1LLCA

Structure determination of the allosteric l-lactate dehydrogenase from lactobacillus casei at 3.0 angstroms resolution
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
320
structure length
320
Chain Sequence
ASITDKDHQKVILVGDGAVGSSYAFAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFTSPKKIYSAEYSDAKDADLVVITAGAPKQPGETRLDLVNKNLKILKSIVDPIVDSGFNLIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSVHAYIMGEHGDTEFPVWSHANIGGVTIAEWVKAHPEIKEDKLVKMFEDVRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGINDLYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAFAKND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURE DETERMINATION OF THE ALLOSTERIC L-LACTATE DEHYDROGENASE FROM LACTOBACILLUS-CASEI AT 3A RESOLUTION.
pubmed rcsb
source organism Lactobacillus casei
molecule tags Oxidoreductase(choh(d)-nad(a))
molecule keywords L-LACTATE DEHYDROGENASE
total genus 57
structure length 320
sequence length 320
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1988-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1llcA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1llcA02
3ZWVA 4J4BA 4WLNA 1NHGA 4C7KA 3EHEA 3E48A 4W7IA 5BNFA 3SC4A 3OETA 4BIIA 1E1NA 2UV8A 1Y8RA 2EF1A 1OC4A 3E8XA 3KYDB 3SBOA 1I3NA 4FFOA 2Z1MA 2JCVA 1QLJA 3QWFA 3WNQA 4ZQEA 1F8FA 1XU7A 3I9MA 3DHNA 1PJBA 4Y6SA 1PQPA 3ITKA 1I2ZA 3D3EA 5IDXA 1G1AA 1ZBQA 4CLRA 4XIJA 3IDSA 4NQZA 5L7YA 4WJZA 1U5AA 2P4QA 5G4KB 4AFNA 3BHIA 3VH1A 4ZRNA 2VTEA 1VC2A 3VVCA 3N7UA 4PG6A 3WGYA 5L9AA 2OGUA 1ZXBA 4A73A 1U7TA 1LDGA 4IJKA 2GF2A 1Q7CA 4UVDA 4FJ1A 1FXSA 2PR2A 3TZKA 1Y9AA 5B1YA 4AJ2A 4DBZA 3BXXA 3OBBA 4E0BA 1JAYA 2LDXA 4YTEA 2B4TO 3WG9A 3X2FA 2AG5A 4BKUA 1HWYA 4A27A 4GMFA 5ICMA 4DIOA 3ETDA 2C5AA 1ZNQO 4BNTA 5IFLA 4J4TA 2X0NA 4BO8A 2BFAA 3WWZA 4FCCA 1YB4A 3GQVA 3V2HA 4WKGA 2WD7B 1AXEA 1DIHA 1E3LA 3PP8A 3TNLA 3ZWXA 4J49A 2PKRA 4GWGA 3F46A 1I3LA 1Y6JA 2QYTA 1NX6A 4JN6B 3OMLA 1F06A 3ITDA 1DRVA 3PJDA 6LDHA 4CM4B 3ASVA 4OXYA 4BNUA 1ZO8A 5KJCA 3ZDFA 2YQ4A 4PLPA 1A27A 1ISJA 1VL0A 3QIVA 3QW2A 3PFFA 2RBEA 4UUNA 2O7QA 4JJIA 3SC6A 1A7AA 3WBFA 3FTNA 4BMNA 4R41A 4CM3A 4CMIA 1X0XA 4E4YA 5JAZA 5L3ZA 1KBZA 3JYPA 2VNSA 4KUHA 3RI3A 4ZA2A 4B8ZA 2UUOA 3CSDA 2JL1A 2QRKA 4WCFC 1U28A 1PJTA 4GX5A 1E6EA 4S3MA 3JQBC 4NHEA 3NRCA 1BXZA 1SMKA 3CEAA 3C7DB 5COQA 1B0AA 4J0FA 2FSSA 2JKVA 3CZRA 4HFJA 3ZNPA 2E82A 1ZJZA 1GV0A 5TT1A 5L4LA 4U8GA 4NU5A 2BI7A 2O2SA 3AI2A 4CV2A 4LRTB 4W99A 4CMEA 2GN4A 2HO5A 2D4AA 4DPKA 3WIDA 2AG8A 4NIMA 4BNHA 3QLJA 1IZ0A 1PL7A 1ULSA 2BELA 3AOGA 4MOWA 4OKIA 4AL4A 1NQAO 3PJEA 5B12A 4WK6A 1XQ1A 4RPJA 4WLOA 4BQRA 1GYPA 1EZ4A 2CVQA 3LDHA 3GNSA 1GUZA 4NU6A 1AHHA 3H65A 3GDOA 5DCYA 4DLLA 5A06A 1IHYA 4XA8A 4IXWA 2X5OA 1N9GB 3SJUA 2D0IA 3HG7A 4EUHA 1KEPA 1Y8QA 4GAEA 4FFLA 2WE7A 3OQBA 5JCJD 5MDHA 3KSUA 2P9CA 4MINA 4HKTA 2Y93A 1HYGA 2Y68A 3JQFC 4BGUA 1GPDG 2X9NA 1DC4A 3FSRA 3L4BA 5K9ZA 4XZ3A 5JCXA 5CDUA 4WCFA 2RCYA 1A72A 4J7UA 1SB9A 4GH5A 3ON5A 4D3SA 3BMQB 3VPGA 5L40A 1NTOA 2J3IA 2H9IA 4GKVA 5KNLA 3S1LA 1XG5A 4O59O 3TSCA 4RDHA 2HMUA 5U4QA 2QZ9A 4ITUA 3JQ6A 4P4NA 4CODB 4D44A 4N7RA 5ILOA 2PY6A 4MVJH 2P9EA 2ZYDA 4W4TA 1DLIA 4PLYA 3ZV5A 3L9XA 4R16A 2QX7A 2VWQA 1OBFO 1GEGA 3QA9A 2ILTA 5JSFA 4OGWA 4JP3A 2O3RA 3ZHYA 1NR7A 3I9OA 2P91A 4CLXA 3CINA 3PGJA 1YONA 3KRTA 1KVSA 2AXQA 4F6CA 1JWBB 5BNIA 4GPD1 5TLSA 3E9NA 2P68A 2EWMA 2RHRA 3LVFO 1YBMA 3L4BC 1E3IA 2BI8A 1Z45A 4KWHA 4IUYA 4LISA 3RFVA 3T7CA 4B7XA 4PN3A 2R00A 3GGPA 5BSEA 2I76A 1GQYA 2GASA 4D0RA 4PLFA 4KWIA 1BVRA 4R9SA 1NVTA 3JQGA 3ZI0A 1E6WA 3O38A 1E5QA 1LJ8A 4HWKA 5KKCA 3CKYA 4RZHA 3TZ6A 2PZKA 2OL4A 3CIFA 1GYRA 1FDUA 3H4VA 5L51A 4CV1A 4YYZA 4GGOA 1QG6A 2Q46A 5G4KA 4CQMA 3ZH2A 4DLAA 3WOHA 4L74A 4B4VA 3GAFA 3F1KA 4FOSA 3DZFA 4B79A 5AXDA 3FWNA 4BO5A 1HEUA 4A5OA 4ALLA 3BMQA 2IEBA 4MP3A 4MVJF 4QEDA 4L4XA 3L9WA 3VH3A 4BNGA 3AY3A 1HLDA 3UKOA 1ZH8A 2X8LA 3HDYA 3A06A 4Y6PA 4W9NA 2GSDA 2Z95A 3GFBA 2ZTVA 3JQDA 3JQBA 4URFA 1ML3A 4ID9A 2HKIA 1R4MB 5A9RA 2EHDA 2VZ0A 4JGBA 4XYMA 5KJ6A 3GMSA 5JDCA 1J5PA 4MKRA 4ZQFA 4B7CA 3JQAA 3GOHA 3ULKA 1JDJA 1N1GA 4PVCA 4F45A 1ZZEA 3V2GA 3EGOA 3QWBA 4KP7A 1R15A 5TT0A 1LC0A 4NBUA 3IAHA 3LT1A 3AUAA 2NVUB 1ZFNA 3ETGA 4I9NA 3TOXA 5HM8A 4KQXA 3ZNNA 3SX2A 1NQOA 3FN4A 4H7PA 5IXYA 4R3NA 3GRPA 3JYOA 2HMSA 2QYSA 4MVJM 4WEQA 5EESA 4WOJA 5IN5A 4B3HA 2GYYA 3KETA 2HAEA 3RQSA 3GZNB 4NNJA 1ARZA 2O3SA 2VYNA 1R66A 4J2HA 1DC6A 1NP3A 3C8MA 2H6EA 1RPNA 1UXJA 1SNYA 4JBGA 3B70A 3NTRA 3V2UA 1IY8A 1R37A 4RF5A 3ZW8A 2I3GA 1W73A 1UZNA 3E5MA 4GL4A 1PS9A 4KUGA 4Q3CA 3A4VA 4F6LA 4WCFB 3PDJA 4YJHB 1IUKA 4HY3A 1EK5A 2QRJA 2DTDA 4DIBA 3JD2A 3S2EA 3R3JA 3QVWA 4PLCA 3I3OA 4Y6RA 5GZ6A 2O2YA 2ZYGA 3BMCA 4MVJD 4R9RA 4Q3NA 3QHAA 3QSGA 5CHEA 5G4LA 1NASA 2ZTMA 1ZMOA 4WLVA 1C1XA 3JD1A 4UVEA 2PH5A 1ZMTA 5BQFA 4B4UA 4DQUA 3MJCA 2B36A 3U4CA 1PL6A 1ZJYA 2DM6A 2PD6A 3QJ5A 4AJ4A 1LTHR 3CMCO 4E33A 2AEJA 2GPTA 3I9LA 4BHTA 3D3WB 3ASUA 1IB6A 3MCVA 4BVAA 4E5NA 4RVUA 2VNAA 5I9MA 1I0ZA 1LDNA 1GZ6A 3OFSA 3HDHA 1BDBA 3F9IA 4FOOA 4IGEA 4FBGA 3I52A 1U3WA 1K89A 4Y9DA 3VAZA 4BV8A 3V1UA 3T7EA 3VZPA 3RVDA 3WGZA 4CMGA 5EN4A 2J3HA 1XR3A 1ISMA 3I4CA 4FB5A 4IDFA 3PHLA 2D3TA 5CP8A 3Q2KA 2Q3EA 4IIVA 3VC7A 4J0EA 2C0CA 3HSKA 4ZU3A 4J90A 4YAJA 3PWZA 4FFRA 3GN1A 4W82A 1RKXA 2HMWA 1ZVMA 2EKLA 3FTPA 4WPGA 4OOFA 3ANNA 4MO2A 4AJLA 2FRDA 1K2WA 3JYQA 2VHYA 1PJSA 1BDMA 2B35A 3OF2A 2RHCA 3G1TA 4RF2A 1KVUA 2NTJA 4K6CA 4QO8A 4TRRA 4UVHA 2B0JA 2BF7A 2VOEA 4NBRA 1XKQA 2J6IA 5FYDA 3ZNOA 1NWCA 5CDYA 3ZHBA 1KVRA 2YFQA 3BHMA 2GZ2A 2OZPA 5FI5A 3K31A 3HQ4O 3ZWMA 1HE4A 4OSPA 5I8ZA 4MKZA 2D8AA 1GQ2A 4BB6A 1I8TA 4BO4A 3MOGA 1PQWA 2PV7A 1C1XB 1EE2A 3PWSA 4GI2A 3TQHA 1F12A 1EDOA 2WMDA 1UZMA 2JCYA 1H9BA 1HYHA 1UZLA 3SEFA 1T24A 5G0TA 3EDMA 3VPFA 1HDOA 1UH5A 4ZVVA 2CDCA 4EITA 3Q11A 3SJ7A 3DBHB 2FY8A 1ZK1A 4YB8A 4CR8A 2OHXA 1E5LA 1YL6A 3HDQA 3QVSA 1VJTA 2VYVA 4IY1A 4XYBA 4NBTA 3PDUA 4DYDA 3OSUA 5HBRA 4XGNA 1LLDA 5L45A 3GPDG 2HDHA 1VSUA 1YOVA 3I6QA 4XWYA 4ZQGA 3BMOA 2JJYA 3M6IA 5LCXA 3KYBA 4HNGA 2D5AA 2GERA 2O3QA 1PJQA 1Y8RB 3DONA 4RLHA 2WYWA 3E9QA 3F1LA 1T26A 1YB5A 4I9UA 2Y1DA 1GQQA 1KYQA 3ORFA 1ZK4A 5J23A 1DPGA 1AGNA 5HS4A 2EERA 5JDIC 2ET6A 4BNFA 2EGGA 1CEQA 1MG0A 1I36A 2FHSA 2FWMX 4HFNA 1QSGA 3UN1A 3GHYA 5BSGA 3GEGA 3BAZA 1FK8A 2PH3A 2AEFA 3ZWAA 1CETA 4PLWA 4XKJA 2BGKA 3OQ1A 1LSJA 1NQTA 3UAGA 1UR5A 4JBHA 2OORA 4U0JA 1T2DA 1QYWA 1NXQA 4AJ1A 3U4IA 1RWBA 4TSKA 2NQTA 3IQDB 4U6SA 3GLQA 2HCTA 2XOXA 1O5IA 2NU6A 4QXMA 5F3RA 4ALKA 2AHRA 2C29D 2IZ1A 2J5QA 3AI1A 3DZIA 4B3IA 3QV1A 2YHIB 4RVGA 1OC2A 3RWBA 2X5JO 1CJCA 4HFRA 3O26A 2CNBA 2V7PA 1HZZA 1GL3A 3I1JA 4M49A 3VDRA 5I7FA 1RM0A 1E1MA 1YKFA 4HUJA 2FR1A 2P9GA 4B3JA 2CVZA 2DU8A 1ORRA 1P1KA 3NV9A 3WFIA 4CLOA 4CM6A 1U2GA 3MTGA 2EJVA 4PRKA 2DBRA 3I23A 5IZ4A 2VT3A 4MPDA 3Q0EA 3F3SA 5CEJA 5K6AC 3OQ6A 4WECA 2GD1O 3NGLA 3QP9A 4AJOA 3PTZA 2B37A 2A9FA 1EUZA 2X23A 2CD9A 1WZIA 4IINA 2UAGA 4M54A 3ZHXA 1LDBA 5B4UA 1FDVA 1ADFA 5JAQA 3CMMA 4LVCA 1ISGA 2GN9A 3AW9A 3OECA 3Q9UA 4BNLA 5IG2A 4F3YA 4C4OA 3PGXA 1GTMA 5ES3A 1ZW1A 1R6DA 2GDZA 4E2ZA 3I9NA 2ZYAA 4PLVA 3KLPX 3VOSA 4QT0A 3U9LA 3INTA 3JQFA 2GZ1A 4IXTA 4FJ0A 4YRBA 1CDOA 1I3KA 1TA4A 3ZN2A 4JLWA 3RBVA 2GN8A 1O95A 3FBTA 3PVZA 1OOEA 2OOSA 3JQ7A 2YDYA 4MVJG 1OFGA 2TMDA 4EJ0A 4GLLA 4IS3A 1SOVA 4Z9YA 1O8CA 2SCUA 2G1UA 1NPTO 3K9QO 3DBLA 3G0OA 5DNAA 3RUAA 2GR9A 4KDFA 3E9MA 1HYEA 4IJWA 1XLTA 2VYND 4W6ZA 4YJFA 3VPHA 2DUWA 4UEOA 3AUTA 4QECA 4CMHA 3QQPA 2PZJA 1XWFA 4FC6A 2FN7A 3I83A 4BO6A 3W4JA 4N54A 1GADO 1LBEA 3WX0A 1NVGA 3ZU3A 2CSUA 3H9GA 2Z5LA 4CMEC 2QQ5A 3L07A 4DMLA 1N8KA 3Q2IA 3FNGA 4I5DA 4U5QA 5BT9A 5C7OO 4TVBA 4J1TA 5JO9A 5HTOA 1JKIA 1VKOA 3ZWCA 3WXBA 3EMKA 5CAEA 3RUEA 4P22A 3DHEA 3WWYA 4P38A 3ZV4A 4CMJA 4QUKA 2DT5A 3BA1A 5AOVA 4WCDA 5GZ3A 1P1JA 5EERA 1SC6A 3G17A 2HMTA 3KZVA 1H6AA 3KUXA 5DULA 5TC4A 3LC1O 4DIFA 2JFFA 2X0JA 4A7PA 1XCBA 3LC7O 4EJMA 4A10A 3F4LA 4UVGA 2GCGA 2C20A 1DC3A 1IYZA 4M8SA 1D3AA 2EG9A 3C85A 3KV3O 3QWAA 3UHAA 4E5KA 5L7TA 3W4IA 3EVNA 3GUYA 1CIVA 4R68A 2Y1EA 4FFMA 5G2OA 3U62A 2EW8A 4ALNA 3LK7A 2AQ8A 1NFFA 2I3AA 2RAFA 5KCZA 2OMEA 3VTZA 1JKFA 1KERA 1DEHA 1QRRA 3NUGA 4JCOA 3TOZA 3EUWA 2O23A 1QKIA 4BB5A 4BNKA 4L0QA 2CZCA 4NMHA 2W8ZA 4K26A 3D5QA 4NH4A 1LX6A 4NZ9A 1PU2A 2XAAA 2Q99A 4BUCA 3DZJA 2OBNA 3DBHA 4CMCA 2FPGA 5CDSA 1C1DA 2BH9A 1QYCA 4OAQA 4E2XA 4IIUA 1ENPA 5KVSA 1YRLA 1WDKA 4LK3A 1EVJA 2V6BA 3OP4A 5IDQA 3WSVA 2FPPA 3WIEA 1HE5A 4UEJA 2POQX 4CLHA 5I9LA 1AE1A 1A9YA 2NTNA 4ZGWA 4J1SA 4JP2A 2O3UA 3UCXA 3VPSA 4BGIA 2VUTA 5DCWA 4PFJA 2HK8A 3RCBA 4D3FA 4O6VA 1PZFA 2WTBA 3WGOA 1NM5A 4O0LA 3W6UA 5IXSA 2IXBA 3QWIA 1Y7TA 1E7YA 3D5TA 4DGSA 3C7AA 1HE2A 3GVPA 3ANLA 4DTIA 5CPFA 3LYLA 4D45A 1VPDA 1LNQA 3K96A 3DAFA 4TVOA 3ZU4A 1LLQA 2YUTA 1ONPA 4Q3DA 1BHSA 1O94A 4K6FA 1EQ2A 2Q45A 3MOIA 3JSAA 3DBVO 2PD4A 1YQDA 1DLJA 1EEHA 4JIGA 3RBXA 1PGNA 1H9AA 3FD8A 2X0IA 3KSZO 2FPIA 2CDAA 1ZEMA 4K1LA 4WEOA 2ZCVA 5IDYA 3ZU5A 5JFOA 3H2SA 3OEYA 3GG2A 4D41A 4GQAA 1V9LA 3TDKA 3AM3A 1NNUA 1PGJA 3F4BA 2W2KA 4PLHA 3FF4A 4IQ0A 2ZTUA 2C54A 1WWKA 4UREA 4GSKA 2X4GA 4HX5A 2ZB4A 1I3MA 1HLPA 2DQ4A 4BL5A 4ZD6A 4NFYA 3RUIA 1GCOA 1FDSA 4JBIA 1LSUA 1PSDA 2PFGA 4YJFB 1XIVA 3BTUA 5EL0A 4TKLA 2Q1SA 1E3WB 3JYLA 1M76A 4IJVA 1DFHA 5JCJA 3M1LA 1UXGA 4I9HA 2B83A 5CDTA 1P77A 5JE8A 4R69A 2IZ0A 5F1KA 2HRZA 3ENNA 2ZCUA 2EGHA 4C7JA 3GT0A 5HRUA 1T2CA 2BRUA 2AW5A 2VZ8A 4TZKA 3TFOA 1NBOA 2OO5A 3GMDA 3NDIA 5EPOA 3KBOA 3KLMX 4JX8A 4NJMB 5DP2A 5TRTA 1I2BA 1QXSA 4FGWA 1H2HA 5DOZA 4DPMA 3GAZA 5JBIA 2X0RA 1UXHA 3AOEA 1TVEA 5G0WA 2QHXA 1MG5A 1PGPA 1Q0QA 4FFNA 2OXIA 4GWKA 5T6BA 4BV9A 5CEEA 2A92A 3MWDB 3INRA 1X7DA 1YXMA 4J6FA 1NFRA 4XDZA 5JO0A 3RROA 1Z7EA 3NJ8A 4HFMA 1X7GA 4RPHA 3DMTA 3WMWA 3VDQA 1PWZA 3K6JA 2LDBA 2V6FA 3NT4A 1DAOA 3ZWYA 3DQPA 4E30A 2CFCA 2H1SA 3JQEA 4GVLA 4Y98A 1VRWA 4S1VA 4IDBA 3AM4A 5DT9A 5JPIA 1JN0A 4ZICA 1IPFA 1U3UA 1H0KA 1YWGO 4RZIA 2DKNA 4OO3A 2NU7A 1VL8A 1A4IA 3OA0A 1HL3A 3M2TA 1C14A 4ONEA 1HE3A 4DLBA 4TWRA 4RGBA 2E4AA 3ROMA 1YS4A 4E5PA 3ZWNA 3KXDA 2EV9A 4A0SA 1GZ3A 5EIOA 2Z1NA 4IMRA 4ALMA 4YT2A 4B7UA 4IQGA 3QE3A 1WAMA 2P4HX 3GVCA 2YQ5A 4RCVA 1Y8QB 2PKQO 1NAHA 4R51A 3ANMA 4L8VA 3U09A 1Z74A 5KIAA 3GY0A 4NG5A 1T2EA 4L73A 5TGDA 3KB6A 2YV1A 2E37A 4EI2A 2FSVA 1PZHA 3AU9A 4YWJA 3HWRA 4TRNA 1UDBA 4N18A 3WLFA 1Q0HA 1YBAA 3JQGB 2VWPA 1K5HA 1B8VA 3OICA 3WR5A 5JNLA 1PS8A 1XELA 3D4PA 3BMOB 3EW7A 2YHUA 1N7GA 1VE9A 3TF5A 1JA9A 1YJQA 2H5LA 2R2GA 4YBZA 2EP5A 2R6JA 2VWHA 3FNEA 3WNVA 5CDGA 4XQGA 2A35A 1WMBA 4G65A 1C1DB 1RYEA 1DJQA 1UAYA 1EFLA 1XSEA 3JCZA 3U49A 2JD1A 4A2CA 4GSLA 1H93A 4FW8A 2Q49A 2BFMA 5LDHA 1GPJA 3GZ4A 1IULA 1RYDA 4ZQBA 2RH8A 3Q3CA 1BSVA 4OYRA 1J0XO 2WJPA 2BHLA 1GR0A 3VH2A 1N2SA 1OZAA 1U3TA 4OHUA 4CQLA 3B6ZA 1OI7A 2NV6A 1EMDA 2ZB8A 2F00A 3H9UA 4IDGA 4NBVA 4I8XA 3DB2A 4R5MA 3TZCA 2Q2QA 2ZB7A 2VHXA 1H2BA 3RSHA 3WICA 1MGOA 4KTVE 4NPCA 3K5PA 4EJ6A 1HDGO 2DLDA 3K8ZA 3I5MA 5I9NA 1N92A 2C5EA 4ZRMA 1M67A 1B3RA 1Y5MA 5ADHA 4LRSB 3HN2A 1S7CA 1D7OA 4YR9A 1C0IA 1SOWA 3WGQA 3BHJA 5KJEA 1X14A 4OOEA 1E7RA 4CLOB 1QP8A 2J5RA 3EK2A 3GF4A 3OJ0A 3AU8A 4LSMA 4L9RA 1Y1PA 2CUKA 3ADOA 4CQMB 1MC4A 4LN1A 4E6PA 1ISFA 4HXYA 2PTGA 1ONOA 2AE2A 1G0NA 4Z0PA 5K6AA 3UCEA 4XB1A 1S6YA 5KTKA 1P1IA 3AI3A 3LT4A 2YV2A 4AJJA 3N74A 2D1YA 3JV7A 4JK3A 3FR7A 4J2OA 1VJ0A 3FBGA 4WUVA 3BTSA 4YJGB 1PJ3A 2AE1A 1KOLA 1YDWA 2EP7A 1R4NB 4XQCA 3ROKA 1K6IA 1PZEA 2G5CA 1OMOA 4QFCA 3B1FA 1I32A 2GLXA 1R4MA 4AG3A 4XQEA 3HB4X 4QTZA 3IMFA 4IZIA 2BKAA 2ZJ0A 2EIHA 1A4UA 5EQFA 2DBVO 1SPXA 3CH6A 1B8UA 1PS0A 2E49A 3WGIA 1L1FA 2Y0CA 3ENKA 2PK3A 2VUSA 4RL6A 1RJWA 4MP6A 1MX3A 4MIEA 4CLEA 3PHHA 5DCUA 1JQBA 1UP6A 2YV3A 5CEFA 2VHZA 1ZSYA 4BKPA 2I9PA 1TT7A 3JYNA 4YT4A 4L4RA 3F5SA 4IDAA 1SBYA 1KC1A 1PGQA 3TPCA 4CL8A 1QV6A 1LA2A 5JDIA 4PIVA 2OP0A 4WOKA 4I08A 2J3JA 4E2YA 4E3ZA 1YH3A 5A03A 4R54A 2JAHA 1I2CA 1X15A 4YT8A 3EYWA 1BMDA 3H9QA 3KYDA 5G0UA 3RKRA 3ZU2A 3IC5A 2ZK7A 2Y0EA 3SLKA 5TJ9A 1F8GA 4J9UE 3DOCA 3GUCA 5G0SA 1E77A 3IS3A 1U1IA 4YXFA 1J6UA 1DIAA 1ADGA 3WFJA 3HZZA 4CJXA 2B5WA 2WSBA 4NJOA 1HDXA 3HDJA 1XA0A 3GHHA 4LGVA 3UVEA 3UCFA 1B26A 2XXBA 5DN9A 2IZZA 5I7SA 4IQ8A 3LC2O 1QYXA 3FNFA 1R12A 1MLDA 3KM0A 4WLEA 5GMOA 4EW6A 4BO2A 2O7SA 3K2BA 1ZK0A 1Q7BA 4R1SA 3EZYA 2WD8A 4BNNA 4J91A 1GUYA 2IXAA 1R0SA 3ROPA 4J7XA 1KEWA 1F14A 3N58A 3RBZA 1R4NA 1U4SA 2AQHA 1P3DA 2IODA 2Q1TA 5C5IA 3E03A 5A9TA 1E7WA 3SVTA 4YDRA 2HMVA 1X0VA 1NFQA 5T67A 2WD7A 5F5NA 1I5RA 1IPEA 2VHVA 5KVQA 4CUJA 2X86A 4CM8A 1C0LA 4JQCA 4AJNA 2X1HA 4I5FA 4RDIA 4L75A 4Y8VA 5IJZA 3CE6A 4N5MA 2DPHA 2DPGA 1F0YA 4BO1A 2NU8A 2ZKLA 2UYYA 4FD3A 3S55A 4QSMA 1A9ZA 1U7HA 1WP4A 1WDLA 1YE3A 3FWZA 2AQKA 1FDTA 4R5HA 4BMVA 3AK4A 5EINA 3DAGA 3JQAB 2BGLA 1LRKA 4YAKA 2PD3A 3X2EA 3WB9A 1Q2XA 3QY9A 2GN6A 4N5NA 1FMCA 4R3WA 1FJHA 1KVQA 1E3SA 3FPCA 2W98A 1PZGA 2JD2A 4JJFA 2Y66A 4IDDA 4UUOA 3STHA 3WTCA 1ZK3A 3FI9A 2CY0A 5THKA 2VTDA 5K0ZA 1P1RA 1IOLA 2OBYA 1QV7A 4L4SA 1ENYA 4XD2A 3VKVA 3B20A 4U7WA 5A05A 4E21A 2V65A 4KUEA 1QLHA 5AXBA 4YPOA 4PLTA 3VH4A 4EUFA 3RIHA 3W1VA 2EXXA 5FWNA 1HTBA 4FQ8A 2FR0A 5BSFA 1LSOA 5FI3A 1N5DA 3QVXA 4XX0A 4GBJA 3KTDA 2BMAA 2YJZA 3C3XA 4EDFA 1MB4A 2PWZA 4WLUA 1YL7A 4CR6A 3GVHA 4DL9A 4WNCA 2J8ZA 3UW3A 2OFPA 1WPQA 2GGSA 4Q39A 2VUUA 5U9CA 2UUPA 4J1NA 4Q3AA 1I24A 2Q2WA 2FOIA 4H15A 4LMRA 3PYMA 1U2DA 4XDYA 1LSSA 3PFWO 2ZB3A 2BFOA 2CDBA 3CXRA 3U3XA 1B7GO 3PZBA 5H81A 1PR9A 1ONNA 4OQYA 3HUDA 3GGGA 4J3FA 1TEHA 1EVIA 1U5CA 1V3TA 3GR6A 1T2FA 1LLCA 3TN7A 1PTJA 3ZCXA 4FPXA 3JQ9A 1W4ZA 4XCVA 5BR7A 1JVSA 4BKOA 5IZCA 2O48X 3PIDA 4TMFA 1UXIA 1VJ1A 3RUCA 4Z0HO 4DPLA 2C7GA 2G76A 1EK6A 4GMGA 3K30A 2JHGA 3WJAA 4OXNA 4FN4A 3E6AA 4FS3A 2Y05A 4W9NC 1P33A 2E48A 3E82A 3GNQA 2WYUA 4KTTE 4NDNE 3PJFA 4RQUA 4YT5A 3T4XA 4DVJA 4DQVA 2Q50A 1Z73A 4DQXA 1JAXA 1PJLA 3D1LA 3CUKA 3E5RA 4LCEA 4YAEA 3RUFA 1XGKA 4IMPA 1GZ4A 1Q7GA 5H83A 2NVWA 2W90A 5DBFA 3DTYA 2C07A 4EZBA 1E3JA 3DZGA 4EEXA 3RU7A 5HWSA 4G81A 4YJGA 3LF2A 4AJKA 2ZQYA 3G3EA 4R4JA 3CZMA 3EZLA 4JROA 1FDWA 1B3BA 3JQAD 4IGFA 4LMPA 1P45A 1E7MA 2GUGA 4RVHA 1YO6A 5C7LO 3PHIA 4GGPA 1PGOA 1SCUA 1E1KA 2HJRA 5AQ1A 4DRYA 1HSZA 1H6BA 1I33A 2AA3A 1YDEA 2CF5A 3TZHA 2QRLA 2R00C 4GLOA 3OIGA 4FDAA 3DC2A 3GA0A 4D43A 2NWQA 2X58A 1T25A 1UDAA 2YYYA 4I1IA 1C3VA 4ND2A 1GV1A 4ROSA 4XGIA 4CPDA 4CUZA 2AEMA 3WLEA 1GY8A 4QO7A 3VHRA 5KVCA 1SEVA 3GH3A 4K9DA 5ILGA 1MFZA 3DZKA 1K6XA 3HN7A 2HQ1A 3RJ5A 1ADBA 2I99A 5A9SA 4II2A 3BIOA 4N5LA 1KEUA 4RVFA 2X9VA 1PL8A 5F1OA 3RC1A 4H3VA 4Q9NA 5JC8A 5CG2A 1EBUA 1ENOA 4GX2A 3NT5A 1PJ2A 1AHIA 1QYDA 1WW8A 1XEAA 3MJEA 3NT2A 3VPXA 3FRJA 2NTVA 2YDXA 3H3FA 4KOAA 5ENDA 4CV0A 1P0CA 4FR5A 3TL3A 1EVZA 2Q4BA 3U0BA 4JXKA 3NEPX 4MVJP 2PNFA 1EUDA 3LT0A 1U8XX 4ND3A 4BO0A 4FSHA 5TX7A 5ER6A 1DB3A 3D3WA 4UUPA 5L4NA 3ZWWA 3ROQA 4OSOA 1V8BA 1ISIA 1LRJA 3D64A 5L95A 3A28A 1GUFA 2UDPA 4ZJUA 3RFXA 5I7VA 4R1TA 3O4RA 1E7QA 5I8WA 1GAEO 1ZSNA 3U5TA 1ISHA 3WQRA 4R1UA 2FP4A 2W2LD 5JXWA 1P0FA 1JKJA 1UJMA 4ND1A 3S2GA 3M2PA 1CERA 4BNJA 4JJGA 3LLVA 3DOJA 3L6DA 2WDZA 2EJWA 2YZ7A 3KOUA 4KQWA 4M1QA 1DRUA 1EBFA 3SLGA 5F21A 4CMKA 1A71A 4CR7A 1RM5A 1NQ5A 2X6TA 2G17A 3MZ0A 1LDMA 1JW9B 5CFZA 4FIZA 2QW8A 3ZWBA 3E18A 1BWSA 9LDBA 1V3VA 3FCOA 1YQXA 4BKRA 4M55A 1VSVA 3R1IA 6ADHA 1WVGA 4Z3DA 3VZQA 1KS9A 1UP7A 5JY6A 2GZ3A 4Z6KA 2IE0A 1LDYA 3O8QA 3R3SA 2JD0A 3IOYA 4CM7A 3ZGYA 3B1KA 1X7HA 4IJUA 3H3JA 1HDCA 2FZWA 5ICSA 2NVUA 3EVTA 1AUPA 3WMXA 4CM9A 5A9SB 3A1NA 1P9LA 5ITVA 3WYCA 2ZTLA 4CLDA 5F1PA 2AMFA 1JU9A 3ZWPA 3DZBA 1PWXA 2EKQA 4AJPA 1WXDA 1HETA 5HA5A 5CG1A 3G49A 3JD3A 4PZDA 5GZ1A 1MP0A 4XJTA 3I9KA 1UUFA 4BO7A 5HS6A 3AUUA 2PKQP 1P1HA 4B8WA 4E32A 2X7HA 1J49A 3RAJA 3ONEA 1DFIA 5TNXA 5EQDA 3MJTA 4Y67A 1BGVA 4CUKA 5L53A 1E1LA 3KHUA 1OAAA 4KDEA 1YOVB 3F47A 4TRJA 4CV3A 5L7WA 3NTQA 2GO1A 2QG4A 1DRWA 3DHYA 2BLLA 3TRIA 1TT5A 4E5MA 3WDSA 2XF8A 4GX0A 5KOIA 1T4BA 2J3KA 5AYVA 4E12A 5TS3A 2UVDA 5DOVA 4CMBA 4ND5A 3IP1A 3RD5A 1HSOA 1R0KA 1EDZA 3IIEA 2Y1GA 2YFHA 4ZN6A 3QVOA 1T4DA 5ER9A 1FF9A 1LQUA 1NHWA 1PIWA 3AFNA 4LSWA 3FR8A 5KVVA 5T5QA 3PEFA 1HT0A 1X1TA 1JVBA 2Q1WA 3C1OA 1DHRA 1O9BA 3TZQA 2VCYA 7MDHA 1VI2A 2O3TA 4LW8A 3MTJA 5TSDA 2NLOA 3ICPA 5IDWA 2VHWA 1DC5A 1E92A 1UAGA 1TXGA 5LC1A 4D46A 4PZEA 1JLLA 2Q4EA 2RIRA 4FJ2A 2WYVA 2VOJA 3Q6IA 4XRGA 4BOYA 1T2AA 3G1UA 3NKLA 3QRWA 5H82A 3IKVA 2NU9A 1KY5A 4IS2A 4M86A 2VQ3A 1Z7BA 5FFFA 4MP8A 5JYEA 1SB8A 3PLRA 1D8AA 5JMPA 4HADA 2BD0A 4YRAA 1V6AA 3FPLA 1GD1O 3ZV6A 2HJSA 4CMAA 1Y81A 3BYZA 4YRDA 1N9GA 4O1MA 3DWFA 2DUUA 3O9ZA 4ALIA 3PPIA 2Y1CA 2WWRA 3HFGA 4QQRA 1PJCA 4CMIB 2IDZA 3TFQA 3DXFA 3M1AA 4AJIA 5A04A 3PQDA 1E6UA 2NM0A 3HJAA 3H9JA 2FMUA 2C2YA 3L77A 4EUEA 5TIIA 1MFPA 5AXCA 1PQUA 3L6OO 4OJNA 4KZPA 3HNPA 3KVOA 3MEQA 2NVBA 1B2LA 3PYLA 5B4VA 1XYGA 1YVEI 3SXPA 3RFTA 4B4WA 1BW9B 3LLSA 5DP1A 2DBZA 3W4KA 1ZK2A 3OHSX 1ZKMA 4TRMA 2HK7A 4J16A 1H5QA 3PHGA 1DIBA 3I9JA 3C1TA 4CQMD 3NDRA 1Y5RA 4XQ9A 3EAGA 1IZ9A 2VRBA 2AQIA 3HADA 1VM6A 5EMHA 3JQ8B 2G0TA 3DDNA 4F46A 4BGVA 3GFGA 3C1AA 3TL2A 1DIGA 1DAPA 4CL3A 3UFXA 1QMGA 5C3MA 4E31A 1V0JA 3DO5A 3TWOA 2HUNA 4GVXA 4AICA 4GKBA 4NR0A 7ADHA 3LSYA 4BNXA 5JW6A 4K28A 3IKTA 5G0VA 1LQTA 4RVDA 1HXHA 1M2WA 3D0OA 2OUIA 4MVJE 1LLUA 1XU9A 3DBLB 2CMDA 1SAYA 3JD4A 1LDEA 4WLFA 5JLAA 3FHLA 1AN9A 3BZUA 4BO3A 1HF3A 1NR1A 1DFGA 4ZQHA 4XYEA 4PG5A 1PX0A 2JCXA 2TMGA 3V8BA 5U1PA 2WEKA 1P31A 1B16A 4IBOA 2Y0DA 5CPBA 2NADA 3GDGA 2P5UA 3PRJA 2J5KA 4UVIA 4YCAA 3PHJA 4ILKA 2JFHA 3LZ6A 3GNTA 1NWHA 5I7EA 4RVSA 1MUUA 3MJVA 3RC2A 2Y1FA 3IJRA 4BNIA 4D3DA 3B1JA 4Z0TA 4MVJI 2GRAA 3C7CB 3IUPA 1MA0A 3LF1A 1WMAA 3D7LA 2Y99A 3EY4A 2I66A 3OJEA 3E1KA 4PZCA 1UXKA 4G5HA 2C82A 3OA2A 2P5YA 2D2IA 3S2FA 5JAMA 2DAPA 3DBRA 4OQZA 1P74A 3PXXA 2YHIA 3ZHZA 3L4SO 3H8VA 1M6WA 3U4DA 3PZRA 3OEWA 1VLLA 4IDEA 1BRMA 5IN4A 4WNIA 4JNKA 4DBVO 2O4UX 3DZHA 3H5RA 3DMTC 5DF1A 1LRLA 1YGYA 4INAA 2I65A 2IYPA 2PZMA 4A26A 4EEZA 5B4TA 1G6KA 3MJ4A 1B8PA 1CWUA 4FC7A 4XYGA 4YQZA 3L0DA 4ALJA 2P2SA 2VRCA 4MJLA 5BNTA 1XQ6A 3RC9A 3OH8A 3VZSA 3H2ZA 2EEZA 3COSA 5IF3A 2CVOA 3H7AA 1E0DA 2DBQA 1PEDA 3NGXA 4LVUA 3F5QA 4J9VA 4WASA 5BSHA 1NYTA 4YJDA 4DC1A 4PLZA 2W2KB 1GU7A 3WGTA 2W4QA 3F6YA 2VN8A 4BNWA 3P7MA 1X1EA 1GEEA 2W2LA 2C2XA 1TB4A 4IZHA 1IHXA 4EBFA 3PIIA 1CQIA 2OP1A 3GZNA 3K92A 1ZUD1 2V6GA 2ZQZA 2NQ8A 4YQYA 1U9JA 4G2NA 2PGLA 1LI4A 1UP4A 3LQFA 3KEQA 3D4OA 4Z9FA 1L7EA 1HRDA 1LU9A 1AXGA 3GG9A 1VL6A 3HHPA 1Z6ZA 4U6QA 2QIOA 3WBBA 4PCVA 5F5LA 5JC1A 4PGFA 3KYCA 1H94A 4BNZA 4NK4A 2H63A 5JDCC 3OIDA 4P4LA 2X5KO 5GY7A 3W8EA 3PJGA 3NTOA 1DOHA 3DFZA 4NBWA 4XR9A 3ST7A 2O3JA 2CF6A 3ETEA 4XR4A 2XPCA 3OIFA 3VVBA 3JQ8A 1DSSG 4YACA 1XHLA 2B5VA 4XYLA 2VWGA 1Z75A 2FR8A 1H6DA 1C0KA 4ESOA 4NFHA 2PLAA 3PK0A 2HU2A 2RH4A 4PG7A 3NYWA 3A14A 2BFPA 3PI7A 4IM7A 4O5OA 1WNTA 1U8FO 4BNVA 5T8KC 5IAAA 3GVIA 5L4SA 3KYCB 3P5SA 4XEHA 4XIYA 5EJ2A 1LC3A 4OXKA 1TT5B 3K73O 3UH1A 2GNAA 3DTTA 3JD0A 2HK9A 3PQEA 1E3WA 3UOGA 3KO8A 1SEPA 3ZZNA 4TQGA 1F17A 2VZ9A 3NX4A 5THQA 1B15A 3VKUA 1GDHA 2I6TA 5KKAA 4PG4A 4YJHA 5JAIA 2FZEA 3DL2A 1O6ZA 4TZTA 1E7SA 1LEHA 1BXGB 1XDWA 2DTEA 3DEYX 4RV9A 4OKNA 3RUDA 4EGFA 1YB1A 2I5PO 2A94A 2DFDA 3GEMA 2E6UX 3JTMA 8ADHA 1MXFA 1QORA 3AY7A 3GEDA 5TJHA 1HZJA 2G82A 5LDGA 1V3UA 1KETA 3U4HA 3WJ7A 4ZHSA 2Q2VA 4RO0A 2NNLD 1CQJA 1I30A 4MVJA 3MWEB 4Z3KA 2DC1A 2NSDA 3CPSA 4NI5A 4WE3A 5COAA 3S8MA 2BGMA 3LU1A 3I4FA 3AY6A 2C59A 1TLTA 1VKNA 3PWKA 1R16A 1T1SA 2PGJA 1CYDA 4RJTA 1DJNA 4J7CA 3FNHA 4DWVA 1K0UA 1P1FA 2DVMA 4A03A 5T57A 1CRWG 3JQCA 2IRWA 4Q3EA 1TI7A 3BMNB 1NPDA 3DAPA 1EFKA 3BTVA 1SZJG 4TROA 1ID1A 1K6JA 1K3TA 4MDHA 4CM5A 1YQGA 4X54A 3VZRA 4I5GA 4UULA 1I10A 1O89A 1RM4A 1KVTA 4L76A 2YY7A 4MIOA 4YEDA 3ZNQA 2D5CA 3V5NA 4W7HA 4IPTA 5AVOA 2HSDA 2ZATA 1W0CA 5JMWA 3RC7A 3AWDA 3ONFA 4OL9A 3UICA 3P2YA 1PR3A 1DDOA 5DZSA 1YBVA 2O4CA 5JYDA 2VRCD 1P44A 3W8DA 3GN2A 4RLSA 1GFSA 3WYBA 5B37A 3WS7A 1M6HA 1X13A 4MIYA 3LT2A 5JY1A 2B4RO 2JAPA 4DUPA 3H9EO 1Q0LA 5A5EA 2JFGA 5FEUA 4RPGA 2NACA 3GVXA 3WQQA 5A02A 1W6UA 1QYVA 1M75A 4Q3BA 1Z82A 3RUHA 4KMSA 4DA9A 1D1SA 1Q1NA 4XRRA 4YVFA 1YJ8A 4OIMA 4MKXA 1ZXLA 1DHTA 5A3JA 2O50A 1ADCA 1EE9A 3KSDO 3ADPA 2Q1UA 1D4FA 3G79A 1N7HA 4YA6A 2HRBA 3T4EA 4XJSA 3AM5A 3UUWA 3DMYA 9LDTA 4CM4A 3RASA 3DOOA 1D1TA 4HNHA 3GPIA 2I67A 4HV4A 1O0SA 3P2OA 3R6DA 4U0KA 1ZEJA 1HKUA 1UDCA 3D4NA 4QFDA 1EVYA 2XXJA 2B69A 2F1KA 4E2WA 4D42A 1DXYA 2IEDA 3PLNA 4QX6A 2ZJ1A 2EKPA 3OM9A 5KJFA 3WYEA 4UUMA 2IYOA 3BMNA 2VYVD 3JQ7B 2X9GA 3R0IA 1WLYA 4BMSA 2DTXA 3OJLA 4RPKA 1U4OA 3ZWOA 1DBVO 1RM3A 1ZIDA 8LDHA 5DBIA 3ABIA 5A3VA 3ICCA 4PVDA 2PGDA 1EUCA 3DR3A 3RU9A 4BO9A 3MJSA 1LXCA 1IL0A 2WE8A 3NAQA 4AVYA 4BNMA 1WZEA 3AUSA 5A4DA 4M89A 1T1RA 4DXHA 1HDRA 5AXAA 3P19A 1IE3A 1GYQA 3PYXA 1ZCJA 3I6IA 2YW9A 3H5NA 1ZSVA 1BXGA 4PG8A 1BTOA 4TKMA 3Q1LA 3K2EA 4IDCA 4CLRB 1KC3A 3WGHA 5KWEA 2DFVA 5ITWA 1DIRA 4B4OA 3IP3A 1R0LA 4RQTA 4E13A 4XB2A 3WQSB 5A1TA 4AJEA 1ULUA 1W8DA 1ENZA 1L7DA 4RORA 2ZIZA 4R1NA 3IJPA 4LCJA 1CF2O 3UGKA 4J1QA 1E3EA 3EC7A 4NJMA 1BVUA 4I5EA 1G0OA 1NPYA 3UXYA 4BGEA 4CM8B 4DC0A 4II3A 3H5AA 3ZV3A 1M66A 4ND4A 3C24A 3PQFA 2V6MA 4RF4A 2JHFA 5A5FA 4RPLA 2A4KA 5MGBA 4CQLB 3W6ZA 3KEOA 4FFPA 3QWHA 5ENVA 1J4AA 5JS6A 2NUAA 4J43A 1MV8A 1BXKA 2PA3A 3ONDA 2WM3A 3WSWA 4D7AA 4GX1A 3W8FA 4BQPA 2EW2A 4J4HA 4PLGA 3GGOA 1WDMA 3NJ4A 4E5YA 4D0SA 3HB5X 4PRLA 1BW9A 3TJRA 3ZW9A 2D59A 4DREA 1A7KA 2X22A 4HBGA 2B4QA 3BMCB 3Q9NA 4O63O 5KJ1A 1H6CA 3WGGA 1BG6A 2QZZA 3O03A 1JWAB 3RJ9A 3V1YA 1DO8A 1KY4A 3AJRA 1KEVA 1Y9EA 3HE3A 3L6EA 3GDFA 4UEKA 4BNYA 3S2IA 4HP8A 1HDYA 4CM1A 4AJHA 3DFUA 3BTOA 1U3VA 3AOEC 1MXHA 3OJOA 2PZLA 5DDIP 4OM8A 2Y67A 3IUSA 3V1TC 4RF3A 3VTFA 1PJ4A 2C7VA 2VT2A 4UAGA 5T8KA 1EQUA 1GCUA 4CM9D 1C0PA 1N1EA 2Y1OA 5T64A 1MC5A 1I01A 4NFSA 3A9WA 4YAIA 3GK3A 4P4GA 1NVMB 4Z9XA 1V35A 3CTMA 4R01A 4P8RA 4M87A 4OH1A 3UF0A 1QR6A 3WTBA 5FF9A 4BS9A 3DBRB 1A5ZA 5C37A 3GC6A 3HFSA 5TQVA 3QVTA 3RKUA 4H16A 1KIFA 1B14A 4XGKA 5TF4A 4FGSA 4OMUA 3INGA 1JTVA 3AFMA 3O8QB 4BKQA 3GRKA 4YAGA 3IL2A 5IZCC 4DYVA 3NDJA 4EYEA 3JQ9C 1LUAA 3OJFA 1HDZA 5COBA 4D79A 5C7IO 1NAIA 4WGGA 5DBGA 4NK5A 2HLPA 4DMMA 1YL5A 1SO8A 3H6KA
chains in the Genus database with same CATH superfamily
4DJDC 4YUXA 1EWTA 4GLJA 4WLNA 1NHGA 2PWYA 1ZP6A 2VDQB 2QUAA 3EHEA 4B47A 3C87A 4Q15A 4W7IA 4R8SA 4XPIB 2XQJA 1EGVB 2OYCA 1E1NA 4A0QA 4YJ3F 4NKRA 1RQ7A 3W7VA 2VH5R 3SBOA 1E6KA 2VRWA 2Z1MA 4FMBB 5JMOA 1NE7A 1XQYA 4EG0A 1Q0ZA 1QLJA 1YJCA 2WFZA 2GCIA 1QB8A 3B78A 4YP5A 4D8TA 1JV2B 3KQPA 4ZQEA 1RJ9A 3M4NA 2DLCX 1X77A 3TECE 1H8HD 3DHNA 2CLOB 1ZUIA 3QNUA 1ZESA 1YQQA 3ITKA 5IDXA 1TKCA 3GJ8A 2ZEJA 4RE5A 3TTUA 1UJ2A 3PTLA 1TKBA 4XIJA 3D4IA 4J7AA 1P2TA 3AFOA 3FGPA 3I2KA 4J0JA 4NQZA 4BE9A 4ZK2A 4RZ2A 4XM1A 4YP1A 2XXAB 4L6CA 3EG5A 4CIDA 5JNSA 4AFNA 3SJZA 3JVIA 1T8WA 4QDOA 1Z6YA 4LWZA 3K70B 3VVCA 1QRSA 4XVCA 4MHTA 3HL0A 2OBMA 4H6VA 3WGYA 2JH9A 4PAMA 1LLFA 3D8SA 3WY9A 4CCWA 4A73A 1U7TA 1DELA 1U0NA 1UKZA 1EM6A 2F1OA 1ZXXA 3QE4A 4NYJQ 4GIBA 4IJKA 1BQ4A 4MGZR 4RAOA 2GF2A 4I50B 2Q0SA 1JE0A 3X1JA 1Q7CA 1YSCA 3KOYA 1RHKA 5JQGA 2CNNA 4D0GA 3X44A 1K9VF 1Y9AA 3MGGA 3FCAA 4FR2A 1E66A 3PC4A 1VP9A 5F9MA 2PMBA 1BS2A 3Q8MA 2HSWA 1JLKA 3UWPA 4LYAA 4DBZA 1BWRA 4U7TB 4XFKA 2LDXA 4YTEA 4AMZA 4DIDA 3PJRA 2AG5A 3OURA 1EHIA 4RA9B 4A27A 2JEOA 4GMFA 2BW0A 2PXXA 5JI2E 1ZJ6A 4BLVA 2EFYA 2O1WA 1RRGA 4YMGA 5F7JA 3IEMA 4LQDA 1AZSC 4BO8A 5JADA 4HGPA 4LY9A 4FCCA 1INLA 1YB4A 3GQVA 4FX5A 4F2HA 5ALMA 2HK6A 3ZK7A 1AXEA 1XTIA 4D2IA 2H18A 4GBED 5A1JA 4M9UA 4FOTA 2Q6OA 1E3LA 3PP8A 3LW8A 2W6IA 4J0IA 4U7PB 1KI6A 3ESXA 2QU8A 4RSHA 1YR8A 3F46A 2O06A 1I3LA 2EAUA 3RT1A 1Y6JA 3JR3A 4CEJB 1Z25A 3PJDA 3VC2A 1WUTA 3ASVA 1QGED 4BE7B 1ZO8A 4CETA 5KJCA 3ZDFA 1TAGA 3H1TA 1ISJA 1L8OA 1VL0A 2FQWA 3QW2A 4UUNA 5H16A 5B3AA 2O7QA 4M0FA 2WU4A 5FL7D 1A7AA 3G2MA 4G5OA 3SC6A 1W30A 3VU9A 3ZR4B 4BMNA 4FGLA 2NYVA 3KZNA 4CQNA 1NSFA 3NHKA 2XKKA 5JAZA 2LCQA 5L3ZA 1KBZA 3OPYI 4ZDWA 2JFXA 4EY8A 3I42A 4B8ZA 1E60A 3DMFA 4DN6A 2UUOA 4R2IA 4AIIA 4JP8A 3FUXA 3C6XA 3EODA 3BWBA 3M83A 1BCRB 4ZVMA 3AERB 3DHWC 3O8OB 3UV6A 3N53A 2CKDA 5GGYA 5EHXA 3RLIA 1SMKA 2EDCA 4N4AA 1NMSA 4C2UA 4F9FA 5D85A 4HFJA 3ZUPA 1EGHA 3KSBC 1E1DA 2E4WA 1WKCA 4KGZA 5B1EA 1ORHA 2XYGA 3JARA 1PFYA 4ADSG 3AI2A 2AEEA 2HCJB 3O93A 3QVVA 3KJHA 4ZDIA 1G16A 2OAP1 3G2NA 3TRHA 2UUAB 3D3NA 4XAQA 2I2XB 4DARA 4X66B 4NVRA 2D13A 1E89A 1VMIA 1IY1A 3HB7A 3AZOA 3QLJA 3SC2B 4AL4A 1PL7A 4MOWA 1A97A 1AOXA 4DCGA 2O19A 2DSNA 3N6VA 4DCPA 2P9TA 1NQAO 1V11A 3PJEA 4AZ0A 4RPJA 3OLZA 5SZIA 1KJ8A 3RIMA 1GYPA 3WGLA 1EZ4A 1M2VB 4NARA 3AHJA 4F3CA 2N42A 3IESA 4FKZA 3HY4A 1X7YB 2B0CA 4TKZA 4XA8A 5BN3B 1RCUA 4MAFA 5HZHA 3U61B 3KLOA 1Q1AA 4HTFB 1ULHA 4UATA 5C8XA 4W1RA 4Q3LA 1O4WA 2JJMA 4IIBA 3UJCA 1NI4A 3EXIB 2WE7A 3OQBA 5JCJD 4B5KA 4W5TA 3MPUA 4HKTA 2J59A 4MINA 1TO2E 4BGUA 3ZE7A 1M2OA 2X9NA 3FSRA 1HO3A 2AFHA 4WERA 5K9ZA 5DTJA 1TYDE 2F8SA 1T13A 4QYIB 4M36A 4PN7A 2VPXA 4DV6B 4WCFA 2X3FA 2DULA 1JXMA 1SB9A 1VBFA 3L92A 4XPZA 1FTNA 5GOTA 3OIVA 4NQRA 4GDFA 2HIHA 3EZFA 4CCYB 3KG2A 2H2AA 3B1XA 5JNWA 4I1UA 5FUBA 1XG5A 1RJGA 4O59O 3P9CA 2YASA 4UU0A 4C4TA 4ITUA 1FMJA 4PRZA 4EA9A 2P9HA 3QMWA 2PLFA 4CODB 3ZHOA 3NHZA 4GPBA 4BLTA 2P7HA 4QIHA 5ILOA 1U1FA 4XGQA 4WX2B 1SJ9A 1NGSA 2CHUA 4EGAA 2ZYDA 1EJ0A 4NABA 2IYYA 1XQ9A 2GEKA 1GNLA 2QJRA 1L7AA 2R2AA 3BN3A 4HNSA 4LOLA 5FOSA 3RG2A 3RSGA 2MCFA 3TGPA 2VQFB 4BPRA 3G5MA 3SU8A 4LK2A 1C41A 3E81A 4G41A 3AVPA 2H1HA 5ED4A 1GEGA 1PLJA 5EE3A 1OH8A 1XP5A 4OGWA 4JP3A 2O3RA 1NR7A 1PV2A 4P3PA 5BN5A 5JU6A 2PUGA 1TQ6A 3IUYA 5IK2D 3PGJA 4OFBA 3CPJB 4Q7JB 4M1TA 4OX9B 3OZIA 2IBSA 3U13A 1JWBB 2XMDA 3E9NA 3L04A 4BFCA 1F8YA 2YBEA 1WL8A 4Q4HA 1Q0TA 3EDQA 4BMDA 3PUIA 1SOMA 4Q7EA 4X61A 3RFVA 4G1FA 4IUYA 4PSUA 1QG4A 1XQWA 1G6OA 2FK7A 2IU3A 3AP3A 5DHRA 5C8VA 3R4CA 3TSWA 2CJWA 4PLFA 1AKVA 3C3BA 4BFTA 3HCAA 1M73E 2P6UA 1E6WA 3A9VA 2BMWA 3WHIA 5KKCA 4HWKA 3SSOA 2RH5A 3EVCA 3S4YA 2PZKA 5LOVF 5IBCA 3ZE0B 2F43B 1FDUA 5L51A 1DZ3A 2GHIA 3FB4A 5DHSA 3WLHA 5IYZF 1EFRA 3W6OA 1V16A 1XAIA 3CW8X 4HTAA 2FDCA 1V43A 4P4UA 1NMZA 4BN0A 4B4VA 4GT1A 1WHSB 3RARA 1LS1A 3U3OA 1Q44A 3KZ1E 4FOSA 4Y2JA 3DZFA 5AXDA 1NY5A 3L3BA 3LUDA 4DJFC 3GLTA 3S28A 5MFZA 4WMLA 1QIGA 1QPGA 3CEJA 1PYOA 3Q3IA 1E2PA 3GARA 4G37A 1QOPB 2JJ2D 2Q3BA 5CITA 2DWUA 2QLFA 1F7UA 2X9LA 5J4HA 1XTVA 4QEDA 2R6R1 4C6TB 4Y2SA 2NYUA 4X1YB 3UKOA 4HN4B 1QHEA 3H4MA 3UJ7A 4Y6PA 1E79A 1B0UA 2Z95A 1KI8A 2ZTVA 3QKSA 2PH1A 2YX1A 2GETA 1LD3A 3UQYS 4QOJA 2RBKA 5DBHX 1EI9A 1L5FA 1ML3A 2VPYA 1R4MB 1CS0B 2B1GA 5E6UB 1LBHA 1KJZA 4NOLA 4HRXA 2CV1A 5KJ6A 4XLTA 4ZZ0A 3GMSA 5JDCA 3EA0A 2VAWA 1A8QA 3EMDA 3L8DA 1CX9B 3K1TA 4JLVA 1CUIA 4ZQFA 4ZHQA 1DMSA 3ZV7A 5FPQA 3EPJA 2OV8A 3HKDB 3TK1A 1OV4A 4F45A 1LJUA 1NXTA 3FMPB 3V2GA 1C7FA 2NQ2C 5CLGA 5ALZA 4KP7A 3A05A 5EAIA 2PH7A 1KJYA 3EMBA 3HA7A 3IAHA 4FSDA 2FF7A 3AUAA 1ZFNA 3OG9A 1OXMA 3RTCA 1OKKD 3GCXA 1GDDA 1FFEA 1NULA 3NP7A 4LRWA 4ZEWA 1L3BA 3ZNNA 2AX4A 3GJSA 3FN4A 4FXOA 5IXYA 3B2QA 3ZKAA 1VFNA 4QU0A 2QYSA 4MVJM 2R7NA 4WOJA 1DMRA 2GYYA 1QO7A 2HOQA 4YMUA 5JROA 4NNJA 4EECA 1ARZA 1KL7A 2O3SA 4DDMA 4A15A 3CNQS 1LBQA 3KUCA 4P93A 2H6EA 5SYNA 1P2GA 3D6JA 1JALA 1UXJA 4M4SA 4JJAA 1IRIA 5K09A 3GZTB 1R37A 2A9VA 3A6EA 2PLRA 2R1TA 2HU8A 1CDZA 1UZNA 3E5MA 3LKZA 3KR2A 1GQFA 3PXUA 2I4LA 5J40A 4Q3CA 3SE7A 3TPZA 2J33A 2QRVB 2RKBA 2AKYA 2XVXA 1IUKA 2ZE8A 4HY3A 1EK5A 1A2QA 3UO8B 2QRJA 2PE5A 4PO9A 4MGEA 4RNCA 1ZIYA 1L7XA 1EK0A 2H4JA 3WRXC 5AKJA 1J0EA 3I3OA 2QLTA 5GZ6A 1E18A 1Y80A 3DUFB 3OTQA 1T2UA 3UB2A 1Z4IA 5CHEA 2QRPA 2YJ3A 5CT9A 3C4VA 1U8AA 3UV7A 3IQXA 2QAGA 1ZMTA 4INJA 4P84A 5FUVA 1WU7A 4B4UA 4DQUA 3MJCA 2B36A 3PU6A 2QSUA 3UMCA 1XL1A 5CK4A 5KAPA 4C0LA 1B6RA 5I5EA 3CYFA 1FX0B 4IKEA 4JLMA 3PC8A 3QJ5A 4AJ4A 2I78A 2VTKA 4TS3A 1LTHR 2GLTA 4DR5B 5DNDA 1KP3A 2XYQA 4DUGD 1CZHA 2AEJA 2P4EA 3H5WA 3T9FA 1O7JA 3NNSA 3ASUA 3OEED 4BVAA 4E5NA 4RVUA 1YR2A 4WKOA 5D1HA 5K51A 4F96A 1VOTA 5LXTF 5I9MA 2ONJA 1I0ZA 4NU0A 4LS3A 3T1VA 3HDHA 1C50A 3AR9A 1KDZA 3IVMA 1A7UA 1AKYA 2Q3CA 4MA4A 4FBGA 2YHAA 4DSUA 1K89A 1Y1LA 1S7GA 3ZVKA 1TZCA 4TTQA 4GC9A 3VSBA 5FPTA 1L6IA 3AJ8A 1OLUB 3IDFA 1XR3A 3C5WP 3E1SA 5EJ8A 4FB5A 2MOKA 3I4CA 4IDFA 3FMVA 1QOQB 1HE1C 3PHLA 2D3TA 3UHOA 2UXCB 4IIVA 2A9RA 2C0CA 3DXYA 5FI1B 3I01M 4JA0A 3S7TA 1TUBA 2C78A 4W5RA 1JHVA 3W34A 1FTGA 2IY8A 1DBRA 2HMWA 4WPGA 1TIKA 4QHYA 3CLSD 1FYWA 5FTJA 4C7MA 4MRAA 3JYQA 3T0GA 3A6PC 2VHYA 1PJSA 1UFRA 4QJ5A 2B35A 3JALA 1T5DX 2J9YB 1IOZA 1RZRA 3DWGA 2OHFA 4G2TA 3RB8A 4TT3A 2J07A 2ATCA 2V7VA 3TTVA 3GLRA 3QOWA 2HU5A 2X0DA 2FW1A 2O8CB 1QS0B 2YXLA 2J6IA 5FYDA 3VAYA 1U7UA 3BMXA 1KVRA 3FBWA 2CGEA 3H6HA 5FI5A 2JATA 1JBEA 4ZYVA 3ZWMA 1HE4A 5KVAA 2VAXA 1UT6A 1RBYA 1QWSA 2D8AA 5TQJA 3SYTA 5EHNA 1AKNA 2ZBQA 2D0OB 3B53X 1PQWA 3OD1A 1ZONA 1U8TA 1C1XB 4KZKA 3RTDA 4GI2A 1XRNA 3TQHA 3U48A 3WK9A 1UZMA 3ZXXA 2AKEA 4AN4A 2FG6C 1F3OA 2QL9A 2XUIA 4I2NA 1T24A 2XF2A 5G0TA 1I1NA 3EDMA 4BKMA 1HDOA 2D8MA 5LIRA 4I1RA 3PUWA 3Q11A 1MF7A 5KREA 3VRHA 2KBFA 1CJVC 4ETNA 3V4RA 4OA5A 1YKGA 3TRDA 2HA3A 2XRFA 4M1YA 1PP4A 5J2TB 2HC9A 4YB8A 2WU3A 4CR8A 5HJ5A 5AVWA 1NC3A 3CNLA 4H31A 4Z4CA 3N8GA 1LBTA 3T1QA 1WUKS 4XGNA 3REFA 1QHSA 3BB3A 621PA 2PBFA 4BDSA 5L45A 2HDHA 1X38A 1O8BA 1K92A 3E7WA 3MSXA 3P2IA 1YOVA 1JT2A 1IHPA 4XWYA 3GJZA 4HB0A 1GKYA 1DQYA 1L8XA 2A3NA 5AHOA 1RP1A 4P7FA 2G8LA 5E7IA 5IARA 1VI6A 1Z0IA 3LX6A 5WRFA 1J06A 3CLHA 3CUWA 3KYBA 3OE7A 3P9KA 4RLHA 1MT0A 2BEVB 3FPBA 4I8IA 1UPXA 3AEUB 4Z1MA 1ZN2A 4Z5XA 1X7ZA 1ZC3A 3E9RA 2AWNA 2A9PA 2Y1DA 5JSKA 5HIMA 5HS4A 2BTQB 3JAWB 3EWSA 4UBOA 5I5GA 4D4LA 2EZUA 4A3SA 1N6KA 2FHSA 2FWMX 4PPYA 3WRVA 3DBOB 3GEGA 2YIDA 4QGHA 2JRLA 1FK8A 3P9XA 1KRWA 6YASA 1ZOLA 2JEZA 3IO3A 1JPJA 2ACVA 3OQ1A 2ZUTA 2BYTA 1P4JA 2VJYA 2Y1KA 3K9GA 3OCXA 4WZAE 4X97A 2M6LA 5BWOA 1A4RA 2GNPA 2PU7A 4TYMA 2AUNA 1SGWA 1IN8A 1QYWA 3P9NA 1NXQA 4HZGA 1FFBA 4QOIA 5AKIA 3TG2A 2ACWA 3B9PA 3R7BA 1XMOB 4L9SA 1QCCA 4U6SA 3GEPA 1P3JA 3KHTA 1O5IA 1TM4E 2AHRA 3BM5A 1J00A 5CX1B 3SHVA 2OZLA 3MXOA 3QV1A 5HBGA 1MD9A 2HBQA 4RVGA 1XTTA 3BJMA 4WFQA 3AILA 2IHJA 1BEEA 2WSSA 1ZWLA 2I4RA 2X5JO 2J41A 3ONWA 4ZCPA 1XPOA 4LF4B 5DLYA 5MN6A 1MQAA 4YXWD 3TTSA 5LJIA 1P17A 1YS1X 5ESRA 3VDRA 1RM0A 3RYCB 4NOMA 2FR1A 4ZTBA 1KA9H 4P6VF 2BCGY 2P9GA 3V33A 1ZVVA 4YC7A 2J30A 3V3KA 4YASA 1P1KA 2JIMA 1M72A 1V8OA 4YHBA 2VT3A 1S8OA 3EFBA 3RTAA 2V54A 1J9EA 1CVIA 3CFYA 1KO1A 1N6IA 2NSJA 2RAUA 3Q0EA 4N01A 4KLRA 3C3KA 3SDSA 3ZZ0A 1R9GA 3OQ6A 4MO9A 4WECA 4XH9B 2R5NA 2FB9A 1EB8A 4NLLA 1DKQA 2A9FA 3Q7EA 5DM0A 4N6GA 3NMUF 1LDBA 2QUHA 1VIMA 3NPAA 1Z2AA 3CX7A 1GXSB 2IYVA 4BNLA 5IG2A 2V7TA 4LI3X 1KOJA 5JEEA 3PGXA 1GOTA 4UCXA 4HDRA 5ES3A 3FFWA 1ICIA 4PLVA 3K16A 3DZDA 3ZHUA 1DL5A 3VOBA 2JIPA 4YDSA 4ARSA 2AR7A 4BLSA 1K8ZB 1OBCA 4H3KB 4QT0A 1RPZA 4DQLA 2RKOA 1RQRA 2ZROA 3INTA 5JAHA 2Q1YA 3D43A 4KDCA 1FXUA 1VJGA 1S2IA 2GXAA 1NLZA 1X1DA 4LJ8A 4ASUA 4DLVA 4FJ0A 3TLGB 4MWCA 4M1MA 5EUMA 4AF8A 3SXUB 3GLSA 3OQIA 1O95A 3P94A 4QKQA 4RULA 3U19A 3CNOA 4NDZA 2VL7A 1FFCA 4PXAA 3RV4A 4B3FX 3BRCA 4CIAA 1A5SB 4WDRA 1SOVA 3F6EX 1O8CA 2SCUA 4Z9YA 4N82A 3DBLA 3M0EA 2BEUA 1E4EB 4W6ZA 1CJBA 3L01A 2DUWA 4CMHA 1R64A 5KQRA 4D56A 1FFGA 2C5SA 1XWFA 3QQPA 2XMGA 4FC6A 4R71A 2XQKA 1TZMA 2ZRDA 5C31A 5FUQA 2Z30A 3DZCA 2AK3A 3L7NA 1N1DA 3WX0A 1NVGA 1YIAA 3AJAA 3BE5A 3ZU3A 4ZEMA 4U2CA 4N9QA 5TGTA 5SY4A 4KXWA 3FF1A 1Z12A 1N8KA 3IMGA 5BT9A 4B6EA 2QRQA 1J2RA 1JEDA 4EPVA 1I6KA 2WHQA 3NIWA 4CTJA 1VKOA 2CZGA 5BUQA 5BN4B 3IQEA 3WXBA 3TQQA 1WEKA 4HB4A 5I4BA 5KYGA 2DOKA 2PIDA 1JDBB 1PNTA 2OWDA 3RUEA 4P22A 1XE3A 3GX1A 3MYYA 4ZJZA 3ZV4A 1L4HA 1GGNA 4LEIA 3RK0A 5IEJA 5L3SA 3RAFC 2VJPA 1SKYB 1XEWX 3FLBA 2ZIEA 1CNFA 2ANCA 2V5UA 5AOVA 5E9JA 4DOMA 3MBKA 3QFFA 1ZHFA 1JMVA 2JFWA 3KWLA 2BDEA 1OBHA 2YWCA 3LFTA 2XTZA 1RSZA 3LQRA 4K6GA 4KAFA 4YMTA 5EJ9A 4KGDA 3U60B 3FCCA 2HMTA 3A2MA 3KZVA 4RZXA 4IH4A 2JFFA 3PT9A 1U8YA 3EOAI 1XCBA 1W88B 1IUNA 2ZREA 3IT0A 4J8PA 3WB0A 4A10A 3F4LA 4UVGA 2FSPA 1OLSB 2C20A 4DQDA 5BYAA 1XDUA 2EG9A 2FVYA 1XZIA 2C92A 1QH1A 2B4KA 1P8AA 4R68A 2GX6A 3D4LA 2WFLA 3U62A 2ZSEA 2EW8A 1IZZA 3MTIA 4IIXA 4ALNA 5I01A 4GEGA 2ZDQA 4X20B 4ZYUA 2F1IA 3Q3EA 3GPCA 2I3AA 2RAFA 3VTZA 4YCBA 3NUGA 4JU8A 3IDZA 1RD4A 3DE3X 4WH0A 4L0QA 1EWQA 2GKSA 1KBOA 2XZLA 4NMHA 1CHDA 4NH4A 2PZAA 4L08A 2MWMA 3GUVA 5TVKA 4TYNA 2HM7A 4OGFA 4KAJA 2XAAA 2OQ2A 4PYLA 4NXNB 2OBNA 3MBIA 1WMEA 1SHUX 1W88A 4U3JB 3K0EA 2EZ8A 1NL3A 2BH9A 3PXBA 4FHFA 1QHNA 4ZU6X 4OFXA 4KO4S 3U39A 3ACDA 2ZSJA 3MS4A 3QBTA 3W5SA 3ZGLA 3IAM1 4ZT7A 4LK3A 3T38A 3UJAA 4DY4A 2AN3A 2QTHA 2V6BA 3OP4A 4RY8A 1G64A 1HC7A 5E7MA 1HE5A 4CLHA 2WG0A 1JIVA 1W36D 4OQDA 1AE1A 1DEKA 4IEEA 3R8XA 4LTDA 1SA0A 3E15A 2NTNA 4B32A 2QAGC 1IJKA 2M1XA 3N1UA 4RJKA 1XRRA 3C39A 1NRJB 4R7ZA 1NXOA 1UBJS 4KFTA 4UQOA 2HWYA 3SNKA 3R4VA 1MPTA 2IDMA 4PFJA 4IF6A 4EENA 2IXGA 4BAGA 4ZGBA 1FEZA 4S05A 4WNAB 3WGOA 1NM5A 3W6UA 4RTJA 5H0IA 1KXJA 4OXXA 2IXBA 4RBNA 3AR5A 4N0QA 4L27A 4CDNA 4XDHA 2B82A 4YAFA 4DTIA 2I2DA 4Y2RA 1N8NA 3DP9A 4KPUA 3ELWA 3SBXA 3LAWA 4TVOA 1JPNA 5HTKA 1LLQA 2FPRA 3B3FA 1XFAA 4Q3DA 3EZ2A 3A3OA 1LCIA 4K6FA 2Q45A 2O2CA 2PD4A 1YQDA 1DLJA 3BGVA 1PGNA 1X3SA 1H9AA 3L93A 1BC5A 3BSFA 4RXUA 3AGQA 3VR5H 5J4YA 4JQYA 4MQMA 2FEPA 1KZ6A 4C6SA 3KSZO 3UJ6A 4W5JA 3OQNA 2O0HA 1E64A 2BZGA 2I7XA 4POOA 3A04A 5IASA 5IVPA 3H2SA 1AHNA 1U3CA 5DRTA 4ML3A 4Z4IA 1LW7A 2J0EA 2WR8A 3C3JA 1SXJE 5CLLA 5ALQA 5CBKA 1M6YA 5CFPA 1NNUA 3UG7A 1HFWA 3FF4A 2C54A 1WWKA 3LBYA 4NCIA 1JJIA 4GSKA 4DLSA 4HX5A 5B2FA 4UU8A 4MA5A 1HLPA 2DQ4A 3C3YA 4WJLA 1WB9A 4ZD6A 4NFYA 3RUIA 3OZGA 1FDSA 1CP3A 1RAAA 3CCFA 2PGNA 1CBUA 1VPWA 2Q1SA 1M76A 1KFKB 3CY6A 4NL4H 2GCOA 1KORA 4U00A 4HEJA 2I33A 2XWJI 3KSAC 4I9HA 2B83A 1UOEA 2YVAA 5JYBA 1WMSA 3TL6A 1FMFA 2XJ9A 4O4IA 2HRZA 3S6JA 3ENNA 1M83A 2OD7A 3MD9A 2FQYA 3VX4A 4OM7A 1T2CA 4KMOA 2XECA 3JZDA 2VZ8A 2P2CA 2G72A 4TZKA 2J09A 3HRIA 1T3SA 4Q9AA 2BC9A 3T9EA 4MRRA 1AZTA 3IVXA 3N9IA 4NJMB 3VPCA 3L1HA 1OYVA 4BUJA 2YKGA 3ASZA 2CNKA 2QUZA 2AF3C 4DPMA 3GAZA 2BJVA 3ESAA 2X0RA 1OLOA 1UXHA 1GLVA 4XASA 1M1UA 1TVEA 5J1TB 2A0UA 2QHXA 1Q6YA 3MT7A 3EPHA 1SUEA 4BQEA 3ELYA 4O2BA 1O3YA 2BTEA 3AVVA 3M3PA 1E2QA 2OXIA 5MN5A 3KKMA 4F4DA 3WQHA 1GVHA 3UWSA 3INRA 1HNNA 2WTAA 4GYWA 2HT1A 4OHWA 1CKEA 3E5HA 1V5IA 1ZWKA 1FFAA 1U2QA 3CPHA 4HFMA 4OY3A 5I7WA 5KNBA 5LUAA 3AIIA 3PA8A 4TVSA 2CNWA 3IBFA 1BX1A 1OWPA 2ODTX 3VDQA 2LDBA 4OLBA 5EC8A 4E03A 4BC1A 1DAOA 3OKFA 4QU8A 4C0JA 2NP7A 3QA3E 3DQPA 3G02A 4E30A 2R1VB 3MCTA 5KNCD 2UZ4A 2I6GA 1K0FA 1VRWA 5DTRA 5JR3A 4F38A 1SKQA 3AM4A 1G8GA 1QC5B 4IDBA 4JH0A 4AXXA 3PHBE 3WLQA 3DXZA 4EATA 4N65A 4M8IA 1ETUA 1H0KA 1JQJC 3UK2A 5K01A 3HYSA 4OO3A 1P8JA 2AJLI 3AR6A 5C1IA 3CCBA 5T4EA 4QLAA 3U9SA 2C99A 4YY3B 4KPYA 4J0QA 2JGKA 4RIEA 4ROTA 3WGJA 5GTDA 1HL3A 1K8QA 2PS3A 1C14A 3M2TA 4GS5A 3Q40A 2XUPA 3ZPXA 3MHPA 1YZUA 2OCBA 3KKLA 3TEJA 3PIRA 3ROMA 4GG1A 3T3PB 2VSFA 3UGJA 3GYGA 5FBHA 4WCVA 1M0WA 4JQSA 2AOVA 3GFRA 2D2VA 3KXDA 2QMHA 4MVXA 3H19A 5EIOA 3PTAA 1EDEA 1KE1A 3AL0C 3HA2A 2Z1NA 4IMRA 1KI4A 4YT2A 2YNMA 4IQGA 4MWBA 4R98A 4LYDA 1WAMA 2YQ5A 4G56A 1XA3A 1YRAA 4RCVA 4CCAA 3F6SA 4KVFA 5AQ1A 5BWCA 3ESDA 2O8BB 1RADA 4L8VA 4XQ0A 4ASUD 5DX1A 2GEBA 2ZXEA 4PU0A 1L1QA 3OZCA 4JASB 1Y4SA 1GGVA 5TGDA 3GP8A 1GRNA 1S02A 3N8KA 1W4CA 1OLXB 3K0CC 2YV1A 2E37A 3A3PA 4FZRA 3O73A 3AU9A 4YWJA 1L5ZA 3B9BA 4Y2GA 1KMMA 3G2OA 4N18A 5F7XA 2ZR8A 1G41A 3IQHX 1HL7A 2IHVA 1K5HA 4UE3S 4G4JA 4K9OA 4KWEA 5F76A 2OYRA 4EHJA 3GLGB 3BRWA 4PG6A 4YPFA 5KSZA 4FNAA 4C0AC 5FTLA 1CUYA 1X94A 2HF8A 3NO4A 2BRUC 4JSRA 3E0XA 4D4IA 4ZVSA 1PWHA 3GLIE 6Q21A 1CQIB 1MO4A 2AG0A 5G1OA 1VE9A 3JYHA 4DMFA 2EP5A 4AWXA 2WUFA 1Z5WA 2DEUA 1YE8A 1WMBA 1C1DB 2AX3A 1TTQB 2IX3A 1DJQA 4KX5A 1EFLA 3NXKA 1XSEA 3PKIA 4OHRA 2HDNB 2JD1A 3GJQA 1UQRA 4HWGA 4PHGA 2RI1A 1P5ZB 3PD0A 1Q91A 4FW8A 2BFMA 4X1IB 5C52B 3OCZA 3FETA 4OP2A 5ARDA 1N5KA 2P40A 3GPBA 3Q3CA 4QA9A 1J0XO 2PMFA 1LNZA 5IM4A 2IC5A 3UJ3X 1N2SA 2XUZA 1OZAA 4HLUA 3UENA 1EJ2A 2JEYA 1K7SN 2WWWA 2R1VA 4M46A 3B6ZA 4WA7A 1OI7A 2NV6A 3S8EA 1EMDA 1FSGA 4GICA 3DDUA 1QTNA 4BEBA 3TH5A 4EKEA 1HTTA 4ARZA 3AP1A 3EVAA 2IQ5A 4R5MA 1UPBA 4DV4B 2WOJA 3H18A 4F11A 5I9TA 4OK5A 1G18A 3STXA 3UK1A 1RACA 1HDGO 1N5OX 1IOVA 1ZRMA 2DLDA 2CT8A 1T1GA 5I9NA 1N92A 4JJ8A 4D74A 2X0KA 2WUWE 2OB2A 1NDQA 2YWJA 3FFTA 4RK4A 4NU8X 1TK9A 3LGAA 4M0LA 2ZITA 3IKLA 2C9CA 4MV5A 5EKTA 1M1YB 3BHJA 4BP8A 4RU1A 4D4JA 1MW9X 2B6NA 1QP8A 3WYFA 4CLOB 3D3KA 2CXHA 1UFOA 5F64A 1EGQA 4ZVPA 4ARZB 3IBCA 4E6PA 1ISFA 3N8HA 3VJLA 2Z9BA 1ULZA 5IJXA 1E2IA 2YXPX 4Z1MD 1GWNA 1S6YA 5KTKA 1NJ6A 5CNKA 1OLXA 2WZQA 1OTYA 1NJFA 2J6CA 3PVCA 4HDKB 4M1ZA 2JJ1A 5D86A 1DAFA 4DLKA 2IJGX 3N70A 4JK3A 4J2OA 4DLXA 3FBGA 4WUVA 4YJGB 4YYEA 5IU6A 4LOJA 5IWCA 1UOPA 1PJ3A 2PKXA 4L8WB 4KR9A 5B55A 1KOLA 3ZDBA 1JIXA 1I80A 1YDWA 1R4NB 3ECCA 4K3VA 4L5AA 421PA 1RLJA 1K6IA 3DAHA 3OD5A 1PDOA 4B6FA 3UKJA 1ZJ5A 3D31A 1OMOA 4OG2A 4QFCA 5K0FA 1VA4A 1XCLA 2A4MA 2VUIB 2ZI3A 5GJCA 1KY2A 1BEZA 5HIJA 1ADYA 4IMJB 5HKBA 3NWJA 1KJWA 3UWDA 3ZTWA 3BWEA 4QTZA 3IMFA 4KH0A 4IZIA 2BKAA 1RIFA 4P0PB 5EQFA 2QORA 3K71B 1VBKA 4ND8A 4K9KA 3EY9A 4WOPA 4BQFA 3KNZA 1B8UA 4YJ3A 2OORC 4YBRA 3T0FA 4NE2A 1L1FA 5D7NA 1NU6A 1AB5A 2VUSA 1Y1SA 1RJWA 2FXVA 1V47A 3B6IA 2PFSA 4KQ9A 3EZ9A 4PY2A 4JSTA 1PI3A 2WOOA 4UU1A 3EDOA 4MW0A 4CLEA 4EB8A 4EPYA 1U1DA 2OVFA 5TMDA 4AXBA 2LE0A 5CCXA 2NAFA 2R44A 3VNBA 1TT7A 1OGIA 3QJYA 2RJNA 1FNCA 4L4RA 4IDAA 1J7KA 2G4LA 1KC1A 5JDIA 2B92A 1XWWA 1G9XA 1QV6A 1RPTA 4DABA 4IIHA 3O5AA 5D01A 4DIMA 4EAQA 3GJ5A 4F1WA 3AHGA 2O8BA 5FOWA 2BSXA 1DJPA 2BHTA 2J3JA 2ZYWX 1XD8A 1CSEE 2OQIA 1K86A 3SHQA 4RWEA 3KWJA 3L0BA 2F3UA 4OHZA 3PS9A 4R54A 4S12A 4YT8A 2ZUBA 3MNFA 2NSYA 3H04A 4IILA 3H9QA 3KYDA 3ZU2A 3LWNA 4C3VA 3IC5A 3RJTA 1TZKA 4LZJA 1CG6A 2CLSA 1GFWA 1R6TA 2NXJA 2PO7A 3BICA 3G2IA 1JMYA 1N3IA 4KN6A 5EP2A 5JALA 3OO1A 3I6YA 1G7SA 1ZS9A 5G0SA 2HQBA 1DWPA 1E77A 2P4SA 3KQTA 3IS3A 4EQZA 1U1IA 3SMVA 1YF3A 1FFXB 6REQA 4A91A 2QSYA 2RGAA 2BBOA 3U1BA 1DIAA 3I09A 1SWWA 2COKA 3WFJA 2B5WA 1N33B 5IC6A 5HK9A 4PFQA 5LUBA 2B7CA 3JALB 1RE1A 4BMPB 5DN9A 4WACA 5T3UA 1QYXA 1DTSA 1MLDA 1WTCA 2BH2A 2ZM5A 5AJZA 3KM0A 5GMOA 2FX5A 1YJAA 3Q3GE 3Q88A 4BO2A 4LHSA 4HH3C 5IRCD 1Q7BA 1SBCA 1ZOOA 3D5EA 4X8LA 4C2TA 1D2GA 2WD8A 2GTHA 4OH7A 3R7LA 4O2AB 1JHAA 5K4HA 3LDUA 1MPXA 5FEMA 3ET5A 5DHUA 4MV6A 3ZCQA 2C96A 2W0MA 2UZ1B 4M1KA 4FNOA 4RTLA 1VIDA 1PG2A 3B36A 4TXNA 2Z8YA 3JZIA 3CWQA 5A6SA 2WPDA 3P8ZA 2W6MA 1F14A 3H5IA 3DKPA 3RBZA 5BT8A 1O95C 1R4NA 2CUTA 2SKDA 2FQ1A 3AP2A 2Q3JA 3E03A 4MCIA 1H4TA 1PD0A 1U0HC 4OIFA 1FZQA 2G8NA 3OTIA 2A58A 5E4FA 5HKAA 1EXVA 2C2KA 3TXAA 1RKVA 2J0UA 4DJAA 5F5NA 5FBWB 2CHEA 1UC5B 2R96A 2CCGA 2ONKA 2OCIA 2GJ4A 1VB3A 1QBGA 1U28C 2X42A 5EJFA 5IXJA 2ES4A 2X86A 3C2QA 1C0LA 3QEJA 4JQCA 3UT5A 4DA7A 3AV3A 1F7VA 4AJNA 2YWDA 1RRMA 2BAGA 1L5GB 3MMXA 3UOAB 5EJ5A 5JMTA 4Y9UA 1HT3A 3EFEA 1TYAE 1FQWA 1TX4B 4HCJA 3I9FA 4YNBA 2WT8A 3RSCA 3NVDA 4RJIA 3TSYA 3VZCA 5LQDA 5TS2A 3L1KA 1VJCA 2NU8A 2R4QA 3RYIA 5AVVA 1ZOPA 3S55A 2NNWB 5AM4A 1P6UA 1HDIA 1YE3A 2APJA 2GTIA 3EGIA 1YZQA 4BCBA 2FUCA 1U2RA 1QH0A 2Q5JA 3QTTA 4QYWA 4MEJA 2ECOA 3N0TA 3BSYA 1Z4OA 4YCLA 4YECA 4BJ5A 1NXXA 1TEVA 2JJ1D 1N2EA 1G5HA 3WBKA 4TM8A 4BMOB 3UPDA 4PBTA 1SCQA 2PD3A 4LOHA 3CLRC 3NALA 2A7QA 4MTLA 3WC4A 1Q2XA 3QY9A 4KV9A 1EXNA 1TM5E 3ROZA 5CLHA 4JJ7A 2OKGA 3H7IA 1NATA 1KVQA 2BL4A 3OPXA 4LX0A 4HYQA 3P9YA 4OYYA 4DQ0A 3FPCA 5CJ2A 1PZGA 1XD9A 4MYHA 1FZTA 2Y66A 2WTXA 3QPBA 4HT3B 2CY0A 3S0JA 1QJCA 1S8NA 3AC0A 3RH0A 2ISCA 2VTDA 3F8SA 3LQ1A 5K0ZA 3A31A 2IXFA 4K86A 2FZKA 3MRTA 1IOLA 2B99A 1QV7A 4QXOA 1X8XA 4UMFA 5A0TA 2QL5A 1NSTA 3LCCA 4L4SA 1EFUA 1JA1A 3X1DA 1G8JA 2XBLA 1SVIA 4QHTA 4CF5A 5BMVB 4U7WA 3SZ3A 5A05A 4E21A 2V65A 4U7DA 3N2LA 3OZAA 4IOKA 3COZA 3IAEA 5AXBA 3OQPA 4U6NA 4C01A 3PITA 4LFBB 3A8TA 3L7AA 3PD7A 1EFCA 1NNI1 1P7CA 3LL4A 4OEHA 3TCKA 3UUGA 1UC9A 1UM8A 5CT6A 3V8MA 1X7XA 4F56A 1BKSB 2VPWA 2HLDA 2XCLA 3PFKA 1O4VA 2XWPA 3A4NA 4JT2A 1EWKA 2VDPB 1L5MA 5JBNA 1XKTA 5LXTB 1WQ3A 3CVWA 3BS4A 4L8LA 4KC0A 3OX3A 5EEGA 3VKFA 3QXJA 4ESEA 2GF9A 2PWZA 5D5QA 3TSZA 1HQKA 5JSYA 4BMXA 1UKYA 5BURA 4XIFA 1E9VA 4WNCA 2W6NA 4AKEA 4YUZA 5YASA 3MS7A 5LYJF 3IVAA 1QFSA 3P0HA 1K3FA 3E9EA 1UK8A 3GFVA 1I24A 2AFHE 3AW8A 1U1EA 5LBIA 2M6KA 1Q74A 3LQKA 4MDYA 4LMRA 4IIDA 1OFIA 4JYZA 3TGLA 4HH0A 1NQUA 1C3JA 1MDBA 4OBEA 2YN4A 3PFWO 3R5KA 1C80A 4NBLA 4PGMA 3JRNA 3WXMA 3V7UA 2CDBA 4EYOA 2CCJA 1U7XA 3H5LA 3BBLA 4Y2VA 4CKCA 3K35A 2PQ2A 4ER7A 3WIBA 3GGGA 1TEHA 1MDFA 4R1QA 1LLCA 2GHRA 2QX4A 5F1YA 2BBWA 4YX9A 3JQ9A 1F1BA 5EGNA 3UTDA 3FCSB 1JL3A 2XCOA 3SG0A 5LP1A 1N6LA 4NWIA 5IZCA 4AMGA 1KI6B 1LPSA 3EG9A 2CXTA 5NLLA 1FSFA 3VBCA 4MUBA 1UJCA 1EK6A 3SZMA 3K30A 2BFDA 3WJAA 5JBQA 1US8B 1YS2X 2EQ5A 3E6AA 1MEJA 3MA0A 2ZXUA 5D5PA 3M6WA 3AKDA 4KQFA 2FP3A 4W9NC 1L5OA 2E48A 1WXHA 3GNQA 2WYUA 3HV2A 4KTTE 2FSFA 3RJZA 3ZEAA 4X91A 3WZ2A 3ZS9A 2P75A 4DAEA 5ANRB 2B34A 2GKOA 1JAXA 5HHTA 4FLMA 1QH8A 3R0JA 4QUAA 1SVUA 5LBTA 1IWPB 4B6RA 3D1LA 3E5RA 4LCEA 4YAEA 5IH3A 3WGUA 721PA 2VT6A 3LMKA 4K2HA 1WPXA 2WJJA 4P7KA 2G08A 1W2HA 1Z3IX 2D1SA 3CG4A 3LV8A 1U0GA 3OF5A 5DBFA 3DTYA 4ID3A 4ZALA 4PSVA 2OV6A 3U26A 1AUOA 1SU4A 4IIFA 4MQ4A 2XE7A 5SV2A 4AJKA 3ZHQA 3Q72A 3ZDDA 5JHGB 5LR6A 4DM3A 2E5WA 4IL5A 4UAJA 1P45A 2REOA 4F2GA 4B4DA 1OQAA 3GXOA 2FE1A 2I2AA 1OT3A 2IHZA 5AM3A 5CA1A 2OFFA 4JC8A 3E7FA 4ABYA 1P62B 2HJRA 3D8TA 2X14A 1I33A 5IJ9B 4PM4A 4R2KA 1HFEL 2EFJA 3PQ4A 5A5VA 3NNDA 3LHFA 1M34E 1Z0DA 3DC2A 4PX2A 5DK4A 4AZSA 1WQ1R 4MEBA 4CFYA 4JLAA 2X58A 1W4LA 4EW2A 4FQ7A 3TE6A 2HHHB 1E2DA 1SG6A 2HXYA 3UA4A 2HHCA 3A9UA 1YR9A 3KAJA 4W5WA