA 1VHMA 3TW8A 2ZJ9A 4EESA 3UE0A 1ES4A 4JKTA 1S67L 2PT7A 1T1BA 4B93A 2D01A 3T1XA 4MN5A 4IVIA 5AQ9A 1KE0A 3F1PA 1XA1A 5F83A 3QHYA 4E04A 2EFXA 3QP5A 2XH9A 5FDHA 2GJ3A 3IXDA 1K54A 1WYCA 5IS1A 5EE8A 3PXPA 4WZ5A 2P9VA 4E3OA 4Y5FA 1G28A 1ESIA 4GB7A 4OQ0A 1NYYA 3UB9A 1C3BA 3PTEA 2W3HA 2Y2KA 2ZC6B 1H8YA 4F3LB 2C5WB 4HP4A 4R3AA 4DJ2A 2J3TC 3LIFA 4OQHA 3NHQA 4U0XA 3UDIA 2JKFA 1ES3A 2D02A 2M7VA 5HD5A 4ZJ1A 2XEPA 1E25A 3K3CA 1CEFA 3E2LA 2INWA 1XJ3A 3CAXA 2P74A 3E0YA 4WBGA 1AWIA 1NY0A 3CUEC 4ZDXA 3VP1A 1JTDA 1D7EA 1PW8A 4ARZB 3HLCA 3IXGA 1SKOB 3T12B 5E2FA 3LI9A 3W4OA 3CMZA 3MZFA 5DFXA 3L7HA 1LT0A 1ZG6A 1FR1A 3W4PA 2OAQ1 3IS2B 1LI9A 4CPKA 2WK0A 2V9AA 5FQIA 4Y15A 1H3QA 4WELA 3JPUA 4F3LA 3HUNA 4NETA 2WUQA 2EX2A 3NOUC 2DRWA 3B42A 1SCWA
chains in the Genus database with same CATH topology
5FQJA 5HL1A 1YT4A 2WAEA 3ZG0A 4BL2A 2XF3A 1K4FA 3ITBA 5EVIB 2ZM2A 5BOHA 2JBFA 4A5RA 2Y2NA 1FSWA 3G30A 1ES5A 2P9VB 4R0QA 1ONHA 2ZQ8A 3NBLA 1YQSA 4OH0A 5L2FA 2Y2JA 4GDBA 1DY6A 1PZOA 3BLSA 4KQOA 1PI5A 1KVMA 3OCNA 4ZAMA 1JWVA 5GLBA 3BFEA 1YM1A 2I72A 2WZXA 4FH4A 2RCXA 5GHXA 3HBRA 1XPBA 3WWXA 2QMIA 3FKVA 5FI7A 2IWDA 4GD6A 3IXHA 3N4IA 3WRZA 1K25A 3N7WA 2A3UA 4WM9A 3ZG9B 3Q81A 4C6YA 4GD8A 2HDUA 4OOMA 1OMEA 1TDGA 3MKEA 3OPHA 1KDWA 5FASA 3GR2A 3HLFA 2ZQAA 2EX6A 3S22A 3FYZA 4R3BA 1XXMA 2ZC7A 4BD1A 2JC7A 4LCMA 5TR7A 3O3VA 2Y2MA 1KGGA 3FV7A 2E8IA 5M1AA 4KZAA 1SKFA 3GQZA 4RX2A 3SS3A 4OQGA 4E3IA 4EUZA 2EXBA 4EBNA 4KZ3A 3IF6A 5IHVA 3VFFA 5DTKA 2GDNA 4OLDA 3ZDJA 1W5DA 3G4PA 3FKWA 5DF8A 2ZLYA 2BLSA 2EX9A 3IWQA 1SDNA 2PBYA 5J8XA 1IKIA 4YFMA 4EV4A 3WS4A 4X55A 4MBFA 4DXBA 4XXRA 2HDSA 1NXYA 4LV2A 5EUAA 3LCEA 2VGJA 3W4QA 4EQIA 1DJAA 3NIAA 1K57C 3WS5A 3SOIA 2H0TA 4Z9QA 3SH8A 4ZTKA 4LV1A 5CGWA 3C4OA 4S2PA 2ZQDA 1KE3A 3G35A 3BFGA 4Y0OA 2OLVA 2WGWA 1K55C 3O88A 4C75A 3OPPA 3Q07A 2WZZA 4DE3A 3AGEA 1MWUA 4H8RA 3VOZA 1IEMA 1GHMA 1S0WA 1PWGA 4Y0UA 4WEKA 3SH9A 3VMAA 1BLPA 5GLAA 1MWTA 1PWCA 1MWRA 3VFHA 3V39A 1L0DA 4FH2A 1EROA 5HAQA 2XLNA 4L0LA 1U60A 3IF6C 4RVAA 3SS4A 4LCLA 2WKHA 5DF9A 3A3DA 1XP4A 3FZCA 1RGZA 2Y2LA 2JCHA 1IYSA 4XUZA 5AQBA 1MXOA 1FQGA 5A93A 2J9PA 1BLSA 4IEDA 5CRFA 5M18A 1W8YA 4RA7A 4OPQA 1NYMA 3E2KA 3MBZA 2EXAA 4FSFA 4KG2A 3PBNA 4NK3A 4P87A 4PM9A 3GMWA 3NY4A 2Y2IA 5DF7A 3A3IA 3M2KA 5D3OA 3TG9A 1L2SA 1KGFA 1SHVA 3Q7VB 1I5QA 1YLJA 5DTTA 1K6RA 2JE5A 3DW0A 3LY3A 3QNCA 4O7DA 5FQ9A 4K0XA 1GCEA 3IF6B 5FQMA 3CJMA 4MBHA 4PPRA 4OPYA 2HDQA 1HZOA 4PM6A 2IWCA 4ZJ3A 4QJGA 5CTMA 2H0YA 5FAQA 3EQUA 3QNBA 3NDGA 3VSKA 1K56D 1BZAA 2WGVA 5DVAA 1O7EA 3BM6A 5CHJA 3SH7A 3ZG8B 1N9BA 1W79A 1VQQA 5HFOA 5AQ7A 3N8RA 4KQRA 3V50A 3HUOA 3UDXA 3ZVTA 4GKUA 1QMFA 1IYOA 1JVJA 3Q1FA 4IVKA 1L0GA 5HAPA 2ZM0A 4R1GA 4GN2A 3OPLA 1JTGA 5I94A 5FSRA 5FQKA 2QZ6A 3C7UA 1WE4A 4UHUA 5GLDA 3OZHA 5A90A 3HREA 3EQVA 4KZ9A 4OONA 4JF5A 5KMWA 1LL9A 4WMCD 2G2WA 2EFUA 3N8SA 4WZ5C 4S2IA 4E3NA 4E6XA 4DE2A 3UPNA 1JWPA 1TDLA 4X6TA 4N92A 2DCFA 3WS1A 3NDEA 4OPZA 3VP0A 2WADA 3M6BA 2X71A 5JYOA 4DE0A 4JXVA 5GL9A 3DTMA 4GOGA 3DWKA 2H10A 1ALQA 4K0WA 4BL3A 2ZMAA 1CEGA 2WYXA 3RXXA 4KQQA 3Q7ZA 2OV5A 1YLPA 5M19A 2V1ZA 4RYEA 2J8YA 5CXWA 2XD5A 3PAGA 4QY5A 2HP5A 3MZDA 4P0MA 3ZNTA 4LV3A 1ZKJA 5HARA 1BTLA 2XQZA 2Y2PA 3VSLA 1ERQA 2Y91A 1ZG4A 4E3JA 3S4XA 1PW1A 4RX3A 2H5SA 4N9LA 2X01A 3LY4A 4PM7A 3WS2A 2XGNA 1XX2A 4IBRA 4Y7PA 2XR0A 3IF5A 1XGIA 5E2EA 4E3MA 4S2OA 3G2ZA 1FCNA 2XDMA 4CJNA 2B5RA 1XA7A 4OLGA 2BG1A 5CERA 4E3KA 1M40A 4X56A 3HL9A 2X02A 5F1GA 3IHAA 1BSGA 4JXSA 4S2MA 1IELA 1Y54A 3N6IA 1ERMA 4JXWA 3BEBA 5TGFA 1YMXA 4QU3A 3V5MA 2QPNA 5FA7A 1K56A 2UWXA 1XGJA 2ZC5B 4WEJA 3A3EA 3FWLA 4K91A 4OQIA 4JBFA 3ZG7B 1KVLA 1BLHA 5KZHA 4QY6A 2VGKA 4KZ6A 3G32A 1XKZA 2ZC4B 3NC8A 4N1HA 4BQMA 3N8LA 4Y0TA 4IBXA 1Z6FA 2Z2LB 1BLCA 3PBSA 5HAIA 4X68A 2WKEA 1PIOA 2PU4A 5CGXA 5E2HA 3HLGA 4EWFA 3GSGA 3P09A 3G34A 2FFFB 5F1FA 4FCFA 3ISGA 2G2UA 3BLMA 3W8KA 3PBTA 3LO7A 3UPPA 4KG5A 1LI0A 2Q9NA 3O86A 4N1XA 4R23A 2R9WA 4KZBA 4KZ5A 3B3XA 4U0TA 1O07A 1AXBA 2Y2GA 1FOFA 4E6WA 1G6AA 1TVFA 3MFDA 1G68A 2Y2QA 1GA9A 5EVIC 1PI4A 2ZQCA 3GTCA 4EBPA 1ZC2A 5GLCA 4JPMA 3MXRA 4OKPA 3GV9A 4LENA 4M3KA 5EECA 1Q2PA 3IH8A 5F82A 3TOIA 4S2LA 1H8ZA 1K55A 4R4SA 3O87A 4B88A 1HVBA 1GHPA 4U3TA 2CC1A 2HPBA 5CECA 3HLWA 4DE1A 3AGFA 3P98A 4S2NC 3ZCZA 5CHUA 4ZBEA 3IWOA 3VP4A 1J9MA 3IQAA 5KSCA 1RP5A 3ZFZA 5CEDA 2WGWB 3NI9A 4LV0A 1YLWA 1PZPA 4DXCA 5CHMA 3JYIA 5FI2A 4FD8A 5CGSA 3HUMA 1GA0A 3MKFA 4MLLA 1JWZA 4OPRA 4KENB 3VP3A 3ZGAB 1PYYA 1HD8A 2HP9A 1H5XA 1KGEA 4EBLA 4HBTA 2XFTA 1FR6A 1LLBA 2C6WB 1K54C 2ZJ9A 3M2JA 4Q8IA 3UE1A 5JYPA 5EPHA 3UE0A 5A91A 1YMSA 4KZ8A 1ES4A 4JKTA 2XD1A 2XK1A 4MEZA 1E3UD 1RCJA 3C5AA 4DKIA 2WKIA 3Q7VA 3OPRA 1NZUA 2PU2A 2Y2HA 1BULA 4JXGA 1W8QA 1K57A 2HP6A 2J9OA 3GVBA 4IVIA 1M6KA 3UN7A 3UNWA 5AQ9A 1KE0A 1XA1A 5F83A 4OOLA 1RGYA 3QHYA 4B4ZA 2WGIA 2V20A 3V3SA 1LL5A 3PBRA 1ESUA 4DDSA 2Z2MB 3PBQA 3ZG5A 4DDYA 2ZM8A 3G31A 2R9XA 1CI9A 3CG5A 2EFXA 3OCLA 4DRTA 2RL3A 4HBUA 5HW3A 3IXBA 1FSYA 3ITAA 3TSGA 3UDFA 1NZOA 4DF6A 2XH9A 3I7JA 1EI5A 5FDHA 3IXDA 1K54A 3ZHHA 1FCMA 1WYCA 3DWZA 1I2WA 3BFFA 4OVDA 5FI6A 5EE8A 3VOYA 4WZ5A 3C7VA 5FATA 2DNSA 4WYYA 2OSUA 1L0FA 2HDRA 3HLBA 4OOYA 3V3RA 3WS0A 1MWSA 4UA7A 2P9VA 2ZC3B 1NRFA 4E3OA 2ZQ7A 4BLMA 4BENA 1YLTA 3PBOA 3D4FA 1QMEA 1I2SA 1MBLA 2V2FF 3IT9A 1IKGA 1ESIA 4P6BA 3MXSA 4GB7A 4OQ0A 1NYYA 4YINA 3Q82A 1C3BA 3PTEA 5CTNA 2XFSA 4JF6A 1K4EA 2Y2KA 5EOOA 1CI8A 4X69A 1DJCA 1FCOA 4MNRA 1S6RA 1ONGA 1H8YA 2ZC6B 4X53A 4XUXA 4WZ4A 4BJPA 5KSHA 1BUEA 2C5WB 4KG6A 3AGDA 3G2YA 4OP8A 1Q2QA 4UA9A 2ZQ9A 3A3FA 4S2NA 4OQHA 3PAEA 4HEFA 3ZNYA 4PM8A 4KZ4A 1TEMA 3MZEA 5FQQA 1YLYA 4U0XA 5GHYA 5HX9A 3IH9A 3UDIA 1IYPA 4PM5A 5CEBA 4E3LA 2FFYA 4B4XA 3C4PA 1ES3A 4C3QA 5AQAA 2Y59A 1K6SA 1BT5A 4WMCA 4R4RA 2XEPA 1E25A 4UAAA 4ZJ1A 1CEFA 3E2LA 4S2JA 2OLUA 3RXWA 5E2GA 4R3JA 3BECA 2P74A 3LEZA 4HESA 4OP5A 4WBGA 3NCKA 1NY0A 4S2KA 3RJUA 2J7VA 1MPLA 2EX8A 3A3JA 4D2OA 1VM1A 3BFDA 3UO9A 1NJ4A 5TFQA 4GDNA 4KZ7A 4ID4A 4N9KA 4QB8A 1HTZA 5U47A 3VP1A 4ZDXA 1E4DA 4P85A 4PMAA 1KE4A 4JF4A 4QHCA 1JTDA 5G18A 3CZDA 2A49A 1PW8A 3GRJA 5EVLA 4JLFA 5FAPA 3UY6A 3OC2A 3HLCA 1CK3A 3IXGA 2Y4AA 3BFCA 3WRTA 5E2FA 3UPOA 3SS5A 1MY8A 3W4OA 3HLDA 4MBKA 1K38A 3CMZA 3M6HA 3MZFA 4ZJ2A 1SDEA 1ZG6A 1FR1A 3W4PA 5EOEA 1EWZA 1KDSA 4F94A 5EVID 4UA6A 5EVIA 2Q9MA 3IHBA 1LI9A 5FAOA 4CPKA 2WK0A 1PWDA 1GHIA 2WAFA 2Y2OA 3BYDA 3UE3A 1N4OA 1WYBA 2Y55A 1ES2A 5GHZA 4GNUA 5E43A 3VP2A 3BRMA 3HLEA 4QD4A 4GZBA 3HVFA 3IWIA 5FQIA 3S1YA 4WELA 1L0EA 1E3UA 1DJBA 1LHYA 3HUNA 1MKIA 2ZD8A 2WUQA 4NETA 2EX2A 5A92A 1W7FA 1IYQA 2DRWA 4BD0A 5DTSA 3ZVWA 2IWBA 1SCWA 1YLZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FQJ A;  5HL1 A;  1YT4 A;  2WAE A;  3ZG0 A;  4BL2 A;  2XF3 A;  1K4F A;  3ITB A;  5EVI B;  2ZM2 A;  5BOH A;  2JBF A;  4A5R A;  2Y2N A;  1FSW A;  3G30 A;  1ES5 A;  2P9V B;  4R0Q A;  1ONH A;  2ZQ8 A;  3NBL A;  1YQS A;  4OH0 A;  5L2F A;  2Y2J A;  4GDB A;  1DY6 A;  1PZO A;  3BLS A;  4KQO A;  1PI5 A;  1KVM A;  3OCN A;  4ZAM A;  1JWV A;  5GLB A;  3BFE A;  1YM1 A;  2I72 A;  2WZX A;  4FH4 A;  2RCX A;  5GHX A;  3HBR A;  1XPB A;  3WWX A;  2QMI A;  3FKV A;  5FI7 A;  2IWD A;  4GD6 A;  3IXH A;  3N4I A;  3WRZ A;  1K25 A;  3N7W A;  2A3U A;  4WM9 A;  3ZG9 B;  3Q81 A;  4C6Y A;  4GD8 A;  2HDU A;  4OOM A;  1OME A;  1TDG A;  3MKE A;  3OPH A;  1KDW A;  5FAS A;  3GR2 A;  3HLF A;  2ZQA A;  2EX6 A;  3S22 A;  3FYZ A;  4R3B A;  1XXM A;  2ZC7 A;  4BD1 A;  2JC7 A;  4LCM A;  5TR7 A;  3O3V A;  2Y2M A;  1KGG A;  3FV7 A;  2E8I A;  5M1A A;  4KZA A;  1SKF A;  3GQZ A;  4RX2 A;  3SS3 A;  4OQG A;  4E3I A;  4EUZ A;  2EXB A;  4EBN A;  4KZ3 A;  3IF6 A;  5IHV A;  3VFF A;  5DTK A;  2GDN A;  4OLD A;  3ZDJ A;  1W5D A;  3G4P A;  3FKW A;  5DF8 A;  2ZLY A;  2BLS A;  2EX9 A;  3IWQ A;  1SDN A;  2PBY A;  5J8X A;  1IKI A;  4YFM A;  4EV4 A;  3WS4 A;  4X55 A;  4MBF A;  4DXB A;  4XXR A;  2HDS A;  1NXY A;  4LV2 A;  5EUA A;  3LCE A;  2VGJ A;  3W4Q A;  4EQI A;  1DJA A;  3NIA A;  1K57 C;  3WS5 A;  3SOI A;  2H0T A;  4Z9Q A;  3SH8 A;  4ZTK A;  4LV1 A;  5CGW A;  3C4O A;  4S2P A;  2ZQD A;  1KE3 A;  3G35 A;  3BFG A;  4Y0O A;  2OLV A;  2WGW A;  1K55 C;  3O88 A;  4C75 A;  3OPP A;  3Q07 A;  2WZZ A;  4DE3 A;  3AGE A;  1MWU A;  4H8R A;  3VOZ A;  1IEM A;  1GHM A;  1S0W A;  1PWG A;  4Y0U A;  4WEK A;  3SH9 A;  3VMA A;  1BLP A;  5GLA A;  1MWT A;  1PWC A;  1MWR A;  3VFH A;  3V39 A;  1L0D A;  4FH2 A;  1ERO A;  5HAQ A;  2XLN A;  4L0L A;  1U60 A;  3IF6 C;  4RVA A;  3SS4 A;  4LCL A;  2WKH A;  5DF9 A;  3A3D A;  1XP4 A;  3FZC A;  1RGZ A;  2Y2L A;  2JCH A;  1IYS A;  4XUZ A;  5AQB A;  1MXO A;  1FQG A;  5A93 A;  2J9P A;  1BLS A;  4IED A;  5CRF A;  5M18 A;  1W8Y A;  4RA7 A;  4OPQ A;  1NYM A;  3E2K A;  3MBZ A;  2EXA A;  4FSF A;  4KG2 A;  3PBN A;  4NK3 A;  4P87 A;  4PM9 A;  3GMW A;  3NY4 A;  2Y2I A;  5DF7 A;  3A3I A;  3M2K A;  5D3O A;  3TG9 A;  1L2S A;  1KGF A;  1SHV A;  3Q7V B;  1I5Q A;  1YLJ A;  5DTT A;  1K6R A;  2JE5 A;  3DW0 A;  3LY3 A;  3QNC A;  4O7D A;  5FQ9 A;  4K0X A;  1GCE A;  3IF6 B;  5FQM A;  3CJM A;  4MBH A;  4PPR A;  4OPY A;  2HDQ A;  1HZO A;  4PM6 A;  2IWC A;  4ZJ3 A;  4QJG A;  5CTM A;  2H0Y A;  5FAQ A;  3EQU A;  3QNB A;  3NDG A;  3VSK A;  1K56 D;  1BZA A;  2WGV A;  5DVA A;  1O7E A;  3BM6 A;  5CHJ A;  3SH7 A;  3ZG8 B;  1N9B A;  1W79 A;  1VQQ A;  5HFO A;  5AQ7 A;  3N8R A;  4KQR A;  3V50 A;  3HUO A;  3UDX A;  3ZVT A;  4GKU A;  1QMF A;  1IYO A;  1JVJ A;  3Q1F A;  4IVK A;  1L0G A;  5HAP A;  2ZM0 A;  4R1G A;  4GN2 A;  3OPL A;  1JTG A;  5I94 A;  5FSR A;  5FQK A;  2QZ6 A;  3C7U A;  1WE4 A;  4UHU A;  5GLD A;  3OZH A;  5A90 A;  3HRE A;  3EQV A;  4KZ9 A;  4OON A;  4JF5 A;  5KMW A;  1LL9 A;  4WMC D;  2G2W A;  2EFU A;  3N8S A;  4WZ5 C;  4S2I A;  4E3N A;  4E6X A;  4DE2 A;  3UPN A;  1JWP A;  1TDL A;  4X6T A;  4N92 A;  2DCF A;  3WS1 A;  3NDE A;  4OPZ A;  3VP0 A;  2WAD A;  3M6B A;  2X71 A;  5JYO A;  4DE0 A;  4JXV A;  5GL9 A;  3DTM A;  4GOG A;  3DWK A;  2H10 A;  1ALQ A;  4K0W A;  4BL3 A;  2ZMA A;  1CEG A;  2WYX A;  3RXX A;  4KQQ A;  3Q7Z A;  2OV5 A;  1YLP A;  5M19 A;  2V1Z A;  4RYE A;  2J8Y A;  5CXW A;  2XD5 A;  3PAG A;  4QY5 A;  2HP5 A;  3MZD A;  4P0M A;  3ZNT A;  4LV3 A;  1ZKJ A;  5HAR A;  1BTL A;  2XQZ A;  2Y2P A;  3VSL A;  1ERQ A;  2Y91 A;  1ZG4 A;  4E3J A;  3S4X A;  1PW1 A;  4RX3 A;  2H5S A;  4N9L A;  2X01 A;  3LY4 A;  4PM7 A;  3WS2 A;  2XGN A;  1XX2 A;  4IBR A;  4Y7P A;  2XR0 A;  3IF5 A;  1XGI A;  5E2E A;  4E3M A;  4S2O A;  3G2Z A;  1FCN A;  2XDM A;  4CJN A;  2B5R A;  1XA7 A;  4OLG A;  2BG1 A;  5CER A;  4E3K A;  1M40 A;  4X56 A;  3HL9 A;  2X02 A;  5F1G A;  3IHA A;  1BSG A;  4JXS A;  4S2M A;  1IEL A;  1Y54 A;  3N6I A;  1ERM A;  4JXW A;  3BEB A;  5TGF A;  1YMX A;  4QU3 A;  3V5M A;  2QPN A;  5FA7 A;  1K56 A;  2UWX A;  1XGJ A;  2ZC5 B;  4WEJ A;  3A3E A;  3FWL A;  4K91 A;  4OQI A;  4JBF A;  3ZG7 B;  1KVL A;  1BLH A;  5KZH A;  4QY6 A;  2VGK A;  4KZ6 A;  3G32 A;  1XKZ A;  2ZC4 B;  3NC8 A;  4N1H A;  4BQM A;  3N8L A;  4Y0T A;  4IBX A;  1Z6F A;  2Z2L B;  1BLC A;  3PBS A;  5HAI A;  4X68 A;  2WKE A;  1PIO A;  2PU4 A;  5CGX A;  5E2H A;  3HLG A;  4EWF A;  3GSG A;  3P09 A;  3G34 A;  2FFF B;  5F1F A;  4FCF A;  3ISG A;  2G2U A;  3BLM A;  3W8K A;  3PBT A;  3LO7 A;  3UPP A;  4KG5 A;  1LI0 A;  2Q9N A;  3O86 A;  4N1X A;  4R23 A;  2R9W A;  4KZB A;  4KZ5 A;  3B3X A;  4U0T A;  1O07 A;  1AXB A;  2Y2G A;  1FOF A;  4E6W A;  1G6A A;  1TVF A;  3MFD A;  1G68 A;  2Y2Q A;  1GA9 A;  5EVI C;  1PI4 A;  2ZQC A;  3GTC A;  4EBP A;  1ZC2 A;  5GLC A;  4JPM A;  3MXR A;  4OKP A;  3GV9 A;  4LEN A;  4M3K A;  5EEC A;  1Q2P A;  3IH8 A;  5F82 A;  3TOI A;  4S2L A;  1H8Z A;  1K55 A;  4R4S A;  3O87 A;  4B88 A;  1HVB A;  1GHP A;  4U3T A;  2CC1 A;  2HPB A;  5CEC A;  3HLW A;  4DE1 A;  3AGF A;  3P98 A;  4S2N C;  3ZCZ A;  5CHU A;  4ZBE A;  3IWO A;  3VP4 A;  1J9M A;  3IQA A;  5KSC A;  1RP5 A;  3ZFZ A;  5CED A;  2WGW B;  3NI9 A;  4LV0 A;  1YLW A;  1PZP A;  4DXC A;  5CHM A;  3JYI A;  5FI2 A;  4FD8 A;  5CGS A;  3HUM A;  1GA0 A;  3MKF A;  4MLL A;  1JWZ A;  4OPR A;  4KEN B;  3VP3 A;  3ZGA B;  1PYY A;  1HD8 A;  2HP9 A;  1H5X A;  1KGE A;  4EBL A;  4HBT A;  2XFT A;  1FR6 A;  1LLB A;  2C6W B;  1K54 C;  2ZJ9 A;  3M2J A;  4Q8I A;  3UE1 A;  5JYP A;  5EPH A;  3UE0 A;  5A91 A;  1YMS A;  4KZ8 A;  1ES4 A;  4JKT A;  2XD1 A;  2XK1 A;  4MEZ A;  1E3U D;  1RCJ A;  3C5A A;  4DKI A;  2WKI A;  3Q7V A;  3OPR A;  1NZU A;  2PU2 A;  2Y2H A;  1BUL A;  4JXG A;  1W8Q A;  1K57 A;  2HP6 A;  2J9O A;  3GVB A;  4IVI A;  1M6K A;  3UN7 A;  3UNW A;  5AQ9 A;  1KE0 A;  1XA1 A;  5F83 A;  4OOL A;  1RGY A;  3QHY A;  4B4Z A;  2WGI A;  2V20 A;  3V3S A;  1LL5 A;  3PBR A;  1ESU A;  4DDS A;  2Z2M B;  3PBQ A;  3ZG5 A;  4DDY A;  2ZM8 A;  3G31 A;  2R9X A;  1CI9 A;  3CG5 A;  2EFX A;  3OCL A;  4DRT A;  2RL3 A;  4HBU A;  5HW3 A;  3IXB A;  1FSY A;  3ITA A;  3TSG A;  3UDF A;  1NZO A;  4DF6 A;  2XH9 A;  3I7J A;  1EI5 A;  5FDH A;  3IXD A;  1K54 A;  3ZHH A;  1FCM A;  1WYC A;  3DWZ A;  1I2W A;  3BFF A;  4OVD A;  5FI6 A;  5EE8 A;  3VOY A;  4WZ5 A;  3C7V A;  5FAT A;  2DNS A;  4WYY A;  2OSU A;  1L0F A;  2HDR A;  3HLB A;  4OOY A;  3V3R A;  3WS0 A;  1MWS A;  4UA7 A;  2P9V A;  2ZC3 B;  1NRF A;  4E3O A;  2ZQ7 A;  4BLM A;  4BEN A;  1YLT A;  3PBO A;  3D4F A;  1QME A;  1I2S A;  1MBL A;  2V2F F;  3IT9 A;  1IKG A;  1ESI A;  4P6B A;  3MXS A;  4GB7 A;  4OQ0 A;  1NYY A;  4YIN A;  3Q82 A;  1C3B A;  3PTE A;  5CTN A;  2XFS A;  4JF6 A;  1K4E A;  2Y2K A;  5EOO A;  1CI8 A;  4X69 A;  1DJC A;  1FCO A;  4MNR A;  1S6R A;  1ONG A;  1H8Y A;  2ZC6 B;  4X53 A;  4XUX A;  4WZ4 A;  4BJP A;  5KSH A;  1BUE A;  2C5W B;  4KG6 A;  3AGD A;  3G2Y A;  4OP8 A;  1Q2Q A;  4UA9 A;  2ZQ9 A;  3A3F A;  4S2N A;  4OQH A;  3PAE A;  4HEF A;  3ZNY A;  4PM8 A;  4KZ4 A;  1TEM A;  3MZE A;  5FQQ A;  1YLY A;  4U0X A;  5GHY A;  5HX9 A;  3IH9 A;  3UDI A;  1IYP A;  4PM5 A;  5CEB A;  4E3L A;  2FFY A;  4B4X A;  3C4P A;  1ES3 A;  4C3Q A;  5AQA A;  2Y59 A;  1K6S A;  1BT5 A;  4WMC A;  4R4R A;  2XEP A;  1E25 A;  4UAA A;  4ZJ1 A;  1CEF A;  3E2L A;  4S2J A;  2OLU A;  3RXW A;  5E2G A;  4R3J A;  3BEC A;  2P74 A;  3LEZ A;  4HES A;  4OP5 A;  4WBG A;  3NCK A;  1NY0 A;  4S2K A;  3RJU A;  2J7V A;  1MPL A;  2EX8 A;  3A3J A;  4D2O A;  1VM1 A;  3BFD A;  3UO9 A;  1NJ4 A;  5TFQ A;  4GDN A;  4KZ7 A;  4ID4 A;  4N9K A;  4QB8 A;  1HTZ A;  5U47 A;  3VP1 A;  4ZDX A;  1E4D A;  4P85 A;  4PMA A;  1KE4 A;  4JF4 A;  4QHC A;  1JTD A;  5G18 A;  3CZD A;  2A49 A;  1PW8 A;  3GRJ A;  5EVL A;  4JLF A;  5FAP A;  3UY6 A;  3OC2 A;  3HLC A;  1CK3 A;  3IXG A;  2Y4A A;  3BFC A;  3WRT A;  5E2F A;  3UPO A;  3SS5 A;  1MY8 A;  3W4O A;  3HLD A;  4MBK A;  1K38 A;  3CMZ A;  3M6H A;  3MZF A;  4ZJ2 A;  1SDE A;  1ZG6 A;  1FR1 A;  3W4P A;  5EOE A;  1EWZ A;  1KDS A;  4F94 A;  5EVI D;  4UA6 A;  5EVI A;  2Q9M A;  3IHB A;  1LI9 A;  5FAO A;  4CPK A;  2WK0 A;  1PWD A;  1GHI A;  2WAF A;  2Y2O A;  3BYD A;  3UE3 A;  1N4O A;  1WYB A;  2Y55 A;  1ES2 A;  5GHZ A;  4GNU A;  5E43 A;  3VP2 A;  3BRM A;  3HLE A;  4QD4 A;  4GZB A;  3HVF A;  3IWI A;  5FQI A;  3S1Y A;  4WEL A;  1L0E A;  1E3U A;  1DJB A;  1LHY A;  3HUN A;  1MKI A;  2ZD8 A;  2WUQ A;  4NET A;  2EX2 A;  5A92 A;  1W7F A;  1IYQ A;  2DRW A;  4BD0 A;  5DTS A;  3ZVW A;  2IWB A;  1SCW A;  1YLZ A; 
#chains in the Genus database with same CATH topology
 3CLO A;  1YT4 A;  3ITB A;  5EVI B;  3KSF A;  4A5R A;  1FSW A;  3PHY A;  4I3J A;  1YAX A;  4CLC B;  4GHI B;  2P9V B;  4M4X A;  2ZQ8 A;  4NXG A;  1T18 A;  1PZO A;  4KQO A;  1KVM A;  4KQD A;  4D60 A;  4EXO A;  1YM1 A;  2I72 A;  2VEA A;  2W1T B;  3P01 A;  2V1A A;  5FI7 A;  4GD6 A;  5C5K A;  4Q0H A;  3EGX C;  4EEU A;  4JGO A;  3C8C A;  2ZQA A;  4R3B A;  2K2N A;  1XXM A;  2ZC7 A;  2JC7 A;  1KGG A;  2VV8 A;  1SKF A;  3GQZ A;  3CIT A;  4EUZ A;  2OWH A;  5HSQ A;  2GDN A;  4OLD A;  3FKW A;  5DF8 A;  3T1Q B;  2PBY A;  3WS4 A;  4LV2 A;  5EUA A;  3QP2 A;  2BTF P;  3W4Q A;  2O9B A;  4EQI A;  4ZTK A;  3C4O A;  2OLV A;  1K55 C;  2VGL S;  3OPP A;  3AGE A;  3VOZ A;  5GLA A;  1PWC A;  1MWR A;  1L0D A;  4FOF A;  5HDS A;  4Y3I A;  3DTK A;  5AQB A;  3LR0 A;  2QKP A;  1NYM A;  3E2K A;  2EXA A;  2V8F A;  3PBN A;  4EW7 A;  3GMW A;  2QJ5 A;  3M2K A;  1L2S A;  3Q7V B;  1YLJ A;  1TF1 A;  4O7D A;  4GS9 B;  4K0X A;  1GCE A;  3QP4 A;  3BW6 A;  3IX4 A;  5G4Y A;  2HDQ A;  4PM6 A;  3LGO A;  4ZJ3 A;  3VSK A;  3EQU A;  5JYO A;  3BM6 A;  5CHJ A;  2O9C A;  1W79 A;  2GNX A;  4ESP A;  3B47 A;  4KQR A;  1S66 L;  5EV0 A;  3V50 A;  2FH5 A;  3MS6 A;  3FPV A;  3Q1F A;  4IVK A;  1L0G A;  2ZM0 A;  1GSV A;  3OPL A;  2ZMV A;  1VEU B;  2QZ6 A;  5A90 A;  1LL9 A;  4WMC D;  3RFB A;  2G2W A;  3N8S A;  2ZOI A;  4S2I A;  4E3N A;  4DE2 A;  5DKL A;  1L3L A;  4OPZ A;  2X71 A;  3K2N A;  5GL9 A;  1PRQ A;  2Z6D A;  5EM1 A;  2ZBB A;  2YKH A;  4K0W A;  1JNU A;  1CEG A;  4X1M A;  3EGD C;  4KQQ A;  1OJ5 A;  2JN7 A;  1IOU A;  3ZNT A;  1NWZ A;  2XQZ A;  3U4L P;  2Y2P A;  3T1S A;  4AFI A;  1GSW A;  4FTX A;  4PM7 A;  3LYX A;  5AJG A;  3IF5 A;  4E3M A;  3C2W A;  4CJN A;  1XA7 A;  4OLG A;  5CER A;  1M40 A;  3HL9 A;  5F1G A;  3T4Q A;  2PHY A;  3MF0 A;  1Y54 A;  1ERM A;  4HH2 A;  3BY8 A;  3K3D A;  1LL8 A;  2UWX A;  1XGJ A;  3SZT A;  1W63 Q;  3D9Y A;  1SKO A;  4WUJ A;  3ZG7 B;  1KVL A;  4QY6 A;  4KZ6 A;  4ARZ A;  3G32 A;  2ZC4 B;  3NC8 A;  3VOL A;  3ZYT A;  4N1H A;  3N8L A;  4NXE A;  1BLC A;  3S7P A;  4X68 A;  2PU4 A;  5CGX A;  5E2H A;  5F1F A;  3GSG A;  2G2U A;  3W8K A;  3NEC A;  3H9W A;  2JKR M;  2FZ0 A;  3NOP C;  1AXB A;  4PAU A;  1V9Y A;  4E6W A;  1GA9 A;  3GTC A;  3MXR A;  4OKP A;  4M3K A;  1Q2P A;  5F82 A;  1K55 A;  4R4S A;  4B88 A;  3IBR A;  3AGF A;  2GX5 A;  4HI4 A;  2B02 A;  1VEU A;  5CED A;  3MSH A;  1PZP A;  3T4J A;  5CGS A;  3MKF A;  1PYY A;  1XJ4 A;  1KGE A;  4EBL A;  2XFT A;  3LIE A;  4Q8I A;  5EPH A;  4KZ8 A;  2M1C A;  1E3U D;  1RCJ A;  1S4S A;  3Q7V A;  3OPR A;  2PU2 A;  2Y2H A;  2PYR A;  5TBM B;  4JXG A;  3UN7 A;  1M6K A;  4CLC E;  1RGY A;  2WGI A;  3V3S A;  3F1P B;  3PBQ A;  4PHT A;  2ZM8 A;  4X25 A;  3IXB A;  3TSG A;  1OT6 A;  5HPF A;  1I2W A;  5J4E A;  1UWN X;  2DNS A;  2VX8 A;  4R6L A;  4K08 A;  2PR5 A;  4BLM A;  4BEN A;  3D4F A;  1I2S A;  1MBL A;  4Y2F A;  3IT9 A;  4P6B A;  4YIN A;  3A0S A;  4MCW A;  2XFS A;  4JF6 A;  1CI8 A;  1FCO A;  4XUX A;  1S6R A;  5TJJ A;  3T4T A;  2W3E A;  4X53 A;  2A24 B;  4BJP A;  5KSH A;  3G2Y A;  1G6O A;  5L07 A;  4OP8 A;  1Q2Q A;  2ZQ9 A;  3PAE A;  4HEF A;  4LPZ A;  3QP8 A;  3MZE A;  5FQQ A;  3T50 A;  5GHY A;  4PM5 A;  3IH9 A;  1IYP A;  2R78 A;  4E3L A;  3C4P A;  4C3Q A;  5AQA A;  4WMC A;  4UAA A;  3RXW A;  5E2G A;  2PDR A;  5HDD A;  2Q0O A;  3RJU A;  4BBT A;  3PYP A;  3RH8 B;  3BFD A;  3UO9 A;  1NJ4 A;  2W1T A;  5TFQ A;  4N9K A;  1E4D A;  4FUW A;  4JF4 A;  5EVL A;  5FAP A;  3OC2 A;  1CK3 A;  4EER A;  3WRT A;  3HLD A;  4GHI A;  4ME4 A;  2Z6C A;  1LSX A;  3EEH A;  3CI6 A;  5EVI A;  2Q9M A;  2KX6 A;  2WAF A;  3IX3 A;  1WYB A;  1ES2 A;  4GNU A;  5E43 A;  3D3O A;  4QD4 A;  1P9R A;  3HVF A;  3IWI A;  5EM0 A;  3V67 A;  1DJB A;  1MKI A;  2ZD8 A;  4P6Z S;  1F98 A;  2ZMF A;  1OTI A;  4I39 A;  5FQJ A;  2WAE A;  2XF3 A;  1K4F A;  1LSV A;  4NXB A;  2ZM2 A;  5BOH A;  3G30 A;  4HJ4 A;  1YPR A;  1Y4O A;  4IUK A;  3ULF A;  4IJG A;  1ES5 A;  4R0Q A;  2K31 A;  1ONH A;  4GDB A;  1DY6 A;  1PI5 A;  3OCN A;  1JWV A;  2WZX A;  4FH4 A;  3WWX A;  2A3U A;  4WM9 A;  3ZG9 B;  1TDG A;  3VE3 A;  1OT9 A;  5FAS A;  3S22 A;  3UB8 A;  4R70 A;  1MC0 A;  4LCM A;  3O3V A;  5M1A A;  1Z09 A;  4RX2 A;  4HH3 A;  4EBN A;  3BQA A;  3ZDJ A;  1W5D A;  2ZLY A;  1SDN A;  4EV4 A;  4MBF A;  2HDS A;  2J80 A;  1DJA A;  3WS5 A;  1K57 C;  4EU0 A;  4HOI A;  5CGW A;  4NKP A;  2JHE A;  2WGW A;  4NG2 A;  3SH9 A;  3VMA A;  4WEK A;  2JKT I;  3VFH A;  1MZU A;  4L0L A;  3IF6 C;  5EFW A;  2VKS A;  1RGZ A;  2Y2L A;  5A93 A;  3KYE A;  2J9P A;  1BLS A;  4IED A;  5CRF A;  5IT5 A;  4RA7 A;  4HHD A;  4NK3 A;  4FSF A;  3NY4 A;  2Y2I A;  5D3O A;  1KGF A;  5DTT A;  2JE5 A;  5FQ9 A;  2UV0 E;  3IF6 B;  5FQM A;  1MKM A;  2P08 A;  4GS9 A;  1HZO A;  2JKR I;  4QJG A;  1S1Y A;  1O7E A;  3ZG8 B;  4BMW A;  2KDK A;  1Y28 A;  3HUO A;  3MR0 A;  3CHW P;  5HAP A;  4R1G A;  5FQK A;  5LBR A;  3ICY A;  3C7U A;  5GLD A;  1DRM A;  4KZ9 A;  5KMW A;  4JF5 A;  3KYQ A;  4B9O A;  2EFU A;  4O0P A;  4MDZ A;  1P97 A;  3UPN A;  1OJG A;  4X6T A;  5HPI A;  2WAD A;  1BYW A;  3IX8 A;  4HP9 A;  1NLZ A;  2ZMA A;  2WYX A;  2V8C A;  2OV5 A;  5M19 A;  2V1Z A;  4RYE A;  4IUH A;  3PAG A;  3MZD A;  3PR6 A;  2EA9 A;  3EWK A;  5HAR A;  4LRY C;  3UMD A;  2VA0 A;  2K7S A;  4E3J A;  2H5S A;  4N9L A;  3NJA A;  4Y7P A;  2O99 A;  2LB5 A;  3G2Z A;  2XDM A;  4LLO B;  2B5R A;  4E3K A;  3IHA A;  1BSG A;  1TS7 A;  2BAS A;  4JXS A;  4S2M A;  1IEL A;  1YMX A;  4MN6 A;  3HCY A;  3S7N A;  3VV4 A;  4K91 A;  4OQI A;  2VGK A;  5I5L A;  3MFX A;  3E4Q A;  4G3V A;  4IBX A;  1Z6F A;  1PIO A;  1UGU A;  3HLG A;  3P09 A;  2FFF B;  4FCF A;  4CLC A;  3BLM A;  3C38 A;  3O86 A;  4XT2 A;  4LRX C;  4KZB A;  4U0T A;  1O07 A;  1G6A A;  1TVF A;  1PFL A;  4EBP A;  4JPM A;  5EEC A;  3IH8 A;  4S2L A;  1GHP A;  4U3T A;  2CC1 A;  1PNE A;  3HLW A;  3P98 A;  1CQA A;  3IWO A;  2MJ6 A;  3VP4 A;  3IQA A;  5FEG A;  2JKG A;  5KSC A;  1RP5 A;  1OTD A;  1FIK A;  4BBV A;  4DXC A;  3IS2 A;  1YSP A;  1P0Z A;  3HUM A;  4OPR A;  3T1R A;  4KEN B;  3ZGA B;  1FR6 A;  1LLB A;  2C6W B;  3UE1 A;  5JYP A;  4KUO A;  3A0V A;  1YMS A;  2HGV A;  2XA7 S;  2WKI A;  1NZU A;  3NOT C;  1BUL A;  1W8Q A;  1XJ2 A;  2J9O A;  3GVB A;  1UWP X;  3E98 A;  4OOL A;  4B4Z A;  2V20 A;  1IFQ A;  1LL5 A;  4Z1W A;  2Z2M B;  2R9X A;  1CI9 A;  5DKK A;  1HLU P;  3OCL A;  4H6J B;  1EW0 A;  1FSY A;  4UEY A;  4YNR A;  4BBU A;  3I7J A;  1FCM A;  3DWZ A;  4OVD A;  3C7V A;  3LID A;  5FAT A;  2OSU A;  1L0F A;  3HLB A;  4OOY A;  3V3R A;  3WS0 A;  1MWS A;  4UA7 A;  4GJ4 A;  2ZQ7 A;  1OTE A;  3DBA A;  5IU1 A;  2EWV A;  2V2F F;  1IKG A;  3MXS A;  3S7O A;  5HWW A;  2PD7 A;  2VZW A;  4MNR A;  1VET B;  3UME A;  3MJQ A;  4EEP A;  5FEF A;  1WA9 A;  3A3F A;  3ZNY A;  1ODV A;  1YLY A;  5HX9 A;  5CEB A;  1BT5 A;  3MMH A;  3NCK A;  3HJK A;  3OBF A;  4PKY A;  2J7V A;  1MPL A;  2EX8 A;  3GEC A;  4QB8 A;  4ID4 A;  2QJ7 A;  1HTZ A;  5U47 A;  2IA2 A;  4P85 A;  3CZD A;  1F5M A;  3GRJ A;  2PBD P;  3UY6 A;  2Y4A A;  5A8B A;  3BFC A;  3UPO A;  3SS5 A;  1MY8 A;  4MBK A;  3GDI A;  3M6H A;  4ZJ2 A;  1CJF A;  3KSG A;  1KDS A;  4F94 A;  5EVI D;  2NUT C;  5FAO A;  1PWD A;  1F9I A;  1GHI A;  2WKP A;  5HWT A;  2Y55 A;  3LUQ A;  3BRM A;  3HLE A;  4GZB A;  2CMN A;  2OAP 1;  3S1Y A;  1S1Z A;  1E3U A;  1J3W A;  1W7F A;  1IYQ A;  2P7J A;  1YLZ A;  5HL1 A;  1D06 A;  3ZG0 A;  4BL2 A;  3R7W A;  2JBF A;  2Y2N A;  2HJE A;  5MC7 A;  3VE4 A;  3NBL A;  3H82 B;  5L2F A;  2Y2J A;  2J3T D;  4WLA A;  4ZAM A;  1GSX A;  5GLB A;  3BFE A;  2VV7 A;  3UE6 A;  3BJN A;  2QMI A;  3FKV A;  4H6J A;  2ZL1 A;  3IXH A;  3KSI A;  1K25 A;  3Q81 A;  4C6Y A;  2HDU A;  1OME A;  3LI8 A;  3GR2 A;  2EX6 A;  3FYZ A;  3A0R A;  2M7U A;  4BD1 A;  3CPT B;  5TR7 A;  2Y2M A;  3F1N A;  3FV7 A;  2E8I A;  2I9V A;  3SS3 A;  4OQG A;  2EXB A;  1VB6 A;  5IHV A;  2BLS A;  1IKI A;  4YFM A;  4X55 A;  4DXB A;  1KOU A;  3JVU A;  1OPX A;  5K5B A;  1NXY A;  4QWO A;  3LCE A;  1T19 A;  3IBJ A;  4Z9Q A;  3SH8 A;  4S2P A;  2ZQD A;  3O88 A;  3BQ8 A;  1MWU A;  1N9O A;  1N9N A;  1IEM A;  3DTI A;  4DN0 A;  1BLP A;  3NUL A;  4ETZ A;  3V39 A;  2PD8 A;  4FH2 A;  1ERO A;  4GW9 A;  5HAQ A;  3T4S A;  1U60 A;  4RVA A;  3C30 A;  5DF9 A;  4UQI M;  3A3D A;  3FZC A;  1IYS A;  3EEA A;  1MXO A;  1P9W A;  1W8Y A;  4XT2 B;  4P87 A;  3MBZ A;  4PM9 A;  4KG2 A;  3TG9 A;  5DFY A;  1SHV A;  1I5Q A;  3RTY A;  1K6R A;  3DW0 A;  3QNC A;  2A2L A;  5F6A A;  4WN5 A;  4MBH A;  4PPR A;  4OPY A;  2IWC A;  5CTM A;  2H0Y A;  2B95 A;  3F1N B;  3QNB A;  3FPW A;  3NDG A;  1K56 D;  1BZA A;  4LRZ E;  5DVA A;  1VQQ A;  5HFO A;  5AQ7 A;  3N8R A;  2XRO A;  4YWZ A;  1JVJ A;  4GN2 A;  1JTG A;  5FSR A;  4I3A A;  1WE4 A;  4NXF A;  3OZH A;  3EQV A;  2V0W A;  2YKF A;  4E6X A;  1JWP A;  1TDL A;  4N92 A;  2DCF A;  3WS1 A;  3NDE A;  3VP0 A;  3M6B A;  4JXV A;  2VK3 A;  1W63 M;  4GOG A;  2H10 A;  2PR6 A;  3KYZ A;  1YLP A;  1XJ6 A;  2VLG A;  2J8Y A;  5CXW A;  4HJ3 A;  1YKD A;  2XD5 A;  4QY5 A;  2HP5 A;  4LV3 A;  1V9Z A;  1H0M A;  1BTL A;  2L1M A;  4II7 A;  2XA7 M;  3O5Y A;  1ERQ A;  1TS6 A;  2VGL M;  1PW1 A;  4RX3 A;  2Y8H A;  2X01 A;  3LY4 A;  4I38 A;  1XX2 A;  5HWV A;  4MN7 A;  1XGI A;  5E2E A;  4S2O A;  1FCN A;  4HQA A;  4HY8 A;  4X56 A;  2X02 A;  4YOF A;  3LIA A;  4JXW A;  3BEB A;  2B18 A;  4QU3 A;  2QPN A;  4G3W A;  4Q0J A;  5AVF A;  2ZC5 B;  4WEJ A;  2V0U A;  4EQ1 A;  4JBF A;  5KZH A;  1BLH A;  1XKZ A;  4Y0T A;  1A0K A;  3PBS A;  4RQ9 A;  1YSQ A;  3BY9 A;  2WKE A;  4ZRR A;  4CLC C;  3MXQ A;  3PBT A;  3LO7 A;  4KG5 A;  1LI0 A;  2Q9N A;  2R9W A;  2ZOH A;  3B3X A;  4DJ3 A;  2PRF A;  2XSS A;  2Y2Q A;  5EVI C;  2ZQC A;  3TRC A;  5AVE A;  5GLC A;  3L9K A;  3LFV A;  4LEN A;  1D1J A;  3O87 A;  2O9A A;  1OTB A;  4DE1 A;  3F1O A;  4S2N C;  3ZCZ A;  5HL6 A;  1VET A;  3ZFZ A;  2WGW B;  3NI9 A;  2GZA A;  3UB5 P;  4LV0 A;  1YLW A;  3LIC A;  5CHM A;  4FD8 A;  2G7U A;  1N9L A;  3T4K A;  3VP3 A;  5L09 A;  2HP9 A;  4HBT A;  3T4L A;  3H7W A;  1K54 C;  3DAV A;  3M2J A;  2E8J A;  5A91 A;  2XD1 A;  2XK1 A;  4MEZ A;  5FDS A;  4DKI A;  3C5A A;  2QWS A;  1K57 A;  2HP6 A;  3UNW A;  4L9E A;  3E4O A;  3JVV A;  1K0K A;  3UB7 A;  3PBR A;  4DDS A;  1ESU A;  3ZG5 A;  4DDY A;  3G31 A;  3CG5 A;  4DRT A;  2RL3 A;  4HBU A;  3EOI A;  4CLC D;  5HW3 A;  3LIB A;  5F69 A;  3ITA A;  3CWF A;  3UDF A;  1NZO A;  4DF6 A;  1EI5 A;  2QYB A;  3B33 A;  4GLQ A;  5HD3 A;  3ZHH A;  3W2Z A;  3BFF A;  5FI6 A;  3VOY A;  2L0W A;  4L9G A;  4WYY A;  2HDR A;  4Q0I A;  3LR5 A;  2W3G A;  2ZC3 B;  1NRF A;  3G6O A;  3S7Q A;  5J3W A;  3U2A A;  2OWJ A;  1YLT A;  3PBO A;  1QME A;  1CF0 A;  3Q82 A;  1DP8 A;  2L4R A;  5CTN A;  2W3D A;  5FL3 A;  1K4E A;  1TD5 A;  2PAV P;  4X69 A;  1DJC A;  4JGP A;  5EOO A;  1ONG A;  2W3F A;  4WZ4 A;  4O01 A;  4JGR A;  1NLY A;  2O0Y A;  1BUE A;  4HIA A;  4KG6 A;  3AGD A;  4UA9 A;  4S2N A;  4NEE D;  4PM8 A;  4MMN A;  4KZ4 A;  1TEM A;  2FFY A;  4B4X A;  3CPT A;  1DP9 A;  2Y59 A;  1K6S A;  3KO6 A;  4R4R A;  5HZH A;  4S2J A;  2OLU A;  4R3J A;  3BEC A;  3LEZ A;  4HES A;  4OP5 A;  4S2K A;  4G3K A;  3A3J A;  3D72 A;  5DJT A;  4D2O A;  1VM1 A;  2ZL1 B;  3SW1 A;  4GDN A;  4KZ7 A;  4KUK A;  4PMA A;  1KE4 A;  5F68 A;  4QHC A;  5G18 A;  2A49 A;  4JLF A;  1TS8 A;  3H7W B;  1K38 A;  1SDE A;  5HDC A;  5EOE A;  4WF0 A;  1EWZ A;  2WKR A;  5L8M A;  4LFU A;  4UA6 A;  3IHB A;  2HZ5 A;  2Y2O A;  3BYD A;  3UE3 A;  2DMW A;  1N4O A;  5GHZ A;  3VP2 A;  3F1O B;  2XRN A;  1T1C A;  1L0E A;  1LHY A;  5A92 A;  2A24 A;  4L9F A;  3OLO A;  4BD0 A;  5DTS A;  3ZVW A;  2IWB A;  3ZQ5 A;  2AVX A;  4IHQ A;  2HJ9 C;  2OOL A;  2ACG A;  1ACF A;  3E4P A;  4EUV A;  4OH0 A;  1YQS A;  1G5U A;  3BLS A;  2QHK A;  3DTE A;  2RCX A;  5GHX A;  3HBR A;  1XPB A;  1NRJ A;  2PYP A;  2IWD A;  3N4I A;  3WRZ A;  1ZTU A;  3N7W A;  4PKY G;  5L10 A;  4GD8 A;  1S4R A;  4OOM A;  3MKE A;  3OPH A;  3T4O A;  1KDW A;  3HLF A;  2W27 A;  4CQH A;  5TBM A;  4P6Z M;  4KZA A;  3MQO A;  4E3I A;  1ZHH B;  4KZ3 A;  3IF6 A;  3VFF A;  5DTK A;  3G4P A;  2EX9 A;  3IWQ A;  5J8X A;  5EVE A;  4I5S A;  4XXR A;  5J7E A;  2KLI A;  2VGJ A;  5DJU A;  3NIA A;  3UB6 A;  3SOI A;  2H0T A;  2LB9 A;  4LV1 A;  3LR4 A;  5F5Y A;  1KE3 A;  3G35 A;  3BFG A;  4Y0O A;  4Y13 A;  4C75 A;  3Q07 A;  2WZZ A;  4DE3 A;  4QPR A;  3CUE A;  4H8R A;  2W0N A;  1GHM A;  1S0W A;  1PWG A;  4Y0U A;  1MWT A;  4LGW A;  2XLN A;  2J3W A;  3SS4 A;  4LCL A;  2WKH A;  1XP4 A;  2JCH A;  4XUZ A;  2HV1 A;  1FQG A;  5M18 A;  4O8G A;  3LR3 A;  4OPQ A;  2Y79 A;  5DF7 A;  3A3I A;  3LY3 A;  4HJ6 A;  5KIZ A;  4UQI S;  2HF6 A;  3CJM A;  4JGQ A;  3KX0 X;  3TJZ C;  5FAQ A;  2WGV A;  3SH7 A;  3TE8 A;  1N9B A;  3HJI A;  2P04 A;  1F2K A;  3UDX A;  3LEQ A;  4GKU A;  3ZVT A;  1QMF A;  1IYO A;  4GCZ A;  5I94 A;  3P7N A;  3FC7 A;  4UHU A;  1XFN A;  3HRE A;  4OON A;  4WZ5 C;  4R38 A;  5CX7 A;  4DE0 A;  4I3I A;  3DTM A;  3DWK A;  1ALQ A;  4BL3 A;  3RXX A;  4HNB A;  3Q7Z A;  1TS0 A;  1SZV A;  4P0M A;  1ZKJ A;  1OTA A;  4ETX A;  3OOV A;  3VSL A;  2Y91 A;  1ZG4 A;  3S4X A;  3MQQ A;  3WS2 A;  2XGN A;  4IBR A;  5G4Z A;  2XR0 A;  1FIL A;  2BG1 A;  2W1R A;  2JKT M;  3N6I A;  5TGF A;  3V5M A;  5FA7 A;  2KOI A;  1K56 A;  2H28 A;  3A3E A;  3FWL A;  1LSW A;  4BQM A;  3QP6 A;  4Y17 A;  3R4K A;  2Z2L B;  2VJW A;  3H82 A;  5HAI A;  1STZ A;  4EWF A;  1T1A A;  3G34 A;  3ISG A;  3UPP A;  2WKQ A;  4N1X A;  4R23 A;  3R7W B;  4KZ5 A;  1X0O A;  2Y2G A;  1FOF A;  3MFD A;  1H8M A;  1G68 A;  1PI4 A;  1ZC2 A;  3GV9 A;  3TOI A;  1H8Z A;  2VV6 A;  1HVB A;  1DP6 A;  4EET B;  2HPB A;  5CEC A;  1XFQ A;  5CHU A;  4ZBE A;  3FG8 A;  1J9M A;  4WL9 A;  4BWI A;  3MQ0 A;  2V1B A;  4DMZ A;  3KSH A;  2EWW A;  3JYI A;  5FI2 A;  1GA0 A;  4MLL A;  1JWZ A;  1HD8 A;  1H5X A;  2NUP C;  4X1L A;  3QP1 A;  3BWL A;  1VHM A;  3TW8 A;  2ZJ9 A;  4EES A;  3UE0 A;  1ES4 A;  4JKT A;  1S67 L;  2PT7 A;  1T1B A;  4B93 A;  2D01 A;  3T1X A;  4MN5 A;  4IVI A;  5AQ9 A;  1KE0 A;  3F1P A;  1XA1 A;  5F83 A;  3QHY A;  4E04 A;  2EFX A;  3QP5 A;  2XH9 A;  5FDH A;  2GJ3 A;  3IXD A;  1K54 A;  1WYC A;  5IS1 A;  5EE8 A;  3PXP A;  4WZ5 A;  2P9V A;  4E3O A;  4Y5F A;  1G28 A;  1ESI A;  4GB7 A;  4OQ0 A;  1NYY A;  3UB9 A;  1C3B A;  3PTE A;  2W3H A;  2Y2K A;  2ZC6 B;  1H8Y A;  4F3L B;  2C5W B;  4HP4 A;  4R3A A;  4DJ2 A;  2J3T C;  3LIF A;  4OQH A;  3NHQ A;  4U0X A;  3UDI A;  2JKF A;  1ES3 A;  2D02 A;  2M7V A;  5HD5 A;  4ZJ1 A;  2XEP A;  1E25 A;  3K3C A;  1CEF A;  3E2L A;  2INW A;  1XJ3 A;  3CAX A;  2P74 A;  3E0Y A;  4WBG A;  1AWI A;  1NY0 A;  3CUE C;  4ZDX A;  3VP1 A;  1JTD A;  1D7E A;  1PW8 A;  4ARZ B;  3HLC A;  3IXG A;  1SKO B;  3T12 B;  5E2F A;  3LI9 A;  3W4O A;  3CMZ A;  3MZF A;  5DFX A;  3L7H A;  1LT0 A;  1ZG6 A;  1FR1 A;  3W4P A;  2OAQ 1;  3IS2 B;  1LI9 A;  4CPK A;  2WK0 A;  2V9A A;  5FQI A;  4Y15 A;  1H3Q A;  4WEL A;  3JPU A;  4F3L A;  3HUN A;  4NET A;  2WUQ A;  2EX2 A;  3NOU C;  2DRW A;  3B42 A;  1SCW A; 
#chains in the Genus database with same CATH homology
 5FQJ A;  5HL1 A;  1YT4 A;  2WAE A;  3ZG0 A;  4BL2 A;  2XF3 A;  1K4F A;  3ITB A;  5EVI B;  2ZM2 A;  5BOH A;  2JBF A;  4A5R A;  2Y2N A;  1FSW A;  3G30 A;  1ES5 A;  2P9V B;  4R0Q A;  1ONH A;  2ZQ8 A;  3NBL A;  1YQS A;  4OH0 A;  5L2F A;  2Y2J A;  4GDB A;  1DY6 A;  1PZO A;  3BLS A;  4KQO A;  1PI5 A;  1KVM A;  3OCN A;  4ZAM A;  1JWV A;  5GLB A;  3BFE A;  1YM1 A;  2I72 A;  2WZX A;  4FH4 A;  2RCX A;  5GHX A;  3HBR A;  1XPB A;  3WWX A;  2QMI A;  3FKV A;  5FI7 A;  2IWD A;  4GD6 A;  3IXH A;  3N4I A;  3WRZ A;  1K25 A;  3N7W A;  2A3U A;  4WM9 A;  3ZG9 B;  3Q81 A;  4C6Y A;  4GD8 A;  2HDU A;  4OOM A;  1OME A;  1TDG A;  3MKE A;  3OPH A;  1KDW A;  5FAS A;  3GR2 A;  3HLF A;  2ZQA A;  2EX6 A;  3S22 A;  3FYZ A;  4R3B A;  1XXM A;  2ZC7 A;  4BD1 A;  2JC7 A;  4LCM A;  5TR7 A;  3O3V A;  2Y2M A;  1KGG A;  3FV7 A;  2E8I A;  5M1A A;  4KZA A;  1SKF A;  3GQZ A;  4RX2 A;  3SS3 A;  4OQG A;  4E3I A;  4EUZ A;  2EXB A;  4EBN A;  4KZ3 A;  3IF6 A;  5IHV A;  3VFF A;  5DTK A;  2GDN A;  4OLD A;  3ZDJ A;  1W5D A;  3G4P A;  3FKW A;  5DF8 A;  2ZLY A;  2BLS A;  2EX9 A;  3IWQ A;  1SDN A;  2PBY A;  5J8X A;  1IKI A;  4YFM A;  4EV4 A;  3WS4 A;  4X55 A;  4MBF A;  4DXB A;  4XXR A;  2HDS A;  1NXY A;  4LV2 A;  5EUA A;  3LCE A;  2VGJ A;  3W4Q A;  4EQI A;  1DJA A;  3NIA A;  1K57 C;  3WS5 A;  3SOI A;  2H0T A;  4Z9Q A;  3SH8 A;  4ZTK A;  4LV1 A;  5CGW A;  3C4O A;  4S2P A;  2ZQD A;  1KE3 A;  3G35 A;  3BFG A;  4Y0O A;  2OLV A;  2WGW A;  1K55 C;  3O88 A;  4C75 A;  3OPP A;  3Q07 A;  2WZZ A;  4DE3 A;  3AGE A;  1MWU A;  4H8R A;  3VOZ A;  1IEM A;  1GHM A;  1S0W A;  1PWG A;  4Y0U A;  4WEK A;  3SH9 A;  3VMA A;  1BLP A;  5GLA A;  1MWT A;  1PWC A;  1MWR A;  3VFH A;  3V39 A;  1L0D A;  4FH2 A;  1ERO A;  5HAQ A;  2XLN A;  4L0L A;  1U60 A;  3IF6 C;  4RVA A;  3SS4 A;  4LCL A;  2WKH A;  5DF9 A;  3A3D A;  1XP4 A;  3FZC A;  1RGZ A;  2Y2L A;  2JCH A;  1IYS A;  4XUZ A;  5AQB A;  1MXO A;  1FQG A;  5A93 A;  2J9P A;  1BLS A;  4IED A;  5CRF A;  5M18 A;  1W8Y A;  4RA7 A;  4OPQ A;  1NYM A;  3E2K A;  3MBZ A;  2EXA A;  4FSF A;  4KG2 A;  3PBN A;  4NK3 A;  4P87 A;  4PM9 A;  3GMW A;  3NY4 A;  2Y2I A;  5DF7 A;  3A3I A;  3M2K A;  5D3O A;  3TG9 A;  1L2S A;  1KGF A;  1SHV A;  3Q7V B;  1I5Q A;  1YLJ A;  5DTT A;  1K6R A;  2JE5 A;  3DW0 A;  3LY3 A;  3QNC A;  4O7D A;  5FQ9 A;  4K0X A;  1GCE A;  3IF6 B;  5FQM A;  3CJM A;  4MBH A;  4PPR A;  4OPY A;  2HDQ A;  1HZO A;  4PM6 A;  2IWC A;  4ZJ3 A;  4QJG A;  5CTM A;  2H0Y A;  5FAQ A;  3EQU A;  3QNB A;  3NDG A;  3VSK A;  1K56 D;  1BZA A;  2WGV A;  5DVA A;  1O7E A;  3BM6 A;  5CHJ A;  3SH7 A;  3ZG8 B;  1N9B A;  1W79 A;  1VQQ A;  5HFO A;  5AQ7 A;  3N8R A;  4KQR A;  3V50 A;  3HUO A;  3UDX A;  3ZVT A;  4GKU A;  1QMF A;  1IYO A;  1JVJ A;  3Q1F A;  4IVK A;  1L0G A;  5HAP A;  2ZM0 A;  4R1G A;  4GN2 A;  3OPL A;  1JTG A;  5I94 A;  5FSR A;  5FQK A;  2QZ6 A;  3C7U A;  1WE4 A;  4UHU A;  5GLD A;  3OZH A;  5A90 A;  3HRE A;  3EQV A;  4KZ9 A;  4OON A;  4JF5 A;  5KMW A;  1LL9 A;  4WMC D;  2G2W A;  2EFU A;  3N8S A;  4WZ5 C;  4S2I A;  4E3N A;  4E6X A;  4DE2 A;  3UPN A;  1JWP A;  1TDL A;  4X6T A;  4N92 A;  2DCF A;  3WS1 A;  3NDE A;  4OPZ A;  3VP0 A;  2WAD A;  3M6B A;  2X71 A;  5JYO A;  4DE0 A;  4JXV A;  5GL9 A;  3DTM A;  4GOG A;  3DWK A;  2H10 A;  1ALQ A;  4K0W A;  4BL3 A;  2ZMA A;  1CEG A;  2WYX A;  3RXX A;  4KQQ A;  3Q7Z A;  2OV5 A;  1YLP A;  5M19 A;  2V1Z A;  4RYE A;  2J8Y A;  5CXW A;  2XD5 A;  3PAG A;  4QY5 A;  2HP5 A;  3MZD A;  4P0M A;  3ZNT A;  4LV3 A;  1ZKJ A;  5HAR A;  1BTL A;  2XQZ A;  2Y2P A;  3VSL A;  1ERQ A;  2Y91 A;  1ZG4 A;  4E3J A;  3S4X A;  1PW1 A;  4RX3 A;  2H5S A;  4N9L A;  2X01 A;  3LY4 A;  4PM7 A;  3WS2 A;  2XGN A;  1XX2 A;  4IBR A;  4Y7P A;  2XR0 A;  3IF5 A;  1XGI A;  5E2E A;  4E3M A;  4S2O A;  3G2Z A;  1FCN A;  2XDM A;  4CJN A;  2B5R A;  1XA7 A;  4OLG A;  2BG1 A;  5CER A;  4E3K A;  1M40 A;  4X56 A;  3HL9 A;  2X02 A;  5F1G A;  3IHA A;  1BSG A;  4JXS A;  4S2M A;  1IEL A;  1Y54 A;  3N6I A;  1ERM A;  4JXW A;  3BEB A;  5TGF A;  1YMX A;  4QU3 A;  3V5M A;  2QPN A;  5FA7 A;  1K56 A;  2UWX A;  1XGJ A;  2ZC5 B;  4WEJ A;  3A3E A;  3FWL A;  4K91 A;  4OQI A;  4JBF A;  3ZG7 B;  1KVL A;  1BLH A;  5KZH A;  4QY6 A;  2VGK A;  4KZ6 A;  3G32 A;  1XKZ A;  2ZC4 B;  3NC8 A;  4N1H A;  4BQM A;  3N8L A;  4Y0T A;  4IBX A;  1Z6F A;  2Z2L B;  1BLC A;  3PBS A;  5HAI A;  4X68 A;  2WKE A;  1PIO A;  2PU4 A;  5CGX A;  5E2H A;  3HLG A;  4EWF A;  3GSG A;  3P09 A;  3G34 A;  2FFF B;  5F1F A;  4FCF A;  3ISG A;  2G2U A;  3BLM A;  3W8K A;  3PBT A;  3LO7 A;  3UPP A;  4KG5 A;  1LI0 A;  2Q9N A;  3O86 A;  4N1X A;  4R23 A;  2R9W A;  4KZB A;  4KZ5 A;  3B3X A;  4U0T A;  1O07 A;  1AXB A;  2Y2G A;  1FOF A;  4E6W A;  1G6A A;  1TVF A;  3MFD A;  1G68 A;  2Y2Q A;  1GA9 A;  5EVI C;  1PI4 A;  2ZQC A;  3GTC A;  4EBP A;  1ZC2 A;  5GLC A;  4JPM A;  3MXR A;  4OKP A;  3GV9 A;  4LEN A;  4M3K A;  5EEC A;  1Q2P A;  3IH8 A;  5F82 A;  3TOI A;  4S2L A;  1H8Z A;  1K55 A;  4R4S A;  3O87 A;  4B88 A;  1HVB A;  1GHP A;  4U3T A;  2CC1 A;  2HPB A;  5CEC A;  3HLW A;  4DE1 A;  3AGF A;  3P98 A;  4S2N C;  3ZCZ A;  5CHU A;  4ZBE A;  3IWO A;  3VP4 A;  1J9M A;  3IQA A;  5KSC A;  1RP5 A;  3ZFZ A;  5CED A;  2WGW B;  3NI9 A;  4LV0 A;  1YLW A;  1PZP A;  4DXC A;  5CHM A;  3JYI A;  5FI2 A;  4FD8 A;  5CGS A;  3HUM A;  1GA0 A;  3MKF A;  4MLL A;  1JWZ A;  4OPR A;  4KEN B;  3VP3 A;  3ZGA B;  1PYY A;  1HD8 A;  2HP9 A;  1H5X A;  1KGE A;  4EBL A;  4HBT A;  2XFT A;  1FR6 A;  1LLB A;  2C6W B;  1K54 C;  2ZJ9 A;  3M2J A;  4Q8I A;  3UE1 A;  5JYP A;  5EPH A;  3UE0 A;  5A91 A;  1YMS A;  4KZ8 A;  1ES4 A;  4JKT A;  2XD1 A;  2XK1 A;  4MEZ A;  1E3U D;  1RCJ A;  3C5A A;  4DKI A;  2WKI A;  3Q7V A;  3OPR A;  1NZU A;  2PU2 A;  2Y2H A;  1BUL A;  4JXG A;  1W8Q A;  1K57 A;  2HP6 A;  2J9O A;  3GVB A;  4IVI A;  1M6K A;  3UN7 A;  3UNW A;  5AQ9 A;  1KE0 A;  1XA1 A;  5F83 A;  4OOL A;  1RGY A;  3QHY A;  4B4Z A;  2WGI A;  2V20 A;  3V3S A;  1LL5 A;  3PBR A;  1ESU A;  4DDS A;  2Z2M B;  3PBQ A;  3ZG5 A;  4DDY A;  2ZM8 A;  3G31 A;  2R9X A;  1CI9 A;  3CG5 A;  2EFX A;  3OCL A;  4DRT A;  2RL3 A;  4HBU A;  5HW3 A;  3IXB A;  1FSY A;  3ITA A;  3TSG A;  3UDF A;  1NZO A;  4DF6 A;  2XH9 A;  3I7J A;  1EI5 A;  5FDH A;  3IXD A;  1K54 A;  3ZHH A;  1FCM A;  1WYC A;  3DWZ A;  1I2W A;  3BFF A;  4OVD A;  5FI6 A;  5EE8 A;  3VOY A;  4WZ5 A;  3C7V A;  5FAT A;  2DNS A;  4WYY A;  2OSU A;  1L0F A;  2HDR A;  3HLB A;  4OOY A;  3V3R A;  3WS0 A;  1MWS A;  4UA7 A;  2P9V A;  2ZC3 B;  1NRF A;  4E3O A;  2ZQ7 A;  4BLM A;  4BEN A;  1YLT A;  3PBO A;  3D4F A;  1QME A;  1I2S A;  1MBL A;  2V2F F;  3IT9 A;  1IKG A;  1ESI A;  4P6B A;  3MXS A;  4GB7 A;  4OQ0 A;  1NYY A;  4YIN A;  3Q82 A;  1C3B A;  3PTE A;  5CTN A;  2XFS A;  4JF6 A;  1K4E A;  2Y2K A;  5EOO A;  1CI8 A;  4X69 A;  1DJC A;  1FCO A;  4MNR A;  1S6R A;  1ONG A;  1H8Y A;  2ZC6 B;  4X53 A;  4XUX A;  4WZ4 A;  4BJP A;  5KSH A;  1BUE A;  2C5W B;  4KG6 A;  3AGD A;  3G2Y A;  4OP8 A;  1Q2Q A;  4UA9 A;  2ZQ9 A;  3A3F A;  4S2N A;  4OQH A;  3PAE A;  4HEF A;  3ZNY A;  4PM8 A;  4KZ4 A;  1TEM A;  3MZE A;  5FQQ A;  1YLY A;  4U0X A;  5GHY A;  5HX9 A;  3IH9 A;  3UDI A;  1IYP A;  4PM5 A;  5CEB A;  4E3L A;  2FFY A;  4B4X A;  3C4P A;  1ES3 A;  4C3Q A;  5AQA A;  2Y59 A;  1K6S A;  1BT5 A;  4WMC A;  4R4R A;  2XEP A;  1E25 A;  4UAA A;  4ZJ1 A;  1CEF A;  3E2L A;  4S2J A;  2OLU A;  3RXW A;  5E2G A;  4R3J A;  3BEC A;  2P74 A;  3LEZ A;  4HES A;  4OP5 A;  4WBG A;  3NCK A;  1NY0 A;  4S2K A;  3RJU A;  2J7V A;  1MPL A;  2EX8 A;  3A3J A;  4D2O A;  1VM1 A;  3BFD A;  3UO9 A;  1NJ4 A;  5TFQ A;  4GDN A;  4KZ7 A;  4ID4 A;  4N9K A;  4QB8 A;  1HTZ A;  5U47 A;  3VP1 A;  4ZDX A;  1E4D A;  4P85 A;  4PMA A;  1KE4 A;  4JF4 A;  4QHC A;  1JTD A;  5G18 A;  3CZD A;  2A49 A;  1PW8 A;  3GRJ A;  5EVL A;  4JLF A;  5FAP A;  3UY6 A;  3OC2 A;  3HLC A;  1CK3 A;  3IXG A;  2Y4A A;  3BFC A;  3WRT A;  5E2F A;  3UPO A;  3SS5 A;  1MY8 A;  3W4O A;  3HLD A;  4MBK A;  1K38 A;  3CMZ A;  3M6H A;  3MZF A;  4ZJ2 A;  1SDE A;  1ZG6 A;  1FR1 A;  3W4P A;  5EOE A;  1EWZ A;  1KDS A;  4F94 A;  5EVI D;  4UA6 A;  5EVI A;  2Q9M A;  3IHB A;  1LI9 A;  5FAO A;  4CPK A;  2WK0 A;  1PWD A;  1GHI A;  2WAF A;  2Y2O A;  3BYD A;  3UE3 A;  1N4O A;  1WYB A;  2Y55 A;  1ES2 A;  5GHZ A;  4GNU A;  5E43 A;  3VP2 A;  3BRM A;  3HLE A;  4QD4 A;  4GZB A;  3HVF A;  3IWI A;  5FQI A;  3S1Y A;  4WEL A;  1L0E A;  1E3U A;  1DJB A;  1LHY A;  3HUN A;  1MKI A;  2ZD8 A;  2WUQ A;  4NET A;  2EX2 A;  5A92 A;  1W7F A;  1IYQ A;  2DRW A;  4BD0 A;  5DTS A;  3ZVW A;  2IWB A;  1SCW A;  1YLZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...