1LL8A

Structure and interactions of pas kinase n-terminal pas domain: model for intramolecular kinase regulation
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
114
structure length
114
Chain Sequence
GAMDPEFNKAIFTVDAKTTEILVANDKACGLLGYSSQDLIGQKLTQFFLRSDSDVVEALSEEHMEADGHAAVVFGTVVDIISRSGEKIPVSVWMKRMRQERRLCCVVVLEPVER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and interactions of PAS kinase N-terminal PAS domain: model for intramolecular kinase regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords PAS Kinase
total genus 14
structure length 114
sequence length 114
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ll8A00
4H6JA 4HJ4A 1N9NA 4NXEA 4I39A 1Y28A 3A0SA 4HH2A 4NXGA 4JGOA 5HZHA 3E4OA 5DJTA 5F69A 4F3LA 3C8CA 4HJ3A 3UMEA 5AVFA 1XFQA 3E4QA 3FC7A 2WKQA 3LYXA 4GS9A 4HP9A 4WN5A 3UE6A 1NWZA 2JHEA 3H82B 4L9EA 2L1MA 2OWHA 1OJ5A 2V1AA 4JGPA 4KQDA 4R6LA 3GECA 2A24A 3UB9A 4I3JA 4KUOA 1V9ZA 2PYRA 4XT2B 5A8BA 2WKPA 5HWWA 3H7WB 1X0OA 2D02A 4HOIA 4JGRA 1D7EA 5HD5A 1TS6A 4HQAA 4K08A 3BWLA 4EQ1A 5J4EA 2P7JA 5DKKA 4WLAA 4R38A 5IS1A 4E04A 3F1PB 4L9FA 3UB8A 3SW1A 3MJQA 4HI4A 4EEPA 3ICYA 2QJ7A 4PKYG 1F9IA 3LI9A 1S67L 5I5LA 3LIBA 1S66L 2PR5A 3LICA 4I3IA 4HY8A 1T19A 5HDCA 3VE3A 2JN7A 5F68A 5AVEA 1MZUA 3ZQ5A 2L4RA 1S1YA 1P97A 2CMNA 2V0UA 2ZOIA 4RQ9A 4HIAA 5G4YA 3ULFA 2INWA 3RH8B 3F1NB 1WA9A 3LIAA 4BBVA 1N9OA 2QKPA 2YKFA 1TS8A 2QHKA 3F1PA 3LI8A 4I5SA 3A0RA 2V1BA 1OTBA 2V0WA 3MFXA 5G4ZA 4LPZA 1DRMA 1UWPX 3G6OA 2QJ5A 3F1NA 1G28A 3H7WA 4XT2A 3E4PA 3A0VA 3K3DA 4WUJA 4B9OA 5HDDA 5HWVA 1GSVA 2A24B 3HJIA 4HHDA 5HWTA 2VV6A 3NOPC 2PD8A 1F98A 4EERA 1DP8A 3KX0X 3D72A 3B33A 4GS9B 4M4XA 5DKLA 2BASA 5EFWA 3CWFA 1XJ2A 1V9YA 2W0NA 3NHQA 3BY9A 1GSXA 2H28A 5DJUA 1T1AA 3MQOA 2L0WA 4R3AA 5IU1A 4R70A 1XJ4A 4JGQA 1UWNX 2I9VA 3LIFA 3PYPA 4BBUA 4DJ2A 4GCZA 4GHIA 3MR0A 1OTAA 1VB6A 3MXQA 5J3WA 3LUQA 2OOLA 1XJ6A 1JNUA 3HJKA 1S4RA 3F1OA 3GDIA 2W27A 4EESA 3UB6A 4MN6A 3UB7A 2ZBBA 4LLOB 3H9WA 4GW9A 2VV8A 3EEHA 4DJ3A 1OTIA 1OTDA 3H82A 1T1BA 2YKHA 4KUKA 2Z6DA 4LRXC 4NXFA 4I38A 2PD7A 2ZOHA 2D01A 5HD3A 4HP4A 4WF0A 3VE4A 3C2WA 1N9LA 1LL8A 2VV7A 1OTEA 5F6AA 4F3LB 1TS7A 1P0ZA 2WKRA 1T18A 1T1CA 2KX6A 2B02A 3CAXA 2M1CA 4WL9A 4BBTA 1LSXA 3IS2A 5F5YA 4YWZA 3VOLA 4EEUA 4H6JB 2PYPA 3LIEA 3NOTC 1DP6A 1GSWA 5J7EA 3LIDA 5TBMB 1S4SA 5HDSA 1LSVA 2OWJA 2J80A 3NOUC 1LSWA 1XJ3A 2PR6A 3RTYA 2HV1A 3NJAA 3IS2B 1D06A 1OT6A 1XFNA 2EA9A 4I3AA 4NXBA 1TS0A 4HJ6A 1ODVA 2VLGA 1OT9A 2QWSA 1S1ZA 3PHYA 1BYWA 2K7SA 4LRZE 4LRYC 3IBRA 2PDRA 4PKYA 3T50A 1EW0A 4EETB 1OJGA 3MQQA 1LT0A 4EXOA 1KOUA 3P7NA 5HSQA 3BY8A 3K3CA 2KDKA 4MN5A 2VEAA 2GJ3A 2R78A 2Z6CA 3CLOA 2V9AA 3OLOA 5KIZA 3EWKA 3F1OB 3UMDA 4EW7A 4HH3A 5TBMA 4HNBA 1DP9A 1UGUA 4GHIB 4L9GA 2PHYA 3FG8A
chains in the Genus database with same CATH superfamily
4H6JA 4ESPA 1FCNA 1YSPA 3PBOA 1KE0A 3TJZC 2A3UA 4N1HA 3ZNYA 1V9ZA 2PYRA 4RX2A 1K56A 3T4SA 4Y5FA 3IXBA 4MBHA 4KZ5A 3CITA 2RL3A 3QHYA 1FCMA 3HUMA 1P9RA 1GHIA 4QB8A 3O5YA 2PT7A 4HY8A 4MEZA 5HDCA 4FD8A 4E3OA 2V0UA 2INWA 3BM6A 2IWCA 5L07A 5AVEA 2XH9A 4P0MA 1TS8A 1Q2QA 4O7DA 1STZA 4S2NA 2PD8A 1BUEA 3MZDA 1YMSA 3KYQA 4LV0A 5EM1A 3LIFA 4QPRA 4X68A 3JVVA 4OPRA 4E6WA 3QNBA 4P6ZS 1H3QA 4S2LA 4I38A 5IHVA 1T1CA 2M1CA 1Y54A 2PU2A 3M6HA 3SH7A 3OPRA 2W3HA 1PWCA 1ZG4A 2OWJA 4QY5A 4IVKA 2HGVA 4I3AA 1OT6A 3BLMA 2QWSA 4IHQA 3MZFA 1LT0A 1G6OA 1H0MA 1RP5A 2NUTC 3IH8A 3NY4A 4KZ4A 2XDMA 5E2FA 1ESIA 4Y0OA 4HNBA 4EW7A 1WYBA 4GB7A 4U0TA 1LI0A 5FL3A 3UB9A 4G3WA 3GECA 4DXCA 3C7VA 2WADA 4WELA 4F94A 3ZG9B 3GSGA 3S4XA 2EXBA 2VGKA 3KO6A 2WGIA 2O0YA 2JN7A 3ZHHA 2J3TC 4WEKA 2FFYA 1WA9A 3FKVA 4S2IA 1FSWA 2M7UA 3PXPA 1UWPX 4OQHA 4LCMA 4WEJA 1F98A 4M4XA 4GN2A 2L0WA 1XJ4A 4DJ2A 4HBTA 1SHVA 4LGWA 1XKZA 1OMEA 3DWKA 4YOFA 2W27A 4PM5A 3IHAA 4WYYA 2HPBA 3QP2A 4RX3A 3VE4A 4ZDXA 5M1AA 1O07A 4WMCA 4X6TA 3VOLA 3G2YA 4ZBEA 3MKEA 4DRTA 4G3VA 5DVAA 5FATA 1LSWA 2QMIA 5U47A 3HREA 1S1ZA 4OPYA 2QZ6A 1ERMA 1KDSA 5CTMA 3BY8A 1XX2A 2KDKA 3F1OB 3IBJA 3QP4A 1QMEA 2ZLYA 4JLFA 2Y2KA 5DF9A 4HP9A 2LB9A 3CHWP 4Y13A 3Q7VB 1PYYA 4OONA 5TGFA 3T1QB 4CLCC 4BD1A 4E3NA 1MWUA 4E3IA 3A3FA 1N4OA 1ZC2A 4B4ZA 4L0LA 2M7VA 3DTMA 4RQ9A 3V5MA 4GJ4A 1LI9A 4WZ5A 3A0RA 1OTBA 2WKIA 1ZKJA 4RVAA 3CPTB 2QJ5A 3UE1A 5HFOA 1G28A 4CLCA 2W3FA 1YMXA 4YNRA 2A24B 1K54A 3KSHA 1L0GA 3B33A 2ZQ9A 1WYCA 3BY9A 4FUWA 4P6BA 3Q7ZA 1SDEA 3N4IA 2ZC4B 2Y79A 3UDIA 1PW8A 4BLMA 2O9CA 4C3QA 4C6YA 4MBFA 3EEHA 4KZ9A 1OTDA 4LRXC 3C2WA 1OTEA 1YLJA 1T18A 2WKRA 4BBTA 4EEUA 2HZ5A 3EEAA 5CEBA 3AGFA 4ETXA 3BQ8A 5DFXA 5J7EA 4UHUA 3SS3A 3K2NA 2V2FF 3IBRA 3LY3A 2Q0OA 2H0YA 5CERA 1VETB 3UN7A 5HSQA 3TOIA 1S0WA 3MS6A 5KIZA 1H8YA 3L9KA 3NECA 4B4XA 1AWIA 1SKFA 4HH2A 2KLIA 3PBRA 2W1RA 4R6LA 4HOIA 3WRTA 3T4KA 3BFEA 3BYDA 5FAOA 1K54C 4XXRA 1YLZA 4E04A 4L9FA 2JKTI 3C7UA 3VSLA 5FI6A 5J8XA 4QY6A 3LIBA 1PFLA 1T19A 4N9KA 1NRJA 2QKPA 4MMNA 2V8CA 3PR6A 1LLBA 3MXSA 2VV6A 3IX3A 2DCFA 3ZG8B 4GS9B 1XGIA 3CZDA 2BASA 1IYPA 1PZOA 3BECA 4R23A 2GX5A 2G2WA 1T1AA 1F2KA 2PBYA 4JGQA 2DMWA 4Y17A 1PNEA 4GD8A 3A3JA 3MSHA 4GW9A 2ZOHA 4KZAA 3UPPA 3VV4A 5FEGA 3IS2A 4JXVA 2JKRM 2XGNA 1AXBA 1HZOA 1DP6A 3LIDA 3DW0A 1S6RA 1XJ3A 3VOZA 5HAQA 1ODVA 1BLCA 2VLGA 3TSGA 1KVMA 1EW0A 5E2HA 2PAVP 4H8RA 2HDUA 1J3WA 1MY8A 2Y8HA 4EBLA 5HW3A 5TJJA 3P01A 5HPIA 1FILA 3VFHA 5CHUA 3O88A 4BL2A 4NXGA 4ZJ1A 3UDXA 1EWZA 5AVFA 3LYXA 2ZC5B 4Z1WA 2OLVA 3UDFA 5A91A 5HAIA 4UA9A 5CHMA 4IUHA 4NKPA 4HQAA 3BWLA 2B5RA 1Q2PA 3F1PB 5TR7A 3LCEA 4MN7A 2O99A 5GLAA 1W8YA 4DE1A 2XA7S 3HUNA 3BLSA 4OQIA 1YAXA 1K56D 2EX6A 4S2NC 1YLYA 3MQ0A 2ZQAA 1HD8A 2WKHA 1K4EA 5EE8A 3C4PA 3PBTA 4B9OA 3OPPA 1GSVA 1KDWA 4FH4A 3V3RA 4JF4A 4EV4A 2Y55A 2J3TD 5FAQA 2KOIA 4X69A 5DJUA 2HP5A 3ZG7B 1K0KA 1PRQA 2JKRI 3MXQA 1MKMA 4Y7PA 1XA7A 4MN6A 3UB7A 3KSIA 3NULA 4OP5A 3W4OA 4E6XA 3IXGA 1I2SA 1GA0A 1ESUA 5HDSA 5EOEA 1MBLA 2HDSA 4LRYC 3FYZA 4HEFA 4DF6A 4OVDA 4R3BA 1RCJA 2ZQCA 3IF6A 2QPNA 1JVJA 4P87A 4CPKA 3GRJA 4MN5A 3OLOA 4PM6A 4GHIB 1D1JA 4FSFA 3UO9A 4BD0A 1KGEA 1MWSA 4ME4A 4QWOA 5HZHA 1FIKA 3FC7A 1J9MA 3DTKA 3G30A 4O0PA 2JKTM 4Y2FA 5EVIB 4S2JA 3G32A 2AVXA 1BT5A 1K57C 4R38A 3T1XA 4WM9A 2H5SA 1SZVA 3NBLA 3RXWA 3ICYA 4NK3A 2XQZA 4LCLA 5FQMA 1YM1A 2L4RA 3ZQ5A 1DJCA 3TRCA 2DRWA 4N92A 1PWGA 2Y59A 5KSCA 3NDEA 3OBFA 1E3UD 3PAEA 3N6IA 3HBRA 2WYXA 1L3LA 1YKDA 4UA7A 1W79A 3HCYA 2V1ZA 1F5MA 2OOLA 1MWRA 2EXAA 2EX9A 2GDNA 5F83A 4O8GA 1NRFA 4YFMA 5KSHA 1N9LA 3V67A 2HP6A 5F5YA 1RGZA 1ZHHB 2Y2IA 4H6JB 3L7HA 3DWZA 1K55C 5IT5A 4Q0JA 3ZNTA 1D06A 1XFNA 5M19A 4FH2A 4FCFA 5BOHA 4EQIA 4EXOA 3P7NA 3E0YA 1VEUA 2BG1A 2Q9MA 4EUZA 4EBPA 1K4FA 1JTGA 2XLNA 2XR0A 5FDSA 3OCNA 2NUPC 3VFFA 3EQUA 4AFIA 1H8MA 4BQMA 5EVIC 2WKQA 1GHMA 4GZBA 1K38A 2EWWA 2B18A 3T4TA 1X0OA 1ZG6A 1TS6A 3GMWA 2W3EA 5FSRA 3FPVA 2WGWA 3FPWA 4PAUA 3UB8A 1N9BA 4KG6A 3LI9A 2BLSA 3BFDA 4Y0TA 1TDGA 4OP8A 1S1YA 1P97A 2ZOIA 3CUEA 5EOOA 3LIAA 1E4DA 5D3OA 5F82A 1MXOA 3W2ZA 3AGEA 4XT2A 3A0VA 1YSQA 1FCOA 2JKGA 3SS4A 2EFUA 1UWNX 1OTAA 3BEBA 2ZL1A 4D2OA 1SDNA 5A92A 1ES5A 3E2KA 2W3GA 2XF3A 4IVIA 2EWVA 2HJ9C 4NXFA 3IX4A 2HJEA 5GHXA 2JKFA 1Z6FA 3N8SA 2IA2A 2XSSA 1H8ZA 5HX9A 3IWQA 3NOUC 4MNRA 3PBNA 3GR2A 3PHYA 3VOYA 1HLUP 1VHMA 3ITBA 2B95A 2MJ6A 3N8LA 5L2FA 5HAPA 1PI4A 1MWTA 3T4LA 3TE8A 2PHYA 2VZWA 4JF6A 1IKIA 4NXEA 1BULA 3T1RA 3P98A 4JGOA 4R4RA 5DJTA 5F69A 5GL9A 3T4OA 1ALQA 2FFFB 3IWIA 1IYOA 2FH5A 2V1AA 5E43A 3G2ZA 4NETA 2WKEA 1D7EA 2P74A 3BFFA 1BSGA 1E25A 5FQQA 3SS5A 4OPQA 4S2KA 5CGWA 2ZM2A 1CEFA 2C6WB 4Q8IA 3C5AA 5MC7A 3IWOA 4PM9A 3FZCA 1DY6A 5HL1A 5G4ZA 3F1NA 2JCHA 3H7WA 3ZVTA 4PPRA 5KMWA 2Y2NA 3BQAA 5HWTA 3OPLA 3QNCA 3CWFA 3WS4A 1V9YA 1XPBA 2VGJA 1WE4A 4OOMA 2I9VA 1BLHA 4ARZA 1JNUA 2W1TA 3S1YA 2D01A 4HP4A 1K6SA 1CF0A 5EM0A 5DFYA 5HWVA 4UQIM 1ERQA 3M6BA 4JF5A 1MC0A 2E8JA 4NXBA 2EA9A 3MFDA 5FEFA 5EFWA 3QP5A 4YINA 1BLSA 5FQ9A 1NLZA 2VJWA 5GLCA 2ZM0A 1PZPA 1VQQA 3K3CA 2V9AA 3EWKA 5I94A 2Y4AA 4ETZA 5K5BA 4QJGA 2EFXA 3UB5P 1N9NA 5DTKA 2J3WA 3ZYTA 3QP8A 4F3LA 1XFQA 5L09A 4Z9QA 4I3JA 4KUOA 3H7WB 4JGRA 4K08A 3KYEA 3B47A 3GTCA 1Z09A 3MF0A 2WZXA 5GHZA 4CLCE 4CLCD 2YKFA 4I5SA 2P08A 3C38A 3MFXA 1PI5A 3G4PA 3DBAA 1BZAA 4QU3A 3E4PA 3WS2A 3WWXA 3P09A 1PIOA 3FKWA 3IQAA 4X56A 2J7VA 2A49A 1XXMA 2JE5A 4CJNA 4LENA 4DMZA 3PYPA 4GCZA 1ONGA 4LV3A 3PTEA 3ZG5A 4BWIA 2OV5A 2VV8A 3R7WB 3HLCA 4DJ3A 4O01A 5HD3A 3O87A 1K55A 4IEDA 3SZTA 1TF1A 1TEMA 3V39A 1GSWA 2EX8A 2LB5A 2Z2LB 2PR6A 2HV1A 5EECA 2XROA 2Y2GA 2PDRA 5E2EA 4DXBA 4KQQA 2UV0E 3MQQA 4U0XA 1MKIA 4HH3A 5GLBA 3S22A 4HJ4A 4DKIA 1Y28A 2Y2JA 1YLTA 3C8CA 2I72A 4C75A 2HDQA 2OWHA 5CEDA 5HPFA 2VX8A 2ZC6B 1FR6A 2O9AA 2QYBA 2WKPA 4XT2B 5HWWA 1QMFA 1KE4A 5DKKA 2X02A 2HDRA 4EU0A 1Y4OA 3IF6C 1W7FA 1NXYA 4DDSA 3IH9A 3M2KA 1MPLA 3SOIA 4Q0IA 3A3EA 3Q81A 1CEGA 3RH8B 3UPNA 3ULFA 3LI8A 4Y15A 2WGWB 1XGJA 3OOVA 4EWFA 4JBFA 3EOIA 2XD5A 3NOPC 3S7NA 4IBXA 5EPHA 1GSXA 2FZ0A 2VA0A 1K57A 4R70A 5F1GA 4BBUA 3MR0A 4PM8A 1O7EA 3PAGA 2R9WA 5FQIA 4S2MA 1VEUB 2WAFA 3OCLA 4KUKA 2Z6DA 1YLWA 3CMZA 4E3LA 4WZ4A 4WF0A 1TS7A 1LSXA 1W63M 3OZHA 2Y2QA 2ZQ7A 1FOFA 1OT9A 4LRZE 4PKYA 2V8FA 2Y2PA 3C4OA 3NIAA 4Y0UA 4JPMA 3FWLA 2R78A 5CTNA 4BL3A 1DP9A 3D4FA 4UAAA 1CK3A 1NZUA 1GHPA 4MBKA 4WN5A 3JVUA 4GDBA 2L1MA 4KZ6A 1DJBA 3TG9A 2VGLS 2JC7A 4XUZA 4GDNA 5GHYA 2DNSA 2RCXA 4JXSA 1EI5A 4FOFA 1C3BA 1KE3A 3IHBA 1F9IA 2X01A 3VE3A 1NLYA 4DN0A 2O9BA 2XK1A 3NDGA 4WBGA 3T12B 4Q0HA 1N9OA 4UEYA 2V0WA 1L0DA 1IEMA 3ZCZA 1ONHA 3N7WA 3LEQA 5EVIA 4X55A 1SKOA 2ZM8A 1ES3A 3VP4A 1NZOA 5FASA 3LFVA 4EERA 2HP9A 4GNUA 4KG2A 4UA6A 4S2OA 3MQOA 3Q07A 3O86A 4OH0A 1KVLA 3DTEA 2ZC7A 4ZJ3A 1NYYA 4GHIA 2OAP1 3GDIA 2OSUA 2ZBBA 3H9WA 1IKGA 3H82A 1T1BA 3IF6B 3CUEC 1LL8A 3BJNA 4OQGA 3UE0A 2P9VB 3NOTC 5TBMB 1S4SA 1LL9A 3NJAA 1TS0A 1P9WA 3EGXC 3S7PA 1BYWA 2G2UA 3BFGA 4EETB 4D60A 2PBDP 5AQAA 4ZJ2A 2ZQDA 5TBMA 1IYSA 4Y3IA 4GOGA 2P9VA 3NC8A 3VP1A 4K0XA 5M18A 4I39A 3WS1A 3HLBA 4HJ3A 2UWXA 1KGGA 3UE6A 1YT4A 1NWZA 2JHEA 3H82B 4P6ZM 3UNWA 4KQDA 4X53A 2WAEA 4R4SA 3GQZA 4KZBA 2Y91A 4X1LA 3G35A 5EVEA 4KG5A 4X25A 3ZFZA 3IXHA 4II7A 3LICA 3GVBA 4I3IA 3UPOA 1YPRA 1SKOB 2VGLM 1CQAA 3F1PA 3I7JA 4LPZA 2H10A 3G6OA 4R3JA 1IOUA 2OAQ1 3GV9A 5EVID 3NHQA 1VM1A 5FDHA 1ES4A 2IWBA 2Z2MB 3ZVWA 3MZEA 2J9PA 5CX7A 3LUQA 1PWDA 2XEPA 2ZC3B 3ZGAB 4EBNA 4KQOA 1P0ZA 2KX6A 3CAXA 4M3KA 4KZ3A 1BLPA 3PBQA 4XUXA 3UY6A 1GA9A 1G6AA 4RA7A 3MXRA 3IT9A 3IS2B 4R3AA 4WZ5C 2GNXA 4HJ6A 5DTSA 1PW1A 4K0WA 3T50A 1ACFA 3VP3A 1OJGA 3HVFA 3RXXA 3ZDJA 3RFBA 1JWZA 1I5QA 3W4QA 3LGOA 2ACGA 3FG8A 4ZTKA 5F1FA 5DF7A 2BTFP 3T4JA 3E4OA 5FI7A 5G18A 4MDZA 5E2GA 3UMEA 1YLPA 4GS9A 1M40A 4GD6A 5JYPA 1OJ5A 4E3JA 3CI6A 3FV7A 4EQ1A 4MCWA 2K31A 3SW1A 1KGFA 1S66L 2PR5A 2ZMAA 4PM7A 3VP0A 3QP6A 3WRZA 3KSGA 3A3DA 3KYZA 2ZJ9A 1G68A 4BJPA 4WUJA 5FQKA 3HJIA 3HLFA 3LO7A 5L8MA 2OLUA 5EUAA 3HLDA 1DP8A 3KX0X 5DKLA 4IJGA 1XJ2A 4JXWA 1M6KA 1NYMA 5CECA 1L0EA 2CC1A 3IX8A 1K25A 5DF8A 3LEZA 1H5XA 3ITAA 4LLOB 3BFCA 5FAPA 1VETA 2JBFA 3D3OA 2WZZA 5AQ9A 3U2AA 1FQGA 2Y2HA 4WL9A 5AJGA 3HLEA 4YWZA 2PYPA 2ZD8A 4N9LA 5DTTA 2Y2MA 3W4PA 3T1SA 3MKFA 2C5WB 2IWDA 1CI9A 4LFUA 4BMWA 3MMHA 1I2WA 1W63Q 3HLGA 3C30A 4QHCA 1LHYA 4WMCD 3IF5A 4L9GA 1BTLA 3LR4A 3E2LA 3A0SA 5CXWA 4R0QA 4N1XA 4OQ0A 3E4QA 3QP1A 4P85A 4B93A 1TDLA 2ZMFA 5AQ7A 2E8IA 4L9EA 3R7WA 4JGPA 1YQSA 2A24A 4CLCB 2D02A 5HD5A 4EUVA 3CPTA 2P7JA 5CHJA 2J9OA 3VMAA 5FQJA 2WUQA 4OLDA 3MJQA 4NEED 4HESA 4UQIS 1SCWA 1JTDA 4OOYA 3R4KA 1MZUA 4JXGA 3IXDA 1W8QA 3RJUA 5G4YA 5A8BA 1DRMA 2HF6A 5HDDA 1LL5A 3LR5A 3Q7VA 3D9YA 1RGYA 1TVFA 3OC2A 3D72A 1DJAA 4OLGA 2VKSA 3HL9A 3LY4A 1NJ4A 2W3DA 4KZ8A 1EROA 3V3SA 4S2PA 4MLLA 1XJ6A 3F1OA 1JWPA 4OOLA 2YKHA 5AQBA 2H0TA 3SH8A 3OPHA 3VP2A 4F3LB 4CQHA 5GLDA 4IBRA 3V50A 2ZQ8A 2J80A 3RTYA 1IYQA 4WLAA 3JYIA 3A3IA 1KOUA 3CG5A 2Z6CA 4K91A 4BENA 2WK0A 1K6RA 5CGXA 4ID4A 1TD5A 3VSKA 4QD4A 4GLQA 1JWVA 4X1MA 4G3KA 5JYOA 2W1TB 3LR0A 2Y2LA 3PBSA 1GCEA 2PRFA 1IELA 4NG2A 3NI9A 4ARZB 1CI8A 3W8KA 2XA7M 1A0KA 4IUKA 1HVBA 4DE2A 5IS1A 2GZAA 3JPUA 5HARA 2X71A 5I5LA 2PU4A 1IFQA 5F68A 5EV0A 2V20A 1OPXA 3U4LP 2CMNA 2WGVA 4HIAA 3F1NB 2QHKA 4KENB 1U60A 1CJFA 3DTIA 3K3DA 1NY0A 2G7UA 3Q82A 1XA1A 5C5KA 5TFQA 2W0NA 4A5RA 2H28A 2A2LA 3TW8A 2XRNA 3BW6A 4PMAA 3HJKA 1S4RA 4EESA 3ZG0A 4DE0A 3B42A 1FR1A 5F6AA 2VV7A 3DAVA 5J4EA 2XFTA 3LR3A 5EVLA 4DE3A 2VK3A 2P04A 4KZ7A 4RYEA 4R1GA 3UB6A 3M2JA 4FTXA 1FSYA 5HL6A 5FA7A 3N8RA 2Y2OA 2VEAA 2J8YA 1E3UA 3WS0A 3WS5A 1UGUA 3UMDA 5KZHA 3S7QA 5L10A 5FI2A 1HTZA 3Q1FA 2XFSA 2ZL1B 3S7OA 4JKTA 3G31A 4OKPA 1L0FA 4DDYA 3MBZA 5A93A 4HI4A 4GKUA 2QJ7A 4PKYG 4OPZA 3HUOA 1S67L 5LBRA 3KSFA 4EEPA 4BBVA 2V1BA 3EQVA 3HLWA 3O3VA 5CRFA 4E3MA 3EGDC 4HHDA 1ES2A 2EX2A 3G34A 3B3XA 2R9XA 4ZRRA 3UE3A 5IU1A 4PHTA 2XD1A 3E98A 4HBUA 1VB6A 5J3WA 3AGDA 4KQRA 1XP4A 3T4QA 3NCKA 1OTIA 2Q9NA 4B88A 3BRMA 2PD7A 1ZTUA 4E3KA 1L2SA 4ZAMA 2B02A 3CJMA 3LIEA 2ZMVA 2K2NA 1LSVA 4LV1A 2K7SA 3ISGA 1W5DA 4U3TA 4LV2A 3CLOA 2GJ3A 3SH9A 5A90A 5CGSA 1G5UA
chains in the Genus database with same CATH topology
5HPIA 4H6JA 1N9NA 2J3WA 4NXGA 3ZYTA 1YSPA 3E4OA 3T4JA 4F3LA 4MDZA 3UMEA 5AVFA 1XFQA 3PBOA 3LYXA 4GS9A 4Z1WA 3TJZC 1OJ5A 3CI6A 4I3JA 4KUOA 1V9ZA 2PYRA 4IUHA 3H7WB 3T4SA 4NKPA 4EQ1A 4JGRA 4Y5FA 4HQAA 4K08A 3BWLA 4MCWA 2K31A 3B47A 3CITA 3F1PB 4MN7A 3SW1A 2O99A 1P9RA 3MF0A 4CLCE 1S66L 4CLCD 2XA7S 2PR5A 3O5YA 2PT7A 4HY8A 5HDCA 1YAXA 3KSGA 2V0UA 3KYZA 2INWA 5AVEA 2YKFA 1TS8A 4I5SA 2P08A 3C38A 3MQ0A 3MFXA 4BJPA 3DBAA 1STZA 3E4PA 3PBTA 4WUJA 4B9OA 1GSVA 3HJIA 5L8MA 2PD8A 1DP8A 3KX0X 5DKLA 2J3TD 4IJGA 1XJ2A 3KYQA 2KOIA 5DJUA 4DMZA 3LIFA 3PYPA 4QPRA 2JKRI 3JVVA 4GCZA 3MXQA 1MKMA 4BWIA 4MN6A 3UB7A 4LLOB 2VV8A 3KSIA 3R7WB 4P6ZS 1H3QA 4O01A 4DJ3A 5HD3A 3D3OA 4I38A 3U2AA 1T1CA 1TF1A 2M1CA 4WL9A 5AJGA 4YWZA 2PYPA 1GSWA 2W3HA 5HDSA 2OWJA 2LB5A 2PR6A 2HGVA 2HV1A 4I3AA 1OT6A 2XROA 2QWSA 4LRYC 4IHQA 2PDRA 3MQQA 1LT0A 1G6OA 2NUTC 4BMWA 3MMHA 1W63Q 4MN5A 3OLOA 3C30A 4HH3A 4HNBA 4GHIB 4EW7A 4L9GA 4FSFA 4HJ4A 3LR4A 1Y28A 3A0SA 4ME4A 5HZHA 3C8CA 4B93A 3E4QA 3FC7A 5FL3A 2ZMFA 4L9EA 3R7WA 2OWHA 4JGPA 4O0PA 3UB9A 4G3WA 2JKTM 2A24A 3GECA 5HPFA 2VX8A 4Y2FA 2O9AA 2QYBA 2WKPA 4XT2B 5HWWA 4CLCB 2D02A 4WELA 5HD5A 4EUVA 2P7JA 5DKKA 4R38A 4EU0A 3MJQA 4NEED 3KO6A 3ICYA 4UQIS 2O0YA 3R4KA 2JN7A 1MZUA 2J3TC 2L4RA 3ZQ5A 5G4YA 4Q0IA 4WEKA 5A8BA 3ULFA 3RH8B 1WA9A 3LI8A 2M7UA 3PXPA 3TRCA 1DRMA 2HF6A 1UWPX 3OOVA 3EOIA 5HDDA 3NOPC 3LR5A 4WEJA 1F98A 3OBFA 3OC2A 3D72A 4M4XA 3S7NA 2VKSA 1GSXA 2FZ0A 2W3DA 2VA0A 2L0WA 1YKDA 4R70A 1XJ4A 3HCYA 4BBUA 4DJ2A 3MR0A 1F5MA 2OOLA 1XJ6A 3F1OA 4YOFA 2W27A 4OOLA 3OCLA 4KUKA 2YKHA 2Z6DA 4O8GA 5KSHA 4WF0A 3VE4A 1N9LA 4F3LB 3V67A 1TS7A 4CQHA 1LSXA 5F5YA 3VOLA 1ZHHB 4H6JB 1W63M 4G3VA 2J80A 5IT5A 1LSWA 3RTYA 4Q0JA 1D06A 1XFNA 4WLAA 1OT9A 4LRZE 1S1ZA 4PKYA 4EXOA 1KOUA 3P7NA 3E0YA 3BY8A 2KDKA 2R78A 2Z6CA 3F1OB 1TD5A 3IBJA 1DP9A 3OCNA 4GLQA 2NUPC 3EQUA 4G3KA 4AFIA 1H8MA 5DF9A 2WKQA 3JVUA 4HP9A 4WN5A 2LB9A 2EWWA 2W1TB 2L1MA 3LR0A 2B18A 3PBSA 2VGLS 3T4TA 1X0OA 4ARZB 1TS6A 2XA7M 4CLCC 4IUKA 2W3EA 3FPVA 3FPWA 5IS1A 4PAUA 3UB8A 2GZAA 4FOFA 1F9IA 3LI9A 5I5LA 4L0LA 1IFQA 3VE3A 1NLYA 5F68A 4DN0A 2M7VA 2O9BA 1OPXA 1S1YA 1P97A 2CMNA 2ZOIA 4Q0HA 4RQ9A 4GJ4A 4HIAA 3CUEA 3F1NB 3LIAA 1N9OA 4UEYA 2QHKA 3A0RA 1OTBA 2V0WA 2QJ5A 3W2ZA 1G28A 4CLCA 2W3FA 4XT2A 3A0VA 3K3DA 4YNRA 2A24B 3KSHA 2G7UA 3LFVA 4EERA 3B33A 5C5KA 2W0NA 1YSQA 3BY9A 2H28A 3MQOA 2A2LA 3TW8A 1UWNX 2XRNA 3BW6A 1OTAA 4GHIA 2OAP1 3HJKA 1S4RA 3GDIA 2W3GA 2Y79A 4EESA 2ZBBA 2EWVA 2HJ9C 2O9CA 3H9WA 3EEHA 3H82A 1OTDA 3B42A 1T1BA 4LRXC 2HJEA 4NXFA 3C2WA 3CUEC 1LL8A 2VV7A 1OTEA 5F6AA 5K5BA 3BJNA 2WKRA 1T18A 2IA2A 5J4EA 2XSSA 3LR3A 4BBTA 4EEUA 3EEAA 4ETXA 3NOTC 3BQ8A 5DFXA 5J7EA 5TBMB 2P04A 1S4SA 3NOUC 3PBNA 3NJAA 3K2NA 3UB6A 1TS0A 1P9WA 3EGXC 3PHYA 3S7PA 1BYWA 3IBRA 5HL6A 4EETB 1VHMA 2MJ6A 5HSQA 2VEAA 5KIZA 3T4LA 3TE8A 5TBMA 1UGUA 4Y3IA 2PHYA 3UMDA 2VZWA 3S7QA 4NXEA 4I39A 4HH2A 4JGOA 5DJTA 5F69A 4HJ3A 3T4OA 2KLIA 3UE6A 3PBRA 1NWZA 2JHEA 3H82B 4P6ZM 2FH5A 2W1RA 2V1AA 4KQDA 4R6LA 4HOIA 1D7EA 3T4KA 3S7OA 4E04A 4L9FA 2JKTI 4HI4A 2QJ7A 4PKYG 5LBRA 1S67L 3LIBA 4II7A 3LICA 3KSFA 4I3IA 1T19A 2VGLM 5MC7A 1NRJA 4EEPA 4BBVA 2QKPA 4MMNA 3F1PA 2V1BA 3EQVA 5G4ZA 4LPZA 3G6OA 3PR6A 3F1NA 1IOUA 3H7WA 2OAQ1 3EGDC 3BQAA 4HHDA 5HWTA 2VV6A 4GS9B 2BASA 3CWFA 3NHQA 1V9YA 4ZRRA 2GX5A 3UE3A 1T1AA 5IU1A 4PHTA 4JGQA 2I9VA 2DMWA 3E98A 4OOMA 5CX7A 1VB6A 5J3WA 3LUQA 4ARZA 1JNUA 3T4QA 4GW9A 2W1TA 1OTIA 2PD7A 1ZTUA 2D01A 2ZOHA 4HP4A 4KQOA 3VV4A 1P0ZA 2KX6A 2B02A 3CAXA 5DFYA 4UQIM 5HWVA 3IS2A 2JKRM 3PBQA 3LIEA 1DP6A 2ZMVA 2K2NA 3LIDA 1LSVA 1MC0A 1XJ3A 3IS2B 4NXBA 4R3AA 2EA9A 2GNXA 1ODVA 2VLGA 4HJ6A 5EFWA 2K7SA 3T50A 1EW0A 1NLZA 1OJGA 2VJWA 3RFBA 2Y8HA 3K3CA 3CLOA 2GJ3A 2V9AA 3EWKA 5TJJA 3P01A 4ETZA 3FG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H6J A;  4HJ4 A;  1N9N A;  4NXE A;  4I39 A;  1Y28 A;  3A0S A;  4HH2 A;  4NXG A;  4JGO A;  5HZH A;  3E4O A;  5DJT A;  5F69 A;  4F3L A;  3C8C A;  4HJ3 A;  3UME A;  5AVF A;  1XFQ A;  3E4Q A;  3FC7 A;  2WKQ A;  3LYX A;  4GS9 A;  4HP9 A;  4WN5 A;  3UE6 A;  1NWZ A;  2JHE A;  3H82 B;  4L9E A;  2L1M A;  2OWH A;  1OJ5 A;  2V1A A;  4JGP A;  4KQD A;  4R6L A;  3GEC A;  2A24 A;  3UB9 A;  4I3J A;  4KUO A;  1V9Z A;  2PYR A;  4XT2 B;  5A8B A;  2WKP A;  5HWW A;  3H7W B;  1X0O A;  2D02 A;  4HOI A;  4JGR A;  1D7E A;  5HD5 A;  1TS6 A;  4HQA A;  4K08 A;  3BWL A;  4EQ1 A;  5J4E A;  2P7J A;  5DKK A;  4WLA A;  4R38 A;  5IS1 A;  4E04 A;  3F1P B;  4L9F A;  3UB8 A;  3SW1 A;  3MJQ A;  4HI4 A;  4EEP A;  3ICY A;  2QJ7 A;  4PKY G;  1F9I A;  3LI9 A;  1S67 L;  5I5L A;  3LIB A;  1S66 L;  2PR5 A;  3LIC A;  4I3I A;  4HY8 A;  1T19 A;  5HDC A;  3VE3 A;  2JN7 A;  5F68 A;  5AVE A;  1MZU A;  3ZQ5 A;  2L4R A;  1S1Y A;  1P97 A;  2CMN A;  2V0U A;  2ZOI A;  4RQ9 A;  4HIA A;  5G4Y A;  3ULF A;  2INW A;  3RH8 B;  3F1N B;  1WA9 A;  3LIA A;  4BBV A;  1N9O A;  2QKP A;  2YKF A;  1TS8 A;  2QHK A;  3F1P A;  3LI8 A;  4I5S A;  3A0R A;  2V1B A;  1OTB A;  2V0W A;  3MFX A;  5G4Z A;  4LPZ A;  1DRM A;  1UWP X;  3G6O A;  2QJ5 A;  3F1N A;  1G28 A;  3H7W A;  4XT2 A;  3E4P A;  3A0V A;  3K3D A;  4WUJ A;  4B9O A;  5HDD A;  5HWV A;  1GSV A;  2A24 B;  3HJI A;  4HHD A;  5HWT A;  2VV6 A;  3NOP C;  2PD8 A;  1F98 A;  4EER A;  1DP8 A;  3KX0 X;  3D72 A;  3B33 A;  4GS9 B;  4M4X A;  5DKL A;  2BAS A;  5EFW A;  3CWF A;  1XJ2 A;  1V9Y A;  2W0N A;  3NHQ A;  3BY9 A;  1GSX A;  2H28 A;  5DJU A;  1T1A A;  3MQO A;  2L0W A;  4R3A A;  5IU1 A;  4R70 A;  1XJ4 A;  4JGQ A;  1UWN X;  2I9V A;  3LIF A;  3PYP A;  4BBU A;  4DJ2 A;  4GCZ A;  4GHI A;  3MR0 A;  1OTA A;  1VB6 A;  3MXQ A;  5J3W A;  3LUQ A;  2OOL A;  1XJ6 A;  1JNU A;  3HJK A;  1S4R A;  3F1O A;  3GDI A;  2W27 A;  4EES A;  3UB6 A;  4MN6 A;  3UB7 A;  2ZBB A;  4LLO B;  3H9W A;  4GW9 A;  2VV8 A;  3EEH A;  4DJ3 A;  1OTI A;  1OTD A;  3H82 A;  1T1B A;  2YKH A;  4KUK A;  2Z6D A;  4LRX C;  4NXF A;  4I38 A;  2PD7 A;  2ZOH A;  2D01 A;  5HD3 A;  4HP4 A;  4WF0 A;  3VE4 A;  3C2W A;  1N9L A;  1LL8 A;  2VV7 A;  1OTE A;  5F6A A;  4F3L B;  1TS7 A;  1P0Z A;  2WKR A;  1T18 A;  1T1C A;  2KX6 A;  2B02 A;  3CAX A;  2M1C A;  4WL9 A;  4BBT A;  1LSX A;  3IS2 A;  5F5Y A;  4YWZ A;  3VOL A;  4EEU A;  4H6J B;  2PYP A;  3LIE A;  3NOT C;  1DP6 A;  1GSW A;  5J7E A;  3LID A;  5TBM B;  1S4S A;  5HDS A;  1LSV A;  2OWJ A;  2J80 A;  3NOU C;  1LSW A;  1XJ3 A;  2PR6 A;  3RTY A;  2HV1 A;  3NJA A;  3IS2 B;  1D06 A;  1OT6 A;  1XFN A;  2EA9 A;  4I3A A;  4NXB A;  1TS0 A;  4HJ6 A;  1ODV A;  2VLG A;  1OT9 A;  2QWS A;  1S1Z A;  3PHY A;  1BYW A;  2K7S A;  4LRZ E;  4LRY C;  3IBR A;  2PDR A;  4PKY A;  3T50 A;  1EW0 A;  4EET B;  1OJG A;  3MQQ A;  1LT0 A;  4EXO A;  1KOU A;  3P7N A;  5HSQ A;  3BY8 A;  3K3C A;  2KDK A;  4MN5 A;  2VEA A;  2GJ3 A;  2R78 A;  2Z6C A;  3CLO A;  2V9A A;  3OLO A;  5KIZ A;  3EWK A;  3F1O B;  3UMD A;  4EW7 A;  4HH3 A;  5TBM A;  4HNB A;  1DP9 A;  1UGU A;  4GHI B;  4L9G A;  2PHY A;  3FG8 A; 
#chains in the Genus database with same CATH topology
 4H6J A;  4ESP A;  1FCN A;  1YSP A;  3PBO A;  1KE0 A;  3TJZ C;  2A3U A;  4N1H A;  3ZNY A;  1V9Z A;  2PYR A;  4RX2 A;  1K56 A;  3T4S A;  4Y5F A;  3IXB A;  4MBH A;  4KZ5 A;  3CIT A;  2RL3 A;  3QHY A;  1FCM A;  3HUM A;  1P9R A;  1GHI A;  4QB8 A;  3O5Y A;  2PT7 A;  4HY8 A;  4MEZ A;  5HDC A;  4FD8 A;  4E3O A;  2V0U A;  2INW A;  3BM6 A;  2IWC A;  5L07 A;  5AVE A;  2XH9 A;  4P0M A;  1TS8 A;  1Q2Q A;  4O7D A;  1STZ A;  4S2N A;  2PD8 A;  1BUE A;  3MZD A;  1YMS A;  3KYQ A;  4LV0 A;  5EM1 A;  3LIF A;  4QPR A;  4X68 A;  3JVV A;  4OPR A;  4E6W A;  3QNB A;  4P6Z S;  1H3Q A;  4S2L A;  4I38 A;  5IHV A;  1T1C A;  2M1C A;  1Y54 A;  2PU2 A;  3M6H A;  3SH7 A;  3OPR A;  2W3H A;  1PWC A;  1ZG4 A;  2OWJ A;  4QY5 A;  4IVK A;  2HGV A;  4I3A A;  1OT6 A;  3BLM A;  2QWS A;  4IHQ A;  3MZF A;  1LT0 A;  1G6O A;  1H0M A;  1RP5 A;  2NUT C;  3IH8 A;  3NY4 A;  4KZ4 A;  2XDM A;  5E2F A;  1ESI A;  4Y0O A;  4HNB A;  4EW7 A;  1WYB A;  4GB7 A;  4U0T A;  1LI0 A;  5FL3 A;  3UB9 A;  4G3W A;  3GEC A;  4DXC A;  3C7V A;  2WAD A;  4WEL A;  4F94 A;  3ZG9 B;  3GSG A;  3S4X A;  2EXB A;  2VGK A;  3KO6 A;  2WGI A;  2O0Y A;  2JN7 A;  3ZHH A;  2J3T C;  4WEK A;  2FFY A;  1WA9 A;  3FKV A;  4S2I A;  1FSW A;  2M7U A;  3PXP A;  1UWP X;  4OQH A;  4LCM A;  4WEJ A;  1F98 A;  4M4X A;  4GN2 A;  2L0W A;  1XJ4 A;  4DJ2 A;  4HBT A;  1SHV A;  4LGW A;  1XKZ A;  1OME A;  3DWK A;  4YOF A;  2W27 A;  4PM5 A;  3IHA A;  4WYY A;  2HPB A;  3QP2 A;  4RX3 A;  3VE4 A;  4ZDX A;  5M1A A;  1O07 A;  4WMC A;  4X6T A;  3VOL A;  3G2Y A;  4ZBE A;  3MKE A;  4DRT A;  4G3V A;  5DVA A;  5FAT A;  1LSW A;  2QMI A;  5U47 A;  3HRE A;  1S1Z A;  4OPY A;  2QZ6 A;  1ERM A;  1KDS A;  5CTM A;  3BY8 A;  1XX2 A;  2KDK A;  3F1O B;  3IBJ A;  3QP4 A;  1QME A;  2ZLY A;  4JLF A;  2Y2K A;  5DF9 A;  4HP9 A;  2LB9 A;  3CHW P;  4Y13 A;  3Q7V B;  1PYY A;  4OON A;  5TGF A;  3T1Q B;  4CLC C;  4BD1 A;  4E3N A;  1MWU A;  4E3I A;  3A3F A;  1N4O A;  1ZC2 A;  4B4Z A;  4L0L A;  2M7V A;  3DTM A;  4RQ9 A;  3V5M A;  4GJ4 A;  1LI9 A;  4WZ5 A;  3A0R A;  1OTB A;  2WKI A;  1ZKJ A;  4RVA A;  3CPT B;  2QJ5 A;  3UE1 A;  5HFO A;  1G28 A;  4CLC A;  2W3F A;  1YMX A;  4YNR A;  2A24 B;  1K54 A;  3KSH A;  1L0G A;  3B33 A;  2ZQ9 A;  1WYC A;  3BY9 A;  4FUW A;  4P6B A;  3Q7Z A;  1SDE A;  3N4I A;  2ZC4 B;  2Y79 A;  3UDI A;  1PW8 A;  4BLM A;  2O9C A;  4C3Q A;  4C6Y A;  4MBF A;  3EEH A;  4KZ9 A;  1OTD A;  4LRX C;  3C2W A;  1OTE A;  1YLJ A;  1T18 A;  2WKR A;  4BBT A;  4EEU A;  2HZ5 A;  3EEA A;  5CEB A;  3AGF A;  4ETX A;  3BQ8 A;  5DFX A;  5J7E A;  4UHU A;  3SS3 A;  3K2N A;  2V2F F;  3IBR A;  3LY3 A;  2Q0O A;  2H0Y A;  5CER A;  1VET B;  3UN7 A;  5HSQ A;  3TOI A;  1S0W A;  3MS6 A;  5KIZ A;  1H8Y A;  3L9K A;  3NEC A;  4B4X A;  1AWI A;  1SKF A;  4HH2 A;  2KLI A;  3PBR A;  2W1R A;  4R6L A;  4HOI A;  3WRT A;  3T4K A;  3BFE A;  3BYD A;  5FAO A;  1K54 C;  4XXR A;  1YLZ A;  4E04 A;  4L9F A;  2JKT I;  3C7U A;  3VSL A;  5FI6 A;  5J8X A;  4QY6 A;  3LIB A;  1PFL A;  1T19 A;  4N9K A;  1NRJ A;  2QKP A;  4MMN A;  2V8C A;  3PR6 A;  1LLB A;  3MXS A;  2VV6 A;  3IX3 A;  2DCF A;  3ZG8 B;  4GS9 B;  1XGI A;  3CZD A;  2BAS A;  1IYP A;  1PZO A;  3BEC A;  4R23 A;  2GX5 A;  2G2W A;  1T1A A;  1F2K A;  2PBY A;  4JGQ A;  2DMW A;  4Y17 A;  1PNE A;  4GD8 A;  3A3J A;  3MSH A;  4GW9 A;  2ZOH A;  4KZA A;  3UPP A;  3VV4 A;  5FEG A;  3IS2 A;  4JXV A;  2JKR M;  2XGN A;  1AXB A;  1HZO A;  1DP6 A;  3LID A;  3DW0 A;  1S6R A;  1XJ3 A;  3VOZ A;  5HAQ A;  1ODV A;  1BLC A;  2VLG A;  3TSG A;  1KVM A;  1EW0 A;  5E2H A;  2PAV P;  4H8R A;  2HDU A;  1J3W A;  1MY8 A;  2Y8H A;  4EBL A;  5HW3 A;  5TJJ A;  3P01 A;  5HPI A;  1FIL A;  3VFH A;  5CHU A;  3O88 A;  4BL2 A;  4NXG A;  4ZJ1 A;  3UDX A;  1EWZ A;  5AVF A;  3LYX A;  2ZC5 B;  4Z1W A;  2OLV A;  3UDF A;  5A91 A;  5HAI A;  4UA9 A;  5CHM A;  4IUH A;  4NKP A;  4HQA A;  3BWL A;  2B5R A;  1Q2P A;  3F1P B;  5TR7 A;  3LCE A;  4MN7 A;  2O99 A;  5GLA A;  1W8Y A;  4DE1 A;  2XA7 S;  3HUN A;  3BLS A;  4OQI A;  1YAX A;  1K56 D;  2EX6 A;  4S2N C;  1YLY A;  3MQ0 A;  2ZQA A;  1HD8 A;  2WKH A;  1K4E A;  5EE8 A;  3C4P A;  3PBT A;  4B9O A;  3OPP A;  1GSV A;  1KDW A;  4FH4 A;  3V3R A;  4JF4 A;  4EV4 A;  2Y55 A;  2J3T D;  5FAQ A;  2KOI A;  4X69 A;  5DJU A;  2HP5 A;  3ZG7 B;  1K0K A;  1PRQ A;  2JKR I;  3MXQ A;  1MKM A;  4Y7P A;  1XA7 A;  4MN6 A;  3UB7 A;  3KSI A;  3NUL A;  4OP5 A;  3W4O A;  4E6X A;  3IXG A;  1I2S A;  1GA0 A;  1ESU A;  5HDS A;  5EOE A;  1MBL A;  2HDS A;  4LRY C;  3FYZ A;  4HEF A;  4DF6 A;  4OVD A;  4R3B A;  1RCJ A;  2ZQC A;  3IF6 A;  2QPN A;  1JVJ A;  4P87 A;  4CPK A;  3GRJ A;  4MN5 A;  3OLO A;  4PM6 A;  4GHI B;  1D1J A;  4FSF A;  3UO9 A;  4BD0 A;  1KGE A;  1MWS A;  4ME4 A;  4QWO A;  5HZH A;  1FIK A;  3FC7 A;  1J9M A;  3DTK A;  3G30 A;  4O0P A;  2JKT M;  4Y2F A;  5EVI B;  4S2J A;  3G32 A;  2AVX A;  1BT5 A;  1K57 C;  4R38 A;  3T1X A;  4WM9 A;  2H5S A;  1SZV A;  3NBL A;  3RXW A;  3ICY A;  4NK3 A;  2XQZ A;  4LCL A;  5FQM A;  1YM1 A;  2L4R A;  3ZQ5 A;  1DJC A;  3TRC A;  2DRW A;  4N92 A;  1PWG A;  2Y59 A;  5KSC A;  3NDE A;  3OBF A;  1E3U D;  3PAE A;  3N6I A;  3HBR A;  2WYX A;  1L3L A;  1YKD A;  4UA7 A;  1W79 A;  3HCY A;  2V1Z A;  1F5M A;  2OOL A;  1MWR A;  2EXA A;  2EX9 A;  2GDN A;  5F83 A;  4O8G A;  1NRF A;  4YFM A;  5KSH A;  1N9L A;  3V67 A;  2HP6 A;  5F5Y A;  1RGZ A;  1ZHH B;  2Y2I A;  4H6J B;  3L7H A;  3DWZ A;  1K55 C;  5IT5 A;  4Q0J A;  3ZNT A;  1D06 A;  1XFN A;  5M19 A;  4FH2 A;  4FCF A;  5BOH A;  4EQI A;  4EXO A;  3P7N A;  3E0Y A;  1VEU A;  2BG1 A;  2Q9M A;  4EUZ A;  4EBP A;  1K4F A;  1JTG A;  2XLN A;  2XR0 A;  5FDS A;  3OCN A;  2NUP C;  3VFF A;  3EQU A;  4AFI A;  1H8M A;  4BQM A;  5EVI C;  2WKQ A;  1GHM A;  4GZB A;  1K38 A;  2EWW A;  2B18 A;  3T4T A;  1X0O A;  1ZG6 A;  1TS6 A;  3GMW A;  2W3E A;  5FSR A;  3FPV A;  2WGW A;  3FPW A;  4PAU A;  3UB8 A;  1N9B A;  4KG6 A;  3LI9 A;  2BLS A;  3BFD A;  4Y0T A;  1TDG A;  4OP8 A;  1S1Y A;  1P97 A;  2ZOI A;  3CUE A;  5EOO A;  3LIA A;  1E4D A;  5D3O A;  5F82 A;  1MXO A;  3W2Z A;  3AGE A;  4XT2 A;  3A0V A;  1YSQ A;  1FCO A;  2JKG A;  3SS4 A;  2EFU A;  1UWN X;  1OTA A;  3BEB A;  2ZL1 A;  4D2O A;  1SDN A;  5A92 A;  1ES5 A;  3E2K A;  2W3G A;  2XF3 A;  4IVI A;  2EWV A;  2HJ9 C;  4NXF A;  3IX4 A;  2HJE A;  5GHX A;  2JKF A;  1Z6F A;  3N8S A;  2IA2 A;  2XSS A;  1H8Z A;  5HX9 A;  3IWQ A;  3NOU C;  4MNR A;  3PBN A;  3GR2 A;  3PHY A;  3VOY A;  1HLU P;  1VHM A;  3ITB A;  2B95 A;  2MJ6 A;  3N8L A;  5L2F A;  5HAP A;  1PI4 A;  1MWT A;  3T4L A;  3TE8 A;  2PHY A;  2VZW A;  4JF6 A;  1IKI A;  4NXE A;  1BUL A;  3T1R A;  3P98 A;  4JGO A;  4R4R A;  5DJT A;  5F69 A;  5GL9 A;  3T4O A;  1ALQ A;  2FFF B;  3IWI A;  1IYO A;  2FH5 A;  2V1A A;  5E43 A;  3G2Z A;  4NET A;  2WKE A;  1D7E A;  2P74 A;  3BFF A;  1BSG A;  1E25 A;  5FQQ A;  3SS5 A;  4OPQ A;  4S2K A;  5CGW A;  2ZM2 A;  1CEF A;  2C6W B;  4Q8I A;  3C5A A;  5MC7 A;  3IWO A;  4PM9 A;  3FZC A;  1DY6 A;  5HL1 A;  5G4Z A;  3F1N A;  2JCH A;  3H7W A;  3ZVT A;  4PPR A;  5KMW A;  2Y2N A;  3BQA A;  5HWT A;  3OPL A;  3QNC A;  3CWF A;  3WS4 A;  1V9Y A;  1XPB A;  2VGJ A;  1WE4 A;  4OOM A;  2I9V A;  1BLH A;  4ARZ A;  1JNU A;  2W1T A;  3S1Y A;  2D01 A;  4HP4 A;  1K6S A;  1CF0 A;  5EM0 A;  5DFY A;  5HWV A;  4UQI M;  1ERQ A;  3M6B A;  4JF5 A;  1MC0 A;  2E8J A;  4NXB A;  2EA9 A;  3MFD A;  5FEF A;  5EFW A;  3QP5 A;  4YIN A;  1BLS A;  5FQ9 A;  1NLZ A;  2VJW A;  5GLC A;  2ZM0 A;  1PZP A;  1VQQ A;  3K3C A;  2V9A A;  3EWK A;  5I94 A;  2Y4A A;  4ETZ A;  5K5B A;  4QJG A;  2EFX A;  3UB5 P;  1N9N A;  5DTK A;  2J3W A;  3ZYT A;  3QP8 A;  4F3L A;  1XFQ A;  5L09 A;  4Z9Q A;  4I3J A;  4KUO A;  3H7W B;  4JGR A;  4K08 A;  3KYE A;  3B47 A;  3GTC A;  1Z09 A;  3MF0 A;  2WZX A;  5GHZ A;  4CLC E;  4CLC D;  2YKF A;  4I5S A;  2P08 A;  3C38 A;  3MFX A;  1PI5 A;  3G4P A;  3DBA A;  1BZA A;  4QU3 A;  3E4P A;  3WS2 A;  3WWX A;  3P09 A;  1PIO A;  3FKW A;  3IQA A;  4X56 A;  2J7V A;  2A49 A;  1XXM A;  2JE5 A;  4CJN A;  4LEN A;  4DMZ A;  3PYP A;  4GCZ A;  1ONG A;  4LV3 A;  3PTE A;  3ZG5 A;  4BWI A;  2OV5 A;  2VV8 A;  3R7W B;  3HLC A;  4DJ3 A;  4O01 A;  5HD3 A;  3O87 A;  1K55 A;  4IED A;  3SZT A;  1TF1 A;  1TEM A;  3V39 A;  1GSW A;  2EX8 A;  2LB5 A;  2Z2L B;  2PR6 A;  2HV1 A;  5EEC A;  2XRO A;  2Y2G A;  2PDR A;  5E2E A;  4DXB A;  4KQQ A;  2UV0 E;  3MQQ A;  4U0X A;  1MKI A;  4HH3 A;  5GLB A;  3S22 A;  4HJ4 A;  4DKI A;  1Y28 A;  2Y2J A;  1YLT A;  3C8C A;  2I72 A;  4C75 A;  2HDQ A;  2OWH A;  5CED A;  5HPF A;  2VX8 A;  2ZC6 B;  1FR6 A;  2O9A A;  2QYB A;  2WKP A;  4XT2 B;  5HWW A;  1QMF A;  1KE4 A;  5DKK A;  2X02 A;  2HDR A;  4EU0 A;  1Y4O A;  3IF6 C;  1W7F A;  1NXY A;  4DDS A;  3IH9 A;  3M2K A;  1MPL A;  3SOI A;  4Q0I A;  3A3E A;  3Q81 A;  1CEG A;  3RH8 B;  3UPN A;  3ULF A;  3LI8 A;  4Y15 A;  2WGW B;  1XGJ A;  3OOV A;  4EWF A;  4JBF A;  3EOI A;  2XD5 A;  3NOP C;  3S7N A;  4IBX A;  5EPH A;  1GSX A;  2FZ0 A;  2VA0 A;  1K57 A;  4R70 A;  5F1G A;  4BBU A;  3MR0 A;  4PM8 A;  1O7E A;  3PAG A;  2R9W A;  5FQI A;  4S2M A;  1VEU B;  2WAF A;  3OCL A;  4KUK A;  2Z6D A;  1YLW A;  3CMZ A;  4E3L A;  4WZ4 A;  4WF0 A;  1TS7 A;  1LSX A;  1W63 M;  3OZH A;  2Y2Q A;  2ZQ7 A;  1FOF A;  1OT9 A;  4LRZ E;  4PKY A;  2V8F A;  2Y2P A;  3C4O A;  3NIA A;  4Y0U A;  4JPM A;  3FWL A;  2R78 A;  5CTN A;  4BL3 A;  1DP9 A;  3D4F A;  4UAA A;  1CK3 A;  1NZU A;  1GHP A;  4MBK A;  4WN5 A;  3JVU A;  4GDB A;  2L1M A;  4KZ6 A;  1DJB A;  3TG9 A;  2VGL S;  2JC7 A;  4XUZ A;  4GDN A;  5GHY A;  2DNS A;  2RCX A;  4JXS A;  1EI5 A;  4FOF A;  1C3B A;  1KE3 A;  3IHB A;  1F9I A;  2X01 A;  3VE3 A;  1NLY A;  4DN0 A;  2O9B A;  2XK1 A;  3NDG A;  4WBG A;  3T12 B;  4Q0H A;  1N9O A;  4UEY A;  2V0W A;  1L0D A;  1IEM A;  3ZCZ A;  1ONH A;  3N7W A;  3LEQ A;  5EVI A;  4X55 A;  1SKO A;  2ZM8 A;  1ES3 A;  3VP4 A;  1NZO A;  5FAS A;  3LFV A;  4EER A;  2HP9 A;  4GNU A;  4KG2 A;  4UA6 A;  4S2O A;  3MQO A;  3Q07 A;  3O86 A;  4OH0 A;  1KVL A;  3DTE A;  2ZC7 A;  4ZJ3 A;  1NYY A;  4GHI A;  2OAP 1;  3GDI A;  2OSU A;  2ZBB A;  3H9W A;  1IKG A;  3H82 A;  1T1B A;  3IF6 B;  3CUE C;  1LL8 A;  3BJN A;  4OQG A;  3UE0 A;  2P9V B;  3NOT C;  5TBM B;  1S4S A;  1LL9 A;  3NJA A;  1TS0 A;  1P9W A;  3EGX C;  3S7P A;  1BYW A;  2G2U A;  3BFG A;  4EET B;  4D60 A;  2PBD P;  5AQA A;  4ZJ2 A;  2ZQD A;  5TBM A;  1IYS A;  4Y3I A;  4GOG A;  2P9V A;  3NC8 A;  3VP1 A;  4K0X A;  5M18 A;  4I39 A;  3WS1 A;  3HLB A;  4HJ3 A;  2UWX A;  1KGG A;  3UE6 A;  1YT4 A;  1NWZ A;  2JHE A;  3H82 B;  4P6Z M;  3UNW A;  4KQD A;  4X53 A;  2WAE A;  4R4S A;  3GQZ A;  4KZB A;  2Y91 A;  4X1L A;  3G35 A;  5EVE A;  4KG5 A;  4X25 A;  3ZFZ A;  3IXH A;  4II7 A;  3LIC A;  3GVB A;  4I3I A;  3UPO A;  1YPR A;  1SKO B;  2VGL M;  1CQA A;  3F1P A;  3I7J A;  4LPZ A;  2H10 A;  3G6O A;  4R3J A;  1IOU A;  2OAQ 1;  3GV9 A;  5EVI D;  3NHQ A;  1VM1 A;  5FDH A;  1ES4 A;  2IWB A;  2Z2M B;  3ZVW A;  3MZE A;  2J9P A;  5CX7 A;  3LUQ A;  1PWD A;  2XEP A;  2ZC3 B;  3ZGA B;  4EBN A;  4KQO A;  1P0Z A;  2KX6 A;  3CAX A;  4M3K A;  4KZ3 A;  1BLP A;  3PBQ A;  4XUX A;  3UY6 A;  1GA9 A;  1G6A A;  4RA7 A;  3MXR A;  3IT9 A;  3IS2 B;  4R3A A;  4WZ5 C;  2GNX A;  4HJ6 A;  5DTS A;  1PW1 A;  4K0W A;  3T50 A;  1ACF A;  3VP3 A;  1OJG A;  3HVF A;  3RXX A;  3ZDJ A;  3RFB A;  1JWZ A;  1I5Q A;  3W4Q A;  3LGO A;  2ACG A;  3FG8 A;  4ZTK A;  5F1F A;  5DF7 A;  2BTF P;  3T4J A;  3E4O A;  5FI7 A;  5G18 A;  4MDZ A;  5E2G A;  3UME A;  1YLP A;  4GS9 A;  1M40 A;  4GD6 A;  5JYP A;  1OJ5 A;  4E3J A;  3CI6 A;  3FV7 A;  4EQ1 A;  4MCW A;  2K31 A;  3SW1 A;  1KGF A;  1S66 L;  2PR5 A;  2ZMA A;  4PM7 A;  3VP0 A;  3QP6 A;  3WRZ A;  3KSG A;  3A3D A;  3KYZ A;  2ZJ9 A;  1G68 A;  4BJP A;  4WUJ A;  5FQK A;  3HJI A;  3HLF A;  3LO7 A;  5L8M A;  2OLU A;  5EUA A;  3HLD A;  1DP8 A;  3KX0 X;  5DKL A;  4IJG A;  1XJ2 A;  4JXW A;  1M6K A;  1NYM A;  5CEC A;  1L0E A;  2CC1 A;  3IX8 A;  1K25 A;  5DF8 A;  3LEZ A;  1H5X A;  3ITA A;  4LLO B;  3BFC A;  5FAP A;  1VET A;  2JBF A;  3D3O A;  2WZZ A;  5AQ9 A;  3U2A A;  1FQG A;  2Y2H A;  4WL9 A;  5AJG A;  3HLE A;  4YWZ A;  2PYP A;  2ZD8 A;  4N9L A;  5DTT A;  2Y2M A;  3W4P A;  3T1S A;  3MKF A;  2C5W B;  2IWD A;  1CI9 A;  4LFU A;  4BMW A;  3MMH A;  1I2W A;  1W63 Q;  3HLG A;  3C30 A;  4QHC A;  1LHY A;  4WMC D;  3IF5 A;  4L9G A;  1BTL A;  3LR4 A;  3E2L A;  3A0S A;  5CXW A;  4R0Q A;  4N1X A;  4OQ0 A;  3E4Q A;  3QP1 A;  4P85 A;  4B93 A;  1TDL A;  2ZMF A;  5AQ7 A;  2E8I A;  4L9E A;  3R7W A;  4JGP A;  1YQS A;  2A24 A;  4CLC B;  2D02 A;  5HD5 A;  4EUV A;  3CPT A;  2P7J A;  5CHJ A;  2J9O A;  3VMA A;  5FQJ A;  2WUQ A;  4OLD A;  3MJQ A;  4NEE D;  4HES A;  4UQI S;  1SCW A;  1JTD A;  4OOY A;  3R4K A;  1MZU A;  4JXG A;  3IXD A;  1W8Q A;  3RJU A;  5G4Y A;  5A8B A;  1DRM A;  2HF6 A;  5HDD A;  1LL5 A;  3LR5 A;  3Q7V A;  3D9Y A;  1RGY A;  1TVF A;  3OC2 A;  3D72 A;  1DJA A;  4OLG A;  2VKS A;  3HL9 A;  3LY4 A;  1NJ4 A;  2W3D A;  4KZ8 A;  1ERO A;  3V3S A;  4S2P A;  4MLL A;  1XJ6 A;  3F1O A;  1JWP A;  4OOL A;  2YKH A;  5AQB A;  2H0T A;  3SH8 A;  3OPH A;  3VP2 A;  4F3L B;  4CQH A;  5GLD A;  4IBR A;  3V50 A;  2ZQ8 A;  2J80 A;  3RTY A;  1IYQ A;  4WLA A;  3JYI A;  3A3I A;  1KOU A;  3CG5 A;  2Z6C A;  4K91 A;  4BEN A;  2WK0 A;  1K6R A;  5CGX A;  4ID4 A;  1TD5 A;  3VSK A;  4QD4 A;  4GLQ A;  1JWV A;  4X1M A;  4G3K A;  5JYO A;  2W1T B;  3LR0 A;  2Y2L A;  3PBS A;  1GCE A;  2PRF A;  1IEL A;  4NG2 A;  3NI9 A;  4ARZ B;  1CI8 A;  3W8K A;  2XA7 M;  1A0K A;  4IUK A;  1HVB A;  4DE2 A;  5IS1 A;  2GZA A;  3JPU A;  5HAR A;  2X71 A;  5I5L A;  2PU4 A;  1IFQ A;  5F68 A;  5EV0 A;  2V20 A;  1OPX A;  3U4L P;  2CMN A;  2WGV A;  4HIA A;  3F1N B;  2QHK A;  4KEN B;  1U60 A;  1CJF A;  3DTI A;  3K3D A;  1NY0 A;  2G7U A;  3Q82 A;  1XA1 A;  5C5K A;  5TFQ A;  2W0N A;  4A5R A;  2H28 A;  2A2L A;  3TW8 A;  2XRN A;  3BW6 A;  4PMA A;  3HJK A;  1S4R A;  4EES A;  3ZG0 A;  4DE0 A;  3B42 A;  1FR1 A;  5F6A A;  2VV7 A;  3DAV A;  5J4E A;  2XFT A;  3LR3 A;  5EVL A;  4DE3 A;  2VK3 A;  2P04 A;  4KZ7 A;  4RYE A;  4R1G A;  3UB6 A;  3M2J A;  4FTX A;  1FSY A;  5HL6 A;  5FA7 A;  3N8R A;  2Y2O A;  2VEA A;  2J8Y A;  1E3U A;  3WS0 A;  3WS5 A;  1UGU A;  3UMD A;  5KZH A;  3S7Q A;  5L10 A;  5FI2 A;  1HTZ A;  3Q1F A;  2XFS A;  2ZL1 B;  3S7O A;  4JKT A;  3G31 A;  4OKP A;  1L0F A;  4DDY A;  3MBZ A;  5A93 A;  4HI4 A;  4GKU A;  2QJ7 A;  4PKY G;  4OPZ A;  3HUO A;  1S67 L;  5LBR A;  3KSF A;  4EEP A;  4BBV A;  2V1B A;  3EQV A;  3HLW A;  3O3V A;  5CRF A;  4E3M A;  3EGD C;  4HHD A;  1ES2 A;  2EX2 A;  3G34 A;  3B3X A;  2R9X A;  4ZRR A;  3UE3 A;  5IU1 A;  4PHT A;  2XD1 A;  3E98 A;  4HBU A;  1VB6 A;  5J3W A;  3AGD A;  4KQR A;  1XP4 A;  3T4Q A;  3NCK A;  1OTI A;  2Q9N A;  4B88 A;  3BRM A;  2PD7 A;  1ZTU A;  4E3K A;  1L2S A;  4ZAM A;  2B02 A;  3CJM A;  3LIE A;  2ZMV A;  2K2N A;  1LSV A;  4LV1 A;  2K7S A;  3ISG A;  1W5D A;  4U3T A;  4LV2 A;  3CLO A;  2GJ3 A;  3SH9 A;  5A90 A;  5CGS A;  1G5U A; 
#chains in the Genus database with same CATH homology
 5HPI A;  4H6J A;  1N9N A;  2J3W A;  4NXG A;  3ZYT A;  1YSP A;  3E4O A;  3T4J A;  4F3L A;  4MDZ A;  3UME A;  5AVF A;  1XFQ A;  3PBO A;  3LYX A;  4GS9 A;  4Z1W A;  3TJZ C;  1OJ5 A;  3CI6 A;  4I3J A;  4KUO A;  1V9Z A;  2PYR A;  4IUH A;  3H7W B;  3T4S A;  4NKP A;  4EQ1 A;  4JGR A;  4Y5F A;  4HQA A;  4K08 A;  3BWL A;  4MCW A;  2K31 A;  3B47 A;  3CIT A;  3F1P B;  4MN7 A;  3SW1 A;  2O99 A;  1P9R A;  3MF0 A;  4CLC E;  1S66 L;  4CLC D;  2XA7 S;  2PR5 A;  3O5Y A;  2PT7 A;  4HY8 A;  5HDC A;  1YAX A;  3KSG A;  2V0U A;  3KYZ A;  2INW A;  5AVE A;  2YKF A;  1TS8 A;  4I5S A;  2P08 A;  3C38 A;  3MQ0 A;  3MFX A;  4BJP A;  3DBA A;  1STZ A;  3E4P A;  3PBT A;  4WUJ A;  4B9O A;  1GSV A;  3HJI A;  5L8M A;  2PD8 A;  1DP8 A;  3KX0 X;  5DKL A;  2J3T D;  4IJG A;  1XJ2 A;  3KYQ A;  2KOI A;  5DJU A;  4DMZ A;  3LIF A;  3PYP A;  4QPR A;  2JKR I;  3JVV A;  4GCZ A;  3MXQ A;  1MKM A;  4BWI A;  4MN6 A;  3UB7 A;  4LLO B;  2VV8 A;  3KSI A;  3R7W B;  4P6Z S;  1H3Q A;  4O01 A;  4DJ3 A;  5HD3 A;  3D3O A;  4I38 A;  3U2A A;  1T1C A;  1TF1 A;  2M1C A;  4WL9 A;  5AJG A;  4YWZ A;  2PYP A;  1GSW A;  2W3H A;  5HDS A;  2OWJ A;  2LB5 A;  2PR6 A;  2HGV A;  2HV1 A;  4I3A A;  1OT6 A;  2XRO A;  2QWS A;  4LRY C;  4IHQ A;  2PDR A;  3MQQ A;  1LT0 A;  1G6O A;  2NUT C;  4BMW A;  3MMH A;  1W63 Q;  4MN5 A;  3OLO A;  3C30 A;  4HH3 A;  4HNB A;  4GHI B;  4EW7 A;  4L9G A;  4FSF A;  4HJ4 A;  3LR4 A;  1Y28 A;  3A0S A;  4ME4 A;  5HZH A;  3C8C A;  4B93 A;  3E4Q A;  3FC7 A;  5FL3 A;  2ZMF A;  4L9E A;  3R7W A;  2OWH A;  4JGP A;  4O0P A;  3UB9 A;  4G3W A;  2JKT M;  2A24 A;  3GEC A;  5HPF A;  2VX8 A;  4Y2F A;  2O9A A;  2QYB A;  2WKP A;  4XT2 B;  5HWW A;  4CLC B;  2D02 A;  4WEL A;  5HD5 A;  4EUV A;  2P7J A;  5DKK A;  4R38 A;  4EU0 A;  3MJQ A;  4NEE D;  3KO6 A;  3ICY A;  4UQI S;  2O0Y A;  3R4K A;  2JN7 A;  1MZU A;  2J3T C;  2L4R A;  3ZQ5 A;  5G4Y A;  4Q0I A;  4WEK A;  5A8B A;  3ULF A;  3RH8 B;  1WA9 A;  3LI8 A;  2M7U A;  3PXP A;  3TRC A;  1DRM A;  2HF6 A;  1UWP X;  3OOV A;  3EOI A;  5HDD A;  3NOP C;  3LR5 A;  4WEJ A;  1F98 A;  3OBF A;  3OC2 A;  3D72 A;  4M4X A;  3S7N A;  2VKS A;  1GSX A;  2FZ0 A;  2W3D A;  2VA0 A;  2L0W A;  1YKD A;  4R70 A;  1XJ4 A;  3HCY A;  4BBU A;  4DJ2 A;  3MR0 A;  1F5M A;  2OOL A;  1XJ6 A;  3F1O A;  4YOF A;  2W27 A;  4OOL A;  3OCL A;  4KUK A;  2YKH A;  2Z6D A;  4O8G A;  5KSH A;  4WF0 A;  3VE4 A;  1N9L A;  4F3L B;  3V67 A;  1TS7 A;  4CQH A;  1LSX A;  5F5Y A;  3VOL A;  1ZHH B;  4H6J B;  1W63 M;  4G3V A;  2J80 A;  5IT5 A;  1LSW A;  3RTY A;  4Q0J A;  1D06 A;  1XFN A;  4WLA A;  1OT9 A;  4LRZ E;  1S1Z A;  4PKY A;  4EXO A;  1KOU A;  3P7N A;  3E0Y A;  3BY8 A;  2KDK A;  2R78 A;  2Z6C A;  3F1O B;  1TD5 A;  3IBJ A;  1DP9 A;  3OCN A;  4GLQ A;  2NUP C;  3EQU A;  4G3K A;  4AFI A;  1H8M A;  5DF9 A;  2WKQ A;  3JVU A;  4HP9 A;  4WN5 A;  2LB9 A;  2EWW A;  2W1T B;  2L1M A;  3LR0 A;  2B18 A;  3PBS A;  2VGL S;  3T4T A;  1X0O A;  4ARZ B;  1TS6 A;  2XA7 M;  4CLC C;  4IUK A;  2W3E A;  3FPV A;  3FPW A;  5IS1 A;  4PAU A;  3UB8 A;  2GZA A;  4FOF A;  1F9I A;  3LI9 A;  5I5L A;  4L0L A;  1IFQ A;  3VE3 A;  1NLY A;  5F68 A;  4DN0 A;  2M7V A;  2O9B A;  1OPX A;  1S1Y A;  1P97 A;  2CMN A;  2ZOI A;  4Q0H A;  4RQ9 A;  4GJ4 A;  4HIA A;  3CUE A;  3F1N B;  3LIA A;  1N9O A;  4UEY A;  2QHK A;  3A0R A;  1OTB A;  2V0W A;  2QJ5 A;  3W2Z A;  1G28 A;  4CLC A;  2W3F A;  4XT2 A;  3A0V A;  3K3D A;  4YNR A;  2A24 B;  3KSH A;  2G7U A;  3LFV A;  4EER A;  3B33 A;  5C5K A;  2W0N A;  1YSQ A;  3BY9 A;  2H28 A;  3MQO A;  2A2L A;  3TW8 A;  1UWN X;  2XRN A;  3BW6 A;  1OTA A;  4GHI A;  2OAP 1;  3HJK A;  1S4R A;  3GDI A;  2W3G A;  2Y79 A;  4EES A;  2ZBB A;  2EWV A;  2HJ9 C;  2O9C A;  3H9W A;  3EEH A;  3H82 A;  1OTD A;  3B42 A;  1T1B A;  4LRX C;  2HJE A;  4NXF A;  3C2W A;  3CUE C;  1LL8 A;  2VV7 A;  1OTE A;  5F6A A;  5K5B A;  3BJN A;  2WKR A;  1T18 A;  2IA2 A;  5J4E A;  2XSS A;  3LR3 A;  4BBT A;  4EEU A;  3EEA A;  4ETX A;  3NOT C;  3BQ8 A;  5DFX A;  5J7E A;  5TBM B;  2P04 A;  1S4S A;  3NOU C;  3PBN A;  3NJA A;  3K2N A;  3UB6 A;  1TS0 A;  1P9W A;  3EGX C;  3PHY A;  3S7P A;  1BYW A;  3IBR A;  5HL6 A;  4EET B;  1VHM A;  2MJ6 A;  5HSQ A;  2VEA A;  5KIZ A;  3T4L A;  3TE8 A;  5TBM A;  1UGU A;  4Y3I A;  2PHY A;  3UMD A;  2VZW A;  3S7Q A;  4NXE A;  4I39 A;  4HH2 A;  4JGO A;  5DJT A;  5F69 A;  4HJ3 A;  3T4O A;  2KLI A;  3UE6 A;  3PBR A;  1NWZ A;  2JHE A;  3H82 B;  4P6Z M;  2FH5 A;  2W1R A;  2V1A A;  4KQD A;  4R6L A;  4HOI A;  1D7E A;  3T4K A;  3S7O A;  4E04 A;  4L9F A;  2JKT I;  4HI4 A;  2QJ7 A;  4PKY G;  5LBR A;  1S67 L;  3LIB A;  4II7 A;  3LIC A;  3KSF A;  4I3I A;  1T19 A;  2VGL M;  5MC7 A;  1NRJ A;  4EEP A;  4BBV A;  2QKP A;  4MMN A;  3F1P A;  2V1B A;  3EQV A;  5G4Z A;  4LPZ A;  3G6O A;  3PR6 A;  3F1N A;  1IOU A;  3H7W A;  2OAQ 1;  3EGD C;  3BQA A;  4HHD A;  5HWT A;  2VV6 A;  4GS9 B;  2BAS A;  3CWF A;  3NHQ A;  1V9Y A;  4ZRR A;  2GX5 A;  3UE3 A;  1T1A A;  5IU1 A;  4PHT A;  4JGQ A;  2I9V A;  2DMW A;  3E98 A;  4OOM A;  5CX7 A;  1VB6 A;  5J3W A;  3LUQ A;  4ARZ A;  1JNU A;  3T4Q A;  4GW9 A;  2W1T A;  1OTI A;  2PD7 A;  1ZTU A;  2D01 A;  2ZOH A;  4HP4 A;  4KQO A;  3VV4 A;  1P0Z A;  2KX6 A;  2B02 A;  3CAX A;  5DFY A;  4UQI M;  5HWV A;  3IS2 A;  2JKR M;  3PBQ A;  3LIE A;  1DP6 A;  2ZMV A;  2K2N A;  3LID A;  1LSV A;  1MC0 A;  1XJ3 A;  3IS2 B;  4NXB A;  4R3A A;  2EA9 A;  2GNX A;  1ODV A;  2VLG A;  4HJ6 A;  5EFW A;  2K7S A;  3T50 A;  1EW0 A;  1NLZ A;  1OJG A;  2VJW A;  3RFB A;  2Y8H A;  3K3C A;  3CLO A;  2GJ3 A;  2V9A A;  3EWK A;  5TJJ A;  3P01 A;  4ETZ A;  3FG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...