1LL8A

Structure and interactions of pas kinase n-terminal pas domain: model for intramolecular kinase regulation
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
114
structure length
114
Chain Sequence
GAMDPEFNKAIFTVDAKTTEILVANDKACGLLGYSSQDLIGQKLTQFFLRSDSDVVEALSEEHMEADGHAAVVFGTVVDIISRSGEKIPVSVWMKRMRQERRLCCVVVLEPVER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PAS Kinase
publication title Structure and interactions of PAS kinase N-terminal PAS domain: model for intramolecular kinase regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 14
structure length 114
sequence length 114
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13426 PAS_9 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 1ll8A00
3H7WB 4MN5A 1EW0A 5DKLA 1LSXA 3E4QA 1OTBA 3UB7A 4WUJA 2B02A 3LIEA 3LI9A 3A0VA 5TBMB 4HJ4A 5TBMA 1LT0A 4R38A 4HH3A 4R6LA 2V9AA 3BY8A 4L9FA 1LSWA 1DRMA 1XFNA 5AVFA 3VE3A 4HJ3A 4HHDA 2J80A 4EETB 2JN7A 1S4RA 1S67L 2HV1A 2PHYA 2BASA 5J4EA 3VOLA 4JGPA 1BYWA 2KDKA 4H6JA 3UB6A 5HDCA 3LIDA 3BY9A 3FC7A 1P0ZA 1JNUA 1S4SA 2PYRA 2YKHA 4WL9A 2OOLA 1NWZA 2PD7A 3A0RA 3HJIA 2VLGA 1LL8A 2L0WA 4GS9B 4GS9A 1S66L 3UE6A 3NOPC 4I39A 3LICA 5J3WA 1TS0A 2D01A 5G4YA 4EESA 4WLAA 4GW9A 3CWFA 3H9WA 1KOUA 5HDDA 4EQ1A 3FG8A 5DJUA 4BBVA 3RTYA 3C8CA 3NHQA 3UB8A 3D72A 4GHIA 4BBUA 3F1NA 1GSVA 2CMNA 4HQAA 1XJ3A 4KUOA 4PKYG 3UMEA 2VV6A 4L9EA 4JGOA 2Z6CA 2P7JA 1F98A 3SW1A 1UGUA 1LSVA 2VV8A 1UWPX 1N9LA 3PHYA 3MJQA 2INWA 3CAXA 4B9OA 5IU1A 4NXEA 2YKFA 1XJ4A 2D02A 3PYPA 4HIAA 4WN5A 3P7NA 5F68A 3EEHA 2V1BA 4YWZA 2JHEA 2PR6A 1TS8A 5EFWA 3UMDA 5F5YA 2W0NA 4LPZA 1XJ2A 2KX6A 2ZOHA 2L1MA 3K3DA 4H6JB 1TS6A 4EEUA 4LLOB 5F69A 3MFXA 1T18A 3H82A 3B33A 1UWNX 4EERA 2OWJA 5J7EA 3LIAA 3F1OB 3F1OA 5HWTA 1DP8A 5F6AA 4GCZA 3UB9A 4I3JA 1S1YA 2WKPA 5KIZA 4EXOA 1MZUA 3OLOA 2ZBBA 5HD5A 1WA9A 5HSQA 3IBRA 1OT9A 4NXFA 1OTEA 3NJAA 2Z6DA 3ULFA 4PKYA 4DJ2A 3HJKA 1DP9A 1DP6A 3ICYA 5AVEA 4LRZE 1F9IA 1N9OA 4I5SA 2PD8A 1S1ZA 4GHIB 1XFQA 1D06A 3F1NB 2L4RA 2WKRA 4L9GA 3A0SA 4HY8A 3IS2B 3IS2A 1OTIA 3LIFA 3H7WA 3ZQ5A 2ZOIA 4F3LB 4F3LA 3EWKA 3LUQA 5IS1A 3NOTC 4HP4A 3LIBA 2I9VA 4HI4A 3BWLA 4E04A 5HZHA 2K7SA 1T1CA 1T1BA 1VB6A 1OT6A 4EW7A 2QJ5A 3E4PA 4KQDA 4BBTA 1OTDA 4MN6A 4JGQA 2V1AA 4HNBA 2VEAA 4LRXC 1ODVA 3GDIA 2WKQA 1N9NA 3MQOA 4I3IA 3KX0X 2OWHA 2QKPA 5I5LA 5DJTA 4DJ3A 5A8BA 4NXGA 4I38A 1P97A 3RH8B 3G6OA 2M1CA 2R78A 3H82B 1OJ5A 4WF0A 5HDSA 1TS7A 1OTAA 2PDRA 4M4XA 4KUKA 4XT2B 4XT2A 1Y28A 4K08A 4R3AA 4HH2A 1D7EA 1T1AA 3F1PB 3F1PA 4LRYC 2PR5A 5HD3A 2QHKA 1XJ6A 2H28A 3CLOA 1T19A 3GECA 3LYXA 1GSWA 3NOUC 2W27A 4RQ9A 1GSXA 4HJ6A 1X0OA 3T50A 2V0WA 4R70A 5G4ZA 5DKKA 3E4OA 4HP9A 4JGRA 4I3AA 1V9YA 2EA9A 3VE4A 5HWVA 2VV7A 1OJGA 2GJ3A 4HOIA 1V9ZA 2A24B 2A24A 4NXBA 2QJ7A 3K3CA 3MXQA 5HWWA 3MR0A 1G28A 3C2WA 4EEPA 2PYPA 3LI8A 2QWSA 2V0UA 3MQQA
chains in the Genus database with same CATH superfamily
3MMHA 3O88A 1TF1A 3G35A 3GR2A 3M6HA 3UB7A 4LV3A 3LIEA 3S7PA 1W63Q 1GHIA 3A0VA 5TBMB 4HJ4A 3TSGA 2O0YA 4K0WA 3CZDA 1FIKA 3JVUA 1HTZA 5AQ9A 1K55C 4FSFA 5DTKA 1DRMA 2OAQ1 1XFNA 4N1XA 2WKIA 5MC7A 4OH0A 4Q0IA 5AVFA 3TG9A 2EFUA 2XLNA 4ID4A 3UO9A 3LR4A 2GNXA 1PW8A 4ZJ3A 4ZJ2A 1S4RA 5J8XA 1J9MA 5A91A 3T1XA 2WYXA 2XD5A 4CJNA 4E3NA 5J4EA 1DJBA 1S0WA 1NYYA 3G30A 1SKFA 1BYWA 4B93A 3M2KA 3RJUA 1CQAA 4H6JA 3NULA 1IKGA 1AXBA 1JWZA 3VP4A 5JYOA 3DWKA 1G6OA 3A0RA 3HJIA 2ACGA 3MBZA 4S2LA 3BM6A 4UQIS 5EUAA 1LL8A 2EX8A 2NUPC 3SH7A 5EVLA 4GS9A 1YQSA 2HDUA 4ESPA 1K57C 3VFHA 5JYPA 1ES5A 4WLAA 4GW9A 5CTMA 3BFFA 2WAEA 2Y2GA 3LEZA 3MS6A 5CHUA 4E3JA 2W1TB 4S2MA 3O5YA 4EQ1A 2HJEA 2ZM8A 3Q07A 3JYIA 4DRTA 4BBVA 4DE2A 3ZNTA 2EWWA 4DMZA 3A3JA 2XD1A 4EBLA 1BZAA 5FASA 3RFBA 3KYZA 4X6TA 3IH8A 2EXAA 3NHQA 3D72A 4ZTKA 4QJGA 3PBOA 2C5WB 2CMNA 3IX4A 4KG6A 2XQZA 5CX7A 1XJ3A 3BQ8A 4EBPA 4YINA 4KZAA 3MFDA 2VV6A 3HLCA 4L9EA 4JGOA 3T4LA 4FH2A 4QY6A 3OCLA 4N92A 2P7JA 3NI9A 3BFDA 4ARZB 2ZJ9A 1E25A 3ZVTA 3Q7ZA 4IBXA 5F1GA 1LSVA 3N4IA 2XRNA 2OLVA 3IHAA 4JF4A 2VGLM 3NIAA 3UDIA 3W8KA 3LR3A 2INWA 3Q7VB 3A3DA 1VETA 2XA7M 5GLDA 3HLBA 4G3KA 3WS4A 2KLIA 3OPRA 4NEED 1D1JA 1XGJA 2HDSA 4XUXA 5CGSA 4OQHA 1F5MA 2PR6A 1TS8A 1RGZA 1ALQA 3UMDA 4R4SA 2J3TC 4RA7A 3WS5A 3LR0A 4QPRA 4BL2A 4G3WA 2MJ6A 5HFOA 5BOHA 3MKFA 4P85A 4LFUA 2OWJA 4ZBEA 4Z1WA 2FH5A 5FQIA 2B95A 4I3JA 3SH8A 3LY4A 2ZLYA 2WGWB 2Y2QA 1QMFA 3NECA 1XKZA 3M6BA 3EQUA 4DE1A 1W79A 5FQKA 2K31A 3IXHA 3SS4A 3FPVA 5FEGA 3BEBA 2V2FF 5A92A 4K91A 1DP6A 3A3IA 2JKTM 2BLSA 2XDMA 4N9KA 1IELA 4I5SA 1DJAA 2PRFA 1XFQA 4P87A 3HREA 1FQGA 2DRWA 4O0PA 2WKRA 2LB9A 3KSIA 3U2AA 3IS2B 4X68A 1ZTUA 1OTIA 3TOIA 4ZRRA 3BYDA 1YAXA 5DF8A 4X69A 3WS1A 4H8RA 2Y2MA 4F3LA 3QP8A 3HLGA 4KZ6A 5IS1A 2VZWA 3KYQA 1PZPA 1ESUA 5EM1A 3CHWP 2I9VA 4E04A 5HZHA 3IX3A 1Y4OA 1JWPA 1ES2A 2BTFP 4JF6A 1W8QA 1L0FA 2E8IA 2Y2KA 1XA1A 3R4KA 4LV2A 5HPFA 4B88A 2VEAA 4EWFA 3LCEA 4ETZA 5FAOA 4DE0A 3ZG9B 1BSGA 2VX8A 5EOOA 4I38A 1P97A 4FOFA 1IFQA 5IHVA 1OJ5A 3L9KA 5HDSA 1K54A 4QWOA 5FI6A 3L7HA 2PDRA 4II7A 3O86A 4X53A 1Y28A 5E2FA 3GRJA 1TDLA 4HH2A 2Y79A 1D7EA 3M2JA 5CECA 2HP9A 3FPWA 5E43A 1PZOA 4R1GA 1FCMA 2J7VA 5HD3A 2QHKA 1KDWA 2ZL1A 1T19A 5CHJA 2Y91A 3LYXA 3UDXA 4OQIA 3UNWA 2M7UA 1GHPA 1GSXA 4HJ6A 5FQJA 4OVDA 4WYYA 2XFTA 2WZXA 1RCJA 5E2GA 1ZG6A 5DKKA 2UWXA 4JGRA 2V8CA 2EA9A 4Y7PA 3VE4A 4GJ4A 2H0YA 1MKIA 1ERQA 4HOIA 2G7UA 2ZM0A 3C5AA 5DF7A 4NXBA 3FV7A 3ZNYA 4OPYA 1PI4A 2ZQ8A 3LI8A 1FCOA 2QWSA 3MQQA 3I7JA 3H7WB 1YSPA 3VMAA 3DWZA 3PBQA 5DF9A 3E4QA 1OTBA 1MBLA 2Q9MA 3SH9A 1ACFA 4O8GA 4EQIA 3UPNA 3T1QB 3B3XA 3MZEA 2V8FA 2VGJA 3W2ZA 1LI0A 4KQRA 3BY8A 1L0DA 4RX3A 3IT9A 1I5QA 2K2NA 2WUQA 2ZC5B 3VE3A 3UY6A 1MWTA 4WMCD 4EETB 3IF6A 1PFLA 4WBGA 3V3SA 2JKFA 4GB7A 1K38A 2BASA 4B4ZA 3W4PA 4MMNA 3VOLA 1FSWA 4E3MA 3V39A 3IWIA 2Y2LA 2KDKA 3UB6A 4EBNA 2HGVA 5HDCA 1HZOA 1PI5A 3BY9A 2EXBA 4WZ5A 1RGYA 1JNUA 2YKHA 2JBFA 4OONA 3U4LP 4DF6A 2VLGA 5FAPA 1PNEA 1I2WA 3KSGA 4O7DA 2O99A 4GS9B 4YOFA 1VEUA 5J3WA 2FZ0A 1J3WA 1TS0A 4HEFA 5G4YA 4OP5A 1BUEA 4E3IA 4UHUA 1MPLA 4XUZA 3ZG0A 3MF0A 3IF5A 2IWCA 4YFMA 3HLDA 1TVFA 4GLQA 2ZMVA 2WADA 5EECA 4KZ9A 2WAFA 3LFVA 5F83A 1Z6FA 5HW3A 1TD5A 4IUKA 2VKSA 5FA7A 3HUMA 5TR7A 1IYSA 4BD0A 5FDSA 2H10A 5FAQA 4EV4A 3UMEA 2Z6CA 4WEKA 3A3EA 1KVMA 4O01A 3FKWA 4D2OA 1UGUA 2V20A 3KO6A 1HD8A 1W7FA 1YT4A 5GHYA 1UWPX 3Q82A 3PHYA 5I94A 4HESA 2XF3A 3OZHA 1G6AA 4JPMA 5KMWA 4DKIA 5L07A 1XJ4A 2UV0E 3R7WB 3PYPA 4HIAA 4CLCD 4N1HA 4NETA 4KQOA 1SDNA 3EEHA 2A3UA 2V1BA 4YWZA 1YLTA 3V3RA 3CMZA 5EFWA 3O87A 3IXBA 2DNSA 5KSCA 1Y54A 5F5YA 2W0NA 2ZOHA 1SKOA 3K3DA 1MWRA 2P08A 5EVID 4LLOB 5F69A 3C7UA 3H82A 1UWNX 1ZKJA 3MXRA 3LIAA 3PBSA 2PU4A 5F82A 4OPQA 4KG2A 1NLYA 3LO7A 3UB9A 2XGNA 2Q0OA 1S1YA 5KIZA 1EWZA 3OLOA 4NG2A 3BLSA 4KZ5A 5L10A 4JF5A 1LHYA 5AQ7A 3HLFA 3Q81A 5EVIA 3IBRA 3IXDA 3IX8A 5M19A 2Z6DA 2Y2NA 5L8MA 2G2UA 3BFGA 1Z09A 4C3QA 1SHVA 5CEDA 3MZDA 4GN2A 2OV5A 3NC8A 1U60A 1F9IA 2ZC7A 2IWBA 4MBKA 5FEFA 4GHIB 2Y2HA 1D06A 3E98A 2ZC6B 2IA2A 3F1NB 2L4RA 4WZ4A 4MBHA 3IBJA 3UDFA 1L2SA 1PIOA 4L9GA 3IQAA 5M18A 2Y2JA 3C7VA 3T4KA 3OC2A 1K6RA 4GKUA 1G5UA 5FL3A 4N9LA 2EX6A 3ZQ5A 2WGIA 2ZOIA 2GDNA 2W3EA 4F3LB 1ZG4A 4KG5A 1NZUA 4OLGA 3SOIA 2PT7A 3NOTC 4HP4A 4PM8A 5HARA 4DN0A 2ZMAA 5FDHA 3T12B 2XFSA 4HI4A 2K7SA 1C3BA 1T1CA 1XP4A 3IXGA 1PWDA 1VB6A 3TRCA 5TFQA 2QJ5A 1YLZA 1OTDA 4ME4A 4JGQA 4HNBA 1GHMA 4LRXC 5GL9A 1CI8A 3MQOA 2JE5A 3G2ZA 4GOGA 4X25A 4QU3A 2QKPA 4QHCA 3IF6C 4OOLA 4G3VA 2M1CA 4IEDA 4LV1A 1IYOA 4PM6A 3B42A 4M4XA 4KUKA 4XT2A 5K5BA 5CTNA 5DVAA 1E3UD 4C6YA 4GD6A 1T1AA 2ZM2A 3F1PA 3CJMA 4Y5FA 3QP1A 4PM9A 2O9AA 3E0YA 3ZG8B 2R9WA 2ZL1B 2W3HA 1GSWA 3T1SA 4MCWA 3VOYA 5HPIA 5HX9A 1X0OA 1MC0A 2JKRI 3SZTA 4S2PA 4R70A 1MY8A 4WEJA 3VP0A 3T1RA 4X1LA 4GD8A 4I3AA 4OOYA 5AQBA 1E3UA 1H5XA 4OP8A 2A49A 1OJGA 2GJ3A 3T4TA 2W1TA 1FSYA 1V9ZA 2A24A 1E4DA 3IWQA 5HWWA 4EEPA 2PYPA 5FATA 3T4JA 2Y2PA 4EUZA 4Y0OA 1H8ZA 1OPXA 5FSRA 1EW0A 1IEMA 3LGOA 3MKEA 1LSXA 3T4SA 1K56D 2B02A 2HDRA 3LI9A 1LT0A 4R38A 3QNBA 1M6KA 4UA9A 4R6LA 4S2IA 1TDGA 2V9AA 3VOZA 4L9FA 3P98A 1IKIA 2PBDP 1LL9A 2M7VA 1P9RA 3Q7VA 3GSGA 2J80A 3T4QA 1K56A 3IF6B 3VSLA 2JN7A 4IJGA 2HV1A 2J3WA 2VA0A 2PAVP 3CG5A 4PAUA 5CGXA 4PM7A 2RL3A 2X01A 3LIDA 1P0ZA 2HJ9C 3RXXA 2H0TA 1YPRA 1S4SA 1NLZA 2PYRA 2EX9A 1BULA 1NWZA 2PD7A 4X55A 3NBLA 2HP5A 4Y13A 1L0GA 4U0TA 5DTSA 3GV9A 1S66L 3UE6A 1M40A 4I39A 2Q9NA 3LICA 3MZFA 4JXSA 2D01A 1H8MA 2JKRM 4EESA 2Z2MB 3VP2A 1BT5A 4CLCE 3FZCA 2ZMFA 5EVIC 1KE4A 2JCHA 2H5SA 1KOUA 3CUEA 4DXCA 1YMXA 1XPBA 2ZQ9A 5CERA 3S7QA 1ONGA 1H3QA 5DJUA 4OPZA 3ZVWA 2JC7A 1S6RA 3ISGA 4R4RA 1GCEA 3JPUA 2O9BA 3C8CA 1JTDA 3MSHA 4BL3A 3UB8A 2J9OA 2WK0A 1VM1A 2HP6A 4BBUA 4WM9A 1GSVA 2WZZA 3G34A 4L0LA 3FWLA 5HL1A 4HQAA 4KUOA 1PYYA 4PKYG 3UB5P 3ITBA 1BLPA 2J8YA 1CI9A 4S2NA 2W1RA 4OLDA 1NXYA 4R23A 4UEYA 2J3TD 3QP2A 3BW6A 4NKPA 3G31A 3EQVA 2EWVA 3ZG7B 4KZ3A 1CK3A 3LEQA 1N4OA 4S2JA 3MJQA 4BENA 2EX2A 3D4FA 3CPTA 2QMIA 2YKFA 3G4PA 5F68A 4DDYA 2X02A 4QD4A 4IVIA 2P04A 3IH9A 5CGWA 3EGDC 4KZ8A 5FQ9A 3HL9A 4ZDXA 1GA9A 4GZBA 4LGWA 2W3GA 2VGLS 4LPZA 2KX6A 3PBTA 2Y55A 4H6JB 3EOIA 1TS6A 3MFXA 2XA7S 5CHMA 2HZ5A 4Q0JA 5J7EA 4DXBA 4WMCA 3V50A 4Q8IA 3F1OA 1O07A 2W3DA 4YNRA 4X1MA 5HWTA 1DP8A 5F6AA 1PWGA 4MLLA 3C4PA 4GCZA 4FH4A 2XK1A 4UA6A 4EXOA 5U47A 3IHBA 4RVAA 2ZBBA 1MXOA 1W8YA 3EEAA 2P9VA 3BECA 1STZA 2IWDA 3P01A 1Q2QA 4PHTA 3LY3A 5EVIB 5KZHA 1P9WA 1OT9A 3UE3A 4NXFA 1CJFA 4Y15A 2P74A 2JKGA 4FUWA 4OPRA 1YLWA 4IVKA 4DJ2A 3ZFZA 3ICYA 3DAVA 2QPNA 4LRZE 3LR5A 3TE8A 1N9OA 3HUOA 2PD8A 1ONHA 5FI2A 3GQZA 1H8YA 4OOMA 1WE4A 4KQQA 3W4OA 4DE3A 3OPPA 4WELA 2ZQDA 5HAQA 4P6BA 1SDEA 3K2NA 3C30A 3H7WA 1GA0A 3V5MA 1BTLA 4A5RA 3EWKA 5GLCA 4R3BA 3LUQA 2VGKA 5F1FA 4RX2A 4MNRA 3VFFA 3LIBA 2Y8HA 3IWOA 1VETB 1T1BA 4JXWA 1OT6A 4JLFA 1NZOA 5EM0A 1W5DA 3E4PA 5GLBA 1KGGA 4BBTA 4MN6A 3UE0A 2V1AA 1LLBA 5EOEA 2XH9A 3GDIA 1G68A 3N6IA 3Q1FA 5L09A 3N8LA 1BLCA 4CQHA 3KX0X 5HL6A 5I5LA 5DJTA 4DJ3A 5A8BA 1XX2A 1FCNA 5FQQA 3T4OA 3RH8B 3G6OA 3WRTA 1KE3A 2J9PA 4WF0A 4KENB 1TS7A 1K54C 4E3KA 4HBUA 4IUHA 2QZ6A 3P09A 4XT2B 4CLCA 4R3AA 2WKHA 4OQGA 4U0XA 1WYCA 4BWIA 3ZCZA 3UN7A 4P6ZM 4ZAMA 3BLMA 1HLUP 1NRJA 3F1PB 3MQ0A 2LB5A 3VV4A 5IT5A 4EUVA 2WKEA 3HCYA 1K6SA 3AGFA 4KZBA 4C75A 2H28A 3CLOA 4BLMA 3NOUC 2W27A 4RQ9A 2R9XA 3AGEA 3S1YA 2V0WA 4GDBA 2XROA 1FILA 4HP9A 3TW8A 2ZQAA 1CEFA 1ES3A 1W63M 2EFXA 5DFYA 2VV7A 3OPHA 4BMWA 3CUEC 2DMWA 2A24B 1O7EA 2JKTI 3K3CA 3MXQA 2O9CA 3DTEA 4FTXA 1YLPA 2GZAA 4E3LA 3D9YA 4MN5A 3SS5A 1YM1A 5DKLA 3C38A 4Q0HA 2Z2LB 1A0KA 2QYBA 1EROA 3OOVA 3UPOA 2Y2OA 4WUJA 3QP4A 2HPBA 4MEZA 1L3LA 5EE8A 4M3KA 4S2NC 3G32A 5TBMA 5EVEA 4X56A 1IOUA 4HH3A 1FR6A 2ZQ7A 1MWSA 1LSWA 1IYPA 1FR1A 4FCFA 3C4OA 4PMAA 5AJGA 4UA7A 5FQMA 3WWXA 2DCFA 4HJ3A 2NUTC 4HHDA 3QNCA 3R7WA 4ETXA 2AVXA 3ITAA 1S67L 3S7OA 1K25A 2PHYA 5GLAA 1VHMA 3OPLA 5HAPA 3EGXC 3ZDJA 2OLUA 4JGPA 3GVBA 1JWVA 4JBFA 3DW0A 1H0MA 4PPRA 5DTTA 2PBYA 3FC7A 3DTIA 4WZ5C 2E8JA 2OSUA 4WL9A 2FFYA 2OOLA 5KSHA 2HDQA 2L0WA 3QHYA 3NOPC 2G2WA 4LCMA 4MN7A 2X71A 3NDGA 4GNUA 3CWFA 4LCLA 1JVJA 1TEMA 1XGIA 3HLEA 3H9WA 1XXMA 4PM5A 3CITA 5HDDA 3ZYTA 2OAP1 3FG8A 1CEGA 3D3OA 4HBTA 3KSFA 1KGEA 4Y3IA 4LV0A 4OKPA 3RTYA 5FI7A 1DJCA 3E2KA 3OCNA 4GHIA 3E2LA 4ZJ1A 3UE1A 3QP5A 5TJJA 3F1NA 4KZ4A 4R0QA 5LBRA 2I72A 5CRFA 1K4EA 3A3FA 3KSHA 3VP1A 2Y59A 4Z9QA 3HLWA 1F98A 1K0KA 4ARZA 3SW1A 1KGFA 2VV8A 5A93A 1K55A 2BG1A 3N8SA 3TJZC 4GDNA 1ERMA 1N9LA 5D3OA 4QY5A 2PU2A 4BQMA 4EU0A 1NRFA 4B4XA 3WS2A 3CAXA 3CPTB 4B9OA 3V67A 5IU1A 4NXEA 3N7WA 2D02A 1RP5A 4WN5A 3P7NA 4Y17A 1ESIA 1YLYA 3W4QA 2B5RA 2JHEA 5CXWA 1LI9A 4UQIM 5DFXA 2ZC4B 3UPPA 1MKMA 5M1AA 1XJ2A 2L1MA 4XXRA 5TGFA 1K4FA 4RYEA 4EEUA 3DTKA 1T18A 3B33A 4EERA 1Q2PA 1JTGA 3JVVA 4E3OA 3F1OB 2B18A 4IBRA 4CLCC 4BD1A 4KZ7A 1VEUB 4IHQA 2ZQCA 1K57A 2WKPA 1MZUA 3PXPA 2WGWA 4JXGA 2P9VB 5HD5A 3VP3A 1QMEA 1WA9A 5HSQA 1PW1A 3PAEA 1OTEA 1CF0A 1EI5A 5HAIA 3NJAA 5CEBA 4D60A 1KE0A 1ZHHB 4K0XA 3ULFA 3KYEA 4PKYA 1NY0A 1WYBA 3HJKA 1KDSA 1DP9A 2HF6A 4P6ZS 5AVEA 3PAGA 3PBNA 1BLSA 2RCXA 3PTEA 4AFIA 3HVFA 1S1ZA 2XSSA 4U3TA 2GX5A 4F94A 1YKDA 1YLJA 3VSKA 1YSQA 3NCKA 3N8RA 2KOIA 1YMSA 4Y0TA 1F2KA 3A0SA 4HY8A 1LL5A 3IS2A 1IYQA 4P0MA 1HVBA 1NJ4A 1MWUA 3LIFA 3ZG5A 3S22A 4OQ0A 4E6WA 1DY6A 3FKVA 4LENA 4UAAA 4R3JA 4JKTA 2ZC3B 3BQAA 3BWLA 2XEPA 1NYMA 1N9BA 4DDSA 1L0EA 3ZGAB 4EW7A 3WRZA 3S4XA 4KQDA 3ZHHA 1ES4A 2Y4AA 1ZC2A 2ZD8A 3G2YA 2XR0A 2FFFB 4JXVA 1AWIA 4S2KA 3PBRA 1ODVA 3B47A 5G18A 3DTMA 3FYZA 1SKOB 1N9NA 2VK3A 2WKQA 4I3IA 1I2SA 3RXWA 2CC1A 4S2OA 2OWHA 4NXGA 4Y0UA 2WGVA 2R78A 3BJNA 3H82B 1BLHA 3QP6A 2Y2IA 1OTAA 5C5KA 4CPKA 4CLCB 2W3FA 3DBAA 4K08A 1SZVA 5A90A 5AQAA 4MBFA 2A2LA 3SS3A 3NY4A 4E6XA 3BRMA 3MXSA 2PR5A 4LRYC 5GHZA 4NK3A 1XA7A 1XJ6A 4BJPA 5GHXA 5E2EA 3GECA 3OBFA 1FOFA 1SCWA 5EPHA 2V1ZA 3T50A 2C6WB 1OMEA 3S7NA 3NDEA 5G4ZA 3E4OA 1V9YA 4MDZA 5EV0A 5HWVA 4QB8A 3BFCA 3HUNA 1PWCA 4FD8A 3WS0A 1PRQA 3O3VA 2QJ7A 3CI6A 1KVLA 3GMWA 3PR6A 3BFEA 3HBRA 3MR0A 3AGDA 1G28A 3C2WA 5L2FA 1VQQA 5E2HA 2VJWA 4Y2FA 3GTCA 2V0UA
chains in the Genus database with same CATH topology
3H7WB 3MMHA 4MN5A 1TF1A 1OPXA 1EW0A 5DKLA 1YSPA 3C38A 4Q0HA 3PBQA 1LSXA 2QYBA 5DF9A 3OOVA 3T4SA 3E4QA 1OTBA 3UB7A 4WUJA 4O8GA 2B02A 3LIEA 3S7PA 1W63Q 3LI9A 3A0VA 5TBMB 4HJ4A 5TBMA 1LT0A 4R38A 1IOUA 2O0YA 4HH3A 4R6LA 3W2ZA 2V9AA 3JVUA 3BY8A 4L9FA 4FSFA 1LSWA 1DRMA 2OAQ1 1XFNA 5AJGA 5MC7A 2M7VA 2K2NA 4Q0IA 1P9RA 5AVFA 3VE3A 4HJ3A 2NUTC 4HHDA 2J80A 3LR4A 2GNXA 3R7WA 4EETB 4ETXA 3T4QA 2JN7A 1S4RA 1S67L 4IJGA 3S7OA 2HV1A 2PHYA 2J3WA 2BASA 2VA0A 4MMNA 5J4EA 1VHMA 3VOLA 3EGXC 4PAUA 4JGPA 1BYWA 4B93A 2KDKA 4H6JA 3UB6A 2HGVA 5HDCA 3LIDA 3BY9A 3FC7A 1P0ZA 2HJ9C 1JNUA 1S4SA 1NLZA 2PYRA 2YKHA 4WL9A 2OOLA 5KSHA 1G6OA 1NWZA 2PD7A 3A0RA 3HJIA 2VLGA 4UQIS 1LL8A 2NUPC 3KSGA 2L0WA 2O99A 4GS9B 4GS9A 4YOFA 1S66L 3UE6A 3NOPC 4I39A 3LICA 5J3WA 2FZ0A 4MN7A 1TS0A 2D01A 5G4YA 1H8MA 2JKRM 4EESA 4WLAA 4GW9A 3CWFA 4CLCE 2ZMFA 3H9WA 1KOUA 3CITA 5HDDA 2W1TB 3CUEA 3ZYTA 3O5YA 4EQ1A 2OAP1 2HJEA 3FG8A 3MF0A 3D3OA 3S7QA 1H3QA 3KSFA 5DJUA 4BBVA 2EWWA 4DMZA 4GLQA 4Y3IA 2ZMVA 3RFBA 3KYZA 3RTYA 2O9BA 3C8CA 3NHQA 3LFVA 3UB8A 3D72A 3OCNA 4GHIA 1TD5A 4IUKA 2VKSA 3PBOA 5TJJA 4BBUA 3F1NA 1GSVA 2CMNA 5LBRA 5CX7A 4L0LA 4HQAA 1XJ3A 3BQ8A 4KUOA 4PKYG 3UMEA 2VV6A 4L9EA 4JGOA 3T4LA 2W1RA 2Z6CA 4WEKA 3KSHA 3OCLA 2P7JA 1F98A 4O01A 4ARZB 4ARZA 4UEYA 3SW1A 1UGUA 3KO6A 2J3TD 3BW6A 4NKPA 1LSVA 3EQVA 2VV8A 2EWVA 2XRNA 3TJZC 2VGLM 1UWPX 1N9LA 3PHYA 3MJQA 4EU0A 3LR3A 2INWA 3CAXA 4B9OA 3V67A 5IU1A 4NXEA 2XA7M 4G3KA 2YKFA 1XJ4A 2D02A 3R7WB 3PYPA 4HIAA 2KLIA 4CLCD 4NEED 4WN5A 3P7NA 5F68A 4KQOA 3EEHA 2V1BA 4YWZA 2JHEA 1F5MA 2P04A 2PR6A 4UQIM 1TS8A 3EGDC 5DFXA 5EFWA 3UMDA 1MKMA 2J3TC 5F5YA 2W0NA 2W3GA 2VGLS 4LPZA 1XJ2A 2KX6A 2ZOHA 2L1MA 3PBTA 3K3DA 3LR0A 4H6JB 3EOIA 4QPRA 2P08A 1TS6A 4G3WA 2MJ6A 4EEUA 4LLOB 5F69A 1T18A 3MFXA 2XA7S 3H82A 3B33A 1UWNX 4EERA 2OWJA 4Q0JA 5J7EA 3LIAA 3JVVA 3F1OB 2B18A 3F1OA 4Z1WA 2FH5A 2W3DA 4YNRA 3PBSA 4CLCC 5HWTA 1DP8A 5F6AA 4GCZA 1NLYA 3UB9A 4I3JA 4IHQA 1S1YA 2WKPA 5KIZA 4EXOA 1MZUA 3OLOA 3PXPA 2ZBBA 3EEAA 5HD5A 1STZA 1WA9A 5HSQA 3P01A 4PHTA 3IBRA 1P9WA 3EQUA 1OT9A 3UE3A 4NXFA 1OTEA 3NJAA 2K31A 3FPVA 1ZHHB 2Z6DA 3ULFA 4PKYA 4DJ2A 5L8MA 3HJKA 1DP9A 1DP6A 2HF6A 3ICYA 2JKTM 4P6ZS 5AVEA 4LRZE 3PBNA 1F9IA 3LR5A 3TE8A 1N9OA 4I5SA 4AFIA 2PD8A 1S1ZA 2XSSA 4GHIB 1XFQA 2GX5A 1YKDA 1D06A 3E98A 3F1NB 2IA2A 2L4RA 4O0PA 1YSQA 2KOIA 4OOMA 3IBJA 2WKRA 4L9GA 2LB9A 3KSIA 3A0SA 4HY8A 4WELA 3U2AA 3IS2B 3IS2A 1ZTUA 1OTIA 4ZRRA 3OC2A 3LIFA 3T4KA 3K2NA 3C30A 3H7WA 1YAXA 5FL3A 3ZQ5A 2ZOIA 2W3EA 4F3LB 4F3LA 3EWKA 3LUQA 5IS1A 2PT7A 2VZWA 3NOTC 3KYQA 4HP4A 4DN0A 3LIBA 2I9VA 2Y8HA 4HI4A 3BQAA 3BWLA 4E04A 5HZHA 2K7SA 1T1CA 1T1BA 1VB6A 1OT6A 4EW7A 3TRCA 2QJ5A 3E4PA 4KQDA 4BBTA 1OTDA 3R4KA 4ME4A 4MN6A 5HPFA 4JGQA 2V1AA 4HNBA 2VEAA 4LRXC 3PBRA 1ODVA 3B47A 3GDIA 2WKQA 1N9NA 3MQOA 4I3IA 4ETZA 4CQHA 3KX0X 5HL6A 2OWHA 2QKPA 5I5LA 5DJTA 4DJ3A 5A8BA 2VX8A 4OOLA 4NXGA 3T4OA 4G3VA 1P97A 4FOFA 3G6OA 1IFQA 2M1CA 2R78A 3BJNA 3H82B 4I38A 3RH8B 1OJ5A 4WF0A 5HDSA 1TS7A 1OTAA 3B42A 4IUHA 5C5KA 2PDRA 4II7A 4M4XA 4KUKA 4XT2B 2W3FA 4XT2A 4CLCB 1Y28A 4CLCA 3DBAA 4K08A 5K5BA 4R3AA 4BWIA 4HH2A 2Y79A 4P6ZM 1D7EA 2A2LA 1T1AA 1NRJA 3F1PB 3F1PA 2LB5A 3FPWA 2PR5A 3MQ0A 4LRYC 3VV4A 5IT5A 4Y5FA 5HD3A 4EUVA 2O9AA 3E0YA 2QHKA 3HCYA 1XJ6A 4BJPA 2H28A 3CLOA 1T19A 2W3HA 3GECA 3OBFA 3LYXA 1GSWA 3NOUC 4MCWA 2W27A 4RQ9A 5HPIA 2M7UA 1GSXA 4HJ6A 1X0OA 1MC0A 2JKRI 3T50A 2V0WA 4WEJA 4R70A 3S7NA 2XROA 5G4ZA 5DKKA 3E4OA 4HP9A 4JGRA 4I3AA 3TW8A 1V9YA 2EA9A 4MDZA 3VE4A 4GJ4A 5HWVA 1W63M 5DFYA 2VV7A 4BMWA 1OJGA 2GJ3A 4HOIA 2W1TA 3CUEC 2DMWA 3T4TA 2G7UA 1V9ZA 2A24B 2A24A 4NXBA 2JKTI 2QJ7A 3K3CA 3CI6A 3MXQA 3PR6A 5HWWA 3MR0A 2O9CA 1G28A 3C2WA 4EEPA 2PYPA 3LI8A 3T4JA 2QWSA 2VJWA 4Y2FA 2V0UA 2GZAA 3MQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H7W B;  4MN5 A;  1EW0 A;  5DKL A;  1LSX A;  3E4Q A;  1OTB A;  3UB7 A;  4WUJ A;  2B02 A;  3LIE A;  3LI9 A;  3A0V A;  5TBM B;  4HJ4 A;  5TBM A;  1LT0 A;  4R38 A;  4HH3 A;  4R6L A;  2V9A A;  3BY8 A;  4L9F A;  1LSW A;  1DRM A;  1XFN A;  5AVF A;  3VE3 A;  4HJ3 A;  4HHD A;  2J80 A;  4EET B;  2JN7 A;  1S4R A;  1S67 L;  2HV1 A;  2PHY A;  2BAS A;  5J4E A;  3VOL A;  4JGP A;  1BYW A;  2KDK A;  4H6J A;  3UB6 A;  5HDC A;  3LID A;  3BY9 A;  3FC7 A;  1P0Z A;  1JNU A;  1S4S A;  2PYR A;  2YKH A;  4WL9 A;  2OOL A;  1NWZ A;  2PD7 A;  3A0R A;  3HJI A;  2VLG A;  1LL8 A;  2L0W A;  4GS9 B;  4GS9 A;  1S66 L;  3UE6 A;  3NOP C;  4I39 A;  3LIC A;  5J3W A;  1TS0 A;  2D01 A;  5G4Y A;  4EES A;  4WLA A;  4GW9 A;  3CWF A;  3H9W A;  1KOU A;  5HDD A;  4EQ1 A;  3FG8 A;  5DJU A;  4BBV A;  3RTY A;  3C8C A;  3NHQ A;  3UB8 A;  3D72 A;  4GHI A;  4BBU A;  3F1N A;  1GSV A;  2CMN A;  4HQA A;  1XJ3 A;  4KUO A;  4PKY G;  3UME A;  2VV6 A;  4L9E A;  4JGO A;  2Z6C A;  2P7J A;  1F98 A;  3SW1 A;  1UGU A;  1LSV A;  2VV8 A;  1UWP X;  1N9L A;  3PHY A;  3MJQ A;  2INW A;  3CAX A;  4B9O A;  5IU1 A;  4NXE A;  2YKF A;  1XJ4 A;  2D02 A;  3PYP A;  4HIA A;  4WN5 A;  3P7N A;  5F68 A;  3EEH A;  2V1B A;  4YWZ A;  2JHE A;  2PR6 A;  1TS8 A;  5EFW A;  3UMD A;  5F5Y A;  2W0N A;  4LPZ A;  1XJ2 A;  2KX6 A;  2ZOH A;  2L1M A;  3K3D A;  4H6J B;  1TS6 A;  4EEU A;  4LLO B;  5F69 A;  3MFX A;  1T18 A;  3H82 A;  3B33 A;  1UWN X;  4EER A;  2OWJ A;  5J7E A;  3LIA A;  3F1O B;  3F1O A;  5HWT A;  1DP8 A;  5F6A A;  4GCZ A;  3UB9 A;  4I3J A;  1S1Y A;  2WKP A;  5KIZ A;  4EXO A;  1MZU A;  3OLO A;  2ZBB A;  5HD5 A;  1WA9 A;  5HSQ A;  3IBR A;  1OT9 A;  4NXF A;  1OTE A;  3NJA A;  2Z6D A;  3ULF A;  4PKY A;  4DJ2 A;  3HJK A;  1DP9 A;  1DP6 A;  3ICY A;  5AVE A;  4LRZ E;  1F9I A;  1N9O A;  4I5S A;  2PD8 A;  1S1Z A;  4GHI B;  1XFQ A;  1D06 A;  3F1N B;  2L4R A;  2WKR A;  4L9G A;  3A0S A;  4HY8 A;  3IS2 B;  3IS2 A;  1OTI A;  3LIF A;  3H7W A;  3ZQ5 A;  2ZOI A;  4F3L B;  4F3L A;  3EWK A;  3LUQ A;  5IS1 A;  3NOT C;  4HP4 A;  3LIB A;  2I9V A;  4HI4 A;  3BWL A;  4E04 A;  5HZH A;  2K7S A;  1T1C A;  1T1B A;  1VB6 A;  1OT6 A;  4EW7 A;  2QJ5 A;  3E4P A;  4KQD A;  4BBT A;  1OTD A;  4MN6 A;  4JGQ A;  2V1A A;  4HNB A;  2VEA A;  4LRX C;  1ODV A;  3GDI A;  2WKQ A;  1N9N A;  3MQO A;  4I3I A;  3KX0 X;  2OWH A;  2QKP A;  5I5L A;  5DJT A;  4DJ3 A;  5A8B A;  4NXG A;  4I38 A;  1P97 A;  3RH8 B;  3G6O A;  2M1C A;  2R78 A;  3H82 B;  1OJ5 A;  4WF0 A;  5HDS A;  1TS7 A;  1OTA A;  2PDR A;  4M4X A;  4KUK A;  4XT2 B;  4XT2 A;  1Y28 A;  4K08 A;  4R3A A;  4HH2 A;  1D7E A;  1T1A A;  3F1P B;  3F1P A;  4LRY C;  2PR5 A;  5HD3 A;  2QHK A;  1XJ6 A;  2H28 A;  3CLO A;  1T19 A;  3GEC A;  3LYX A;  1GSW A;  3NOU C;  2W27 A;  4RQ9 A;  1GSX A;  4HJ6 A;  1X0O A;  3T50 A;  2V0W A;  4R70 A;  5G4Z A;  5DKK A;  3E4O A;  4HP9 A;  4JGR A;  4I3A A;  1V9Y A;  2EA9 A;  3VE4 A;  5HWV A;  2VV7 A;  1OJG A;  2GJ3 A;  4HOI A;  1V9Z A;  2A24 B;  2A24 A;  4NXB A;  2QJ7 A;  3K3C A;  3MXQ A;  5HWW A;  3MR0 A;  1G28 A;  3C2W A;  4EEP A;  2PYP A;  3LI8 A;  2QWS A;  2V0U A;  3MQQ A; 
#chains in the Genus database with same CATH topology
 3MMH A;  3O88 A;  1TF1 A;  3G35 A;  3GR2 A;  3M6H A;  3UB7 A;  4LV3 A;  3LIE A;  3S7P A;  1W63 Q;  1GHI A;  3A0V A;  5TBM B;  4HJ4 A;  3TSG A;  2O0Y A;  4K0W A;  3CZD A;  1FIK A;  3JVU A;  1HTZ A;  5AQ9 A;  1K55 C;  4FSF A;  5DTK A;  1DRM A;  2OAQ 1;  1XFN A;  4N1X A;  2WKI A;  5MC7 A;  4OH0 A;  4Q0I A;  5AVF A;  3TG9 A;  2EFU A;  2XLN A;  4ID4 A;  3UO9 A;  3LR4 A;  2GNX A;  1PW8 A;  4ZJ3 A;  4ZJ2 A;  1S4R A;  5J8X A;  1J9M A;  5A91 A;  3T1X A;  2WYX A;  2XD5 A;  4CJN A;  4E3N A;  5J4E A;  1DJB A;  1S0W A;  1NYY A;  3G30 A;  1SKF A;  1BYW A;  4B93 A;  3M2K A;  3RJU A;  1CQA A;  4H6J A;  3NUL A;  1IKG A;  1AXB A;  1JWZ A;  3VP4 A;  5JYO A;  3DWK A;  1G6O A;  3A0R A;  3HJI A;  2ACG A;  3MBZ A;  4S2L A;  3BM6 A;  4UQI S;  5EUA A;  1LL8 A;  2EX8 A;  2NUP C;  3SH7 A;  5EVL A;  4GS9 A;  1YQS A;  2HDU A;  4ESP A;  1K57 C;  3VFH A;  5JYP A;  1ES5 A;  4WLA A;  4GW9 A;  5CTM A;  3BFF A;  2WAE A;  2Y2G A;  3LEZ A;  3MS6 A;  5CHU A;  4E3J A;  2W1T B;  4S2M A;  3O5Y A;  4EQ1 A;  2HJE A;  2ZM8 A;  3Q07 A;  3JYI A;  4DRT A;  4BBV A;  4DE2 A;  3ZNT A;  2EWW A;  4DMZ A;  3A3J A;  2XD1 A;  4EBL A;  1BZA A;  5FAS A;  3RFB A;  3KYZ A;  4X6T A;  3IH8 A;  2EXA A;  3NHQ A;  3D72 A;  4ZTK A;  4QJG A;  3PBO A;  2C5W B;  2CMN A;  3IX4 A;  4KG6 A;  2XQZ A;  5CX7 A;  1XJ3 A;  3BQ8 A;  4EBP A;  4YIN A;  4KZA A;  3MFD A;  2VV6 A;  3HLC A;  4L9E A;  4JGO A;  3T4L A;  4FH2 A;  4QY6 A;  3OCL A;  4N92 A;  2P7J A;  3NI9 A;  3BFD A;  4ARZ B;  2ZJ9 A;  1E25 A;  3ZVT A;  3Q7Z A;  4IBX A;  5F1G A;  1LSV A;  3N4I A;  2XRN A;  2OLV A;  3IHA A;  4JF4 A;  2VGL M;  3NIA A;  3UDI A;  3W8K A;  3LR3 A;  2INW A;  3Q7V B;  3A3D A;  1VET A;  2XA7 M;  5GLD A;  3HLB A;  4G3K A;  3WS4 A;  2KLI A;  3OPR A;  4NEE D;  1D1J A;  1XGJ A;  2HDS A;  4XUX A;  5CGS A;  4OQH A;  1F5M A;  2PR6 A;  1TS8 A;  1RGZ A;  1ALQ A;  3UMD A;  4R4S A;  2J3T C;  4RA7 A;  3WS5 A;  3LR0 A;  4QPR A;  4BL2 A;  4G3W A;  2MJ6 A;  5HFO A;  5BOH A;  3MKF A;  4P85 A;  4LFU A;  2OWJ A;  4ZBE A;  4Z1W A;  2FH5 A;  5FQI A;  2B95 A;  4I3J A;  3SH8 A;  3LY4 A;  2ZLY A;  2WGW B;  2Y2Q A;  1QMF A;  3NEC A;  1XKZ A;  3M6B A;  3EQU A;  4DE1 A;  1W79 A;  5FQK A;  2K31 A;  3IXH A;  3SS4 A;  3FPV A;  5FEG A;  3BEB A;  2V2F F;  5A92 A;  4K91 A;  1DP6 A;  3A3I A;  2JKT M;  2BLS A;  2XDM A;  4N9K A;  1IEL A;  4I5S A;  1DJA A;  2PRF A;  1XFQ A;  4P87 A;  3HRE A;  1FQG A;  2DRW A;  4O0P A;  2WKR A;  2LB9 A;  3KSI A;  3U2A A;  3IS2 B;  4X68 A;  1ZTU A;  1OTI A;  3TOI A;  4ZRR A;  3BYD A;  1YAX A;  5DF8 A;  4X69 A;  3WS1 A;  4H8R A;  2Y2M A;  4F3L A;  3QP8 A;  3HLG A;  4KZ6 A;  5IS1 A;  2VZW A;  3KYQ A;  1PZP A;  1ESU A;  5EM1 A;  3CHW P;  2I9V A;  4E04 A;  5HZH A;  3IX3 A;  1Y4O A;  1JWP A;  1ES2 A;  2BTF P;  4JF6 A;  1W8Q A;  1L0F A;  2E8I A;  2Y2K A;  1XA1 A;  3R4K A;  4LV2 A;  5HPF A;  4B88 A;  2VEA A;  4EWF A;  3LCE A;  4ETZ A;  5FAO A;  4DE0 A;  3ZG9 B;  1BSG A;  2VX8 A;  5EOO A;  4I38 A;  1P97 A;  4FOF A;  1IFQ A;  5IHV A;  1OJ5 A;  3L9K A;  5HDS A;  1K54 A;  4QWO A;  5FI6 A;  3L7H A;  2PDR A;  4II7 A;  3O86 A;  4X53 A;  1Y28 A;  5E2F A;  3GRJ A;  1TDL A;  4HH2 A;  2Y79 A;  1D7E A;  3M2J A;  5CEC A;  2HP9 A;  3FPW A;  5E43 A;  1PZO A;  4R1G A;  1FCM A;  2J7V A;  5HD3 A;  2QHK A;  1KDW A;  2ZL1 A;  1T19 A;  5CHJ A;  2Y91 A;  3LYX A;  3UDX A;  4OQI A;  3UNW A;  2M7U A;  1GHP A;  1GSX A;  4HJ6 A;  5FQJ A;  4OVD A;  4WYY A;  2XFT A;  2WZX A;  1RCJ A;  5E2G A;  1ZG6 A;  5DKK A;  2UWX A;  4JGR A;  2V8C A;  2EA9 A;  4Y7P A;  3VE4 A;  4GJ4 A;  2H0Y A;  1MKI A;  1ERQ A;  4HOI A;  2G7U A;  2ZM0 A;  3C5A A;  5DF7 A;  4NXB A;  3FV7 A;  3ZNY A;  4OPY A;  1PI4 A;  2ZQ8 A;  3LI8 A;  1FCO A;  2QWS A;  3MQQ A;  3I7J A;  3H7W B;  1YSP A;  3VMA A;  3DWZ A;  3PBQ A;  5DF9 A;  3E4Q A;  1OTB A;  1MBL A;  2Q9M A;  3SH9 A;  1ACF A;  4O8G A;  4EQI A;  3UPN A;  3T1Q B;  3B3X A;  3MZE A;  2V8F A;  2VGJ A;  3W2Z A;  1LI0 A;  4KQR A;  3BY8 A;  1L0D A;  4RX3 A;  3IT9 A;  1I5Q A;  2K2N A;  2WUQ A;  2ZC5 B;  3VE3 A;  3UY6 A;  1MWT A;  4WMC D;  4EET B;  3IF6 A;  1PFL A;  4WBG A;  3V3S A;  2JKF A;  4GB7 A;  1K38 A;  2BAS A;  4B4Z A;  3W4P A;  4MMN A;  3VOL A;  1FSW A;  4E3M A;  3V39 A;  3IWI A;  2Y2L A;  2KDK A;  3UB6 A;  4EBN A;  2HGV A;  5HDC A;  1HZO A;  1PI5 A;  3BY9 A;  2EXB A;  4WZ5 A;  1RGY A;  1JNU A;  2YKH A;  2JBF A;  4OON A;  3U4L P;  4DF6 A;  2VLG A;  5FAP A;  1PNE A;  1I2W A;  3KSG A;  4O7D A;  2O99 A;  4GS9 B;  4YOF A;  1VEU A;  5J3W A;  2FZ0 A;  1J3W A;  1TS0 A;  4HEF A;  5G4Y A;  4OP5 A;  1BUE A;  4E3I A;  4UHU A;  1MPL A;  4XUZ A;  3ZG0 A;  3MF0 A;  3IF5 A;  2IWC A;  4YFM A;  3HLD A;  1TVF A;  4GLQ A;  2ZMV A;  2WAD A;  5EEC A;  4KZ9 A;  2WAF A;  3LFV A;  5F83 A;  1Z6F A;  5HW3 A;  1TD5 A;  4IUK A;  2VKS A;  5FA7 A;  3HUM A;  5TR7 A;  1IYS A;  4BD0 A;  5FDS A;  2H10 A;  5FAQ A;  4EV4 A;  3UME A;  2Z6C A;  4WEK A;  3A3E A;  1KVM A;  4O01 A;  3FKW A;  4D2O A;  1UGU A;  2V20 A;  3KO6 A;  1HD8 A;  1W7F A;  1YT4 A;  5GHY A;  1UWP X;  3Q82 A;  3PHY A;  5I94 A;  4HES A;  2XF3 A;  3OZH A;  1G6A A;  4JPM A;  5KMW A;  4DKI A;  5L07 A;  1XJ4 A;  2UV0 E;  3R7W B;  3PYP A;  4HIA A;  4CLC D;  4N1H A;  4NET A;  4KQO A;  1SDN A;  3EEH A;  2A3U A;  2V1B A;  4YWZ A;  1YLT A;  3V3R A;  3CMZ A;  5EFW A;  3O87 A;  3IXB A;  2DNS A;  5KSC A;  1Y54 A;  5F5Y A;  2W0N A;  2ZOH A;  1SKO A;  3K3D A;  1MWR A;  2P08 A;  5EVI D;  4LLO B;  5F69 A;  3C7U A;  3H82 A;  1UWN X;  1ZKJ A;  3MXR A;  3LIA A;  3PBS A;  2PU4 A;  5F82 A;  4OPQ A;  4KG2 A;  1NLY A;  3LO7 A;  3UB9 A;  2XGN A;  2Q0O A;  1S1Y A;  5KIZ A;  1EWZ A;  3OLO A;  4NG2 A;  3BLS A;  4KZ5 A;  5L10 A;  4JF5 A;  1LHY A;  5AQ7 A;  3HLF A;  3Q81 A;  5EVI A;  3IBR A;  3IXD A;  3IX8 A;  5M19 A;  2Z6D A;  2Y2N A;  5L8M A;  2G2U A;  3BFG A;  1Z09 A;  4C3Q A;  1SHV A;  5CED A;  3MZD A;  4GN2 A;  2OV5 A;  3NC8 A;  1U60 A;  1F9I A;  2ZC7 A;  2IWB A;  4MBK A;  5FEF A;  4GHI B;  2Y2H A;  1D06 A;  3E98 A;  2ZC6 B;  2IA2 A;  3F1N B;  2L4R A;  4WZ4 A;  4MBH A;  3IBJ A;  3UDF A;  1L2S A;  1PIO A;  4L9G A;  3IQA A;  5M18 A;  2Y2J A;  3C7V A;  3T4K A;  3OC2 A;  1K6R A;  4GKU A;  1G5U A;  5FL3 A;  4N9L A;  2EX6 A;  3ZQ5 A;  2WGI A;  2ZOI A;  2GDN A;  2W3E A;  4F3L B;  1ZG4 A;  4KG5 A;  1NZU A;  4OLG A;  3SOI A;  2PT7 A;  3NOT C;  4HP4 A;  4PM8 A;  5HAR A;  4DN0 A;  2ZMA A;  5FDH A;  3T12 B;  2XFS A;  4HI4 A;  2K7S A;  1C3B A;  1T1C A;  1XP4 A;  3IXG A;  1PWD A;  1VB6 A;  3TRC A;  5TFQ A;  2QJ5 A;  1YLZ A;  1OTD A;  4ME4 A;  4JGQ A;  4HNB A;  1GHM A;  4LRX C;  5GL9 A;  1CI8 A;  3MQO A;  2JE5 A;  3G2Z A;  4GOG A;  4X25 A;  4QU3 A;  2QKP A;  4QHC A;  3IF6 C;  4OOL A;  4G3V A;  2M1C A;  4IED A;  4LV1 A;  1IYO A;  4PM6 A;  3B42 A;  4M4X A;  4KUK A;  4XT2 A;  5K5B A;  5CTN A;  5DVA A;  1E3U D;  4C6Y A;  4GD6 A;  1T1A A;  2ZM2 A;  3F1P A;  3CJM A;  4Y5F A;  3QP1 A;  4PM9 A;  2O9A A;  3E0Y A;  3ZG8 B;  2R9W A;  2ZL1 B;  2W3H A;  1GSW A;  3T1S A;  4MCW A;  3VOY A;  5HPI A;  5HX9 A;  1X0O A;  1MC0 A;  2JKR I;  3SZT A;  4S2P A;  4R70 A;  1MY8 A;  4WEJ A;  3VP0 A;  3T1R A;  4X1L A;  4GD8 A;  4I3A A;  4OOY A;  5AQB A;  1E3U A;  1H5X A;  4OP8 A;  2A49 A;  1OJG A;  2GJ3 A;  3T4T A;  2W1T A;  1FSY A;  1V9Z A;  2A24 A;  1E4D A;  3IWQ A;  5HWW A;  4EEP A;  2PYP A;  5FAT A;  3T4J A;  2Y2P A;  4EUZ A;  4Y0O A;  1H8Z A;  1OPX A;  5FSR A;  1EW0 A;  1IEM A;  3LGO A;  3MKE A;  1LSX A;  3T4S A;  1K56 D;  2B02 A;  2HDR A;  3LI9 A;  1LT0 A;  4R38 A;  3QNB A;  1M6K A;  4UA9 A;  4R6L A;  4S2I A;  1TDG A;  2V9A A;  3VOZ A;  4L9F A;  3P98 A;  1IKI A;  2PBD P;  1LL9 A;  2M7V A;  1P9R A;  3Q7V A;  3GSG A;  2J80 A;  3T4Q A;  1K56 A;  3IF6 B;  3VSL A;  2JN7 A;  4IJG A;  2HV1 A;  2J3W A;  2VA0 A;  2PAV P;  3CG5 A;  4PAU A;  5CGX A;  4PM7 A;  2RL3 A;  2X01 A;  3LID A;  1P0Z A;  2HJ9 C;  3RXX A;  2H0T A;  1YPR A;  1S4S A;  1NLZ A;  2PYR A;  2EX9 A;  1BUL A;  1NWZ A;  2PD7 A;  4X55 A;  3NBL A;  2HP5 A;  4Y13 A;  1L0G A;  4U0T A;  5DTS A;  3GV9 A;  1S66 L;  3UE6 A;  1M40 A;  4I39 A;  2Q9N A;  3LIC A;  3MZF A;  4JXS A;  2D01 A;  1H8M A;  2JKR M;  4EES A;  2Z2M B;  3VP2 A;  1BT5 A;  4CLC E;  3FZC A;  2ZMF A;  5EVI C;  1KE4 A;  2JCH A;  2H5S A;  1KOU A;  3CUE A;  4DXC A;  1YMX A;  1XPB A;  2ZQ9 A;  5CER A;  3S7Q A;  1ONG A;  1H3Q A;  5DJU A;  4OPZ A;  3ZVW A;  2JC7 A;  1S6R A;  3ISG A;  4R4R A;  1GCE A;  3JPU A;  2O9B A;  3C8C A;  1JTD A;  3MSH A;  4BL3 A;  3UB8 A;  2J9O A;  2WK0 A;  1VM1 A;  2HP6 A;  4BBU A;  4WM9 A;  1GSV A;  2WZZ A;  3G34 A;  4L0L A;  3FWL A;  5HL1 A;  4HQA A;  4KUO A;  1PYY A;  4PKY G;  3UB5 P;  3ITB A;  1BLP A;  2J8Y A;  1CI9 A;  4S2N A;  2W1R A;  4OLD A;  1NXY A;  4R23 A;  4UEY A;  2J3T D;  3QP2 A;  3BW6 A;  4NKP A;  3G31 A;  3EQV A;  2EWV A;  3ZG7 B;  4KZ3 A;  1CK3 A;  3LEQ A;  1N4O A;  4S2J A;  3MJQ A;  4BEN A;  2EX2 A;  3D4F A;  3CPT A;  2QMI A;  2YKF A;  3G4P A;  5F68 A;  4DDY A;  2X02 A;  4QD4 A;  4IVI A;  2P04 A;  3IH9 A;  5CGW A;  3EGD C;  4KZ8 A;  5FQ9 A;  3HL9 A;  4ZDX A;  1GA9 A;  4GZB A;  4LGW A;  2W3G A;  2VGL S;  4LPZ A;  2KX6 A;  3PBT A;  2Y55 A;  4H6J B;  3EOI A;  1TS6 A;  3MFX A;  2XA7 S;  5CHM A;  2HZ5 A;  4Q0J A;  5J7E A;  4DXB A;  4WMC A;  3V50 A;  4Q8I A;  3F1O A;  1O07 A;  2W3D A;  4YNR A;  4X1M A;  5HWT A;  1DP8 A;  5F6A A;  1PWG A;  4MLL A;  3C4P A;  4GCZ A;  4FH4 A;  2XK1 A;  4UA6 A;  4EXO A;  5U47 A;  3IHB A;  4RVA A;  2ZBB A;  1MXO A;  1W8Y A;  3EEA A;  2P9V A;  3BEC A;  1STZ A;  2IWD A;  3P01 A;  1Q2Q A;  4PHT A;  3LY3 A;  5EVI B;  5KZH A;  1P9W A;  1OT9 A;  3UE3 A;  4NXF A;  1CJF A;  4Y15 A;  2P74 A;  2JKG A;  4FUW A;  4OPR A;  1YLW A;  4IVK A;  4DJ2 A;  3ZFZ A;  3ICY A;  3DAV A;  2QPN A;  4LRZ E;  3LR5 A;  3TE8 A;  1N9O A;  3HUO A;  2PD8 A;  1ONH A;  5FI2 A;  3GQZ A;  1H8Y A;  4OOM A;  1WE4 A;  4KQQ A;  3W4O A;  4DE3 A;  3OPP A;  4WEL A;  2ZQD A;  5HAQ A;  4P6B A;  1SDE A;  3K2N A;  3C30 A;  3H7W A;  1GA0 A;  3V5M A;  1BTL A;  4A5R A;  3EWK A;  5GLC A;  4R3B A;  3LUQ A;  2VGK A;  5F1F A;  4RX2 A;  4MNR A;  3VFF A;  3LIB A;  2Y8H A;  3IWO A;  1VET B;  1T1B A;  4JXW A;  1OT6 A;  4JLF A;  1NZO A;  5EM0 A;  1W5D A;  3E4P A;  5GLB A;  1KGG A;  4BBT A;  4MN6 A;  3UE0 A;  2V1A A;  1LLB A;  5EOE A;  2XH9 A;  3GDI A;  1G68 A;  3N6I A;  3Q1F A;  5L09 A;  3N8L A;  1BLC A;  4CQH A;  3KX0 X;  5HL6 A;  5I5L A;  5DJT A;  4DJ3 A;  5A8B A;  1XX2 A;  1FCN A;  5FQQ A;  3T4O A;  3RH8 B;  3G6O A;  3WRT A;  1KE3 A;  2J9P A;  4WF0 A;  4KEN B;  1TS7 A;  1K54 C;  4E3K A;  4HBU A;  4IUH A;  2QZ6 A;  3P09 A;  4XT2 B;  4CLC A;  4R3A A;  2WKH A;  4OQG A;  4U0X A;  1WYC A;  4BWI A;  3ZCZ A;  3UN7 A;  4P6Z M;  4ZAM A;  3BLM A;  1HLU P;  1NRJ A;  3F1P B;  3MQ0 A;  2LB5 A;  3VV4 A;  5IT5 A;  4EUV A;  2WKE A;  3HCY A;  1K6S A;  3AGF A;  4KZB A;  4C75 A;  2H28 A;  3CLO A;  4BLM A;  3NOU C;  2W27 A;  4RQ9 A;  2R9X A;  3AGE A;  3S1Y A;  2V0W A;  4GDB A;  2XRO A;  1FIL A;  4HP9 A;  3TW8 A;  2ZQA A;  1CEF A;  1ES3 A;  1W63 M;  2EFX A;  5DFY A;  2VV7 A;  3OPH A;  4BMW A;  3CUE C;  2DMW A;  2A24 B;  1O7E A;  2JKT I;  3K3C A;  3MXQ A;  2O9C A;  3DTE A;  4FTX A;  1YLP A;  2GZA A;  4E3L A;  3D9Y A;  4MN5 A;  3SS5 A;  1YM1 A;  5DKL A;  3C38 A;  4Q0H A;  2Z2L B;  1A0K A;  2QYB A;  1ERO A;  3OOV A;  3UPO A;  2Y2O A;  4WUJ A;  3QP4 A;  2HPB A;  4MEZ A;  1L3L A;  5EE8 A;  4M3K A;  4S2N C;  3G32 A;  5TBM A;  5EVE A;  4X56 A;  1IOU A;  4HH3 A;  1FR6 A;  2ZQ7 A;  1MWS A;  1LSW A;  1IYP A;  1FR1 A;  4FCF A;  3C4O A;  4PMA A;  5AJG A;  4UA7 A;  5FQM A;  3WWX A;  2DCF A;  4HJ3 A;  2NUT C;  4HHD A;  3QNC A;  3R7W A;  4ETX A;  2AVX A;  3ITA A;  1S67 L;  3S7O A;  1K25 A;  2PHY A;  5GLA A;  1VHM A;  3OPL A;  5HAP A;  3EGX C;  3ZDJ A;  2OLU A;  4JGP A;  3GVB A;  1JWV A;  4JBF A;  3DW0 A;  1H0M A;  4PPR A;  5DTT A;  2PBY A;  3FC7 A;  3DTI A;  4WZ5 C;  2E8J A;  2OSU A;  4WL9 A;  2FFY A;  2OOL A;  5KSH A;  2HDQ A;  2L0W A;  3QHY A;  3NOP C;  2G2W A;  4LCM A;  4MN7 A;  2X71 A;  3NDG A;  4GNU A;  3CWF A;  4LCL A;  1JVJ A;  1TEM A;  1XGI A;  3HLE A;  3H9W A;  1XXM A;  4PM5 A;  3CIT A;  5HDD A;  3ZYT A;  2OAP 1;  3FG8 A;  1CEG A;  3D3O A;  4HBT A;  3KSF A;  1KGE A;  4Y3I A;  4LV0 A;  4OKP A;  3RTY A;  5FI7 A;  1DJC A;  3E2K A;  3OCN A;  4GHI A;  3E2L A;  4ZJ1 A;  3UE1 A;  3QP5 A;  5TJJ A;  3F1N A;  4KZ4 A;  4R0Q A;  5LBR A;  2I72 A;  5CRF A;  1K4E A;  3A3F A;  3KSH A;  3VP1 A;  2Y59 A;  4Z9Q A;  3HLW A;  1F98 A;  1K0K A;  4ARZ A;  3SW1 A;  1KGF A;  2VV8 A;  5A93 A;  1K55 A;  2BG1 A;  3N8S A;  3TJZ C;  4GDN A;  1ERM A;  1N9L A;  5D3O A;  4QY5 A;  2PU2 A;  4BQM A;  4EU0 A;  1NRF A;  4B4X A;  3WS2 A;  3CAX A;  3CPT B;  4B9O A;  3V67 A;  5IU1 A;  4NXE A;  3N7W A;  2D02 A;  1RP5 A;  4WN5 A;  3P7N A;  4Y17 A;  1ESI A;  1YLY A;  3W4Q A;  2B5R A;  2JHE A;  5CXW A;  1LI9 A;  4UQI M;  5DFX A;  2ZC4 B;  3UPP A;  1MKM A;  5M1A A;  1XJ2 A;  2L1M A;  4XXR A;  5TGF A;  1K4F A;  4RYE A;  4EEU A;  3DTK A;  1T18 A;  3B33 A;  4EER A;  1Q2P A;  1JTG A;  3JVV A;  4E3O A;  3F1O B;  2B18 A;  4IBR A;  4CLC C;  4BD1 A;  4KZ7 A;  1VEU B;  4IHQ A;  2ZQC A;  1K57 A;  2WKP A;  1MZU A;  3PXP A;  2WGW A;  4JXG A;  2P9V B;  5HD5 A;  3VP3 A;  1QME A;  1WA9 A;  5HSQ A;  1PW1 A;  3PAE A;  1OTE A;  1CF0 A;  1EI5 A;  5HAI A;  3NJA A;  5CEB A;  4D60 A;  1KE0 A;  1ZHH B;  4K0X A;  3ULF A;  3KYE A;  4PKY A;  1NY0 A;  1WYB A;  3HJK A;  1KDS A;  1DP9 A;  2HF6 A;  4P6Z S;  5AVE A;  3PAG A;  3PBN A;  1BLS A;  2RCX A;  3PTE A;  4AFI A;  3HVF A;  1S1Z A;  2XSS A;  4U3T A;  2GX5 A;  4F94 A;  1YKD A;  1YLJ A;  3VSK A;  1YSQ A;  3NCK A;  3N8R A;  2KOI A;  1YMS A;  4Y0T A;  1F2K A;  3A0S A;  4HY8 A;  1LL5 A;  3IS2 A;  1IYQ A;  4P0M A;  1HVB A;  1NJ4 A;  1MWU A;  3LIF A;  3ZG5 A;  3S22 A;  4OQ0 A;  4E6W A;  1DY6 A;  3FKV A;  4LEN A;  4UAA A;  4R3J A;  4JKT A;  2ZC3 B;  3BQA A;  3BWL A;  2XEP A;  1NYM A;  1N9B A;  4DDS A;  1L0E A;  3ZGA B;  4EW7 A;  3WRZ A;  3S4X A;  4KQD A;  3ZHH A;  1ES4 A;  2Y4A A;  1ZC2 A;  2ZD8 A;  3G2Y A;  2XR0 A;  2FFF B;  4JXV A;  1AWI A;  4S2K A;  3PBR A;  1ODV A;  3B47 A;  5G18 A;  3DTM A;  3FYZ A;  1SKO B;  1N9N A;  2VK3 A;  2WKQ A;  4I3I A;  1I2S A;  3RXW A;  2CC1 A;  4S2O A;  2OWH A;  4NXG A;  4Y0U A;  2WGV A;  2R78 A;  3BJN A;  3H82 B;  1BLH A;  3QP6 A;  2Y2I A;  1OTA A;  5C5K A;  4CPK A;  4CLC B;  2W3F A;  3DBA A;  4K08 A;  1SZV A;  5A90 A;  5AQA A;  4MBF A;  2A2L A;  3SS3 A;  3NY4 A;  4E6X A;  3BRM A;  3MXS A;  2PR5 A;  4LRY C;  5GHZ A;  4NK3 A;  1XA7 A;  1XJ6 A;  4BJP A;  5GHX A;  5E2E A;  3GEC A;  3OBF A;  1FOF A;  1SCW A;  5EPH A;  2V1Z A;  3T50 A;  2C6W B;  1OME A;  3S7N A;  3NDE A;  5G4Z A;  3E4O A;  1V9Y A;  4MDZ A;  5EV0 A;  5HWV A;  4QB8 A;  3BFC A;  3HUN A;  1PWC A;  4FD8 A;  3WS0 A;  1PRQ A;  3O3V A;  2QJ7 A;  3CI6 A;  1KVL A;  3GMW A;  3PR6 A;  3BFE A;  3HBR A;  3MR0 A;  3AGD A;  1G28 A;  3C2W A;  5L2F A;  1VQQ A;  5E2H A;  2VJW A;  4Y2F A;  3GTC A;  2V0U A; 
#chains in the Genus database with same CATH homology
 3H7W B;  3MMH A;  4MN5 A;  1TF1 A;  1OPX A;  1EW0 A;  5DKL A;  1YSP A;  3C38 A;  4Q0H A;  3PBQ A;  1LSX A;  2QYB A;  5DF9 A;  3OOV A;  3T4S A;  3E4Q A;  1OTB A;  3UB7 A;  4WUJ A;  4O8G A;  2B02 A;  3LIE A;  3S7P A;  1W63 Q;  3LI9 A;  3A0V A;  5TBM B;  4HJ4 A;  5TBM A;  1LT0 A;  4R38 A;  1IOU A;  2O0Y A;  4HH3 A;  4R6L A;  3W2Z A;  2V9A A;  3JVU A;  3BY8 A;  4L9F A;  4FSF A;  1LSW A;  1DRM A;  2OAQ 1;  1XFN A;  5AJG A;  5MC7 A;  2M7V A;  2K2N A;  4Q0I A;  1P9R A;  5AVF A;  3VE3 A;  4HJ3 A;  2NUT C;  4HHD A;  2J80 A;  3LR4 A;  2GNX A;  3R7W A;  4EET B;  4ETX A;  3T4Q A;  2JN7 A;  1S4R A;  1S67 L;  4IJG A;  3S7O A;  2HV1 A;  2PHY A;  2J3W A;  2BAS A;  2VA0 A;  4MMN A;  5J4E A;  1VHM A;  3VOL A;  3EGX C;  4PAU A;  4JGP A;  1BYW A;  4B93 A;  2KDK A;  4H6J A;  3UB6 A;  2HGV A;  5HDC A;  3LID A;  3BY9 A;  3FC7 A;  1P0Z A;  2HJ9 C;  1JNU A;  1S4S A;  1NLZ A;  2PYR A;  2YKH A;  4WL9 A;  2OOL A;  5KSH A;  1G6O A;  1NWZ A;  2PD7 A;  3A0R A;  3HJI A;  2VLG A;  4UQI S;  1LL8 A;  2NUP C;  3KSG A;  2L0W A;  2O99 A;  4GS9 B;  4GS9 A;  4YOF A;  1S66 L;  3UE6 A;  3NOP C;  4I39 A;  3LIC A;  5J3W A;  2FZ0 A;  4MN7 A;  1TS0 A;  2D01 A;  5G4Y A;  1H8M A;  2JKR M;  4EES A;  4WLA A;  4GW9 A;  3CWF A;  4CLC E;  2ZMF A;  3H9W A;  1KOU A;  3CIT A;  5HDD A;  2W1T B;  3CUE A;  3ZYT A;  3O5Y A;  4EQ1 A;  2OAP 1;  2HJE A;  3FG8 A;  3MF0 A;  3D3O A;  3S7Q A;  1H3Q A;  3KSF A;  5DJU A;  4BBV A;  2EWW A;  4DMZ A;  4GLQ A;  4Y3I A;  2ZMV A;  3RFB A;  3KYZ A;  3RTY A;  2O9B A;  3C8C A;  3NHQ A;  3LFV A;  3UB8 A;  3D72 A;  3OCN A;  4GHI A;  1TD5 A;  4IUK A;  2VKS A;  3PBO A;  5TJJ A;  4BBU A;  3F1N A;  1GSV A;  2CMN A;  5LBR A;  5CX7 A;  4L0L A;  4HQA A;  1XJ3 A;  3BQ8 A;  4KUO A;  4PKY G;  3UME A;  2VV6 A;  4L9E A;  4JGO A;  3T4L A;  2W1R A;  2Z6C A;  4WEK A;  3KSH A;  3OCL A;  2P7J A;  1F98 A;  4O01 A;  4ARZ B;  4ARZ A;  4UEY A;  3SW1 A;  1UGU A;  3KO6 A;  2J3T D;  3BW6 A;  4NKP A;  1LSV A;  3EQV A;  2VV8 A;  2EWV A;  2XRN A;  3TJZ C;  2VGL M;  1UWP X;  1N9L A;  3PHY A;  3MJQ A;  4EU0 A;  3LR3 A;  2INW A;  3CAX A;  4B9O A;  3V67 A;  5IU1 A;  4NXE A;  2XA7 M;  4G3K A;  2YKF A;  1XJ4 A;  2D02 A;  3R7W B;  3PYP A;  4HIA A;  2KLI A;  4CLC D;  4NEE D;  4WN5 A;  3P7N A;  5F68 A;  4KQO A;  3EEH A;  2V1B A;  4YWZ A;  2JHE A;  1F5M A;  2P04 A;  2PR6 A;  4UQI M;  1TS8 A;  3EGD C;  5DFX A;  5EFW A;  3UMD A;  1MKM A;  2J3T C;  5F5Y A;  2W0N A;  2W3G A;  2VGL S;  4LPZ A;  1XJ2 A;  2KX6 A;  2ZOH A;  2L1M A;  3PBT A;  3K3D A;  3LR0 A;  4H6J B;  3EOI A;  4QPR A;  2P08 A;  1TS6 A;  4G3W A;  2MJ6 A;  4EEU A;  4LLO B;  5F69 A;  1T18 A;  3MFX A;  2XA7 S;  3H82 A;  3B33 A;  1UWN X;  4EER A;  2OWJ A;  4Q0J A;  5J7E A;  3LIA A;  3JVV A;  3F1O B;  2B18 A;  3F1O A;  4Z1W A;  2FH5 A;  2W3D A;  4YNR A;  3PBS A;  4CLC C;  5HWT A;  1DP8 A;  5F6A A;  4GCZ A;  1NLY A;  3UB9 A;  4I3J A;  4IHQ A;  1S1Y A;  2WKP A;  5KIZ A;  4EXO A;  1MZU A;  3OLO A;  3PXP A;  2ZBB A;  3EEA A;  5HD5 A;  1STZ A;  1WA9 A;  5HSQ A;  3P01 A;  4PHT A;  3IBR A;  1P9W A;  3EQU A;  1OT9 A;  3UE3 A;  4NXF A;  1OTE A;  3NJA A;  2K31 A;  3FPV A;  1ZHH B;  2Z6D A;  3ULF A;  4PKY A;  4DJ2 A;  5L8M A;  3HJK A;  1DP9 A;  1DP6 A;  2HF6 A;  3ICY A;  2JKT M;  4P6Z S;  5AVE A;  4LRZ E;  3PBN A;  1F9I A;  3LR5 A;  3TE8 A;  1N9O A;  4I5S A;  4AFI A;  2PD8 A;  1S1Z A;  2XSS A;  4GHI B;  1XFQ A;  2GX5 A;  1YKD A;  1D06 A;  3E98 A;  3F1N B;  2IA2 A;  2L4R A;  4O0P A;  1YSQ A;  2KOI A;  4OOM A;  3IBJ A;  2WKR A;  4L9G A;  2LB9 A;  3KSI A;  3A0S A;  4HY8 A;  4WEL A;  3U2A A;  3IS2 B;  3IS2 A;  1ZTU A;  1OTI A;  4ZRR A;  3OC2 A;  3LIF A;  3T4K A;  3K2N A;  3C30 A;  3H7W A;  1YAX A;  5FL3 A;  3ZQ5 A;  2ZOI A;  2W3E A;  4F3L B;  4F3L A;  3EWK A;  3LUQ A;  5IS1 A;  2PT7 A;  2VZW A;  3NOT C;  3KYQ A;  4HP4 A;  4DN0 A;  3LIB A;  2I9V A;  2Y8H A;  4HI4 A;  3BQA A;  3BWL A;  4E04 A;  5HZH A;  2K7S A;  1T1C A;  1T1B A;  1VB6 A;  1OT6 A;  4EW7 A;  3TRC A;  2QJ5 A;  3E4P A;  4KQD A;  4BBT A;  1OTD A;  3R4K A;  4ME4 A;  4MN6 A;  5HPF A;  4JGQ A;  2V1A A;  4HNB A;  2VEA A;  4LRX C;  3PBR A;  1ODV A;  3B47 A;  3GDI A;  2WKQ A;  1N9N A;  3MQO A;  4I3I A;  4ETZ A;  4CQH A;  3KX0 X;  5HL6 A;  2OWH A;  2QKP A;  5I5L A;  5DJT A;  4DJ3 A;  5A8B A;  2VX8 A;  4OOL A;  4NXG A;  3T4O A;  4G3V A;  1P97 A;  4FOF A;  3G6O A;  1IFQ A;  2M1C A;  2R78 A;  3BJN A;  3H82 B;  4I38 A;  3RH8 B;  1OJ5 A;  4WF0 A;  5HDS A;  1TS7 A;  1OTA A;  3B42 A;  4IUH A;  5C5K A;  2PDR A;  4II7 A;  4M4X A;  4KUK A;  4XT2 B;  2W3F A;  4XT2 A;  4CLC B;  1Y28 A;  4CLC A;  3DBA A;  4K08 A;  5K5B A;  4R3A A;  4BWI A;  4HH2 A;  2Y79 A;  4P6Z M;  1D7E A;  2A2L A;  1T1A A;  1NRJ A;  3F1P B;  3F1P A;  2LB5 A;  3FPW A;  2PR5 A;  3MQ0 A;  4LRY C;  3VV4 A;  5IT5 A;  4Y5F A;  5HD3 A;  4EUV A;  2O9A A;  3E0Y A;  2QHK A;  3HCY A;  1XJ6 A;  4BJP A;  2H28 A;  3CLO A;  1T19 A;  2W3H A;  3GEC A;  3OBF A;  3LYX A;  1GSW A;  3NOU C;  4MCW A;  2W27 A;  4RQ9 A;  5HPI A;  2M7U A;  1GSX A;  4HJ6 A;  1X0O A;  1MC0 A;  2JKR I;  3T50 A;  2V0W A;  4WEJ A;  4R70 A;  3S7N A;  2XRO A;  5G4Z A;  5DKK A;  3E4O A;  4HP9 A;  4JGR A;  4I3A A;  3TW8 A;  1V9Y A;  2EA9 A;  4MDZ A;  3VE4 A;  4GJ4 A;  5HWV A;  1W63 M;  5DFY A;  2VV7 A;  4BMW A;  1OJG A;  2GJ3 A;  4HOI A;  2W1T A;  3CUE C;  2DMW A;  3T4T A;  2G7U A;  1V9Z A;  2A24 B;  2A24 A;  4NXB A;  2JKT I;  2QJ7 A;  3K3C A;  3CI6 A;  3MXQ A;  3PR6 A;  5HWW A;  3MR0 A;  2O9C A;  1G28 A;  3C2W A;  4EEP A;  2PYP A;  3LI8 A;  3T4J A;  2QWS A;  2VJW A;  4Y2F A;  2V0U A;  2GZA A;  3MQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...