1LLCA

Structure determination of the allosteric l-lactate dehydrogenase from lactobacillus casei at 3.0 angstroms resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
320
structure length
320
Chain Sequence
b'ASITDKDHQKVILVGDGAVGSSYAFAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFTSPKKIYSAEYSDAKDADLVVITAGAPKQPGETRLDLVNKNLKILKSIVDPIVDSGFNLIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSVHAYIMGEHGDTEFPVWSHANIGGVTIAEWVKAHPEIKEDKLVKMFEDVRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGINDLYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAFAKND'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-LACTATE DEHYDROGENASE
molecule tags Oxidoreductase(choh(d)-nad(a))
source organism Lactobacillus casei
publication title STRUCTURE DETERMINATION OF THE ALLOSTERIC L-LACTATE DEHYDROGENASE FROM LACTOBACILLUS-CASEI AT 3A RESOLUTION.
pubmed rcsb
total genus 57
structure length 320
sequence length 320
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1988-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1llcA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1llcA02
3QHAA 4QEDA 4IZHA 5TGDA 2Q49A 1BGVA 3IQDB 1H6BA 4JGBA 1H93A 3ORFA 4II3A 4I9HA 4L4SA 3F6YA 5F5LA 3CIFA 1ARZA 1DIAA 1HF3A 4DYDA 3QWFA 4OXYA 1NPTO 3DAGA 3VPGA 3CEAA 3JYQA 5L3ZA 4YAKA 4CJXA 1YGYA 3S8MA 2DBRA 1VM6A 3ZU3A 2CY0A 4GL4A 3WX0A 4CR8A 3NTQA 1J4AA 4E6PA 2AHRA 1ZCJA 3ZNNA 2B36A 1KIFA 2J3KA 3LYLA 4NJMB 1GV0A 3BTVA 3LK7A 2E4AA 1ISIA 2PA3A 2WSBA 1ZXLA 2GRAA 2J8ZA 2ZTMA 4LCJA 1IPFA 5JDCC 3LDHA 3O26A 3GGPA 4OXKA 4ZQHA 5AYVA 3F3SA 1DEHA 1P9LA 4DUPA 4Q3DA 2Q46A 3AM5A 3OETA 5FF9A 3I9JA 1YJ8A 4NHEA 3STHA 1HZZA 2VCYA 2YV3A 4GX5A 2Y1OA 3JV7A 1LEHA 4DREA 5JDIC 3H4VA 4TZTA 2OBNA 4OAQA 2PWZA 1MC4A 1I01A 3D4PA 5AQ1A 2WM3A 1GYQA 4YPOA 4E2ZA 4E5PA 1VRWA 1KYQA 1LRLA 3ZHBA 4B7XA 2VWHA 4BNZA 2VQ3A 3F5SA 4I5DA 4U6QA 3BMQB 1ZEMA 2YUTA 2O3TA 1UAYA 4RQUA 2H63A 4QO8A 1K6IA 2WEKA 1XQ6A 1WPQA 1OMOA 3VHRA 1ENZA 1H2HA 1JKFA 3BTSA 2FZWA 4XQEA 4M8SA 1U2DA 4WOJA 1B2LA 5B1YA 4Z3DA 3RAJA 1DJNA 5BNTA 3GFBA 5J23A 5ENVA 1ENOA 1VSUA 1GZ4A 2PR2A 2W8ZA 3K6JA 3NT4A 4OL9A 1A72A 3SLKA 5CEFA 5IZ4A 1B8UA 4P4GA 4FR5A 9LDTA 5C7IO 4Y6SA 2JFGA 1FK8A 1H6CA 1NFFA 2Q3EA 1GQYA 4PG6A 3ROKA 1NR1A 5B4TA 1M75A 2GN8A 1NHGA 4IDCA 3VPXA 1N2SA 4I8XA 4QUKA 3LQFA 1LSJA 1T26A 3E8XA 4CM8B 4ZJUA 2G1UA 2NVWA 3RKUA 4UUPA 1I0ZA 3I52A 1JKIA 3HZZA 2B0JA 3PEFA 4PZEA 2V6BA 2IXAA 4FC7A 3ULKA 5GZ1A 1ZUD1 1E6UA 1SOWA 5EIOA 4CQLA 3I3OA 5G0UA 2P9GA 1DC5A 1VLLA 4CM1A 4TRJA 2EGHA 3OH8A 3NRCA 4JN6B 2Y1CA 4YJDA 3ZU5A 1C1DA 4IDDA 1W4ZA 4PLHA 2NVBA 3M2PA 1OC2A 2YV2A 2BKAA 4HWKA 3WTCA 1EEHA 3FRJA 7ADHA 4D45A 1W73A 4XR9A 2ZB7A 3C3XA 2LDBA 1I2ZA 4EJ6A 1R4NA 1WZEA 3BHMA 2D8AA 3WTBA 1RM0A 2GN9A 1LDBA 5ENDA 4NJOA 4CV0A 1WLYA 1Y7TA 3CINA 4FOSA 4ZQBA 5L4LA 1UXIA 1UXJA 5DF1A 2NM0A 4PVDA 1H6DA 4O59O 2I66A 2IEBA 4W6ZA 3K96A 3TZKA 4JP3A 1KS9A 5I7SA 1Z7EA 2D4AA 2VRCA 5JE8A 3RFTA 5A02A 1LDGA 4CUJA 3B1KA 3CE6A 4Q39A 3C7CB 2Y0CA 4LISA 3OQ1A 1JKJA 2HMUA 5KJFA 2DTEA 4NH4A 1U5CA 1CF2O 4B3HA 3WLEA 1KERA 5CPFA 3HB5X 2GZ3A 1MG5A 3E9QA 1HDRA 3UICA 2Y1DA 3FI9A 4CLHA 2HDHA 3ZW8A 1F8FA 1AHIA 4XYMA 3MWEB 5U9CA 1WWKA 4J1SA 1R0KA 4H15A 4BQRA 1E7YA 1RM4A 1X0XA 5I7VA 2AE1A 1WDLA 4YJGB 3ANLA 4YAJA 2RH4A 2Q1UA 3GLQA 5IDXA 4PG8A 2VZ0A 4J9UE 1IY8A 1ENPA 3ETDA 3TPCA 1YB1A 3KO8A 3EDMA 1T2EA 1IOLA 3D1LA 4PZDA 1NVGA 1CQJA 3WGHA 3Q0EA 1N7GA 1H0KA 2POQX 4YJFA 2RHRA 1EE2A 3WGQA 4E2XA 3EVTA 4FPXA 2VUSA 3U4IA 1HRDA 5AVOA 1DIGA 4CLEA 4HKTA 4OXNA 5JMPA 3CMCO 4MVJH 3JYPA 4LN1A 2OBYA 2Q4EA 2Z95A 1MC5A 2PTGA 4J4TA 4K6CA 3ZWPA 2HRBA 3PHHA 1BTOA 2YHIA 3WYCA 4Y67A 4CV1A 1P44A 5ITWA 4JBHA 2Q99A 3PFFA 1P77A 4IZIA 1SNYA 1WDKA 3WBBA 4OSOA 4AFNA 5JBIA 1UJMA 4WPGA 3HQ4O 3OQ6A 4C7JA 2J5KA 1X14A 3HE3A 4RCVA 3CSDA 5TS3A 3CTMA 5IAAA 4AG3A 1BW9B 4GWGA 2VOJA 1LLQA 1Q0LA 3T7CA 3GVCA 3UGKA 3V1UA 3V2UA 1SB9A 4ITUA 5I9LA 2BMAA 2PZMA 1JN0A 2NU7A 3C85A 3QLJA 2Q1TA 3P2OA 3FR8A 4F3YA 3R3JA 3WJ7A 4WCFA 4WLUA 4PLPA 4I9NA 4LSMA 1ID1A 4MIOA 4HXYA 3DBRA 1YL7A 4A2CA 1GDHA 3NTRA 1P1IA 4ALMA 4EW6A 4WLVA 1GU7A 3CKYA 3NDIA 1VKNA 3H3JA 4M89A 4RV9A 2HK8A 5EN4A 3ZNQA 4CLDA 1PZGA 4QT0A 1NQ5A 2JCVA 3L0DA 2C29D 4LSWA 4WCDA 4WLEA 1YQGA 5GY7A 3B70A 3E1KA 3L9XA 4NZ9A 5EJ2A 3U9LA 1E1MA 3E5MA 3G1UA 4GI2A 4R16A 3RC2A 3DOJA 1Y81A 2NQTA 5JPIA 3MEQA 3RVDA 1ZIDA 3PJGA 3EGOA 4TSKA 1X1TA 3X2FA 3ZHXA 3JTMA 4YTEA 1YE3A 3A9WA 3ZV6A 4HFNA 3GFGA 4MPDA 1QLJA 1XA0A 5IZCA 1E6EA 4A26A 4AL4A 1Z74A 3C7DB 3MJEA 3KBOA 2ZK7A 2F00A 5T8KC 1XQ1A 1K2WA 3GK3A 1HSZA 3ZWAA 2HSDA 1DC6A 5A9RA 1O5IA 1ZMOA 2BH9A 2D59A 3Q9NA 3QY9A 4EDFA 3O8QA 2PH3A 5L40A 3A06A 1JVSA 4FN4A 3UXYA 1RM3A 4PLYA 4Q9NA 5A5EA 1DLIA 1MXFA 4I9UA 3WGGA 1HE3A 2X5OA 4UREA 2VYVA 4BQPA 3WFJA 4AICA 3F1LA 2VZ8A 4Q3CA 2CD9A 2XOXA 4P8RA 3DWFA 1EVIA 5GMOA 1LSUA 3CPSA 1D8AA 4H3VA 4H7PA 4AVYA 1YB5A 4JK3A 4PLCA 1H9BA 4R1SA 1B8VA 2FR8A 4UVGA 1IPEA 2DPHA 5EQDA 1SMKA 4OKNA 5LC1A 3UF0A 3KV3O 3A1NA 2X8LA 1DRUA 4BMNA 3RSHA 1UXKA 1E7QA 3Q11A 4D0SA 4PRKA 4RDHA 1WP4A 3OP4A 5DBGA 5G0SA 1D7OA 3KYBA 1NWHA 3OMLA 4XYEA 3GDGA 3HWRA 3H2ZA 2GR9A 1Y6JA 3I6QA 4Q3EA 1P3DA 3DR3A 3B1FA 4AJ2A 3D5QA 3TF5A 2IZ0A 4MVJF 5JAIA 3KSDO 3RD5A 4MIYA 5I9MA 1PX0A 2X7HA 2XXJA 1QG6A 4BNJA 1UAGA 1NFRA 2ZIZA 4DGSA 4JJFA 3DBHA 2BFPA 1XU7A 3FCOA 2IRWA 3I9OA 3KZVA 3WMXA 6ADHA 4K26A 3KHUA 4DQUA 5EERA 4XYBA 4ND5A 1IZ9A 3AFNA 1XKQA 1NYTA 3JSAA 3VPSA 4JCOA 3IJPA 1J6UA 3WNVA 1HSOA 1DFGA 1XSEA 4CM6A 1EK5A 3PQDA 3GHHA 4MP3A 4R01A 1PGQA 1QLHA 2XPCA 4DRYA 1F17A 3JQEA 2NWQA 4TZKA 2FPGA 4R9RA 3H5RA 1A71A 1P1JA 3C8MA 2EW8A 5KVSA 5ILOA 2VN8A 2A35A 4CLRB 1LQTA 2YY7A 4XIJA 3S2FA 5FYDA 1WMAA 3WQQA 4E4YA 2Q1WA 1PS0A 4PZCA 4CQMA 3F5QA 1R12A 4JX8A 3N74A 1PR9A 1RPNA 4BHTA 4MVJM 3WGZA 2ZTLA 3GRPA 2WWRA 1FDSA 4PLFA 1DB3A 1ZXBA 2WYUA 1C0KA 1ZFNA 4QSMA 3DHEA 3QIVA 4AJJA 4Y6RA 3W8EA 4JJGA 1BXGA 2DLDA 3RASA 4A10A 4CM3A 5DT9A 3LC7O 5JYDA 2FZEA 3TSCA 4R68A 3TOZA 3DL2A 1V9LA 4BNTA 4GX2A 4XGIA 3RU7A 1X7HA 1I3NA 3GF4A 4CM4B 4NU6A 2DVMA 4IJWA 3RFVA 3DAFA 3DZIA 2BFMA 3LT1A 3I5MA 2E82A 4B3JA 2NTVA 1KVQA 5A3VA 2VHZA 3RUEA 2OOSA 4E5KA 2X4GA 5L7WA 3VC7A 4OIMA 1MFZA 4RGBA 3EZLA 3W8FA 4YJGA 4M1QA 3UW3A 3C7AA 4NBWA 2IYPA 3QJ5A 4ZHSA 1AXGA 4YJHA 3GN2A 5AXCA 4KUHA 2O23A 4CMKA 2BD0A 1ZMTA 4U7WA 4A27A 3EVNA 1GYPA 3I9NA 1XCBA 4MP6A 4BGUA 4BNVA 3OEYA 4EUFA 4DIBA 3LU1A 4I1IA 4J0EA 5IXYA 4XWYA 1ONOA 1LLUA 4D43A 1HLPA 5A06A 4E30A 4MVJA 4QFDA 4BIIA 2YW9A 3BIOA 1Q2XA 1D4FA 2B69A 3JD4A 4CLOB 4B4UA 4B79A 3HUDA 1U7TA 2C2XA 2VRCD 3IC5A 3JYNA 4ND2A 2C07A 3NJ8A 2YYYA 3VPHA 1PGNA 4G65A 1NPDA 4XQ9A 2OGUA 4CL8A 3S55A 3NDRA 2VUTA 5JCJD 2ZQZA 1IE3A 3K73O 4L4RA 4EUEA 1MG0A 4KWHA 3EW7A 4MKXA 5DDIP 3BXXA 1GUYA 4P22A 4IS2A 3K2EA 2ZYDA 4FOOA 3ZWOA 4N7RA 1KY5A 3VH3A 3ST7A 1NPYA 2JFFA 1MX3A 2QZ9A 3EHEA 3NKLA 4IQ8A 2O3RA 3OIGA 3H9UA 2VTEA 4LCEA 3TFQA 3D64A 1PJCA 3FD8A 4BKUA 1YH3A 1CYDA 3FTPA 5JDCA 4D0RA 2TMDA 3TL3A 1HDXA 2C5AA 1J0XO 4PG5A 2JAHA 3Q6IA 5HWSA 4RPHA 4R1NA 2JD2A 4I5FA 1RKXA 4FFNA 4N18A 3WMWA 4NFHA 2QYTA 1ZVMA 4WLOA 1JQBA 1XELA 1ZO8A 4GAEA 5CDTA 3ONFA 3UCEA 3AM4A 1VL0A 4KQXA 3MZ0A 1HWYA 3SC4A 1DAPA 2EP5A 1AN9A 4BO0A 1ZNQO 4XJSA 1L1FA 5U1PA 4XR4A 3U4HA 4INAA 2EJWA 4XEHA 4J43A 1G6KA 7MDHA 1DIHA 1FDUA 4GGOA 4HX5A 4MINA 3KEQA 1UH5A 5A9TA 1ENYA 4ILKA 1VSVA 4E32A 4PLTA 4BVAA 1ZH8A 2VHVA 5EMHA 3MCVA 4LW8A 1SZJG 5F3RA 1TVEA 2PY6A 3NEPX 5FI5A 3ANNA 4RVSA 2AEMA 3GPDG 5KCZA 1SCUA 1LDEA 1LRJA 3QQPA 3NTOA 3HN2A 3PGXA 4WE3A 4RLSA 2WTBA 1LA2A 3JQDA 4RLHA 4DXHA 4UUMA 3EUWA 1S7CA 4E2WA 3W6ZA 2FPIA 4YBZA 4XCVA 2VRBA 2OP1A 3GEGA 3JD0A 5TIIA 3VTZA 5TT0A 3V2HA 4PG7A 2F1KA 2B35A 1P1KA 1ZJZA 2G0TA 1T2CA 1PQUA 1PU2A 4MVJE 3RWBA 4CMIA 2CFCA 2RCYA 1EK6A 3DTYA 4RVUA 2GO1A 2BFAA 1GEEA 4ZGWA 3WQRA 2O2YA 2V6FA 1VC2A 1H5QA 4PLVA 1E7SA 5COQA 4AJEA 4BNHA 5JDIA 3F4BA 1UP4A 4HUJA 4ZQGA 1TB4A 5CDYA 3UVEA 4A73A 4W4TA 1HDYA 3EMKA 4L4XA 4BNKA 3R3SA 3ZWNA 5KKCA 1JVBA 4D79A 1KBZA 4N5NA 3AOEA 4GSLA 4E21A 4FBGA 4TRRA 1L7DA 4WECA 3R0IA 2UVDA 1A4UA 1TT5B 3GZ4A 3NT2A 3WYBA 1DOHA 3K2BA 1EFLA 1DRWA 1ZJYA 3WGOA 3VZRA 3JQBC 1PWXA 1XGKA 5F1OA 1HDCA 3CZRA 1Q0QA 4IQ0A 4NK5A 5IXSA 1U1IA 1X13A 2ZQYA 2P91A 3VDRA 3ITKA 1OBFO 5K6AC 2QYSA 3RBXA 2QRLA 2XAAA 4FFLA 4J2HA 1K6JA 3GEMA 4J1QA 3WQSB 4YT4A 4R1TA 2R00A 5DULA 5BSFA 1X7DA 4RPJA 3TOXA 5A03A 3MTJA 4PLGA 2D1YA 2JKVA 2YZ7A 5FEUA 3D3WB 4YAGA 5CG2A 1MGOA 3L07A 5CP8A 3HFGA 4PLZA 3WG9A 4J3FA 3BMQA 4J90A 3KSUA 4JBGA 4YACA 5A1TA 2J3IA 2ZATA 4YXFA 4R9SA 3RUIA 5ER9A 3VVBA 4BNFA 1R16A 5BR7A 2PZLA 2FWMX 4R5MA 1I32A 2E6UX 3ETGA 3RIHA 4GX0A 4N54A 5T67A 3UH1A 3C1OA 4YR9A 1U3VA 1LDNA 4UUNA 1HE2A 2PGJA 1DC4A 4E3ZA 3KM0A 2ZTUA 1E3WB 1WAMA 3SXPA 4RZHA 1YKFA 1R66A 3DHYA 5L45A 2J3HA 4CV3A 1EUDA 3JQ7A 1BWSA 1I2CA 1K5HA 1PGOA 4Z0PA 1UDAA 4OGWA 2Q45A 4JIGA 4OJNA 3VDQA 2QRJA 2PD4A 3JQCA 4IIUA 4OO3A 2J3JA 2Z1MA 4RPLA 3S1LA 1JWBB 2RAFA 3V5NA 1SO8A 1YDWA 3L6EA 4D46A 5C7LO 1UZMA 1ULSA 1I36A 4U0KA 5L95A 2GERA 1DPGA 4FJ0A 4WJZA 1QYWA 1K3TA 4CQLB 2FSSA 1JWAB 1O95A 1Z45A 2NSDA 3JQ8A 3F4LA 2Q2WA 4CM9A 4XKJA 1WDMA 2D5CA 4PRLA 1QRRA 4M87A 5ES3A 4CM4A 4ALLA 4X54A 2VOEA 3OA2A 3GMSA 4R5HA 4BKOA 4TWRA 1C1DB 4YQZA 3DAPA 3RC9A 3TN7A 4UUOA 3TZQA 3OJLA 1X0VA 3F9IA 4IJVA 5A3JA 3VH2A 1GQ2A 2HMWA 2W98A 4FIZA 5IFLA 2I76A 1EMDA 1FDWA 2B37A 4P38A 4YDRA 3OJOA 3E9NA 2C54A 2E48A 1AE1A 5BNFA 3M6IA 2X23A 3KYDA 1GPJA 2Y93A 4RQTA 2PFGA 2O48X 3S2GA 1XHLA 4AJOA 2ZB4A 2PKQO 1I24A 1LC3A 2VWPA 3GVHA 3KUXA 3NGLA 4YCAA 1MV8A 2I5PO 1NAIA 4YWJA 5CAEA 1LUAA 2GGSA 3DBLA 2UAGA 5DBFA 3UUWA 1U7HA 1X1EA 4J7UA 4XGNA 3L9WA 2B5WA 2Z1NA 1UZNA 2I99A 4FCCA 4IMRA 5T6BA 4EBFA 3K30A 4HADA 1M76A 3HN7A 3HDYA 3D3WA 3LZ6A 3GVIA 4RVHA 1JAXA 2DTXA 1E1NA 3F1KA 4ZICA 3GG2A 4XDZA 1HEUA 4RVGA 4R4JA 4XJTA 3FPCA 1T25A 1F0YA 3AI1A 2AW5A 4Y6PA 4ZA2A 3DMTA 1E3JA 3KYDB 3LSYA 5LDGA 2DC1A 2DT5A 2JL1A 4U8GA 4ALNA 1Q0HA 1SC6A 2EP7A 4A0SA 2OORA 3N7UA 3LVFO 4EI2A 5HRUA 1KC3A 5JS6A 2WE8A 2G5CA 1T4DA 4RF3A 2AG8A 2OZPA 1DSSG 3ZWCA 1NXQA 2YFHA 4J49A 4BOYA 2J5RA 4B8ZA 5KNLA 2HCTA 3BMCB 3DOOA 4B3IA 1DAOA 4IGEA 2JJYA 1YB4A 4WCFC 1EVYA 5IN5A 2X0JA 3S2IA 2W4QA 3KVOA 4HP8A 1YOVB 3QA9A 4NBUA 5HBRA 4L0QA 2JFHA 3WIDA 3O9ZA 4IQGA 3FNFA 1B3BA 3PYMA 3ASUA 3F47A 4RORA 5TX7A 5U4QA 1U3TA 4E0BA 3IUSA 4O1MA 3G79A 4Z0HO 4UAGA 1ISHA 1ZSNA 1E1KA 4RO0A 1PZHA 2QRKA 2X22A 5DN9A 4EJMA 1UP7A 3K8ZA 3TZ6A 4JLWA 4CMGA 4KDFA 4CMEA 4J16A 4DMLA 2UV8A 1F06A 2FR0A 4J7XA 4IJKA 4EUHA 3X2EA 1E7WA 1YBVA 3PVZA 5JFOA 1LC0A 1YQXA 4CODB 5TT1A 3WGIA 1BW9A 1SEPA 2DBZA 1EZ4A 5A9SA 4BS9A 4CMCA 2DPGA 1YQDA 9LDBA 1OAAA 5DP1A 3SVTA 1N9GB 5EESA 2O4CA 1OC4A 5G4LA 3VTFA 4BNXA 1K89A 4PN3A 3W8DA 2EF1A 4NJMA 1LX6A 1Y1PA 4E2YA 5JYEA 3PYXA 3I6IA 1PS8A 3QVXA 3INRA 4CMHA 3BHIA 4GWKA 3VH1A 3V1YA 2GSDA 4QECA 3FR7A 2A94A 3TZCA 1I3KA 3T4EA 3GRKA 3JQ6A 2RH8A 2JHGA 4J0FA 3GZNB 3RQSA 1GD1O 2A92A 5F5NA 1XIVA 3WFIA 1IHYA 3H5NA 2X9GA 2FOIA 3U3XA 3ZGYA 2VNSA 3TRIA 4ZQEA 2G17A 5BT9A 1N9GA 4R3WA 4HFJA 1BSVA 3JYLA 1LTHR 5IZCC 4DTIA 5KJ1A 2G76A 5CPBA 1CEQA 1M67A 2GLXA 1NHWA 2NU8A 3R1IA 3RC7A 3ITDA 3PFWO 3QVTA 2GPTA 2W2KB 3ZV5A 1V6AA 4E31A 3PWZA 3PI7A 5A4DA 4OMUA 1IHXA 4OH1A 4A03A 3D7LA 3DDNA 4KDEA 4R51A 2DFVA 4IIVA 4D3SA 5TJHA 3PIDA 3KTDA 4NBRA 4G2NA 3PJEA 1SPXA 3DZJA 4UEJA 4XA8A 3DTTA 3IAHA 2Y0DA 3WS7A 2PD3A 2AG5A 2D2IA 4JBIA 2ZJ1A 2HJSA 1O6ZA 3M1AA 3PLNA 2H5LA 1MP0A 4XRRA 3GHYA 2GD1O 4LRTB 3U5TA 1JA9A 4GPD1 1CERA 4MJLA 2NU6A 3JQAB 4FS3A 3GA0A 4LRSB 4FJ1A 1QYXA 3IIEA 5THQA 4DLLA 3JQGA 1MLDA 4JXKA 4DLBA 4DPLA 5AOVA 2AMFA 4NIMA 1DDOA 4Z9XA 4ESOA 2C7VA 3UAGA 1E5LA 1PJTA 5CDGA 3AU9A 4BO4A 1NFQA 2Y1EA 2X9NA 2ZB3A 5JCJA 3HDQA 5JSFA 1I5RA 2O3SA 4GMFA 3UKOA 1E3IA 2W2LA 3I9LA 1J49A 4QTZA 2CDAA 5AXAA 2GNAA 1FJHA 4RPGA 5CDSA 3ZHZA 4NNJA 4AJKA 2PV7A 4GSKA 3FWNA 4DBZA 1UDCA 2FR1A 4DC1A 4KP7A 3LT0A 3RUFA 5IN4A 4BGIA 3PYLA 5IDQA 4UVHA 2D0IA 5CEJA 1OI7A 2LDXA 3GNQA 4YRBA 4LMPA 2R2GA 5L7YA 3H5AA 4XYLA 4BV9A 2A9FA 2WMDA 3GZNA 3H3FA 4J7CA 3KLPX 3BMOA 4MVJG 1VJ1A 3NGXA 5DOZA 2AQKA 3H8VA 1NVMB 1VL6A 4IPTA 2JD1A 3VPFA 1U3WA 3ZU4A 3OBBA 1CJCA 1P45A 4O6VA 4DYVA 1TEHA 3GUYA 5JAMA 5ICMA 3AUUA 2PD6A 1JLLA 4IDAA 1C1XA 4BO5A 3JQ9C 5JY6A 4GBJA 3ROMA 1V3VA 1ZKMA 1J5PA 1MFPA 2ILTA 5I7FA 2VZ9A 1GCUA 3JQFC 2O4UX 3ZZNA 3WIEA 4XIYA 2IZ1A 3PXXA 3WDSA 4JROA 2P5UA 1HDZA 3ZU2A 3T4XA 1B14A 2C20A 1XG5A 4Y9DA 1E1LA 4QO7A 3C1TA 1LNQA 3ZI0A 5A04A 2DM6A 3NV9A 4M86A 4DQXA 2ZTVA 2HK9A 3DBVO 5IDYA 5TSDA 4NK4A 2P4QA 3AOEC 5ER6A 3ZNPA 1BDBA 3AOGA 1ZSVA 4WLFA 2GN4A 4J9VA 2NTNA 4MOWA 4PFJA 3HNPA 3AY3A 3ZDFA 3ADOA 2VHWA 3KYCA 5BSGA 3FNHA 3HDJA 2H9IA 4MO2A 4Y98A 3IUPA 3NDJA 4L75A 4EEZA 3GR6A 3AM3A 3P5SA 2QZZA 5MGBA 5T64A 1HT0A 4DA9A 2QIOA 4HBGA 3O4RA 1ISFA 2H6EA 2I67A 1B15A 2AXQA 2B83A 1O8CA 4FJ2A 1YL5A 1BHSA 4NBTA 5ICSA 2WD7A 3G49A 4PCVA 3LF1A 3U49A 1QSGA 2VYNA 3VZQA 4BO1A 1TT5A 4B4WA 4NMHA 4YB8A 1ISMA 1C14A 4GQAA 1A27A 2BHLA 2QHXA 4IS3A 1P1RA 1JW9B 2G82A 3EK2A 4GH5A 4YJHB 3LT4A 3AUAA 4JQCA 4K9DA 8ADHA 3KYCB 2UUOA 1G1AA 4WCFB 3DZKA 5L9AA 3JQAD 3D4NA 4D42A 3PDUA 3WWZA 4YYZA 3Q3CA 1QKIA 1YBAA 3VZSA 4XGKA 3KOUA 3INTA 4ALJA 3PIIA 5F21A 4LVCA 4K28A 5G0TA 4BKQA 1EQUA 2C82A 3DZGA 4QXMA 4YT5A 5FI3A 4BNMA 1PL8A 1EQ2A 3DHNA 3PWKA 2Q2VA 4BNLA 1FXSA 5DCYA 3TDKA 2DUUA 3PZRA 1K0UA 4YT8A 4MDHA 1GCOA 1A9ZA 4DIOA 5JY1A 4NR0A 3GAZA 1JDJA 1C1XB 4BKPA 4J4HA 4CMJA 3T7EA 3EY4A 4BUCA 3GY0A 2ET6A 3ENNA 1KY4A 1U4SA 3H65A 2P4HX 4M49A 5TLSA 3SEFA 2P9EA 4G5HA 5HS6A 4BL5A 4LGVA 3A4VA 2I6TA 5TF4A 2JCYA 2Y1GA 3LC2O 1EBFA 3JQ7B 1W0CA 3COSA 4R3NA 3U0BA 1RM5A 2O3UA 5L4SA 4MVJI 2HRZA 1B7GO 3E18A 2YHUA 1UP6A 3ANMA 1NM5A 4IXWA 5T8KA 4ZRNA 1KVRA 1N1EA 3OQBA 2D5AA 4Z9FA 2VYVD 3VVCA 5COBA 1ZZEA 3AI3A 3WOHA 2GASA 5ILGA 4DPKA 4CPDA 5JAZA 2ZCUA 1QORA 3BMNB 3ADPA 3U62A 1A4IA 3H6KA 4BO3A 2EW2A 2VT2A 1Y5MA 1Q7GA 1A5ZA 1EFKA 1TXGA 1U9JA 3OM9A 3E9MA 3MOIA 4XB2A 4CLRA 1HTBA 2NNLD 2BRUA 1NASA 2EEZA 4WLNA 4TROA 1SEVA 3UHAA 1VJTA 3OJEA 2DFDA 1NP3A 5KVQA 4CM7A 4TQGA 2FPPA 3HDHA 3UFXA 2BGLA 4M55A 1YS4A 1Q7CA 2C59A 3MTGA 4NDNE 3WXBA 2OP0A 4ALKA 3RFXA 1M66A 1UUFA 2Q2QA 1OOEA 2B4TO 2RHCA 2HMSA 2VTDA 3JD2A 3ZCXA 1FF9A 4EJ0A 2GN6A 4R41A 3BTOA 5L51A 1UR5A 1PGPA 4MP8A 3BMNA 5AXBA 1E6WA 3FF4A 3IP1A 5BNIA 5IDWA 3KETA 5C3MA 3MJVA 1QMGA 2HMTA 4IY1A 3MOGA 5EQFA 3ROPA 1UXGA 2YQ4A 2X5JO 3HJAA 3E5RA 1I3MA 3SC6A 3TQHA 4ND1A 2NV6A 3BTUA 1RWBA 1T1SA 3WYEA 4IDEA 4B7CA 3ENKA 1YXMA 2VHYA 1DLJA 4H16A 4MKZA 3I4CA 1GPDG 1X7GA 1IUKA 2NU9A 2YQ5A 3CUKA 5L4NA 1U3UA 4CM9D 5JXWA 1TLTA 1B26A 3HFSA 5JC1A 1CIVA 1QYDA 2FN7A 3UN1A 4A7PA 4IDGA 4MIEA 5I9NA 1A7AA 5JW6A 5K9ZA 5JO0A 4L73A 2O7QA 2HLPA 4BO9A 5EINA 1V8BA 1JU9A 2UDPA 1U4OA 1T2DA 3HG7A 2DAPA 1ZBQA 3FHLA 2PKQP 4XZ3A 1NAHA 4YVFA 4S3MA 3AFMA 2FMUA 2C7GA 4IINA 4ALIA 3LT2A 1DHTA 2JCXA 2I9PA 2OXIA 1GTMA 3E6AA 2CVQA 1E3EA 4FQ8A 1C0LA 1I10A 4M54A 5THKA 1TT7A 3D5TA 3U4DA 1YDEA 2EWMA 3OA0A 3WWYA 3PWSA 5BSHA 1Y8QA 4R54A 2CUKA 2QX7A 1MA0A 4NI5A 4Q3NA 1AHHA 3RI3A 1LU9A 2B4RO 3GEDA 1BDMA 4FFPA 4J6FA 4RPKA 1HZJA 1KEPA 5IG2A 5B12A 2GYYA 3W4JA 2HJRA 3AU8A 3QV1A 4XX0A 2X0RA 1HLDA 4YQYA 4NU5A 3N58A 1BRMA 2QW8A 1B3RA 4KUGA 1DC3A 1ZK3A 4F45A 5HS4A 1PJ4A 1E3WA 2IXBA 2VT3A 3ICPA 4B8WA 2X0IA 2J6IA 1I30A 5ADHA 1VKOA 3I1JA 1RYEA 2I3GA 3JD1A 3H9QA 3H9JA 3LC1O 4WASA 4Y8VA 5DCWA 4ZVVA 5TNXA 1H6AA 2DBVO 5B4VA 1YONA 2C5EA 3TFOA 1QXSA 5H81A 4RZIA 1Z82A 3AWDA 5F1PA 1U8FO 1UDBA 3JQ8B 4IMPA 1R4NB 2HK7A 5KWEA 4TKLA 4BNUA 2PZKA 1KVUA 1PJ2A 4O5OA 3PHGA 4CUZA 3GVXA 3ZH2A 1PJLA 2I3AA 3WBFA 3D3EA 1EUZA 4B7UA 5C5IA 1GYRA 1WXDA 4G81A 3TNLA 1AXEA 2X58A 1GZ3A 3D0OA 3I4FA 4O63O 1VL8A 3QVSA 2TMGA 3V8BA 4WOKA 3HB4X 3EAGA 4BV8A 1KVSA 3RCBA 4YAIA 5CG1A 4IDFA 4NFYA 1Y8RA 5L53A 2WD8A 4Z0TA 3FWZA 3ZWBA 1X15A 2VUUA 3VH4A 1C0IA 5G2OA 3CXRA 4WKGA 2AQHA 2X0NA 4NQZA 1IL0A 1PZFA 2XXBA 4CQMD 2GZ2A 4W7HA 3W4KA 3WICA 3HADA 2OO5A 4FSHA 3U4CA 4RL6A 3ONEA 1N7HA 3DC2A 2UYYA 4Z3KA 2CMDA 1GAEO 4ID9A 4J4BA 2Y66A 3AI2A 3PLRA 3RROA 1GL3A 4FB5A 4PIVA 1WVGA 1R0SA 2NACA 3MJCA 4GGPA 3SX2A 3IL2A 3O38A 4I5GA 1C3VA 3TWOA 4EGFA 4OOEA 3WSVA 1K6XA 1BVRA 1QP8A 3OHSX 4MKRA 1U28A 4YJFB 1U8XX 3PRJA 2Q1SA 1YBMA 1NNUA 5FWNA 3HHPA 3PDJA 3I9KA 3O03A 5KVVA 3KXDA 3ABIA 5K6AA 5HTOA 1P74A 3ZWVA 3M2TA 2QG4A 3IOYA 2BGKA 4CMIB 2FSVA 2GZ1A 3MJ4A 4IDBA 5KJ6A 4TRMA 5F1KA 4URFA 3BZUA 2BELA 5CDUA 2NTJA 1LDYA 3ICCA 2YHIB 1B16A 3DFZA 3L6DA 3PGJA 1LBEA 4IUYA 4W99A 4UVIA 2I65A 2EERA 4FGWA 3GN1A 1N8KA 3DZFA 4ZN6A 1Y9EA 3GMDA 2AQ8A 1XEAA 2AEJA 2WYWA 1GUZA 5AXDA 2C0CA 3H2SA 4KTVE 3MWDB 3OIFA 3V2GA 5GZ3A 2DBQA 5BSEA 1KETA 3ASVA 4P4NA 5TJ9A 3LLVA 5DZSA 5L7TA 5KVCA 5KKAA 1RJWA 1WMBA 3QVWA 4AJ1A 5IJZA 1H2BA 4UVDA 2HU2A 1T2AA 1W8DA 3WGYA 3INGA 3LF2A 1EDZA 1E77A 3PHLA 3SJUA 4KZPA 4D3FA 3ZN2A 4CM8A 1QV7A 2GCGA 3I23A 4EEXA 1CETA 1LRKA 2CF5A 3VOSA 5T57A 1PQWA 4HFRA 1VJ0A 4CMEC 3BMOB 4I08A 3PJDA 3ROQA 1ADGA 3UOGA 4CV2A 4J91A 4PVCA 4KQWA 4DIFA 3KEOA 3RBVA 4CR6A 4K6FA 3Q2KA 3DZBA 4DLAA 1CWUA 5A9SB 4DC0A 2X1HA 1Z73A 1SB8A 3C24A 2X6TA 1PZEA 3DOCA 3K5PA 2FP4A 4GLOA 5HA5A 4CMAA 1XR3A 1UZLA 4O0LA 4YAEA 1N1GA 1LSOA 2Q4BA 4MVJD 2WJPA 1BXZA 3DO5A 2V65A 4RF4A 1A7KA 1PEDA 1F14A 4FW8A 3FNGA 3AY6A 4IGFA 4IM7A 4BKRA 1ZK0A 3MJTA 2V7PA 4RF5A 3GVPA 3QP9A 4ZD6A 4WK6A 1R37A 3RBZA 3O8QB 5DCUA 5JLAA 1ZSYA 3OFSA 1P0FA 1DRVA 2C2YA 1LLCA 1O89A 1O94A 2AEFA 1LJ8A 4BMSA 3EC7A 3KSZO 5G0VA 3PJFA 4GMGA 4RF2A 4YRDA 2ZB8A 4L76A 4KTTE 2EIHA 3GH3A 4DL9A 2YDXA 2ZYGA 2BFOA 4GKBA 3ZW9A 2ZCVA 5COAA 1KVTA 1Y9AA 2OHXA 4KOAA 2R00C 3AY7A 3RUDA 1CDOA 1SAYA 4F6LA 4OQYA 3B1JA 3AK4A 2NLOA 4CQMB 5ITVA 1HKUA 1R4MB 3ZWYA 1I33A 1BXKA 2IEDA 3IS3A 3JCZA 3GGOA 4OSPA 4BNWA 4EITA 2NVUA 4IBOA 4F6CA 4DWVA 1NQOA 2PK3A 2PGLA 2Y67A 2BLLA 3QWBA 2EGGA 1TA4A 1UXHA 1DXYA 1PGJA 3TJRA 3WB9A 1BXGB 2AA3A 3ON5A 3Q1LA 4UVEA 1HDOA 4XRGA 4FDAA 1Q1NA 1PJBA 3L4BA 4E5YA 4IJUA 2HMVA 1GEGA 3H7AA 4KUEA 4TMFA 1HDGO 1T2FA 3GGGA 5DNAA 1NQTA 1NX6A 4QQRA 3K31A 5KJCA 2YDYA 3JQGB 1QR6A 1DIRA 4LK3A 5C7OO 1R4MA 2Y1FA 1ADFA 3BYZA 3NAQA 4MVJP 4OYRA 5EL0A 1R15A 3NJ4A 4AJ4A 1I3LA 1PJQA 1P1FA 2EV9A 3DZHA 3ZWMA 4BGVA 3LLSA 2IDZA 2E37A 4Q3AA 4U5QA 2VWGA 4BO2A 5CEEA 2ZKLA 4DBVO 1PSDA 3NT5A 4ZRMA 4WEQA 1GUFA 4AJPA 1O0SA 4Z6KA 1O9BA 1N5DA 5EPOA 4TKMA 4HY3A 1Y5RA 5CHEA 1FDVA 3L6OO 1P1HA 2NUAA 4UEOA 3FBTA 1S6YA 5JAQA 1E3LA 1YRLA 1E0DA 2O50A 2CF6A 3QW2A 4RJTA 1T4BA 1GR0A 3AJRA 3SJ7A 2P2SA 1LLDA 1FMCA 4GVXA 3UCXA 4AJLA 2PKRA 3PPIA 5I8WA 1BVUA 5JO9A 2CDBA 3GNTA 4TVBA 3AUTA 5LCXA 1IULA 2EHDA 3V1TC 1MUUA 3CH6A 3DBLB 3GAFA 4YEDA 4C4OA 1GQQA 2CVOA 4DMMA 1VE9A 1ZK1A 2D3TA 4B4VA 3QRWA 4ONEA 4II2A 1KEVA 2W2LD 2R6JA 5G0WA 5KOIA 4BGEA 1LQUA 3GT0A 1C0PA 1ISJA 1PWZA 1G0NA 1NR7A 2DQ4A 2X5KO 3HSKA 3W1VA 2FRDA 1CQIA 5IF3A 2O2SA 3A28A 1N92A 3JD3A 4R69A 1Y8RB 5H82A 2NQ8A 3RUCA 2CZCA 2ZYAA 1XYGA 1R6DA 4ROSA 2WYVA 2OL4A 1SBYA 1HE4A 1P0CA 3DFUA 4J1NA 2NVUB 3P2YA 1YL6A 1XWFA 2EJVA 1AGNA 1SOVA 1DFHA 4ND3A 4TVOA 4XD2A 4BNNA 1E5QA 4NBVA 1HXHA 2Y0EA 2BGMA 4BNGA 5GZ6A 3GC6A 4AJHA 4XQCA 3IMFA 1NVTA 1EBUA 1ZK4A 2O3JA 4PG4A 4BB6A 4CUKA 3H9EO 5LDHA 1NQAO 1PQPA 1LI4A 1KC1A 3ZHYA 1F8GA 3GOHA 3IDSA 1D1SA 1YOVA 2Y68A 3EZYA 3NUGA 4W7IA 4TRNA 4BO6A 3L4BC 4CLOA 3KRTA 1ADBA 3Q2IA 2WDZA 3G0OA 4C7KA 3PK0A 1YVEI 1PL6A 4J2OA 4EYEA 2WD7B 2X86A 3W4IA 3WR5A 3ONDA 3UCFA 5B37A 3BA1A 4WNCA 1PJSA 4QFCA 2JD0A 3R6DA 4NG5A 4U0JA 8LDHA 1LDMA 1RYDA 3PTZA 1ONPA 2PLAA 3RUHA 5TC4A 3DQPA 5TQVA 2FY8A 3DMTC 2YFQA 2Z5LA 4WNIA 1OFGA 4HV4A 2GF2A 3Q9UA 5C37A 1Z6ZA 2Y05A 1WNTA 4BMVA 5B4UA 1YO6A 1M6WA 3DBHB 4CMBA 1T1RA 2UUPA 3E82A 3TZHA 1NWCA 4FFOA 1MXHA 3GG9A 3I9MA 3IP3A 3OSUA 4WUVA 1R0LA 4P4LA 4OKIA 3FBGA 3BAZA 3SBOA 5FFFA 4EZBA 1KOLA 3PHJA 1MB4A 4BO7A 3B20A 4DQVA 1M6HA 3F46A 4DPMA 4D7AA 1AUPA 1WW8A 3JYOA 4LMRA 3OJ0A 3IKTA 3DEYX 1Y8QB 2A4KA 1LSSA 4OQZA 2P68A 2QQ5A 3QWHA 3ZWWA 1XLTA 3IJRA 3WNQA 3KB6A 4CLXA 2HAEA 4FD3A 3QWIA 4GVLA 3FSRA 2YV1A 1IB6A 2EXXA 2GUGA 3CMMA 4ND4A 1T24A 3VZPA 1PIWA 1PR3A 1ML3A 1V3TA 2Y99A 3ZWXA 3QWAA 4GX1A 3OEWA 5A5FA 1A9YA 4XDYA 2P9CA 2Q50A 2GDZA 4YA6A 1IYZA 1I8TA 2W2KA 1U2GA 5HM8A 4L9RA 2BI8A 5JCXA 1DJQA 1JTVA 1ULUA 2CSUA 3PHIA 1LXCA 3JQFA 4E33A 1I2BA 3OIDA 3DXFA 5G4KA 1HE5A 1QYVA 4QX6A 3GUCA 4FGSA 4L8VA 4NPCA 4CL3A 6LDHA 2FHSA 3L4SO 4GKVA 4RVFA 4XYGA 1ISGA 1P33A 1E7MA 1OZAA 2VWQA 2VHXA 1Z75A 2E49A 2PGDA 4K1LA 4JP2A 4W9NA 5CFZA 3ETEA 4S1VA 2RBEA 3MJSA 3NX4A 3JQBA 4OHUA 1BMDA 3P19A 1XU9A 5I7EA 4W9NC 1G0OA 2PH5A 3JQAA 1DIBA 1D1TA 4XB1A 4UULA 2JAPA 1HL3A 2EG9A 3L77A 3QVOA 1PJ3A 5DBIA 4OOFA 2HUNA 3E03A 4CR7A 1F12A 1HYHA 1PS9A 1DO8A 2HQ1A 2IZZA 2VNAA 4RDIA 5G4KB 4ZU3A 5KJEA 5JMWA 3PQFA 4JNKA 4Q3BA 1QV6A 3B6ZA 1KEUA 3AW9A 4FFRA 1L7EA 4W82A 2W90A 4D41A 4N5MA 1P31A 2B4QA 1BG6A 1EVZA 5I8ZA 1IZ0A 2VYND 2JHFA 2P5YA 3NYWA 1H94A 3WGTA 1GV1A 2V6GA 1E7RA 1NTOA 1V35A 4R1UA 4HNGA 2HKIA 4E12A 3H9GA 5JNLA 3E48A 3G3EA 1VI2A 5DOVA 3PP8A 4LVUA 2CNBA 2IYOA 3FNEA 4AJNA 4E5MA 1TI7A 2SCUA 2CDCA 4YRAA 1DBVO 4FFMA 1B0AA 1EUCA 2RIRA 1HYGA 3FN4A 4BNYA 4L74A 4A5OA 2H1SA 3A14A 2OMEA 1GY8A 3G1TA 2PZJA 3WSWA 3TL2A 4D44A 3EYWA 4KWIA 1EVJA 3DONA 2DKNA 3CZMA 5H83A 4F46A 2CVZA 3FTNA 3OECA 2X9VA 3OF2A 3RKRA 3OICA 4YT2A 2O7SA 1GZ6A 1E3SA 1PTJA 2J5QA 3BHJA 3RJ9A 3WJAA 5JC8A 4UEKA 3D4OA 5MDHA 1DHRA 3W6UA 1ORRA 1YWGO 3FPLA 3C1AA 3K92A 4NFSA 2B5VA 3PQEA 1HETA 3SLGA 4BNIA 4DVJA 1V3UA 3VAZA 1GADO 1WZIA 3OJFA 4B4OA 2OUIA 5KTKA 1U5AA 3KLMX 4OM8A 3G17A 1ONNA 3ZV3A 1FDTA 4ZQFA 4PGFA 4E5NA 2BI7A 3WLFA 2IE0A 2DU8A 4CM5A 1NBOA 1YJQA 1HYEA 4BO8A 4N5LA 5KIAA 2V6MA 3ZV4A 3QE3A 4PLWA 3M1LA 3I83A 3K9QO 1M2WA 5K0ZA 4BB5A 2PNFA 1JAYA 5DP2A 1Q7BA 2OFPA 1D3AA 1EDOA 3QSGA 4J1TA 4I5EA 3VKVA 3GPIA 3BMCA 5A05A 5BQFA 4IXTA 5TRTA 3P7MA 1XDWA 1QYCA 1V0JA 1CRWG 3RU9A 3ZNOA 1PL7A 1Z7BA 3RUAA 2AQIA 2ZJ0A 3DMYA 3VKUA 4D3DA 2HO5A 1ZK2A 4WGGA 3JQ9A 3DBRB 3AUSA 4U6SA 2EKLA 1B8PA 4HNHA 2EKPA 4AJIA 2AE2A 2EKQA 2NADA 1ZW1A 1W6UA 2IODA 2DUWA 4E13A 2XF8A 3RC1A 2BF7A 3GNSA 3S2EA 4HFMA 2DTDA 4FC6A 4RVDA 4WEOA 1ZEJA 3GQVA 2WE7A 1KEWA 4KMSA 3RJ5A 3U09A 3PZBA 2O3QA 3IKVA 1DFIA 2YJZA 3GDOA 4Z9YA 4XQGA 4JJIA 4GLLA 1E92A 1H9AA 5T5QA 3DB2A 1GFSA 1EE9A 1VPDA 3GDFA 1ADCA
chains in the Genus database with same CATH superfamily
5TGDA 2ASEA 4K3VA 3D8UA 4LYHA 5EWJA 1YR1A 5FXMA 5G3YA 1CDZA 2XWPA 3GOQA 3HRIA 4PBSA 1UDXA 4X1YA 2PPVA 5IHPA 3ORFA 2D2FA 4II3A 2EOAA 5F5LA 3DYBA 5BMOA 4ZC1A 4KVGA 4DJ5X 4Q4JA 1GGMA 1NPTO 3K20A 2FUEA 3FG9A 4YCJA 3CEAA 1JIJA 5EP1A 1PFGA 5HX7A 1CQWA 4NZPA 1JJ7A 1YGYA 4C4TA 3P9QA 4CR8A 4EVQA 4U1RA 3NTQA 3EIQA 4E6PA 2AHRA 2SKEA 3HU2A 3TNYA 2B36A 4DUYB 4ZDJA 4KQFA 2J3KA 1MH9A 1GV0A 2HV8A 3BTVA 3MGBA 1BE1A 1ISIA 2E4AA 3AEQB 1ZXLA 4GMXA 3SK0A 2WUGA 1WLSA 3NVAA 4PHCA 1Z07A 2CN1A 4HDSA 3T99A 3GGPA 3T1QA 4ZQHA 3R7SA 3F3SA 3V33A 1DEHA 3W90A 4D5EA 2IHZA 4DUPA 4Q3DA 2KBFA 1H05A 2BEVA 3DULA 1E1CB 4JJ8A 1KMIY 3UMMA 4UHBA 3OE7D 4RPCA 1UC8A 3WXMA 1I2MA 5CVVA 2YRFA 1WA5A 2D3WA 1XOIA 2Y1OA 2ZT7A 4MRPA 4NAVA 4DREA 2Y2UA 2R6CA 4LQLA 3K5WA 1JDUA 1KP2A 2BUCA 3HMQA 1TM3E 4OAQA 1X8XA 2Q3JA 3HY6A 3CLRD 4BQNA 3ZYCA 4G5QA 4IX9A 4NAHA 1I01A 2I1VB 4X3OA 5C53B 1EJ2A 1GYQA 3P27A 4XB6B 5HK8A 4YPOA 4E5PA 1ORVA 1WXWA 2XKAA 2P30A 2VWHA 4LXTA 3TLZA 2BCEA 3AV0B 3F5SA 4I5DA 3SE0A 2BFBB 2MMCA 5K3CA 1FFSA 1A04A 2HQRA 4QDKA 2GYWA 3E3MA 4B3TB 2G7ZA 2WAXA 5EJFA 1GUAA 4L2IA 1SIWA 2F64A 2H63A 3C7TA 3RUPA 3PXDA 1R8XA 3NBUA 3U7QB 2V0CA 2WEKA 5DHUA 1TMKA 1TCVA 2W2OA 4CIWA 3AVWA 1H2HA 4DLPA 2GPBA 1JKFA 3BTSA 3GV0A 2IF0A 1ZC4A 4PAMA 4M8SA 4CFSA 1B2LA 4PYOA 1DI0A 3DD1A 4MR8B 1ZN2A 4QJ3A 2FSPA 4WESA 5J23A 2FA9A 1JV2B 1XXHA 4JP5A 4TN5A 5F2EA 3WZMA 5J2TA 2PR2A 1LPOA 5JCOA 4ZV9A 3DEAA 1E32A 1UKBA 4XIIA 4RDXA 2XE4A 4M8IA 3WGVA 5KSYA 1PLKA 3UO8B 3MN1A 1PD0A 4P4GA 5IZ4A 1ZXXA 4JLDA 2N75A 2JFGA 2VT7A 2H2DA 2HA0A 2Q3EA 1GQYA 4PG6A 4DM7A 2ACVA 3N8IA 3DG9A 5AT1A 3LECA 4DLTA 3BWVA 1YKGA 2QTMA 5BOSA 2BFDB 2O8CB 2VJOA 4FYHA 4I8XA 3LQFA 4I1VA 2W8BA 4PO1A 2ROQA 4YMWA 1WCIA 5HW0A 1CZHA 2AJCA 1Y3AA 4HD8A 3RKUA 3L43A 4G1VA 1UMCB 3EASA 3I52A 1GG8A 4QNMA 5HJ2A 3OPNA 4HB0A 4FC7A 4PZEA 3PC6A 1EBBA 2FP4B 1ZUD1 4BEVA 1N5OX 1E6UA 4HL6A 5EIOA 2AH5A 1Z8DA 1HNWB 4GZ3A 3TB4A 5CUQA 2WU0A 1UJ4A 1XMSA 5TGTA 4C4AA 3GP3A 4TRJA 2EGHA 2B6NA 4JN6B 2Y1CA 1TIPA 1OFUX 3EBLA 3ZOZA 2VA8A 3UHPA 3MS2A 1QHFA 3U26A 1C1DA 4AKIA 1W4ZA 4MZDA 4PLHA 1WMEA 2WZQA 2WSLA 3ZTWA 1LVUA 2BKAA 4YJ2F 3DGFC 1EEHA 1AIPA 1BDJA 1FPMA 1ZONA 4PNZA 2OAGA 3C3XA 1OFTA 4R1OA 4EJ6A 1R4NA 1VCOA 2AS0A 2D8AA 2Z4RA 3LW8A 4Z4HA 1XZCA 2GN9A 4HTAA 5ENDA 1UF9A 4MVXA 3CVXA 1S8NA 1YR8A 1HFJA 4DDHA 1Q5PA 1U7DA 2QUKA 1O8BA 4UU1A 4QOHA 2C2KA 1H6DA 4O59O 4D8WA 4D4GA 2IEBA 4IH4A 3NB0A 1E1CA 2JNWA 1W0KA 2ZS7A 3V2IA 1XZAA 3TZKA 5J47A 1KS9A 1RWKA 1FFDA 1Z7EA 2D4AA 2M32A 2VRCA 5FBRB 3UJBA 1HQCA 3RADC 4YLEA 3RFTA 5A02A 4OH7A 4LJAA 3EEOA 3DAOA 3PFNA 1L3BA 3USCS 4LISA 1FU8A 3NKVA 3AVQA 4BFLA 1H2XA 4ILEA 4WZAB 1HK7A 4JHXA 4RXMA 3UH0A 2DTEA 4Q0MA 1KH3A 3WLMA 3C3MA 2VEOA 4EY4A 4X65B 4Y30A 4B3HA 4MRAA 1G7SA 4B34A 5CPFA 1G59A 4HRAA 4W5OA 2VJBA 1E2DA 3QVKA 1ZJ4A 1DZIA 2J85A 4YRCA 3UICA 4CLHA 3ZW8A 3IE1A 1CF9A 2YYZA 3EXFB 4J1SA 1R0KA 1ZL2A 4URYR 3R6WA 4D0GA 1E7YA 1RM4A 1X0XA 2DR3A 3D2CA 3FWYA 2AE1A 3L4KA 3NBFA 4Q47A 4UAUA 3VZDA 3LV8A 4WXYB 1GOTA 4H1HA 2RH4A 4RD1A 2Q9UA 3ET5A 1LJUA 1IXRC 4JMLA 3ETDA 1YB1A 4P4SA 4LKRA 1HE8B 1XVUA 2XRYA 4LDRA 2JLBA 3WGHA 3QTLA 1H3FA 2VAPA 3EZXA 1OX5A 4LJRA 2P8SA 4ACBA 1U7PA 3H11B 3AKYA 2AF3C 1EVKA 2XQIA 3O8BA 1T5OA 1YBFA 1ZQ1A 4LFCB 1JSLA 5JOQA 2VNHA 2WV7A 3EOZA 3HPQA 1XCLA 3EVTA 3KQWA 3O8OB 4FPXA 1PFVA 4NKRA 3MRVA 1QRTA 1ATIA 3U4IA 1DQRA 2PMFA 3LUKA 4QVIA 1CUVA 4HKTA 2E5LB 3HBNA 4YCDA 5JMPA 1VJGA 4BP9A 4DV0B 3T5AA 4AW9A 2Z4TA 1FLAA 3JYPA 1IJKA 2HCRA 3Q8XB 4LN1A 4C4SA 3QKRB 4J4TA 1QBGA 2OXRA 3T1OA 2CDNA 1GDTA 2E1RA 2YHIA 3AB8A 3VSDA 4UPDA 4UTZA 4PZPA 4CV1A 4RIFA 1OH5A 1G8FA 4YMSA 4IVPA 1RYMA 4AQDA 1UBKS 3DJYA 4MDYA 4FM9A 1D2GA 2H0AA 2VAXA 2J6BA 2ABWA 3PUXA 3CF4G 4GECA 4WPGA 5FIUA 1F38A 3SDBA 4OB6A 1QFYA 1MNAA 5KHAA 2W0MA 3R74A 4HAUA 3CTMA 1H3EA 1RQ7A 3OZDA 1KEEA 2RJOA 3W5CA 1QTIA 2VOJA 4E07A 1Q0LA 3T7CA 2XMRA 4I9GA 3UGKA 3JY6A 3V2UA 1VDMA 1P2VA 3SYNA 2XODA 2BMAA 1JN0A 2VJNA 1E6LA 1W5EA 2Q1TA 1QG4A 2GTIA 2RC6A 3A3KA 2YN2A 3R3JA 1DUIA 1U2SA 2EQ5A 4PLPA 1B2RA 1TYAE 3VZCA 3GEIA 3DBRA 3BRQA 1KYYA 3NHAA 3NTRA 4UZFA 3CKYA 5BN4B 1QQAA 3B38A 1OWNA 4TWZA 4M89A 4RV9A 2HK8A 3I76A 3IQWA 4JI1B 3OPXA 3UWPA 3ZNQA 4AIRA 5JANA 1TO2E 2JCVA 2XB8A 4PEVA 1C3EA 5EJ7A 2DLCX 1VKHA 2EKZA 2C7QA 4UU7A 1Y1KE 3SF0A 4DM3A 3ESXA 3BL8A 4MWZA 3RW9A 1BJRE 1QHIA 1YQGA 5GY7A 3E1KA 3G5LA 3L9XA 5EJ2A 2XZOA 4KXUA 2O0HA 1E1MA 1KSGA 1Z6AA 1G5QA 1E1RD 3G1UA 4R16A 3CLRC 4LRXA 5JWOA 2X5XA 3ONNA 3I6YA 4ZVRA 2FPGB 1Y81A 2SICE 3RVDA 3MEQA 2PV0A 1X9HA 5F2OA 5ADUS 1ZIDA 3X2FA 3WRXC 1CS0A 3RTBA 2PE5A 3JTMA 3GFQA 4MRSA 2VHQA 3VR6H 1IBSA 4UHCA 4XJXA 5IYZB 1YVUA 5D7BA 5IZCA 5JTUA 5CU7A 3M6MD 3SZLA 2MR6A 4XGQA 1OYYA 3NAZA 3KBOA 1NXPA 4MYTA 4DOMA 2F00A 1YDFA 3P9YA 4N7JA 4QOJA 2QE7D 4K81B 1MAHA 1ZQ9A 2QLBA 3LVRE 4Z7OB 4B3BA 1HSZA 3ZWAA 2HSDA 5KNDD 4R05A 1ZW6A 4QTUB 2IUYA 4EDFA 3TW6A 2PH3A 3IDFA 1ZH4A 3A06A 5BW8A 5J3JA 1RM3A 3B48A 4Q9NA 2FXIA 2X5OA 3JATB 1KBQA 4X84A 1BE8A 4JQOA 2OMKA 1DUSA 3RS3A 1OGIA 2HUPA 3L49A 4IIEA 4Q3CA 2VNJA 3N7AA 5GMOA 4QYTA 1EVIA 4DDVA 2ADFA 4V0RA 4H3VA 3GGCA 2P2DA 3C70A 4H7PA 2GCNA 1G20B 3ET4A 2ONJA 1NZDA 3GGSA 3HFJA 4BLTA 1XHFA 4R1SA 1FFBA 5I9TA 2Q1YA 4RIIA 3AM1A 2FR8A 1B73A 5KNBD 5EQDA 3LFUA 2F1HA 2O2HA 5IVHA 5K05A 3NC1C 4OKNA 4OHZA 2X8LA 3EN0A 1JXOA 5BUSA 5B3LA 4PPYA 1T6ZA 2ZR9A 3Q11A 2VP9A 1D03A 3ADKA 4D0SA 2EKBA 4ZOAA 3MSCA 4QVGA 1T5SA 5IVIA 1Y34E 3ABSB 4IHQA 4K2AA 3AL2A 3QMMA 3EEYA 1Y7HA 1VHQA 4I4NA 5J4LA 1SU7A 2OCXA 2WTEA 1PTKA 2IIVA 4R8MA 2XCTB 3I6QA 1Y6JA 3R40A 3O0TA 5EUMA 3U7QA 3TF5A 1WSWA 2IU4A 1U2EA 3UJ8A 4JYZA 1EHCA 2VDJA 3P9NA 4LFAB 2QVXX 4JOSA 4EJSC 3V3KA 4EG5A 5JAIA 3EFOA 3H9BA 3B7GA 2JFNA 5I9MA 4JCCA 2XXJA 1QG6A 1V2GA 3H1AA 4IV8A 1SHZA 4B3DA 4IKOA 1FIUA 1ZITA 1P2SA 3BQNB 4JJFA 3D6TB 3DBHA 2BFPA 4PYIA 4DQDA 3FCOA 1QAQA 2G8NA 2NTEA 2JFXA 3CNOA 3KZVA 3U40A 4W8HA 3D2BA 6ADHA 4A6EA 2ORYA 3NWOA 4MV5A 1H0SA 2PO7A 5FQOA 3PTLA 4MGEA 4KSYA 3NHPA 4KYVA 3LUBA 4P4TA 1IZ9A 3AFNA 1XKQA 1NYTA 4ZHQB 4J29A 1RFGE 1YCFA 2BFCB 1OIVA 1NJFA 1YS9A 4MP3A 2J5BA 3ZX5A 1F2UA 5F76A 2GWRA 3THYB 5FWXB 1JF8A 2JLRA 3IQHX 4DRYA 3F8WA 1QRAA 2NWQA 1SG6A 3VR0A 2E4UA 4R9RA 2HBQA 3DXZA 1PDOA 1A71A 1CS0B 4L0CA 4WFQA 4BVGA 5C80A 2EW8A 1SA0B 3PQ6A 2OLEA 1V4NA 2A35A 4AN0A 2OQRA 4FHGA 2QMHA 3GJ3A 1T3SA 5EXDA 4BQOA 1Y8ZA 3RBAA 1AKYA 5HJ7A 3EDYA 1N3LA 2I87A 3E9CA 1JAIA 2XT9A 3AJDA 4E4YA 2O0MA 3L8EA 1Q19A 4PZCA 3IOMA 5E7QA 3F5QA 4QBFA 4EW3A 1R12A 4KLZA 1M0SA 3N74A 1C0EA 3P0FA 3O4IA 4NOLA 3ZJ5A 5FEMA 3REGA 3ACCA 3GMIA 2ZPTX 2ZTLA 2P90A 4FKZA 4H0NA 4LXIA 3WGZA 4J0QA 4LOIA 1MJNA 1O4WA 2WYUA 4TLMB 4F9GA 1QH0A 3DHEA 3QIVA 1JR3E 1R3UA 1XZQA 3W8EA 4IDNA 1G17A 2VRWA 1Z4PX 4JXJA 5JAPA 1UBMS 1U8EA 4CDRA 4JI7B 2FEKA 1YZGA 2FMHA 4QUDA 3CSSA 5FBKA 2P27A 5JYDA 2FZEA 2JANA 4XVHA 5HGJA 3TSCA 5DGIA 4IRUB 5LQSA 4B0OA 1X3SA 1R0WA 1V9LA 2WSSD 3L8FA 4GX2A 2QQGA 1I3NA 3G6KA 5HE9A 1JDNA 1CQXA 3AJ8A 3H5LA 4JUAA 4IJWA 5PGMA 4BDTA 1KMHA 1JQ3A 5FTJA 1KSJA 1V26A 2JFYA 4RFVA 5DEOA 2GZSA 5LQKA 3A3OA 4FE3A 3L0PA 1OFIA 1SUCA 3PFCA 4LHVA 3QXSA 5A3VA 3GRCA 3ZE9A 1XZLA 4DMRA 1KMCA 3FDXA 4QUJA 2OOSA 2X4GA 3QXXA 2LIPA 2QMUA 3MWEA 4PHHA 3WYFA 1U5BB 4WH0A 3O3OB 4OIMA 4UDYX 3F2IA 2KPOA 2NXEA 4RS4A 3QPUA 4UE6A 3AG6A 1V6SA 3UW3A 3VVCA 3SWWA 1CNEA 2ATEA 2AX3A 2W11A 4G86A 2IYPA 4NBWA 3SR4A 4ZHSA 1AXGA 4YJHA 3OWXA 2FKAA 2HXSA 1LCIA 1R5BA 3QBEA 5DHSA 3TIFA 3RSOA 1ZMTA 4X44A 4P4SB 4A27A 2Q5JA 1XCBA 1E3TA 3ANYB 4PX2A 2CLLB 2P0AA 4BMZA 4M76B 1YTLA 4I1IA 2G72A 2HI0A 4J0EA 4K8OA 5JRDS 2AIRA 3LE8A 3FY4A 4XH9B 3BGSA 3VO9A 4CEJA 1YRHA 4CLOB 2I7VA 5CA1B 2ERCA 2UXDB 1A4XA 2Q5HA 2ZDGA 4MW9A 1U7TA 3TZEA 3GCGA 1A1SA 3DCNA 4K6MA 1Z29A 4FX2A 3F6BX 3E2IA 3LM8A 1VBMA 3BOSA 3BPSA 1PGNA 1W581 2I62A 3DUFA 3RU2A 4ZHQA 4CL8A 4HVCA 4ZO7A 2XWBF 2OCBA 3I28A 3ICWA 3TAUA 1KZGB 4UQLA 1UK9A 2PGXA 3AHHA 2BH2A 2JFOA 1I9GA 1M72A 1MCZA 1B76A 1Z37A 1DXHA 2E5FA 2QJWA 3LXXA 2I2FA 4X93A 4EHHA 4Z54A 5K01A 1UWLA 4UASA 2DSNA 3CQ9A 5EIWA 2EZUA 2H92A 4NS1A 3ZVKA 4P22A 1FE8A 1IN8A 1PV2A 1WW2A 2XOKA 4MR7B 2OLJA 3GUVA 4WHMA 4N7RA 5EQJB 1OI3A 4ZVMA 3SGLA 3ST7A 3HWSA 4YHBA 2H1IA 4U9IS 4TYQA 1NBWB 3VPCA 3EGDB 2QZ9A 3BILA 3EHEA 3KQTA 4YGYA 3NKLA 5DLQC 3MAJA 2O3RA 4P53A 4Q15A 1YK1A 3AGQA 3H9UA 1P62B 3CJTA 1TJ3A 3I2GA 4U7GA 2HCFA 1J9ZA 2WKSA 1QVRA 4BKUA 2DWQA 4RETA 3WRWA 4C01A 3LUHA 4D0RA 1Y6ZA 1E96A 3RAPR 5HZMA 2C5AA 4DNOA 1OXTA 1YZUA 3W2GA 2ZVJA 1EHYA 4K7JA 4UU8A 5GOZA 1FQOA 4EHDA 5HWSA 2JD2A 2OFOA 2IKQA 2B1JA 1IN1A 2BKUA 3K5HA 2WSYB 4IVNA 4NQRA 1HGXA 3HJUA 4JP8A 3GEBA 1ZVMA 1CZOA 4IJMA 4NFHA 1XELA 1ZO8A 2VBFA 3U1VA 4BXOA 1BMTA 1XU4A 4JQSA 2HHLA 3FH0A 1KZ9A 2JGFA 4M1WA 4U5XA 1HWYA 2B34A 3IHTA 3ZUPA 3SIRA 5B64A 1AN9A 5E1OA 3EXIB 4C2UA 2EYQA 1ESDA 2B2CA 2WJGA 4IEFB 4EJSB 2JI8A 3P2KA 2MSKA 1YVDA 5DWDA 2Y76A 4I66A 1IDN1 2GEUA 2IHYA 4OP3A 4XEHA 3UMJA 2QRQA 4H0FA 5AD1A 3DVLA 4L6AA 1WMFA 4ZANA 3EH2A 5CVUA 4NESA 5DGCA 5A9TA 2Q6LA 4ILKA 4R31A 1VSVA 1KQGA 2EARA 2ZSUA 3DHVA 1IEXA 1WULS 3EC2A 1QP0A 4BVAA 1ZH8A 1KI8A 1X92A 2VHVA 4LW8A 1SZJG 5F3RA 1TVEA 4AS3A 2WZCA 3U80A 7YASA 5FI5A 3HN6A 3ZY3A 5IYZA 2PUGA 1F60A 2AEMA 1GQFA 2OHGA 3NDBB 3X0DA 4MHOA 3DT9A 4FDVA 1OASA 4KIGA 4ARZA 4EGJA 1LRJA 1Z6QA 3QQPA 3NTOA 1K7XB 3UJPA 1NI4A 1UWVA 4G9EA 2Z56A 4JR1A 1JMVA 1QQTA 4RLHA 5DGDA 3UJCA 2W6JD 4QZVA 4W1QA 3R8CA 3D8NA 3LKDA 1PJ8A 2BGIA 5BMVB 1GZ7A 2XQJA 2D0OB 1Y5NA 3NNDA 1TZCA 4GO1A 4ODIA 4RY0A 3VTZA 4PG7A 2XYRA 1ZJZA 1OIXA 2DUNA 2MIIA 1T2CA 4KHZA 1L5HB 1PQUA 1PU2A 4PYRA 2QZJA 2CFCA 4YMUA 1PD1A 2GO1A 3L6BA 5ALWA 1CQZA 1OXVA 1HA3A 3EVGA 3N8HA 3WQRA 1VC2A 3OE7A 3FKQA 3GFPA 1NKVA 3L0IB 1YI0A 3EUAA 5AOBA 5FBHA 5I9SA 5ECDA 2A7XA 2QTHA 1TB4A 3A4YA 4HMPA 4NV3A 3ZJTA 3GT7A 4LEIA 5TF0A 4TLCA 4Y1EA 3TQOA 1EFCA 2RBGA 4MGKR 5FTWA 3PC3A 1KDZA 3DKPA 2P78A 3ZWNA 1DKNA 4NPHA 1JQKA 1NBAA 5CTJA 4YQEA 4BMPB 5ED0A 3UM9A 3VISA 4N5NA 3PSHA 4G26A 2RONA 1ULBA 3MIIA 2VK8A 4N3GA 4E21A 1FVXA 1L7DA 4L4ZA 4WECA 5FRDA 1A4UA 1FMJA 1TT5B 1XDSA 2O2EA 2XAUA 3KWFA 1C29B 2GBPA 2IU6A 3GZ4A 4Q4JB 1CB7A 1DOHA 1E4EA 1EJ6A 4CTKA 4AYXA 1RMQA 1EFLA 1MO5A 3JQBC 1N6PA 3BH7A 4YFYA 5BW4A 4ER6A 3HKDA 4Q1CA 1HDCA 3CZRA 2OCYC 2E4XA 4R2XA 5DNDA 5H02A 4MQ4A 5JWHA 1OA1A 1K97A 5MN4A 3WV4A 2WWXA 2ZYHA 3E61A 5E4YA 4B8YA 3H7IA 1SCQA 4K46A 4EB6B 4GOMD 3GJRA 3VDRA 3B9RA 1OBFO 2FMTA 2ZUEA 1T9GS 2AN9A 2ZPUA 4KRFA 3RBXA 3K70C 2QRLA 3CF2A 3G0GA 4FFLA 3W0LB 3WDKA 2JGMA 2R7MA 3KZOA 1ZD1A 1XF1A 3GEMA 1AMNA 3P0IA 3ICQB 2GLTA 1KI7A 3WQSB 4HH1A 1XDBA 2BC9A 2R00A 4X7RA 2GMWA 1X7DA 3MHPA 3V32A 3DGEC 4F97A 1UMDB 4X6LA 5C34B 5A03A 4GZLA 3FGZA 3ED5A 3D3WB 3EXIA 3R3YA 4G5SA 2RHLA 5CG2A 4ZVLA 4PLZA 1TJNA 3RYIA 1ECPA 4TSFD 3DKIA 2KW5A 4I50F 2CXRA 1L7XA 1NLZA 1SUDA 4JBGA 4L1KA 1H8EA 1GPH1 3DPSA 3GB9A 4FS8A 2ZATA 4PNHA 4YXFA 3W6NA 4JJ7A 1AZTA 2HA2A 5ER9A 1T5IA 3VVBA 5JXIA 1V4BA 5BR7A 2FWMX 4R5MA 4MEJA 4UKDA 1U2QA 5ELMA 1JZTA 3ER8A 1VMIA 4GX0A 1GGNA 4ZT2A 5F3WB 4FYWA 5FP0A 1FUYB 1U9ZA 2F1OA 1M3SA 3COYA 3F71A 5DLEA 3OM8A 4OI0A 5LSAA 2CNDA 1AS3A 1ZI6A 1DC4A 4HDRA 2IYYA 2D2EA 1B1CA 3A9RA 1UT8A 2ZTUA 3KM0A 1E3WB 1QX3A 4MQFA 5KB3A 1TEVA 1VSTA 2IK8A 2LZ0A 4YX9A 2YXDA 4KN8A 2C98A 3C3DA 1EWTA 3CZCA 3ETHA 2H7YA 5IWCA 5KREA 2FAXA 5TQ2B 4H7EA 2XSZA 1NA5A 1SCNE 3H9CA 2I2DA 1UDAA 4P81A 4JIGA 4FMCF 4EYKA 1LBTA 4LRQA 4GOJA 1SJ9A 4TL9A 2F67A 2J3JA 3K5IA 3OKPA 3R3ZA 3BH0A 4M1KA 4RPLA 5HZKA 1RJ9B 2IEYA 1RZUA 3TUZC 1SO8A 2GPAA 4FGJA 3L6EA 3LQ4A 4D46A 2CFRA 5C7LO 3PDWA 1NNI1 1T5BA 2ON6A 3AB7A 4KR2A 3DE7X 5L95A 4QGFA 2LE0A 1TUGA 3AF3A 2C4VA 3OAAA 4PYLA 4WJZA 3R9IA 2ZLBA 4NYJQ 5J5VA 2FSSA 4C1NA 3K15A 3BG5A 1Q20A 1X39A 1J8FA 1E1QA 2LXNA 2V3WA 3FJYA 4HQLA 1Y37A 3FETA 3EC1A 4CM9A 1CUJA 1UKYA 2JIMA 2ZI5A 3S2ZA 4M87A 5JQGA 1I94B 4ALLA 4FUQA 2DPXA 4JYBA 4Y6GB 3GMSA 4R5HA 2H16A 4X85A 3HR8A 4TWRA 1HX7A 3T41A 1A0OA 2A1UB 1ZP6A 2F1RA 3RC9A 2XH8A 2IUTA 4UUOA 2P5SA 3OJLA 1NBEA 3N6RA 4G56A 3TAXA 3UFXB 1WPXA 2WPDD 4QQ8A 2HMWA 4JBXA 4IIJA 5AVZA 4Z4CA 3UATA 1JZSA 3FUVA 2QR5A 3LBIA 2J87A 3BZBA 3CFYA 3MWJA 1YQWA 3E9NA 2C54A 3N28A 4FYXA 4R84A 3OO1A 1IY1A 1KYTA 3P9PA 4L9WA 2ENWA 2DFTA 4FGKA 2PNJA 1RHQA 5I01A 2BGNA 3MWYW 3FYUB 2NUBA 1GPJA 1YHNA 2Y93A 2ZU0C 4X60A 4RQTA 1R6TA 3RYFB 2O48X 1U0GA 4OF4A 4C7VA 2Y9MB 3WWDA 5FPSA 4PWYA 1YDMA 4OBWA 2JLWA 1BU8A 1NTRA 1YC5A 1E2KA 1P75A 2VWPA 4L3VA 3SP1A 3EISA 1ZGBA 1W5SA 3NGLA 4KAJA 3GUHA 3IEPA 5IDXA 2I5PO 5D3MA 3SX0A 1L7VC 3UANA 4C76A 2R8ZA 3DBLA 2W2PA 1T9ZA 5REQA 5DBFA 5CAEA 1X1EA 4J7UA 1ESCA 2GARA 4M8LA 4UM9D 1AQYA 2XTAA 2X15A 5T6BA 2EW1A 4EBFA 4YO8A 3RS0A 5EJ9A 3K9FC 4PGGA 1N6NA 2RH5A 2KJQA 2O5EA 4OBBA 1L3CA 3TLBA 3NPMA 4XARA 2EBUA 2ZVPX 1NRIA 5JZMA 1P5ZB 1V8OA 2DTXA 3HR4A 1DG9A 3K2IA 2D1QA 3HZOA 3LX8A 4JQZA 4M9ZA 1JJAA 4Q7JB 4QGAA 4XDZA 1JKJB 4RVGA 4LHEA 3KS9A 3FPCA 3L7AA 2YWJA 3QLVC 4ZA2A 2P9ZA 3N0TA 4Y6PA 3DMTA 2O8NA 3CNLA 2FFQA 3DEKA 1DO2A 2A67A 4OI4A 4Q7KA 5K51A 1LI7A 2JL1A 4YK7A 1HH4A 4K6KA 4I55B 3RAFC 3OLWA 1EVEA 5ALLA 2EP7A 3A2MA 1JS1X 5T6MA 4LGMA 3FCAA 2LW7A 3PXEA 3THRA 2UYCA 5JS6A 2WE8A 4OIFA 2G5CA 2RG7A 3G0CA 2QU8A 4M0EA 2AG8A 4F5EA 2J7PA 1NXQA 2PYIA 4HPXB 1Z35A 3U3JA 5JZSA 4HNAB 4QOSA 2P6MA 1YR6A 1C9YA 3IAAA 2A5JA 2RK3A 4C43A 4I1OA 1EVYA 1DTWB 1UOEA 4I9FA 3S2IA 5JS8A 4JZYA 4DZZA 2OA0A 1XTPA 2Y9PB 2C8VA 2ZZKA 1YOVB 1N6HA 1YZVA 1ZU4A 2VYQA 3I4LA 1U2DC 1MZVA 3QU2A 3QUTA 1I2AA 2IYXA 4LF4B 3V4OA 1UPTA 2BM8A 3VNAA 3KKQA 1J9EA 2GD6A 4OQLA 2X2FA 5GV8A 1JEYA 4PIMA 5C46F 5TY0A 3T7TA 2IT1A 4RORA 3VYWA 3TH5A 1WD7A 3EW9A 2JIDA 4C4PA 2CYBA 1UBUS 4O1MA 1JE1A 4IIJF 5DYTA 4Z0HO 1Z6TA 2VVTA 2YN0A 3LVQE 4M22A 4UAGA 1EGQA 3L0YA 3LY9A 1E1KA 3UV3A 2H00A 1S96A 4HZGA 5DN9A 4QGSA 1ORWA 4GLJA 2I2WA 3TZ6A 4UMVA 4KDFA 4RFSB 1XC7A 4N4AA 2AN1A 4F4UA 2UV8A 4RENA 4FOLA 4J7XA 4EPVA 1W0JA 4WBSA 2CYCA 3P4YA 2AZTA 4X97A 3TIXB 1B93A 5K6TA 2YTZA 3KQVA 4HC4A 4L8WB 2QQEA 1YQXA 3WGIA 2R65A 2Z8YA 3H05A 3JZDA 2DBZA 4C0SA 2HCBA 4ROTA 2RH9B 5JAHA 4U39A 3VJLA 2DPGA 4BVHA 1YK0A 1YQDA 5DP1A 2PPLA 2BRUC 4K8RB 3VJMA 1OC4A 5I3CA 3NUQA 3NHUA 3OC6A 2V4UA 1G7TA 3A1FA 2EF1A 2PSFA 1OF1A 3CR3C 5HKLA 2Z5GA 2YXBA 2G04A 3VDXA 3FVVA 3GCZA 3I6IA 1PS8A 1KQFA 2F59A 1P2BA 3FPKA 2FMIA 3Q2OA 4HLNA 3M6XA 4F1WA 5KQGA 3WL5A 4IIGA 4QECA 5F51A 2H31A 4DIUA 3FR7A 2J5XA 4L51A 4QBGB 1T5DX 1L1EA 1OLOA 4M9UA 3RKSA 4J0FA 3RQSA 1QHEA 2G77B 1GD1O 1UK6A 3S2UA 2FJ0A 1UJ2A 2D54A 5F5NA 1XIVA 3WFIA 4I4TF 1T9BA 4QPPA 1NIJA 4N12A 5I7HA 1HG0A 3KK0A 5EHGA 3RVNA 4JI5B 3U3XA 4EG1A 1GCAA 1NIPA 1II0A 4URZR 4CT5A 2WHEA 2YWXA 4L8LA 4QUHA 3DKKA 4BBAA 4A16A 1NC1A 1LTHR 1SOAA 4I50A 4MR9B 4PWZA 5KJ1A 1M67A 1KAQA 2PUAA 1G5RA 3PJRA 3RC7A 3R1IA 1FX0B 3MWGA 4HQOA 4A0FA 2WFMA 1PR0A 3QVTA 3PWZA 1RYNA 2WPNA 3U16A 2Q9BA 1CRLA 2Z57A 2G4VA 2XDQA 1R10A 4EY3A 4ENPA 1IHXA 5A4DA 1TK9A 5BN5A 2IPXA 1FRNA 5EIHA 3SIXA 4M9CA 2MMGA 3WZ2A 1IY2A 3D7LA 4FGUA 1N25A 2C5LA 2H4ZA 4KDEA 5EJGA 2QJTA 4WKPA 1GPKA 1E9SA 1T15A 1CIJA 4RWZA 2ZDQA 1Z38A 4AT1A 4ZCRA 1D6SA 1K5PA 3GXOA 3J81k 3E53A 5CCEA 2QM7A 2QKYA 2VJLA 1M8KA 4QXPA 1S4MA 2EBHX 2AG5A 1ISSA 2R1VB 3ZY2A 1EFRD 4JBIA 1U90A 4RWEA 4GYYA 2NXWA 4D81A 3KKPA 1PL0A 2YFYA 3FDZB 1F6BA 3AVTA 1XJQA 1QHGA 2M9MA 3DPUA 1MP0A 1XCOA 2YIMA 3HB9A 3IB6A 2QB5A 3V7YA 5KHOC 2FRVA 2QU7A 2BFDA 4TLDA 4MJLA 2A1IA 5DK6A 1AKWA 3GA0A 2IHKA 1KZ6A 2B7BA 3A31A 1QDUA 3F7MA 1E2PA 3FPGA 3JQGA 4MKHA 5D8DA 5EIBD 3V48A 1ZN9A 5LYJF 3UZUA 4ZOLA 5AW7A 4X7MA 5GOTA 5HIKA 1K4MA 1Z62A 2PVPA 3T5MA 4JUBA 3KQMA 1G8HA 3DLPX 1S01A 1GUDA 2JDID 4Z9XA 4ZJPA 1E5LA 3WRYC 3IIKA 5D3QA 4RELA 1B6SA 4MYHA 5IVPA 5KX5A 3OE5A 3WHPA 2B1QA 5E3JA 1Z0IA 2X9NA 3NU1A 4TXHA 2TECE 3N0RA 4WBNF 1I5RA 1EGAA 5JSFA 1U0FA 2VDUE 2O3SA 3ZLBA 3WNZA 2RHTA 3UKOA 2FDRA 1E3IA 5FUMA 3CUYA 1P4AA 2E21A 4QTZA 1P91A 3HEAA 3TVDA 1A9PA 3GFTA 5K7SA 1FYVA 4AJKA 1WHTA 1MQ9A 4GSKA 1P7ZA 3FWNA 3GRAA 5H70A 3Q9LA 2FR1A 3OX2A 4FDLA 3REOA 4ENTA 4DC1A 5AK3A 5A5GA 1RFLA 3LT0A 3BJRA 3DBIA 3T5TA 4BGIA 4I2NA 1DXQA 3PYLA 4WBNA 5IDQA 1QS0A 2D0IA 1OI7A 2FDXA 3GNQA 4YLYA 3DDZX 1P0MA 3DEIA 3MS7A 1EWVA 4DNQA 3I32A 3D3NA 4DFDA 1QK5A 4MVJG 4YMVA 1NVMB 1VL6A 5TMBA 3ZU4A 4E15A 3OBBA 2IF2A 1PWYE 1W30A 3IT0A 1NF8A 2PN1A 1GZSA 4O6VA 1WUKS 4R2HA 3WLAA 4DYVA 1OYWA 5E8RA 2GS9A 1KFCB 4A0GA 3OZEA 2PD6A 3QYJA 1TM4E 2XVMA 1T4CB 5JY6A 4P3XA 3M9WA 1M34A 4R2KA 5CNJA 4ENRA 1J5PA 1AKEA 4LOHA 4UQOA 1MB9A 4QOFA 5BVHA 1G5TA 1U0HC 3ZZNA 1NW6A 5AM3A 3PXXA 3ZU2A 2P5UA 4DJAA 1CXZA 4JSRA 1UPBA 4KEAA 1HTTA 4KRGA 3TFWA 4F84A 4G37A 1G21B 1E1LA 4QO7A 5AK0A 5BMVA 1XWWA 2JJ2A 3AR9A 4IVRA 4M86A 2WUWE 2IYFA 2P9HA 3C5HA 4KCGA 1K3UB 4DQXA 1QP7A 1QO0A 2G80A 1S5PA 3GROA 3DEJA 3C3CA 3N0WA 2FQQA 5FOXA 5TSDA 5J2UA 3KQQA 2BEKA 2R6ZA 1RQ2A 3ZWKA 3IIJA 2P4QA 4DS3A 2HLHA 1QGAA 3AOGA 3FSEA 1JHOA 1KZ4A 1ZSVA 2GN4A 2JK0A 4Y2XA 3ZE2B 4D8TA 3HNPA 5DGTA 3EFEA 1NVBA 3HLYA 2ECQA 2A1TR 3EQ8A 3FNHA 2RHWA 3KVVA 3PR3A 1J1UA 1FTQA 3OQIA 5BXQC 1SBQA 1GGHA 4EEZA 4ZALA 1F8XA 3GR6A 7AT1A 3AM3A 3STXA 1XTQA 2VPIA 2X8WA 5MGBA 1IXKA 3QKSA 1Z83A 1ODJA 4B71A 2VPQA 4UHKA 4B46A 2I67A 2B83A 1B15A 3H2HA 1O8CA 4FJ2A 1SXJD 4DCGA 5JQWA 2Q9CA 2XF2A 4NBTA 5ICSA 1IUNA 2WD7A 1H2AS 4DR6B 2UKDA 3BRWA 4EUNA 4KQIA 4LFBB 1QSGA 4TOIA 3VZQA 4MGIR 4Y9SA 2X0EA 1C7FA 3BD8A 4NMHA 4RMJA 1ORHA 2C7BA 1C14A 4GQAA 3A3YA 4QBIA 5LYJA 5TS2A 4ED9A 3TG2A 2BHLA 1GN9A 2XMBA 1XAGA 4IS3A 4AY2A 5IC4A 4ZK2A 1Q84A 3AUAA 3WIOA 1X2BA 4EG8A 5A4JA 2MYNA 3W2FA 3BBPA 3HU3A 4JQCA 4RGYA 2H7XA 4PYJA 4J07A 5K3BA 3NYIA 2BAGA 2I7XA 3MLAA 4EUKA 2KB0A 2JGNA 5G3ZA 2CB9A 1CUYA 1QIKA 4PQFA 4R6WA 4YRJA 2ZM6B 3WWEA 4AQ7A 2BONA 3DXXA 2VKTA 4YYZA 4LZAA 4KE9A 3PE3A 4DLRA 2Z4SA 3FXAA 1DVRA 3N2YA 3MT8A 1W1UA 5F21A 4N6GA 4LVCA 1P9NA 4HVAA 5FUBA 4EQZA 1D2MA 3DZGA 1H2ZA 4KU4A 3G9TA 1YASA 2FW7A 4QXMA 2ZITA 2D62A 5D85A 5BSVA 3LNTA 1MB2A 3SSNA 2I33A 4QXOA 3Q7EA 5D3KA 1NZJA 2AFHA 3G0HA 2YJGA 3RYTC 2E1PA 4M1SA 3KJHA 3PZRA 2ZIVB 1K0UA 4HQNA 4MDHA 5CW1A 5EZ5A 1AA9A 4DAOA 2XUGA 1JDJA 2HJHA 1GCGA 1QTRA 3EGCA 4BKPA 4UPEA 4UJ3A 5MN5A 2GRUA 2W00A 3E5HA 3QHQA 1U4SA 3MTIA 3JQRA 2CFIA 2CXXA 4CQJA 1UPXA 2OZVA 2G9UA 3LGSA 3NIBA 2G67A 2IUEA 3PE4A 4LGVA 4QIHA 2C84A 3CZQA 5DRTA 3ZJ4A 1KAMA 4E1BA 3COJA 2W4IA 3LC2O 2XOKD 3COSA 4R3NA 1EVQA 5C31A 1DKPA 1IM5A 2EX1A 5DU2A 2RGBA 3N2KA 3PDCA 5AMXA 3HCNA 3S2YA 4Z1MA 3TTVA 2WT8A 3JAKB 5HFJA 1N5LA 4KMOA 4AKEA 5J4KA 3RTDA 3FHTA 3CLTC 4URWR 2J67A 3SHWA 4I3FA 5HG0A 4ZRNA 1KVRA 3VU9B 3VPDA 5DW3A 3RT9A 4HWGA 1OTYA 5B7NA 4XWGA 1K7FB 2FW1A 2HU5A 1FZQA 3QFSA 2RBKA 2VSFA 3IUJA 4GP6A 4QHTA 2V8OA 4R1MA 4WQMA 5COBA 4LOAA 4YMHA 2PUBA 3DS8A 4DXDA 4L95C 2IH5A 4RIGA 1W35A 1YR7A 3HXQA 4R83A 1WB4A 2FVYA 2X4IA 3F6EX 5D1HA 5LQCA 1C50A 3WHIA 3H6KA 2HEGA 2EW2A 2VT2A 4HEA6 2QX8A 5DM0A 4QEZA 1U9JA 2BWJA 1JSCA 1MOPA 4XB2A 3U56A 3L7MA 5DXJA 4DRZA 1Z7YA 2Z6QA 2ATIA 4KR7A 3NHFA 4QRHA 2OQIA 3E84A 2VF4X 1ZJ5A 2EEZA 2MINB 5ILQA 2H2AA 4YS6A 3AG5A 5CM8B 5LZ2A 2FPWA 3OQPA 4NCBA 3H04A 3DDOA 3NLLA 2EX0A 3OZVA 5ARCA 1AUVA 2CKMA 3MTGA 3QJGA 4YDSA 4Y9UA 5HQJA 2HZ7A 2VYFA 4MRNA 2WYHA 4ALKA 4ZP1A 3R77A 3DDHA 4PPNA 1FX0A 5LIRA 3KE8A 4JC8A 1Z6YA 1KZHA 3ZHSA 4BQEA 2AXPA 2HMSA 2Q29A 3JD2A 4G5RA 3V4ZA 4IF4A 3GLVA 5E4TA 2GPJA 3ZCXA 1VJ5A 2HLDA 2W4MA 2BFWA 5LJIA 1BC5A 3BTOA 3U3DA 3OZUA 4LOKA 1WUYA 1P6UA 3DTVA 4AKGA 1X1BA 4K9KA 5AXBA 1QC5B 2GBGA 2FHPA 3KJZA 4POOA 3WP1B 4DDTA 3QLUC 5C3MA 2YXNA 2ZR7A 5IDWA 1QMGA 2O52A 4WVLA 3TINA 3QPAA 3ROPA 2YQ4A 1N2IA 2X5JO 2ETVA 2YVUA