1LLOA

Hevamine a (a plant endochitinase/lysozyme) complexed with allosamidin
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
273
structure length
273
Chain Sequence
GGIAIYWGQNGNEGTLTQTCSTRKYSYVNIAFLNKFGNGQTPQINLAGHCNPAAGGCTIVSNGIRSCQIQGIKVMLSLGGGIGSYTLASQADAKNVADYLWNNFLGGKSSSRPLGDAVLDGIDFDIEHGSTLYWDDLARYLSAYSKQGKKVYLTAAPQCPFPDRYLGTALNTGLFDYVWVQFYNNPPCQYSSGNINNIINSWNRWTTSINAGKIFLGLPAAPEAAGSGYVPPDVLISRILPEIKKSPKYGGVMLWSKFYDDKNGYSSSILDSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stereochemistry of chitin hydrolysis by a plant chitinase/lysozyme and X-ray structure of a complex with allosamidin: evidence for substrate assisted catalysis.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords HEVAMINE
total genus 95
structure length 273
sequence length 273
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 1995-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 1lloA00
1HKKA 5CJ5A 3AMKA 1E3ZA 4D6DA 3VGBA 4GQRA 3SCUA 2WM0A 3OLIA 3B9DA 4P7LA 2XSBA 3W38A 3T2PA 1EDGA 1ISZA 4GZEA 2XVNA 3CTTA 4UZSA 3CZJA 1XYFA 5M17A 3WQ8A 1OT2A 1KB3A 1KGXA 4CUCA 5A1AA 4PTMA 4QP0A 3WQ5A 2HVMA 1HL9A 3J7HA 3RM4A 2BS9A 3WNLA 2WMGA 2EEXA 2PF0A 2WVSA 2J7BA 3ALFA 2CBJA 1J0ZA 3K46A 1CENA 1CECA 1JYVA 1XH2A 4PMDA 1PBGA 2JIEA 2VCAA 2J4GA 1VEPA 1CIUA 2DSKA 2J25A 3QOKA 4J7RA 4AEFA 4CCDA 1GPFA 3WF1A 1GCYA 1NARA 2EPKX 5IHRA 3BAYA 2GJRA 5CSYA 4WIWA 3CZ8A 1U30A 4PYSA 3VGGA 4UFKA 3PZGA 1V3LA 4U33A 3O9NA 2ZX9A 3CHFA 2JFEX 1QNPA 3GM8A 4PSRA 3RIKA 4HU0A 3OLDA 2PI6A 3OZPA 4D1JA 3GBDA 2CETA 4U5IA 1H11A 1UQYA 1JYWA 4ZEPA 2ZIDA 4M82A 4CN6A 1W9XA 1JYNA 4JKLA 3W24A 3KL3A 1US3A 3LPPA 3WBAA 1BG4A 1QNQA 1QNRA 4GI9A 1J01A 1DWFM 4UR9A 2V3EA 1VRXA 2YL8A 4QCEA 3ZT6A 4TUFA 2YIHA 2J62A 3PTKA 4AIOA 2Q8XA 1QI2A 2J7HA 3WH6A 2DIEA 3SCSA 1H49A 3AIRA 3WF3A 1QBBA 1SMAA 1W9BM 4J3WA 2WXDM 3U57A 2VR4A 3AMGA 1BG9A 3MKKA 3VMPA 3BAJA 2X1IA 1ZB5A 1EIBA 1CXHA 2QMJA 2QLYA 2ZICA 4UCFA 3AYRA 1JFXA 2YKKA 2NT0A 4QLKA 3OG2A 2WZIA 2X09A 4EANA 1EQCA 1CDGA 4R5EA 1E6ZA 2ZWYA 4TTUA 1UZ4A 2XJ7A 1RPKA 2E4TA 3N18A 2FGLA 1TVNA 3EMQA 2WWDA 4ATDA 2GDVA 4OKDA 3MUY1 4RE4A 2YLLA 3WDRA 1FOBA 3PZOA 3NIYA 2GDUA 1K9TA 1Y7VA 2BXYA 4Z2JA 3MSDA 5A3HA 1TR1A 3ZJKA 3KL0A 3AS0A 3D5HA 4N42A 5FIPA 3L4TA 2CITA 1KQYA 4JL1A 2BY3A 4Y7EA 5CGTA 3IK2A 4E4PA 2WB5A 3AMLA 4IISA 1TA3B 4AD1A 4JKMA 1EH9A 2BHYA 2CBIA 1QPKA 3B8SA 1GHSA 2WLYA 1TZ7A 4MB5A 2Z1SA 5LYRA 4P7QA 1KXVA 1HJXA 5A8OA 2XTKA 5A2BA 1NWTA 2GSJA 3CZGA 4CU8A 3GNOA 4J3SA 3VGFA 5CG0A 1JZ5A 2MANA 5HDRA 3ECQA 4BQ3A 8CGTA 5BRQA 5IFTA 1V03A 1HJWA 4MAVA 1OINA 1X1NA 4C7GA 3RDKA 4P8WA 2DQXA 3WELA 3CUHA 1UZ1A 4TTGA 2XM2A 3N1AA 5FL0A 4J28A 3WUFA 1JZ7A 5AC5A 5D9MA 2UY2A 4KRTA 4OOUA 3VO0A 1BYDA 4ML4A 3MANA 3O2LA 2D3LA 3ZT5A 4UFLA 5CQ1A 4S3JA 2E3ZA 5TD4A 3WNOA 1K9EA 1XD0A 1GNXA 4LXFA 4GPNA 3FY1A 2YJQA 1E5JA 3PZVA 4OUEA 2W92A 3AFBA 4QAWA 1GUVA 3VD5A 1IZKA 3WFLA 4AZCA 4W5UA 1W9UA 2J47A 1XCWA 3MV11 4UOJA 4H2CA 3CUIA 5KZ6A 2JIWA 2WHKA 3WDIA 3FN9A 3VNZA 2UY5A 2WSPA 4CD4A 1UD4A 5A95A 3GTNA 1BAGA 2ZUWA 3N17A 1WB0A 2Y24A 1LG1A 4H8VA 1AMYA 3F4VA 2VRJA 3K4DA 3WNPA 1F4AA 3VGEA 5IDIA 4D6IA 3CPUA 4HMEA 3RJYA 1VEOA 3UEQA 3BC9A 4Z2LA 2VVSA 1C3FA 2D20A 3DYPA 2WAGA 4KGJA 1HP4A 3ARYA 2BHUA 2GJPA 4W7UA 1NWSA 1SFSA 1P6WA 4PMVA 1XC6A 3K4AA 1JNEA 2XWDA 1SMDA 3WMSA 1OBAA 1HKIA 2WK2A 3W26A 3SUVA 2XVKA 5CSUA 2VRQA 2EPLX 1YHTA 5IHSA 5A6JA 3BMWA 1KR0A 1D2KA 3THCA 4L4PA 2CKSA 4QLJA 3FHQA 1E72M 1FA2A 1UR4A 4AZHA 5BYWA 1L0PA 3L4VA 5JBDA 2QV4A 3NDZA 1XSKA 4HPGA 2G3NA 2NW0A 1EHAA 3VX0A 1VIWA 1QNOA 3GNRA 3SUUA 1ISWA 1PX3A 3CHDA 2BY2A 2J78A 3OLEA 2F61A 5BXPA 1VB9A 1K9DA 4J3TA 3EDKA 3AI0A 4B16A 4RE2A 3AHXA 4PCSA 1EOMA 1KBKA 3VD3A 3BAKA 1EOKA 2RGLA 5DFAA 3ARQA 1J0IA 3CZKA 1GOWA 5A6KA 4GKLA 4BZYA 3ZSTA 1HF6A 4DUXA 4JFSA 5I5RA 1OCQA 4DWSD 3PZUA 5EB8A 3UESA 3GXMA 1QHPA 2J75A 2FGZA 3GBEA 3TP4A 4RL3A 1QHOA 1OD8A 2PWDA 3UETA 1OIFA 2XWEA 4J3VA 1ZJAA 3VDAA 2FHFA 1JIBA 4H7VA 1I75A 1DWIM 4IPLA 1DWJM 3W81A 4HA1A 2DT2A 2DEPA 3PBGA 2W61A 4MADA 5A6AA 2VOTA 1NWRA 5I24A 2E9MA 2C7FA 3VNYA 1WDPA 1G0CA 5GNYA 1JDCA 1Q4NX 3T0DA 3S6TA 1BFNA 3SUSA 2Y8KA 4FMVA 2QMKA 4PMRA 5CZKA 3WL1A 1WCGA 3AHVA 3BAIA 5E6YA 4GO8A 2ESCA 3WUEA 4CKQA 1KXQA 3QR3A 4ZE4A 2G8ZA 5D9NA 1E4MM 3RJXA 2VRKA 2E40A 1WZLA 4EE9A 2O9RA 4F8XA 3NSXA 4MB3A 1PX4A 1CGXA 5A8QA 5ABFA 5A8MA 3VINA 3L2LA 4U5KA 2V3DA 2X2YA 1KWKA 1JG9A 2YDQA 1V6VA 4WSJA 5D9OA 2X8RA 4HP5A 1LQ0A 3VPLA 2QF8A 1MW1A 1J11A 2JE8A 2ZX5A 5LA2A 3VUPA 3TTYA 5A8NA 1UKOA 5M03A 3CBWA 4YN5A 1WP6A 1PX8A 3UR7A 1UUQA 4A3HA 1ITCA 4M8UA 4WSKA 2A3CA 3EDDA 3ARUA 3DHUA 3IANA 1KXTA 4D6JA 3CMGA 1KBBA 1ZBKA 3AICA 1HVQA 4MJ2A 2BHZA 1XRVA 2YDRA 3ZOAA 5I78A 2WWCA 1E1EA 3FHAA 4PMUA 3WD3A 4W85A 2BY1A 1E4IA 3EMZA 3THDA 3UERA 1JD9A 3KZSA 5D8ZA 3T09A 2CBVA 2CERA 2V38A 1GOMA 1UWUA 2J8FA 2AAAA 1PZ2A 3AIBA 3W82A 1EA9C 1CLXA 4GI8A 3BSHA 3AXIA 3PZNA 3POCA 1HVXA 1NOFA 2XGIA 5A2CA 3AXXA 1CZ1A 2WVUA 4X0NA 2RGMA 1O7AA 1UKPA 1BHGA 4D71A 5BXSA 5CLTA 3FNDA 1MXDA 4MJ4A 1OSEA 3MUZ1 5JUVA 2OYKA 1NP0A 3WMBA 1C7TA 5DT5A 2JEPA 3TONA 1B3VA 1VFUA 1KGUA 1JAEA 3QHMA 5JIPA 4BA0A 2W67A 4H8HA 1JF6A 2Y8VA 1E6PA 1V0KA 2X05A 1G01A 2J7CA 5KEZA 2VMFA 2J77A 4B9YA 1CPUA 3MS8A 3GXFA 1KFWA 3PZQA 1PJ9A 2ZE0A 4E2OA 4JZ5A 2J74A 1Q6GA 3WL0A 4B3KA 1LJYA 3WF2A 4M56A 4PMQA 4MNMA 4ACZB 4AZCB 4JKKA 2JALA 2NSXA 1PIGA 5CPQA 4GQQA 2W91A 1TCMA 3SUTA 1ISXA 3OZOA 1VAHA 3SCVA 5GNZA 2WHJA 1ZJBA 1NP2A 2ZX6A 3A3HA 1WO2A 2AMGA 4QCFA 2CNCA 2V3GA 1LLOA 4HA4A 1UKSA 2DPEA 3QOMA 3BAXA 1GOKA 4F9JA 2G41A 2VZUA 2WKLA 2ZUSA 4LX4A 1W1YA 2GJXA 3AIQA 2OLHA 1ITXA 5ABEA 2D22A 1B1YA 5DF0A 4A4AA 1IT0A 1UD2A 3M7SA 3MMWA 3WMCA 2ZXDA 1Q6DA 3AIVA 5GPRA 4DUVA 1E73M 2XVLA 3VILA 4CD7A 3IAPA 4LPCA 4WKFA 3WQVA 4XV0A 3OLGA 2B31A 3ARXA 1UKQA 1ODUA 2CHNA 3N12A 2XIIA 4FK9A 4ZE5A 3UG5A 4MNJA 4MDOA 1M53A 4CU7A 4D6HA 1W1TA 1LWHA 2DGAA 3WNKA 5ABFB 2WZHA 4ZXOA 4NF7A 3HJEA 4UQDA 4UQAA 3DC0A 4CD6A 2EPMX 2VZOA 2Y2WA 1FFRA 3CUGA 3AHTA 3WQ6A 1ESWA 1V3KA 2BV9A 1UG6A 1GORA 2YA1A 1J0JA 1TG7A 1O6IA 1E6RA 2WYSA 3CUJA 1E6NA 5A2AA 2JEQA 1SR0A 7A3HA 3N13A 4EAMA 1DP0A 1E71M 1XYZA 1H4PA 2GK1B 2PBGA 4L4OA 3L4WA 3ZQ9A 1E3XA 1RP8A 3W6MA 3AQUA 4PN2A 3CHCA 4U2YA 2VZVA 3WEZA 2YOCA 1UWRA 5E0CA 2D1ZA 7CGTA 1WNOA 2VZTA 4P7NA 3W0KA 4TOQA 1AQMA 2WMHA 4DM2A 1WKYA 2EO7A 3BH4A 1E70M 3T2OA 4Z2IA 2V3FA 2WCGA 1CEOA 4GXPA 4U2ZA 1KCLA 5D9PA 2PBOA 1KR1A 2WMFA 4JL2A 1LWJA 2CXGA 1CGTA 2DT1A 3ZJ6A 5AY7A 2DSVA 3G6LA 2CHOA 2XVPA 1JDAA 1KGWA 1QI4A 1MYRA 4B15A 4NI3A 4AYSA 4AD5A 2BVDA 3L4XA 1EGZA 2C0HA 1N82A 4AXNA 3AS2A 1M7XA 1PZ3A 1HKJA 4Z2KA 3U5UA 4EKJA 4P8VA 1D3CA 3PHAA 1UD8A 1TE1A 3MV01 1H0GA 1HX0A 4AWEA 1HJUA 1JAKA 3KEHA 4FLOA 3WD4A 1G5AA 3VIFA 3F5JA 3M6DA 1DWGM 5JBEA 5CLWA 4UQEA 4DUWA 4GIAA 2OYLA 1PAMA 4ATWA 2D23A 1WE5A 4BQ5A 1AQ0A 3VKKA 2CKRA 4M1RA 4HU8A 1OM0A 4W8AA 4NSBA 1JDDA 1BGAA 1UWSA 3GNPA 3TTOA 2VX5A 3N04A 3W28A 3VDCA 3WQ4A 2F2HA 3VM5A 2VTFA 2YL6A 4AY1A 1CGVA 2WMIA 1H09A 4PSPA 4BCEA 1M03A 4JCMA 5I77A 3A4AA 3NCOA 2EPNA 2EBNA 5FD0A 1R8LA 2V5CA 4AD3A 2VX4A 1JZ2A 4KGLA 1F4HA 4OJYA 1RP9A 4E8CA 4AZIA 4CN4A 4HZ7A 5IXEA 3GXIA 2VUYA 2EJ1A 3AZTA 4OZOA 3CH9A 1HT6A 2ZXBA 5BWFA 5EBAA 2CCRA 3WDQA 1UD6A 1H2JA 1UH2A 4AC1X 4GZIA 3W53A 3LPFA 3CO4A 2E8YA 3AJ7A 3EYPA 1UOKA 3QHOA 2X0HA 1K9FA 4CGTA 1LL6A 1E5NA 2ZX8A 2VX6A 2WVVB 1W3LA 5FCZA 5E09A 3E1F1 1PEZA 1NOUA 1KXHA 4MNKA 3MMUA 2XGBA 1BTCA 4WJXA 1UWTA 5ABHA 1LL7A 2BY0A 3EDJA 1LL4A 5A6BD 5I6SA 5BCAA 3AYSA 1JI2A 3AZRA 3ARPA 1J0YA 3BAWA 1UA7A 1OGBA 2GJXB 3TOPA 3OIHA 4JFVA 4C7DA 1FP9A 1B0IA 3WNNA 1W32A 2VL4A 3MU7A 2FH6A 1HIZA 1XCXA 1BLIA 3VTRA 5DMYA 2DSUA 2E9LA 3RO8A 1B3XA 4W86A 1NWUA 4FLQA 3T0BA 3AZSA 2OSXA 4QLLA 1XSIA 5EMYA 4OBSA 4GO9A 4NRRA 2QHAA 1B9ZA 1GOIA 3VM7A 1QI0A 1MQPA 4LYQA 1DTUA 3U7VA 3DHPA 4OBRA 4F79A 1V02A 1EDTA 4UFIA 3AHYA 2ZX7A 4ZXLA 2WCAA 4HTYA 1PPIA 5CPSA 1UWIA 2VI0A 4W84A 3W29A 5HOSA 1GHRA 6TAAA 1VEMA 3W6LA 1B30A 4XUYA 1QVBA 2NT1A 2PWFA 4OOZA 4UZUA 1EHNA 1QNSA 2UY3A 2WC3A 1RH9A 5A6MA 1QHZA 4W7VA 1GOQA 1CYGA 1BYBA 2W62A 2CYGA 3K8LA 5GNXA 4V27A 1E1FA 1V08A 2OWWA 1SYTA 3VGHA 5I3DA 1JD7A 4URIA 3VD7A 3VIHA 5CPTA 2XYLA 2OWCA 3SCQA 4PMOA 1R86A 4LGXA 5M5DA 2FH8A 1G1YA 3AIUA 3SCNA 1U33A 1ISVA 1QW9A 1JXKA 1ZL1A 3PZIA 4GINA 2XG9A 3VDBA 3ZM8A 1C8YA 3PZ9A 3W4RA 4ATLA 3VX1A 3BLPX 1OB0A 1CXIA 3O6AA 3PZTA 1ISYA 4HOZA 1HXJA 1C91A 4UFJA 4IPNB 4YPJA 4CU6A 1UWQA 3UCQA 1E6QM 1B3WA 1QW8A 4WKAA 2O9OA 2WANA 3AS1A 3MO4A 4PUEA 4F66A 2CEQA 4RE3A 4Q7NA 2A3AA 3SCWA 3WF4A 1EXPA 1UA3A 2PB1A 5LA0A 4MAZA 4BF7A 2EPOA 5BRPA 2JF7A 3OB8A 1W9DM 5A8PA 4XZBA 2WMJA 4MPKA 2FHCA 1D7FA 5I2UA 3HMCA 3CZEA 1B2YA 1ZS2A 3K1DA 3ARVA 4PMNA 3CGTA 2VO5A 1X6LA 5A69A 4ACZA 1MW2A 2DDXA 1VENA 4ZFMA 1XGZA 3NDYA 1GONA 3VGDA 2YA2A 1W2PA 3AISA 4M80A 9CGTA 2WMKA 4HA3A 2XVGA 4XB3A 3OGVA 2CESA 2ZUTA 4M24A 4X0VA 2VJXA 3ZJ7A 4LYPA 1K6AA 4D6GA 3SURA 1WAWA 4EK7A 3ARSA 1BYCA 5HBFA 4HZ6A 2OYMA 1MFVA 1JI1A 4TVCA 2PWHA 3VU2A 4D6CA 2VCCA 4P8XA 3HU7A 2VURA 3VMOA 2WKGA 1GQJA 2DIJA 1X6NA 1S46A 2WCSA 4Q22A 3WEOA 4M81A 1QOXA 1BVNP 3PTMA 4PCTA 4KMQA 1V3MA 1C90A 4IUGA 1WZAA 1H1NA 3OGSA 4H04A 1JF5A 1UD5A 3ARWA 3MMDA 1CXLA 4AZ5A 5JBFA 4W8BA 4X9YA 8A3HA 5I0DA 4TX8A 3CLWA 3QGVA 1E4NA 1VJSA 3VD9A 1U2YA 3SCOA 1NM9A 2ZXAA 5GQBA 1V6XA 5C70A 1FHDA 2W66A 2VQTA 3I3DA 3CIVA 4B9ZA 4HOWA 1V02E 2D3NA 1IV8A 2WPGA 1OIMA 1HJQA 1UR2A 1FFQA 1C7SA 3TA9A 1V6WA 2G3IA 4TXEA 4R27A 2WNWA 3AIWA 3L4YA 3A6OA 4JFWA 4S3KA 3WNMA 5FKYA 3ARTA 4HOXA 4AZGA 4D72A 5I23A 2WC7A 2G3JA 1TMQA 1R7AA 1YQ2A 3F5LA 2VNCA 1HJVA 3S2CA 2A3HA 1UYQA 2TAAA 1OGGA 1DWAM 1BQCA 3ARRA 5CXPA 3WSUA 1GZJA 3M46A 4QDMA 1WZMA 5C71A 1J0KA 4PBGA 5A6BA 4UFHA 4HZ8A 1J12A 4PUDA 2CPUA 4JFTA 3ALGA 3PTQA 1CXFA 2ZUVA 2C8NA 2XHYA 4JIEA 2YBTA 3ZR6A 2A3EA 4C7FA 3W27A 1MFUA 1UQZA 3RILA 1Q6FA 3LMYA 1BF2A 3I3BA 1E43A 3KL5A 2XPKA 2WC4A 3EDEA 3PZMA 3WH7A 1W3JA 2QPUA 4TVUA 3SCRA 2WVTA 1ZBWA 3BCDA 3WF0A 4WK9A 1UR1A 2A3BA 4CN1A 1CGWA 3TTQA 2Y5EA 3AMDA 1MQQA 3FAXA 3UR8A 1A3HA 1W91A 5AYIA 4PMZA 1V0LA 3WBEA 1E0XA 1E56A 4KRUA 4W93A 1WZKA 2VCBA 3RPMA 2PWGA 3CUFA 1G94A 1W3HA 1FH9A 2XFFA 1UKTA 4UNIA 2VC9A 1MWOA 1B31A 4IM4A 1VFMA 4NRSA 2W5FA 4YHGA 2DH3A 3JUGA 2JF6A 1A47A 3FW6A 4J27A 4UOQA 1GVYA 1NQ6A 3A4XA 2FDMA 3D3AA 3BXWA 3L2MA 3BSGA 1FHLA 4JAWA 3WD1A 4KWUA 5DEZA 3SCTA 5F7UA 1XH1A 2J7FA 4LYRA 1ZU8A 1V3JA 2E0PA 4LQ1A 4H8UA 2DSWA 2V5DA 1BGGA 3KWXA 4KH2A 3ZJ8A 3ZT7A 4CVWA 4W88A 1UR0A 3FAWA 1UR8A 3VIJA 3K8MA 1E9LA 2W4XA 4AW7A 2E9BA 1JL8A 3T08A 4Z2GA 4UFMA 3B9EA 3SIMA 2YLAA 2BVTA 1B3YA 4U31A 1KQZA 5HNNA 3VIGA 2YBUA 3TTSA 4WKHA 4FLSA 2DT0A 3SEPA 1ODZA 3WIJA 4W7WA 2WHMA 5HPCA 1GVIA 4AZBA 1PIFA 1EDQA 3GH5A 3WQWA 1CNVA 4H41A 3WY1A 3BMVA 4JHZA 3ZIZA 3K8KA 1V0NA 4FF5A 1W2VA 3NYDA 4CVUA 2ZUMA 5HXMA 4D6EA 1OWQA 3WUBA 2W63A 1GW1A 3RCNA 3WDHA 1FH8A 3NSMA 3VVGA 1DHKA 1W3KA 3OBAA 1W9VA 1TUXA 2IXVA 2ZWZA 2CIPA 5DT7A 4AIUA 1MXGA 1VBUA 2ZXQA 3KE0A 2VX7A 1BSIA 2XM1A 4P7RA 1NOWA 1JFHA 4OIFA 1I1WA 5DO8A 1M01A 1CGUA 1QBAA 1UR9A 4PTVA 2EXOA 1UH3A 2G4FA 4MB4A 2WBGA 3WD0A 4D1IA 4AZ7A 1UHVA 1E40A 3WDPP 3WFZA 1BPLB 4XX6A 2WHLA 1JYXA 5D8WA 4JHOA 1JZ6A 3T0AA 3WD2A 3CHEA 4DWSC 1BYAA 4GZJA 1OGSA 3G6MA 4FLRA 3T2QA 1DEDA 3POHA 4PEEA 4WF7A 5A6SA 5FOOA 3VIOA 1JNDA 2VQUA 2BNJA 4J3XA 5EFFA 3L4UA 1HKMA 1KWGA 2J7EA 4BQ2A 3FXYA 3AIEA 3LPOA 2OWXA 1GQKA 1G9HA 3II1A 3AXHA 5I79A 4CD8A 4CCEA 5AYBA 3IJ7A 1CLVA 4AZ6A 3CZLA 1NH6A 2XFRA 5C8BB 2WVVA 3UG4A 1FH7A 1I1XA 3RM9A 2DH2A 4WLCA 1LG2A 1H3GA 5AC4A 3DYMA 1HL8A 1J18A 2VVNA 1MQRA 3AHZA 3N9KA 4UQ9A 1Q6EA 4PMYA 1CXEA 1E0VA 3I3EA 5E6ZA 4K68A 2EQDA 1J10A 3BLKA 3WH9A 4AD0A 3VIPA 1TA3A 3A4WA 4GI6A 3IJ8A 1CXKA 4UOZA 3APGA 3ARZA 1JZ3A 2F8QA 4HMDA 3DECA 5BROA 2FHBA 4J3UA 3OA5A 4D6FA 1XD1A 1GJUA 2XUCA 2CBUA 4BS0A 1H0IA 3ZO9A 3N15A 4W5ZA 4AD4A 3U7BA 3EDFA 1H41A 4UQCA 3WENA 2ZOXA 3WKZA 4HMCA 5FL1A 4NZCA 4N0RA 4MB1A 5CGMA 4MNLA 4TX6A 3WDJA 5E9AA 3ZSSA 4JCLA 1C8QA 3EBVA 4QFUA 1ZBVA 2UY4A 1XSJA 2WBKA 2G3MA 5BXTA 1JZ4A 3OGRA 1CWYA 4W8LA 2D0FA 1DWHM 1US2A 4M29A 4UTFA 1LF1A 4W89A 3AS3A 6A3HA 2XFYA 1RD6A 4U3AA 4F9DA 1MW3A 3N11A 2BXZA 1WDQA 4DWSB 2J79A 1W9PA 5A6LA 4P7OA 2XIBA 3GXDA 7TAAA 1J0HA 3RM8A 1AVAA 3GH4A 4MTVA 3GZAA 3QHNA 2D0HA 1XV8A 1V6UA 1HP5A 1C8XA 1ECEA 1WPCA 2ZUNA 3VIIA 3MSGA 1WDRA 1EQPA 1Z32X 3CMJA 4PTXA 3VIKA 1XH0A 1E15A 3DYOA 1OT1A 1E6XM 3ZR5A 2WW5A 4V2XA 1EO7A 3F5KA 4B3LA 3VD4A 1VBRA 2WLZA 5D4YA 2WMIB 4YHEA 4ACYA 1WDSA 3MUIA 5M3WA 1AQHA 4AMCA 3B9AA 4PMXA 1B3ZA 2D24A 1H5VA 1CGYA 4TVDA 1R7OA 2Y4SA 3VOCA 3A47A 1V6YA 5HPOA 2QPSA 1R87A 2XSAA 4PTWA 4BQ4A 1BVZA 3AOFA 3GYCA 3WH5A 5E70A 5E0FA 4MDPA 2GVYA 1C92A 2O9TA 1R85A 1M04A 1V3IA 1W1PA 1GQIA 2UWFA 4V28A 3NJ3A 4CCCA 2VR5A 1MW0A 3EMCA 5IFPA 3GDBA 6CGTA 4P8UA 2WZEA 1HJSA 2YDSA 4E8DA 2YL9A 4PRWA 1E55A 4CD5A 3WN6A 2OSWA 1JXJA 5ABGA 1Q6CA 1C93A 3W37A 1HN1A 1OD0A 2IUZA 2IXUA 1KCKA 2YL5A 1E0WA 2BFGA 5BXRA 1HNYA 3NSNA 4HPHA 2J7DA 1B90A 2J8GA 1E6SM 4ZENA 1CTNA 3RMEA 3PN8A 2D2OA 2DT3A 1QI3A 2VZSA 3WH8A 2HISA 5A94A 3L4ZA 2J7GA 1FP8A 3GH7A 3NUKA 3VMNA 1XHGA 2GUYA 3SUWA 1TVPA 3AMCA 3UG3A 3VDHA 3M07A 1V3HA 1E4LA 2VT0A 3HN3A 1VFOA 2GFTA 1VJZA 2GK1A 5ECUA 1UD3A 4XZWA 2AOSA 2X0YA 1IZJA 4A3YA 3BCFA 1UH4A 1GJWA 1QI5A 2PWEA 3ZMRA 1L8NA 4AISA 4Z2HA 2D0GA 4AIEA 2WSKA 2PC8A 1ZBCA 4U3CA 4AD2A 3IJ9A 4UQBA 1CBGA 2Z1KA 4JFUA 4DM1A 5JIWA 1VFFA 2E8ZA 1V0MA 1GOOA 3VIMA 2ZUUA 1EO5A 2O9PA 1W1VA 4AEEA 3BGAA 3LPGA 1GQLA 2BVYA 3SCPA 1MVYA 3IAQA 4DWSA 1TFVA 1JGIA 5LA1A 3WEMA 3WUGA 2DSZA 3AROA 4W87A 3W25A 5EFDA 2YA0A 1JZ8A 3MUAA 1J9YA 2O92A 1VF8A 3U5YA 2OSYA
chains in the Genus database with same CATH superfamily
3IIXA 4CQDA 1NDWA 1JULA 3B9DA 4J9JA 4UMAA 3T2PA 3VZXA 1OZMA 2XVNA 2JBMA 3ERPA 2NXGA 4EPBC 3WQ8A 1KB3A 3EEZA 4NIRA 3E2RA 4WGHA 1S5MA 5LSMA 2XIJA 4UB9A 3QV7A 4GYPC 2HVMA 1HL9A 2VEKA 3J7HA 1JGMA 3RM4A 3WJWA 2B7NA 3WNLA 3W70A 5DELA 2PC4A 2WMGA 3BJSA 2WVSA 3R25A 3LI1A 4JIRA 3ALFA 2CBJA 2HSAA 3K46A 1XKJA 4JQ3A 4ICNA 3GWQA 3LHUA 1RJPA 1XICA 3V0SA 2J25A 3TWAA 1KFKA 3TMQA 1EC9A 3W07A 4DJEC 1GPFA 4QEHA 2GJRA 4WOZA 3U6WA 5CSYA 1K4GA 1E9ZB 3ZR4A 1HO1A 1Z9AA 1M9HA 3VGGA 3LNPA 2Y1HA 4C6IA 1KRCC 1K6WA 1H1ZA 4U33A 3BTNA 3CHFA 3GM8A 3RIKA 5BW6A 1OCJA 5AZ0A 4NP7A 3OLDA 3GTIA 3OZPA 4ZZ9A 1AD1A 4D1JA 4ZO9A 3GBDA 1W1IE 4M82A 5T26A 1A5BA 1AL7A 4CCZA 4AC7C 1JYNA 3S9IA 1US3A 3LPPA 5K9DA 2VWTA 1AJ2A 4ZCWA 4LRSA 4UR9A 5IOBA 4HSHA 1TV3A 3VK5A 1VRXA 5MF5A 4AMAA 4JYEA 3QR0A 1A3WA 4D2JA 3FOKA 3W7JA 2F6XA 1SMAA 3DG6A 3EEGA 2ZVIA 3AMGA 1BXCA 2ZICA 3CPRA 1TV4A 2EKCA 3OA3A 3UU0A 3UZYA 1JFXA 3RMJA 1XLKA 3OG2A 4A3RA 4C91A 6PTDA 1E6ZA 4L5ZA 1T8XA 4DBSA 3SJ3A 4H7CA 1RPKA 2Q8LA 1XLGA 2C14A 3BMXA 3FJNA 4WUIA 4K39A 5D2TA 3ONBA 4NNCA 4B4HA 1PWMA 1TVNA 2WWDA 2VC6A 4PCPA 4HPNA 1SJCA 5LIKX 4DLMA 4GVHA 3FJ6A 4BJHA 1Y7VA 1AJZA 5A3HA 1TR1A 3CAWA 1XIGA 2ALRA 3ZJKA 2QCNA 3KL0A 3QGKC 4AWTA 2CITA 2HNHA 1KQYA 4CNNA 2OQHA 5D38A 3W87A 2BVWA 4Y7EA 3TU9A 2IPGA 1XFCA 2WB5A 1M68A 2YFOA 5I06A 4JKMA 3T40A 3QJAA 3VOFA 1D3GA 1XS2A 2BHYA 3PVFA 2A21A 1RY8A 4ZQNA 1CCWB 2FIQA 4MB5A 4MWAD 4M7SA 3IJIA 5A8OA 4HCHA 3G1AA 1W37A 4DELA 4JX4A 1JZ5A 1Q6QA 1ALDA 3HV9A 4BQ3A 1VCFA 5BRQA 3RPTA 4YTRA 1LCOA 2PGEA 5HNTA 5IFTA 2R1PA 2AL2A 4TTGA 4DZIA 1IR2A 2UY2A 4AYGA 4ML4A 3N6QA 4KEUA 4GY0A 5CQ1A 4S3JA 4IIFA 2PF8A 2E3ZA 1DE5A 1XD0A 1GNXA 3UWQA 2YJQA 1E5JA 3PB0A 4OBTA 4LVGA 3MO7A 4QAWA 1F6PA 1IZKA 2Y61A 3VD5A 4AZCA 3MV11 4H2CA 3BV7A 1GEQA 1QW7A 2WHKA 2TODA 3F7JA 1UD4A 1TMLA 3ZXWA 2OB3A 5A95A 3UWEA 4M7TA 1VLWA 1BAGA 1KM3A 1XINA 2ZUWA 3GR7A 3N17A 1WB0A 1YX1A 1LG1A 2GVJA 2Z00A 3UD6A 4QSFA 1DJQA 3WJSA 2R82A 4D6IA 1PTAA 5E0KA 1Y5VA 2D20A 3DYPA 4KGJA 5JH1A 4W7UA 1SFSA 4OGZA 1G67A 2OCZA 4PUNA 4RR4A 4IHCA 1W56A 1OBAA 2WK2A 1FWJC 1AH4A 1TPVA 5PTDA 2VRQA 2EPLX 4GACA 3DUGA 1H1YA 2INFA 3WLMA 3LM3A 2OEMA 4X61A 3GO2A 4IGSA 4FALA 1FY6A 3L4VA 1PZ0A 2QV4A 3O16A 1XSKA 2G3NA 1XPGA 1EHAA 1VIWA 3WLJA 3B04A 1AFSA 3SUUA 5HR7A 1CX9A 3M5ZA 1VB9A 3VOJA 3AHXA 4PCSA 4G8TA 2RGLA 3L0NA 3UJ2A 3ARQA 1J0IA 3TR9A 3ITVA 4IG2B 5A6KA 4GKLA 2QUMA 3MYOA 3BUVA 2QYGA 3GHSA 1KTNA 3PPCA 1QHPA 2Z6JA 4Y9NA 3U0HA 3RLVA 2Q8ZA 3GBEA 1QHOA 4Q8OA 1XIIA 3LLXA 2FHFA 1JIBA 4H7VA 1I75A 1DWIM 1KFLA 1XRFA 1ZP4A 2GUUA 3A23A 4HA1A 2DEPA 1J6PA 3W7LA 4LFYA 4XG1A 4EPKA 4MADA 1XLAA 4BEQA 1WV2A 3NOEA 4P61A 2CZVA 4CNSA 3CXOA 3TN5A 4DF2A 2G0WA 5I24A 4AHOA 1WDPA 1RCXB 4GHRA 3S6TA 5I03A 4PE8A 3NGJA 3PPGA 2QMKA 3WL1A 1WCGA 3AHVA 2Z1VA 2DFAA 1NDYA 1E4MM 2VRKA 1DKWA 3N9RA 1WZLA 4DF0A 2O9RA 4MKSA 3KHDA 3IIZA 3RRAA 3NSXA 4MB3A 3G1FA 4F2BA 1PX4A 2ICSA 1CGXA 4I8YA 5A8MA 4UTTC 4E3VA 4HP5A 3ME3A 4MWAB 2ON3A 4R7OA 1J11A 4XZHA 5LA2A 5B7ZA 3TTYA 3E74A 1CT5A 1DXIA 2IPJA 3CBWA 1F2JA 1OFBA 1DJWA 2GWNA 3W2JA 2PDGA 4PUUA 3B40A 3GDLA 4NZJA 2PAJA 4DXVA 3ARUA 1Z42A 4GZ7A 2Y85A 1U5JA 1VFSA 1AMKA 2YDRA 1E1EA 4PMUA 2X1TA 2BY1A 1E4IA 1G4PA 1FDZA 3VCRA 1JD9A 5D8ZA 4L1GA 4EF8A 3VE7A 2V38A 2ISWA 2J8FA 4LUTB 3AIBA 5BOEA 2V63A 1CLXA 1SFLA 4GI8A 1P6CA 2VC7A 3PZNA 3POCA 2XH4A 2Y6ZA 1R3RA 1P5BA 2DZTA 1NOFA 2YYTA 3SQMA 5A2CA 4X0NA 2RGMA 2ZZ6A 1FQ0A 4FHAA 1UKPA 1BHGA 3NQFA 1BTMA 3USBA 5BXSA 1S1RA 2P1FA 3EB3A 4MJ4A 1OSEA 3CUZA 4C6DA 1TREA 5DT5A 1QJWA 5REQA 1W1ZA 4HNVA 1KGUA 4R53A 1JAEA 5JIPA 4IL0A 5KSWA 4XZNX 4BA0A 3QY7A 4H8HA 4PL2A 4J3ZA 1E6PA 3UVAA 2ZBTA 2VMFA 3GXFA 1KFWA 1BXBA 4ZTYA 2V9DA 2VOMA 3IK4A 3JW7A 3CL6A 1PJ9A 1XDLA 1Q6GA 1OFRA 4JX6A 4M56A 5BMXA 1TPEA 1F9CA 3P67A 1PKYA 5FJOA 4JKKA 2JALA 3GDKA 3RITA 4DJDC 4Z17A 3L66A 3UNTA 4JTGA 4U10A 1TCMA 3VXGA 4B2DA 4UTUA 4JTJA 2WHJA 2DVUA 3GVQA 3OTRA 3S8HA 2ZX6A 3N19B 3E3HA 1TJ0A 2E77A 2WNQA 2AKMA 4C1NB 1UKSA 2A5HA 2B81A 5AHLA 4HN8A 3D6NA 3GVWA 4GVIA 4OQVA 2ATMA 2WKLA 3N4EA 2GJXA 1GKRA 3UBPC 2GVLA 4FIQA 3CYVA 3QMSA 2ZXDA 3WX7A 2QVNA 4IX0A 1FWAC 4C1NA 4LPCA 4WKFA 4US5A 3OLGA 4JDBA 2B31A 1PCKA 1UKQA 4UTTA 2ZA3A 1MO0A 1ODUA 4MWAA 3IVTA 2EJAA 2XIIA 4FK9A 4ZE5A 2QXWA 5LIYX 3N9SA 3GRIA 4BI5A 4CU7A 4D6HA 1WKDA 2DGAA 3GZ3A 1RZMA 1US0A 3CT2A 4ZXOA 3HJEA 1KLYA 3USZA 4UQDA 4FS9A 1M41A 5LNSA 1YIXA 1O66A 2Y2WA 1FFRA 4O28A 3CUGA 3AHTA 3WQ6A 2ISVA 4LSBA 5LGZA 2G3FA 1GORA 1J0JA 3CQHA 2XIMA 3URNA 2PDKA 1O6IA 1R3QA 4GWEA 2JKAA 5A2AA 2JEQA 1SR0A 7A3HA 1FWTA 3CS2A 2E68A 3T4CA 4ICCX 4KFOA 3N13A 4EAMA 3E0VA 3ITLA 3TJ4A 1OCBA 3OIXA 3L4WA 3ZQ9A 3W6MA 1ECQA 4PN2A 2QUNA 3KBVA 4I9TA 3CHCA 3CWHA 1UC5A 3W2LA 4C6QA 2FVLA 3VKAA 7CGTA 1LDCA 1WKYA 1YXYA 1SGJA 3PFRA 3BH4A 4K8HA 3W2NA 4GMEA 2WCGA 4N9DA 3WLTA 1SPQA 1KCLA 5D9PA 2PBOA 2HROA 3KRBA 1NFPA 3ZJ6A 3N6JA 1L6GA 5AY7A 2DSVA 2XN2A 1EKOA 2XVPA 1KCXA 3NZGA 1RVGA 4XZ9A 1K4HA 4LEFA 1MYRA 4NI3A 4ZQRA 2CZFA 3WK3A 2QNEA 1SZNA 1ZAJA 2QF7A 2OLAA 4UTMA 4IMGA 1N82A 4AXNA 1M7XA 5DX7A 1HKJA 4Z2KA 3U5UA 4UWMA 3W1TA 4P8VA 1D3CA 4WJ8A 3MV01 3HTWA 3G1HA 1MNZA 1HJUA 3WD4A 1XPYA 4AY8A 3G1XA 3B05A 4HYRA 5CLWA 4DUWA 1KW1A 3V0UA 4DNMA 3VKKA 3CHVA 1GG0A 4HU8A 4W8AA 1JDDA 1UWSA 3L5MA 3U2OA 4J40A 4NJIA 4RXFA 1CGVA 4YTQA 2WMIA 1H09A 4A8LA 3F4WA 4JYDA 3A4AA 1B4EA 3NCOA 3HJZA 4MOZA 5FD0A 1E1CB 2PDQA 4JN6A 4ZA0A 4E4UA 1OF8A 4C65A 4AUBA 4E8CA 4AZIA 4HZ7A 1KM5A 1VJIA 3HGJA 1J5TA 4OZOA 4LB3A 3V18A 6REQB 4GZIA 1A5KC 4POCA 3H4GA 4ZQMA 2V5KA 3H12A 4LH8A 2NLYA 1YADA 4K37A 1LL6A 4ZB2A 2ZZ5A 1EZWA 2VX6A 4Q8PA 4DAFA 1W3LA 5FCZA 4LB4A 3MTWA 1PEZA 4GNKB 1KXHA 1H62A 4Y6GA 2Y0FA 1TTJA 5ABHA 2BY0A 1LL4A 3QGAC 3OZMA 4JN8A 2VD8A 1QPNA 3LOTA 3NXFA 4ZBCA 4JFVA 3TYEA 3M0VA 1W32A 2VL4A 3F2DA 4Y9PA 2ACQA 3AU2A 3B0UX 2DSUA 3NQ8A 2E9LA 3OBEA 4HBKA 4CQBA 1NWUA 3T0BA 3DAQA 4QLLA 1XSIA 5EMYA 4OBSA 2ZE3A 3FKKA 3TA6A 4OECA 4Z1YA 2O7QA 4F79A 1EDTA 1ICPA 4UFIA 2OT0A 4ZXLA 2E28A 2WCAA 3SFWA 4RDYA 4C6LA 3LD5A 2VI0A 3W29A 4XAFA 2GDQA 6TAAA 1NDZA 4XUYA 2CLOA 4PUJA 3GXNA 3KXQA 3EWDA 2NT1A 3MI6A 4L80A 1EHNA 3OOQA 3UP8A 4XAZA 3WLLA 4BY3A 3M43A 1GOQA 2P3ZA 1CYGA 3TDFA 2CYGA 3W84A 3K8LA 1MDRA 4YYCA 4QBXA 4R7JA 1SYTA 1I9CB 5DBTA 4PUMA 1JD7A 4N6EA 4URIA 4FNUA 3VD7A 5CPTA 1XLBA 1VGAA 2OWCA 4Q3MA 3QQ0A 2CWXA 4XUGA 2H3DA 3WJXA 3MPGA 1DHPA 3SCNA 3V75A 2CLEA 3ELFA 1O94A 2VELA 1ZL1A 5EL1A 2XG9A 3T07A 3W4RA 4IQLA 4G2DA 3VX1A 4XAYA 3RG6A 3ANYA 7XIMA 1PVNA 1FX6A 1SJAA 4M6QA 4KCTA 4N9BA 4YWSA 3TC7A 1UWQA 1B3WA 3E96A 4WKAA 2WANA 3GIYA 3AWOA 1N8WA 2CEQA 3IJQA 1XLHA 8TIMA 2FJUB 1EXPA 4MAZA 5MKGA 5BRPA 5AECA 3OB8A 4AX6A 5A8PA 4MPKA 3PJTA 1D7FA 5I2UA 1AZ1A 4MMWA 3CZEA 1BF6A 4PMNA 1UASA 4ACZA 5KZDA 2DDXA 4AHQA 3URAA 3DH7A 3TR2A 1XGZA 2NV9A 3AISA 1W2PA 4M80A 1QK0A 4OV4A 2Y62A 4BF5A 3OGVA 3KVJA 2ZUTA 3SRKA 3ZJ7A 3IACA 1WAWA 1OFDA 3MWCA 4GH1A 3GU1A 2J6VA 3W1MA 2QCLA 3R43A 1A5MC 1ZP3A 4GOAA 4LJ3A 1GQJA 2QGHA 1YNQA 5C9RA 1PKLA 1S46A 1NFGA 4F48A 2WCSA 2AKZA 1M65A 3TLLA 3R8GA 2GYIA 1WZAA 4E4FA 2I5QA 1F3TA 1JF5A 1UD5A 2QS8A 1XG4A 4AZ5A 1QPOA 1F8IA 5JBFA 4W8BA 8A3HA 4TX8A 4WJEA 3CLWA 1E4NA 1GYLA 4NAFA 2ZXAA 5GQBA 1D8WA 4QM1A 3W7QA 3C52A 3QQ1A 3GVRA 4DBUA 3H8AA 1X1OA 1IV8A 2H90A 3GUGA 1AD4A 4FNTA 2WPGA 2QJIA 3MA8A 2QDDA 1YDVA 3MCOA 4R27A 3AIWA 3L4YA 2AQOA 4JFWA 4TX9A 4E6MA 3H54A 3RPDA 1TPFA 4D72A 2ZRZA 3R12A 1R7AA 2PP3A 1YQ2A 1HJVA 2IKIA 1EPXA 1CLKA 5K4XA 4XVDA 7REQA 3IVSA 1UYQA 1DWAM 2IQTA 3ARRA 1XLLA 3WSUA 1W31A 2CZDA 2A3LA 2VEPA 3Q58A 2POTA 4GQGA 1R46A 3S1XA 4DRSA 2TPSA 1O1ZA 4LS2A 2IS7A 2WSRA 3SECA 4L6DA 1L6YA 2CPUA 1XKYA 4K1GA 4LEQA 5DCEA 2YB1A 4BHYA 4DWDA 4IQJA 4JIEA 2YBTA 3GNXA 4C7FA 1HKVA 5CPLA 4ZMGA 1TCDA 1YNYA 4LNYA 3DFHA 1X6UA 4QROA 4B4FA 3S9YA 1BF2A 3I3BA 1A0CA 1J6OA 3JR2A 4NZ3A 4REQA 5LHEA 3PZMA 1TWWA 1W3JA 3EPOA 1XYBA 3BCDA 1B5TA 4NAFB 3WF0A 4WK9A 3KLLA 4KWOA 1Q8AA 4GABA 1OC7A 4KQNA 1H63A 3RX2A 1RCQA 3TZNA 3KVKA 4LAKA 4V1XA 4O8AA 1A3HA 3H4WA 5AVNA 1V0LA 5C9WA 2Y7EA 2ZRVA 2PDHA 3GC2A 3DI1A 4KETA 4Q4RA 1W3HA 3W88A 3WLIA 4UNIA 3FYPA 3A9IA 4NRSA 3FJ4A 1VH7A 1SW3A 3O63A 3SQLA 3PC0A 1ICSA 1XIEA 1IEXA 1GVYA 1NQ6A 3A4XA 1SZRA 3L2MA 1FHLA 4JAWA 3S6DA 3P5ZA 3WD1A 3DENA 1XP3A 1N8FA 3IGUA 1XH1A 3CV2A 3O05A 3PBVA 3TSMA 2J7FA 4LQ1A 1PO9A 4FNPA 5AHFA 3NQBA 1TX2A 3ZJ8A 1FWBC 5I07A 1ITUA 3UXIA 3DHDA 3VIJA 1JL8A 4Z42C 3B9EA 1KQZA 1Z44A 3Q2DA 5RUBA 3BZJA 4FLSA 3KDOA 1POKA 4W7WA 1EJWC 4R33A 2J27A 2WHMA 3CV7A 4XVEA 1DIOA 1VPQA 4Q8NA 4C60A 1EF2A 1G4EA 2BWGA 4H41A 5EKYA 3WBXA 4QAIA 3NYDA 4CVUA 1W17A 1F74A 1OWQA 3KX6A 3QTGA 2HZGA 3OBAA 2Y70A 3I6RA 2CIPA 1MEIA 2OVLA 1MXGA 3KE0A 1I2OA 5BOFA 2VX7A 2ZVRA 3WZ0E 3BLEA 1TJPA 5DO8A 3B3DA 3TTEA 1UH3A 4MM1A 4MB4A 4S1FA 4LAZA 3D0CA 3WDPP 1BPLB 4G1KA 1RBAA 1R0MA 3GC4A 3DXIA 4DO4A 3CHEA 4DWSC 1GG1A 4KPLA 4FLRA 3T2QA 2QDGA 4PEEA 3P8IA 4F2UA 4I7VA 3VIOA 2BNJA 4J3XA 5EFFA 3LERA 3RRXA 3L4UA 1T8QA 3OZYA 4O16A 3RU8X 3TIMA 6XIAA 2J7EA 3KDNA 1X38A 3L0KA 2YPIA 2YXOA 5FSDC 3FXYA 4MG4A 2GQ3A 4CD8A 3EB4A 4JS3A 5AYBA 1XYLA 1CLVA 3CZLA 3NXLA 1OK4A 3DBPA 1ADSA 3IJDA 3IVUA 4H4IA 1HL8A 1EX5A 4LNCA 5LNRA 3AHZA 1Q6EA 4RX0A 1MEHA 1FWEC 4HCDA 2EQDA 3BLKA 1Q63A 2MUCA 3HFYA 3WH9A 3THAA 4AD0A 1S2UA 1L6SA 3Q94A 4OHQA 1EFZA 4GI6A 3FSTA 1CXKA 1OX5A 4HMDA 4D6FA 1VC4A 1RQEA 1GJUA 2XUCA 1IT8A 5CGQA 2GSEA 3C2VA 2X7VA 1H0IA 2OMAA 3EOSA 3ZO9A 2VR2A 3U7BA 1O5RA 2QCGA 3VKDA 3W7RA 2CU0A 3U3HA 4GXMA 2NX1A 2GQ8A 3S46A 1HTIA 5G2HA 3TEVA 4MB1A 4HCLA 2HPMA 4GYJA 3F4CA 1C8QA 1PIIA 2OEKA 3M5YA 3TK7A 1S3HA 2UY4A 4KCVA 2WBKA 2KX9A 1OFPA 1VHNA 2OELA 4IPJA 3CIWA 1I0DA 3H2CA 2ZC8A 2OEJA 4Q4KA 3V1HA 3O1NA 3JVAA 4B91A 1DWHM 3WFAA 3WG6A 3SSJA 1R2TA 4BI6A 1JQVA 2ZRYA 4UC5A 3AS3A 3LRLA 3VCNA 6A3HA 2XFYA 1EWDA 3OYXA 3S2MA 2RDUA 3AXKA 3LRKA 2BXZA 4UR8A 3SGGA 2JK2A 3SADA 2I14A 4TO8A 4LY8A 3NO3A 1V6UA 4B5WA 1WPCA 2ZUNA 3C6CA 3VIIA 2B0MA 3MSGA 4UUIA 3B97A 4H6RA 5HJXA 4JYFA 2OKTA 3CMJA 2NV2A 1EPVA 1XH0A 2VKZG 1E15A 1KBIA 3DYOA 1E6XM 5B7YA 4AU0A 3ATZA 3W3OA 2ZRXA 2X16A 1TPUA 5FJRA 3HZ3A 3L9CA 2WLZA 5CG7A 4YHEA 4E3TA 4ACYA 4FXSA 3IGSA 4ECLA 4F0LA 3LQLA 2BP1A 2D24A 1H5VA 4TVDA 1XQKA 2PCEA 3DX5A 4Q8WA 1EX1A 4MZ8A 3B8UA 1R87A 3AOFA 3GYCA 4LAUA 4AH7A 4DO5A 4KWSA 3TQ0A 1XC4A 2XH7A 1DIKA 2NXHA 1V3IA 3O07A 1UWAA 1W1PA 2VDHA 4V28A 2O55A 1I6NA 2MNRA 5IFPA 6CGTA 1DPMA 3V3WA 1OG6A 5K9CA 2YL9A 4PRWA 3UXLA 4CD5A 3WN6A 1JXJA 3IIOA 5ABGA 4YXGA 1Q6CA 1C93A 4JR5A 3KM8A 1RY0A 3W37A 1T99A 1EA0A 2IXUA 2ZKMX 1E0WA 2BFGA 3NSNA 1FHUA 4HPHA 2J8GA 4ZB0A 1QPRA 1CTNA 2QGYA 3R58A 4KT2A 1V7YA 2ZTKA 4IMEA 4I5UA 2DT3A 4GY1A 4LWWA 2VZSA 3N3TA 4TV5A 3DGBA 1UW9A 2J7GA 3UWWA 3VKCA 2GUYA 3DU0A 3AMCA 4NZFA 2ZADA 3M07A 1V3HA 1E4LA 3BICA 4I7UA 1VJZA 3EPNA 1P1XA 1WBHA 1X7FA 3QLDA 3W6YA 2NXIA 1HGYA 1L8NA 3DKJA 4U3CA 1FWHC 3K4WA 5H8UA 1CBGA 1PB0A 4MY8A 4F40A 4FP1A 2Z6IA 4JNYA 1EO5A 2ALDA 2QDEA 3BGAA 2VD9A 1GQLA 3S9ZA 1P43A 1TV7A 3LS9A 4JTLA 1Z48A 2WV8A 4DWSA 5LA1A 1PZ1A 4CQ8A 3N34A 1KBLA 3UYIA 2X30A 3OU8A 1LLZA 5EFDA 1JZ8A 1AH3A 3S5OA 4KW2A 4L7ZA 1I2NA 4JEQA 2EG7A 5IDZA 3MSYA 3VGBA 2ACUA 4GQRA 2WM0A 1UP2A 3EWUA 3P81A 2JKEA 2XSBA 3WLKX 3BJTA 1KFBA 4UZSA 3ABSA 4WY0A 1XYFA 3NQCA 1OT2A 1OFAA 1Q8JA 5A1AA 4O1EA 3ANUA 4EXBA 1WKEA 2GQAA 3NVTA 3I6TA 5EMMA 1MUMA 1PXGA 4XD4A 2EEXA 4ICMA 4WOQA 4LF2A 4HHHA 4B5SA 2P8CA 2PWVA 2XINA 7PTDA 4ZGYA 3FVDA 1CENA 1CECA 1TPWA 3LZ3A 3G2GA 2JIEA 2VCAA 2J4GA 3QOKA 1CIUA 2DSKA 3E5PA 3GXTA 3N3MA 2EPKX 3IJLA 5XINA 4WIWA 1DJHA 2HE5A 5CBJA 1MMFA 3P8JA 3U4AA 1V3LA 1ZAHA 1H7RA 3P82A 2KZHA 2ZX9A 2JFEX 3BOFA 4HU0A 3ANVA 4GIYA 3W85A 2CLIA 3DHFA 1BRLA 2RDWA 3KRSA 4PBFA 4UTIA 4ZEPA 2PDNA 4J5NA 4XSMA 1H7XA 1IR1A 1ZFJA 3W24A 4LUJA 3M9YA 1AW1A 2ZRWA 1QK2A 1QNQA 3ZZ1A 1QNRA 3CAKA 1T40A 3KP0A 3NPVA 2YL8A 3NYZA 1DQXA 3C56A 3ZLFA 4TUFA 3SI9A 2J62A 1GZGA 1JPDX 3SCSA 1ZJHA 4OFCA 3WF3A 4J3WA 1LWIA 4O15A 3FEMA 2HK0A 2VR4A 3TW7A 3MKKA 3BAJA 3RN6A 5ECVA 5C9XA 2QMJA 1S2VA 2QLYA 1FCUA 1G4TA 2PODA 3LU2A 3UYCA 4QLKA 2X09A 4EANA 4ES4A 4DB7A 2XJ7A 3GUWA 3M0IA 5FJUA 3VCCA 1YNPA 4ATDA 1PE1A 3M7WA 2C0AA 1YE4A 4RE4A 1U1HA 1FOBA 2L5HA 3NAVA 2GDUA 1IXOA 3D5HA 4N42A 4NXSA 5EA9A 2A2IA 1P7TB 3L4TA 4JL1A 5HINA 2NQHA 1SO5A 4Q4OA 3PY2A 3EKZA 1TJ1A 3BV4A 3R2GA 4E4PA 3ONCA 2GGIA 4IISA 3HPZA 4HMNA 4C6KA 1Z8AA 4EACA 1PDYA 2YCIX 1QPKA 3B8SA 3N2XA 1WXYA 4A3QA 1TZ7A 3BJFA 1ONRA 3OHIA 2NVCA 4D8AA 3KRUA 4MZYA 1HJXA 2XTKA 5A2BA 4IPPA 1NWTA 4NI8A 1XBXA 3FCPA 4CU8A 3GNOA 3VGFA 4XO6A 5CG0A 3RX4A 1VCVA 5LIWX 2Z27A 1JDEA 4I9AA 3OVRA 5I3IA 4MAVA 5D30A 4E2BA 3I7QA 5KZEA 4C7GA 3RDKA 3NGFA 4I5RA 3CUHA 1UZ1A 5FL0A 1Q2SA 5AC5A 4FX6M 1F61A 3SO7A 4E2DA 2A6LA 3VO0A 4GG9A 1R3VA 4UFLA 4H9MA 2Z0IA 3TXZA 4PODA 2FJKA 3TAOA 2YCKX 3EA3A 2QCFA 1O95A 2DY3A 2HVOA 4GPNA 3FY1A 1TYGA 3ZS4A 2CLLA 3NPUA 4OUEA 3LN3A 1LZOA 2W92A 3N2TA 1GUVA 2BX7A 2V5LA 3WLPA 4UOJA 1Q13A 2E09A 4NZ4A 2CLKA 1SW7A 3QRHA 2A1YA 2JIWA 4Q8MA 2X41A 3L7RA 4C6OA 2FZ9A 4AX7A 1BEUA 1M3UA 2HV5A 3GTXA 2I9UA 1P48A 5G2IA 1FDYA 2PDJA 3QYSA 3UPBA 3U2CA 1ZQ5A 3CPUA 4HMEA 3RJYA 4LUIA 1J5SA 2X2GA 1YTDA 3BC9A 2JGQA 2VVSA 3W2UA 3HOJA 1HP4A 4IGNA 2BHUA 4MZ1A 4LAMA 4PMVA 3NO5A 3K4AA 1JNEA 5FAGA 1SR9A 2BASA 2GLKA 3WQCA 3SUVA 2ZDSA 4AEOA 4L9YA 1W3NA 3BMWA 3E5BA 1KR0A 1D2KA 5F4XA 3THCA 2CKSA 3W1AA 2R91A 1EEXA 4I8DA 3NG3A 1FA2A 1UR4A 2VGBA 5BYWA 2P0IA 3NDZA 4HPGA 5FJJA 3K13A 2YR1A 1S5WA 1XW8A 3CHDA 4H7ZA 4GUHA 5BXPA 3QY8A 4WR3A 5KITA 1Y8BA 4J3TA 3EDKA 3WCZA 5CBBA 4RE2A 2QJNA 3VD3A 3DG3A 1R3YA 1EOKA 4CQAA 3F1QA 1JVNA 4BZYA 1TV5A 4JEJA 3W71A 3ZSTA 5CC7A 1TIMA 5EB8A 3UESA 2DORA 4O1AA 4LVDA 2J75A 3A24A 1F5ZA 3S4TA 1E9IA 1Y0EA 1LYXA 3W75A 4RL3A 2YW3A 1BVWA 2QULA 3S6OA 5C55A 3WQEA 1J79A 4J3VA 1ZJAA 3VDAA 1OY0A 5I00A 3U48A 5LNWA 3W81A 5FEWA 3HB9A 1PUDA 1NJJA 1PHQA 2Y5JA 2V82A 2J88A 3TW6A 1Q4WA 2VOTA 4QGCA 2I7GA 1Q7QA 3VNYA 3GR4A 3W83A 1PKNA 1DQWA 1JDCA 1Q4NX 3T0DA 3UJEA 4JX5A 1BFNA 3SUSA 2Y8KA 3A4JA 4H6KA 4L4MA 3W76A 4PMRA 1Q65A 3BAIA 4NZ1A 3QV6A 3B0PA 4CKQA 1KXQA 3QR3A 3GTFA 4ZE4A 2E5BA 3H2AA 1O5XA 3LQGA 4QIUA 2E40A 3A12A 1XJBA 2V2CA 2I5IA 3B8IA 5C5YA 2FTPA 3BGJA 3N2MA 3N25A 4RUBA 3F4NA 3VINA 3LA4A 3QVQA 7REQB 4DJED 3E2SA 2ZYFA 1V6VA 4WSJA 2WKJA 5D9OA 2X8RA 2W0UA 1LQ0A 2WSQA 4XTIA 1MW1A 2ZX5A 5IM51 1UKOA 3QR1A 3NZRA 4UTJA 2YZRA 4A3HA 4M8UA 3MVIA 2A3CA 4KBXA 4BR1A 4DPQA 3HURA 4DXKA 1KXTA 3QXBA 2WWCA 1GW9A 3TZFA 3UJFA 4GC3A 3EMZA 1VD6A 4ZQCA 3UERA 5LNUA 2CERA 3QZ6A 1RALA 4RV8A 1PZ2A 3DFTA 2ZC1A 1TPB1 1T6MA 3BSHA 2PDPA 4WSHA 4D8ZA 1HVXA 3TQKA 1PWLA 2QJHA 3LGGA 2V5JA 2QR6A 4IGHA 4S23A 2X40A 5CLTA 3FNDA 4UIOA 1MXDA 4XD3A 5A5WA 3MUZ1 4IIDA 4IQEA 4GBDA 1NP0A 3TLQA 3NQ7A 1KTBA 3TONA 1VFUA 1WAUA 2W67A 3DEQA 1V0KA 5KEZA 3MJMA 4AG0A 2J77A 1EWEA 3KTCA 4AIBA 1NIUA 4JZ5A 3KW3A 4O1CA 2ISSA 2FTWA 5FAJA 1LJYA 1QNVA 3WF2A 3FYYA 1T7LA 4ACZB 2PGRA 4AZCB 3BSMA 5D04C 4WD0A 1AUSL 1XRSA 3P6LA 3RR1A 2NSXA 1I2PA 4GQQA 2D73A 4S39A 4O50A 5I09A 1VBGA 1ZJBA 1OF6A 2R94A 1NP2A 2Q3RA 3A3HA 4B3ZA 4DO7A 3T9PA 4HT3A 5C2GA 2CNCA 2V3GA 1LLOA 2OOGA 4GI4A 3EPMA 2DPEA 3CLMA 2DW6A 3BAXA 2G41A 2VZUA 2HXUA 2ZUSA 1HUVA 2QCDB 3QY6A 1W1YA 3TFXA 1ITXA 4GY7A 2AL2B 3HBLA 1A5AA 4WRHA 1B1YA 5DF0A 2H6RA 3HPFA 2Z2BA 4O17A 3MMWA 1Q6DA 3H4XA 4ERGA 4DUVA 2XVLA 3VILA 4CD7A 5HAOA 1GVEA 4Q8VA 1W5PA 2OGJA 1V93A 3ARXA 4FOUA 3W7CA 4Q8QA 4TR9A 3UG5A 2I1OA 4DUOA 1GYNA 4Q7IA 3I6EA 4G1NA 2HWGA 5ABFB 1XCFA 4UQAA 1QATA 2FZMA 4MWAE 1XGEA 2EPMX 1KTCA 1GKQA 3QSRA 4QJ4B 1MEWA 1ESWA 3URBA 3KUMA 4Q6XA 2BV9A 2SFPA 3NWRA 4HYWA 4AXKA 1P4CA 4C6PA 1IXQA 1LBLA 4NUWA 4ML9A 2WYSA 2IPWA 3QV9A 2BOEX 4PFMA 2VGFA 4N02A 1H4PA 5SWUA 1MZHA 5JMUA 2TMDA 4O4VA 1K02A 1R2SA 3O06A 1EP2A 3QZEA 2VZVA 2YOCA 2D1ZA 4XBKA 1QASA 2IPFA 3STCA 1A5SA 4P7NA 4TOQA 1AQMA 2WMHA 2P8BA 5HWMA 4HYVA 4UMBA 2EO7A 3QMRA 1E70M 4FI4A 3T2OA 2Q09A 2V3FA 1CEOA 4U2ZA 4FNSA 2WMFA 4JL2A 1LWJA 2DT1A 3PUOA 4LW7A 3HO8A 2HK1A 1DV7A 1WA3A 1J2BA 2CHOA 3H2FA 4Q7BA 3DC8A 3C2EA 1T5AA 4AYSA 2W6RA 2EKGA 4AD5A 3TQPA 3KBNA 3G0UA 3QFEA 1DJYA 1IQ8A 5HJLA 3AS2A 5GJNA 1H7WA 2DQWA 4AWSA 3PHAA 1H0GA 3QMTA 1A5LC 4FLOA 3RUBL 3VIFA 5LKYA 5JBEA 4UQEA 2OYLA 1WE5A 2NZLA 3HFTA 3EWYA 3TTOA 1YYAA 3CO8A 2F2HA 4ERIA 2VTFA 4QS6A 1IIGA 3T6CA 2XH2A 3CV6A 1TV2A 4BCEA 1B9BA 2HVNA 5CKSA 2XN0A 3LY0A 4ZOBA 5TF0A 2EBNA 2ZZ4A 3BCJA 1JCTA 5G5IA 2V5CA 4ERAA 3UZWA 3RGTA 1F4HA 1RP9A 1YDOA 2VUYA 4R7WA 3UXDA 3CH9A 5BWFA 1ZY9A 4LUSB 2PS2A 2V6AA 2H3BA 2PRMA 1P0EA 2B7PA 3WDQA 3CQJA 1H7NA 1GOXA 4AC1X 5D32A 3LPFA 3Q67A 4HSOA 3R0KA 3CO4A 1W3TA 2WJDA 1ENUA 2FZNA 4JGDA 5CAHA 1X8CA 4NASA 1DVJA 1E5NA 3T42A 1M6JA 2NV1A 4DBWA 1TPDA 3UR5A 5FF4A 1NOUA 3GYEA 2J24A 1ME8A 4REQB 4L6HA 1YLVA 4PMJA 4LUSA 1LL7A 1NF7A 3EDJA 3PSVA 1O1HA 3JS3A 1D3HA 4DBEA 5FF7A 3TOPA 4HD5A 4RZ4A 1FP9A 2FFIA 1NDVA 1B0IA 1YRRA 1TIWA 4KERA 4WDUA 1XIHA 1BLIA 4Y8EA 5FF3A 3LYEA 4ZFCA 3RO8A 2QIWA 2ZZ2A 1A49A 3AZSA 3MVTA 1XGDA 4NRRA 2D69A 3VM7A 1MQPA 1DXFA 1DTUA 2HDJA 1FVPA 3AHYA 1L2UA 1OC5A 5EMKA 1EJXC 5CPSA 3KS5A 2VDGA 1UWIA 4W84A 4DYJA 1S38A 3W6LA 1B30A 5CC3A 1Z41A 4UZUA 4H9YA 2NUXA 2UY3A 2WC3A 1N8IA 5HANA 1QHZA 1GYMA 1Q85A 1BYBA 3HGRA 1N55A 4NVTA 3E0WA 1E1FA 5FA5A 2OWWA 1X98A 3O3RA 3KHJA 3W7DA 5MHBA 5F2IA 3GKAA 5C9UA 2P53A 3NZQA 4PMOA 5LIXX 1R86A 5M5DA 3W1RA 1G1YA 4FXFA 4KEMA 2NUYA 3M16A 1ZLPA 2Z1WA 1JXKA 4PUWA 3PBMA 4DEFA 4QISA 3ZM8A 1OQFA 3PZ9A 2VENA 1QO2A 1O12A 4GJIA 1CXIA 4HOZA 1H61A 2Q01A 3SGZA 4HPXA 2WM1A 2I56A 2PU1A 5HQMA 1E6QM 3NZPA 1JCJA 3ATYA 2O9OA 1AW2A 3LBOA 4F66A 1FCQA 4RE3A 3DIPA 5K3VA 3WF4A 1UMYA 4L6OA 4GX9A 1SUXA 2JF7A 4O4WA 1W9DM 4GYFA 4XZBA 2WMJA 3HMCA 3QW4B 2DW7A 3ARVA 3CGTA 1Q6RA 2VO5A 1X6LA 3ZYZA 1MW2A 4QE5A 5CEWA 3CK5A 9XIMA 1B54A 5MKGB 1GONA 4ZODA 4H9ZA 3OEXA 4RZ6A 3FK4A 2XVGA 4HA3A 4XB3A 2PLKA 4IF2A 2FPVA 5CPOA 1YBQB 4M24A 4X0VA 4GXWA 2J13A 1MUWA 5CH9A 1S3TC 4J2MA 1FHVA 4EK7A 3ARSA 1HKWA 1EC7A 5FI8A 5HBFA 4HZ6A 1MFVA 1BKSA 2VCCA 4P8XA 3IRDA 3S1GA 3B8WA 4BWLC 2VYOA 1CI1A 2DIJA 2A6NA 1PSCA 3EB2A 2V8ZA 3HG5A 1QOXA 1BVNP 1Z7AA 3SJNA 3PTMA 1KKRA 4O54A 3UPWA 1GTEA 3UGVA 1V3MA 1FXPA 4H04A 2Z24A 3M0ZA 3OGSA 3B8TA 1KO0A 3MMDA 1CXLA 5C2CA 5I0DA 1F6YA 2NX9A 1QTWA 1VJSA 1U2YA 3EXTA 4Z1DA 2OO6A 5LGXA 2DZVA 3UJRA 1FHDA 4DYKA 3M6YA 8RUCA 4GUFA 2HBVA 3EX3A 1V02E 1I2QA 4GUJA 4QG8A 4NNAA 3DESA 3STPA 3RFAA 1OIMA 4EAYA 4E38A 2ZFAA 4WDWA 1UR2A 1FFQA 1V6WA 1WUFA 2WNWA 3ZVHB 1F3WA 1JCMP 2AGTA 4S3KA 2E7FA 5F1VA 2XN1A 3NVDA 4XBSA 3AALA 3RCMA 4MY9A 2G3JA 1E1CA 3LCXA 2VNCA 4NILA 4FAMA 2FDSA 3ICJA 3WLNA 3TWBA 1S5VA 3PJUA 2TAAA 4RK8A 3VOGA 2QCEA 3H53A 4DJDD 1YXCA 2DP3A 2G96A 4UXDA 4HTBA 3KS6A 1PTGA 3W9ZA 4QDMA 1WZMA 4G5DA 3PWIA 3HQNA 5A6BA 3U9IA 2ABAA 3E0IA 4GNJA 4HZ8A 1RA0A 1AG1O 3EWWA 4RNHA 2PTDA 1XUUA 4RCXA 1CXFA 1W6TA 1FWNA 4HNCA 2XHYA 2E6FA 1TX0A 4QTGA 3W27A 3CH0A 4FO4A 1X97A 3UWVA 3GG7A 1AJ0A 1W1A1 1DTNA 3PB2A 4E8GA 3WH7A 3RLHA 1XDJA 4WX2A 4XBJA 2E1WA 3SCRA 4IXHA 3AUJA 2DZSA 5DN1A 1CGWA 4ZO6A 4ZR8A 3EGJA 1YW1A 4FXJA 3AMDA 4H2HA 4U4MA 4M6PA 1Y5XA 3L2IA 5AC7A 2H9AB 5TBOA 3UR8A 3TQVA 3HPAA 4K38A 1J96A 3VZYA 3KBMA 4N9EA 2VEIA 4PMZA 1J4EA 3WBEA 1E0XA 2ISFA 1E56A 3UWZA 4W93A 1GTHA 3RPMA 3W23A 1DJIA 1G94A 3LHWA 3FGCB 1FH9A 2XFFA 3OHMB 4FR6A 4KWVA 1UKTA 3P60A 4ADTA 4EXQA 1MWOA 3N4AA 5J5RA 2GQ9A 4MJMA 4H3DA 2DH3A 4X2RA 3N2CA 2ZZ7A 3FW6A 4PBEA 4GUGA 2B7OA 3BOLA 2FDMA 3W1XA 3WO8A 3MDWA 3WQPA 1LRQA 2VFEA 4S3EA 3VKJA 1POJA 3C0JA 2V5DA 1BGGA 3EOUA 3KWXA 1M7OA 4KH2A 5ENLA 4EOUA 3ZT7A 1UBPC 1OCNA 1GWJA 2QAFA 1R3WA 1UR8A 5L6UA 2X0SA 3K8MA 3M1ZA 2E9BA 3LLFA 4GC4A 4UFMA 3MSRA 1VFTA 4JY9A 1B3YA 3VIGA 3MP5A 3TTSA 4J2PA 3SEPA 4CLMA 3WIJA 2UZ9A 2YDAA 4IJRA 1GVIA 2YW4A 1PIFA 3BMVA 2XFWA 3QBUA 3K8KA 3ES8A 4FF5A 2ZUMA 3V1PA 3WUBA 3TE9A 2W63A 3INPA 1FH8A 3VVGA 2E5CA 3S5NA 1DHKA 1W9VA 1WXZA 4DXXA 5HNRA 5DT7A 4AIUA 1W5OA 1VBUA 3P61A 3Q45A 2XM1A 1PYMA 1JFHA 4GA8A 4YYFA 1I1WA 1M01A 3UY7A 1UR9A 5EGRA 1FWSA 2EXOA 1UJQA 3KTXA 3TN4A 3HPXA 4GJ1A 3WD0A 1JDFA 4DJFC 4AZ7A 1UHVA 3WFZA 2WHLA 1FBAA 3TSDA 3T0AA 3WD2A 3UFYA 4TMCA 1BYAA 4GZJA 5F4SA 3G6MA 1YPIA 1QWKA 2UBPC 3FFSA 3FIGA 3N2OA 3GC5A 1SM9A 5A6SA 4IIEA 1K7EA 4BQ2A 4GYPA 2OWXA 3II1A 2NQZA 3RCYA 5I79A 1OX6A 3IJ7A 1TWZA 4IZGA 4MKNA 2OX1A 5GJPA 2BOGX 2C13A 5C8BB 3P80A 3BW3A 3RM9A 2FPTA 5AC4A 1H3GA 3A21A 1J18A 1NFBA 2W9MA 3N9KA 3T8LA 4PMYA 1YTKA 3LTPA 2W27A 1UPPA 1A5NC 4FOKA 3VIPA 3GIQA 3LCHA 3TJIA 4RPPA 3APGA 1JZ3A 4QDPA 4N4PA 3UWYA 3DECA 5HR6A 1HZYA 2OOFA 2C1GA 2IQ0A 1K8ZA 3XINA 1O4UA 4YIWA 2VP8A 4QE1A 5CPMA 2PMQA 4UQCA 2ZOXA 5FL1A 4L61A 4PCNA 4N0RA 4K3ZA 1GGOA 1YE6A 4TX6A 1OFQA 5TQLA 4GUIA 4DNHA 1DIDA 4JCLA 5D09A 4PB3A 4Z1BA 4QFUA 2J66A 3MQTA 2G3MA 4ZSTA 4FIRA 4RDVA 1JZ4A 1ONXA 1W54A 2ZQ0A 3OGRA 4RV3A 1IE7C 4W8LA 3SBFA 1EXBA 1EJUC 4GGHA 2R1LA 4YJ5A 5EMLA 1US2A 4FF7A 5HWJA 4FR1A 3JU2A 4UTFA 2PDWA 2R1MA 3M4HA 4BKNA 3LSCA 2IKGA 3UPMA 4W89A 3I10A 3BOXA 4GKTA 4IFRA 4F9DA 3SW6A 1PDZA 2J79A 2O4QA 2PLJA 3G1SA 3PTDA 7ODCA 1FWWA 2V0TA 1HG3A 1BSLA 3L0GA 2XGZA 4MTVA 3B8DA 3GZAA 3QHNA 2D0HA 1XV8A 3M0MA 1HP5A 1C8XA 1ECEA 4ROQA 3MBDA 1MZRA 1WDRA 1EQPA 3ZLGA 5C54A 3IJ6A 3SZ8A 1W3IA 1XQLA 3ZR5A 3F2BA 4V2XA 1AODA 1VIZA 2V81A 3VD4A 3MW7A 4I9MA 4HSNA 4TV6A 4IWWA 3PUEA 4UTLA 1WDSA 3MUIA 1AQHA 1EB3A 3B9AA 2EPHA 4DJFD 4KCUA 4O1DA 4LBUA 4C90A 3ORWA 3LG3A 4M19A 1R7OA 3SM0A 3VOCA 5EMUA 3A5FA 2QPSA 4ORIA 4PTWA 3NL3A 2CHRA 2I57A 3TKFA 5E70A 3GE7A 1Q3NA 5E0FA 5G1YA 1C92A 2NVAA 3CV1A 2YXGA 3SGUA 1GQIA 3MP3A 4NYYA 3VOHA 4HA0A 2J9XA 2WZEA 4GK8A 2OSWA 5CZSA 5KINA 1OD0A 3B9OA 4YU1A 2J7DA 3H7VA 3PWAA 3PN8A 2GVGA 5U7SA 4HNOA 1NSJA 1FKWA 3PWGA 4QR6A 1QFEA 3L4ZA 3C2YA 4GISA 4P2VA 1TJ2A 3GH7A 1QMLA 1JCNA 1MRQA 4M0XA 1BKHA 4DLFA 3UG3A 1BWVA 4PL1A 1FWDC 2OGYA 2DZXA 3HN3A 1VFOA 2Y7FA 1RD5A 4DX3A 1SZEA 3P62A 5ECUA 2TRSA 4XZWA 2AOSA 2X0YA 2QDHA 3BCFA 2HXTA 2PWEA 4Z2HA 4AIEA 2A7RA 2WSKA 1ZBCA 4UQBA 2FMOA 2C15A 4JQ2A 4PA8A 1L8PA 4I3GA 2I9EA 4Z1AA 2BVYA 3DGRA 1MVYA 3CU2A 3NM3A 3OG3A 3TCEA 1YMYA 2VEMA 3VFLA 1OJXA 3WUGA 2DSZA 5CSSA 5CC5A 3W25A 4WEVX 2YA0A 3MUAA 4A3UA 2O92A 5CJ5A 2QJGA 1E3ZA 4D6DA 3R5EA 4I6KA 3OLIA 3W38A 4MKVA 4D8LA 4GLEA 1ISZA 4W4QA 3CTTA 1KGXA 3ISIX 4Y9AA 4QP0A 1RQHA 2YXXA 3W74A 4NJGA 3KAOA 2YZ5A 3SY1A 2BS9A 1BXNA 3V7PA 2PF0A 2E6YA 4RDWA 3W2MA 1TWDA 5T9CE 1JYVA 3R0DA 3NPWA 4S3AA 1EUAA 1XH2A 4V1YA 1PBGA 4FA3A 5EPDA 3MMTA 1EYEA 1VEPA 3TJLA 4E5TA 1R5YA 4H01A 1LM1A 2BOFX 3WF1A 1HGWA 1NARA 3BAYA 3F2CA 3YPIA 2WNZA 3CZ8A 4UFKA 3DG7A 3O9NA 1A50A 1QNPA 4HIBA 4Y2WA 4H9UA 2V2HA 5C7VA 2CETA 4U5IA 1H11A 1JYWA 3A13A 4MJZA 4Y9MA 4CN6A 1W9XA 2OZTA 3W7NA 2XH0A 4L9ZA 1WKFA 1PYFA 4JKLA 3KL3A 5HA7A 4J35A 3WBAA 4XAGA 1BG4A 5M1TA 1GJPA 3U4FA 4Z08A 4ZOAA 2RJHA 4Y9OA 4QCEA 3ZT6A 5JH2A 3LCWA 2XIQA 2Q8XA 2J7HA 3WH6A 3L21A 1H49A 1ME9A 4F0SA 3AIRA 1W9BM 2RJGA 4C5ZA 3KZPA 4H83A 3U57A 1BG9A 3VMPA 1ZB5A 2VFGA 1IF2A 4KESA 3IUDA 4GIRA 3Q37A 1G7UA 4DBDA 3L23A 1XL9A 1VKFA 2Y7DA 4JTCA 2WZIA 1VYPX 4R5EA 3KLKA 3HG4A 3VNDA 5BZAA 4Q8TA 3LCFA 4TTUA 1XF0A 3C2FA 1JUEA 1UZ4A 1NF0A 2QCDA 2FGLA 3FGCA 4LF1A 5AC8A 3C3NA 2YLLA 4A8IA 4QNWA 3QTPA 4WY0B 3W7MA 1K9TA 4QX4A 3MUCA 3H2MA 1X7IA 1DYSA 4LV4A 5FIPA 1EBHA 2BY3A 4JTSA 4IMDA 1CB2A 4MSSA 3IK2A 6TIMA 4IUOA 4L1XA 3APTA 3AMLA 3GB6A 2PDYA 2VUNA 4AD1A 1DE6A 1HQTA 5FACA 1H60A 2QUTA 5D2XA 2WLYA 2DUXA 2PGFA 3KRZA 2Z1SA 2ASHA 5LYRA 4BWLA 1KXVA 1PCWA 1EJ7L 4DYEA 2PSNA 2GSJA 3CZGA 1L2QA 3BANA 4J3SA 3WLSA 3W73A 3GLCA 2MANA 5LXEA 5HDRA 4F0HA 3T0CA 3HGSA 4XD5A 1QU4A 2F2KA 3UA3A 5K2ZA 4TMBA 1HL2A 1V03A 3NNTA 3AXMA 1HJWA 2YSWA 4N7QA 1X1NA 1A4MA 4FXRA 2PUZA 2DQXA 4P8WA 3GXPA 1JRBA 5T9BG 2XM2A 2DUAA 2X1UA 3WUFA 1ZTVA 4OOUA 1BYDA 1AW5A 3MANA 2Y88A 3O2LA 5G4EA 3GG1A 4XD6A 3CM4A 2BGQA 1VPYA 5TD4A 1K9EA 2IW0A 4KFNA 4G56A 4LXFA 3ZVIA 3VE9A 3PZVA 4NHVA 1V6TA 4IFOA 3AFBA 3G1RA 2QCHA 3WFLA 5K7JA 4W5UA 1HO4A 1R6WA 2J47A 3LRMA 5H1WA 3CUIA 5D02A 4CD4A 3FA5A 3FN9A 2UY5A 2WSPA 4YTSA 1D8CA 4L9XA 3OJGA 3RLGA 1WX0A 5LXXA 3EX4A 1R3SA 3F4VA 4C1KA 3WNPA 3K4DA 2FVMA 4QJ1A 4GVFA 4Z2LA 2DZUA 4YCPA 4AVFA 3V5OA 1PHWA 1K7XA 2GJPA 3M0LA 1NWSA 1P6WA 4ZL1A 2R1NA 1ZPTA 2XWDA 4XKYA 4XZLX 1SMDA 4A05A 1HKIA 3W26A 5D03A 4OVXA 1IWPA 1YHTA 1VZWA 3TC6A 2QW5A 4JXCA 1T0OA 4QLJA 4WZHA 4HK6A 3FHQA 3C0QA 4OV9A 1MRAA 5JBDA 3FLUA 2GOKA 1P0KA 3DFYA 1RA5A 1XYMA 1GQNA 1ISWA 1PX3A 1XLJA 3QV8A 1VFLA 2BY2A 2YGYA 3HMJG 2WJZA 1C29A 2J78A 3OLEA 3RAOA 5E93A 4H6EA 3LDVA 1A5OC 4G7FA 4B16A 1EGVA 4ZO8A 2Q3OA 4O14A 4QSHA 3CZKA 5C7HA 3FV9A 3IV3A 3G24A 4JFSA 4DI9A 1OCQA 1R9XA 4DWSD 3S2JA 4L4LA 1EYWA 3QPEA 1XYAA 3STEA 4CEXC 2FGZA 4IICA 5AHIA 4DJEA 1OD8A 1K8YA 4QQ3A 4ZVJA 2PWDA 1AQFA 1OIFA 2XWEA 1GK8A 1WUEA 4DJDA 1UZHA 5I3FA 3ZFHA 1DWJM 2QCCA 3M44A 3PBGA 2HS8A 3UXKA 4HPJA 1R30A 2OJPA 3CPGA 4MHBA 4F3HA 3GTHA 1JCYA 1LQAA 1GVSA 1UIOA 2C7FA 2OZ0A 4HNUA 5GNYA 3IRSA 2EHHA 3ABRA 3M0KA 4HKPA 1REQA 4O11A 4FMVA 4ZOEA 5CZKA 3TFCA 2ESCA 3GDRA 3WUEA 2G8ZA 1XIBA 3CNYA 3AAMA 3E0FA 1XIMA 5AHEA 4EE9A 1YDYA 3C5QA 5AKQA 1A4LA 4F8XA 4M6VA 5A8QA 2VWSA 4AF0A 3PR2A 1KWKA 3U2EA 2E25A 3E49A 3VPLA 2JE8A 3VUPA 1P0NA 3V5FA 4YN5A 1WP6A 1PX8A 1UUQA 3ZVHA 5IBXA 3LBCA 1KBBA 3AICA 3ABZA 3KFTA 4MJ2A 3T78A 3ZOAA 1PTDA 4DJFA 1MI3A 4IP5A 3WD3A 3AU6A 4W85A 5HQEA 1QT1A 3KOZA 3THDA 2D2JA 3G8RA 2FLIA 3BZGA 4X60A 5CBIA 5BMWA 4MUPA 1XYCA 1YPXA 3T09A 2CBVA 2DZWA 3MCNA 1GOMA 1UWUA 5TNVA 3NQ2A 2ZDRA 4LALA 4A2RA 4R34A 1RK5A 1XLCA 1KRMA 3TYBA 3W02A 3WLHA 3W82A 3ITYA 3DI0A 1P1MA 2C71A 2P76A 3GAYA 4QJ3B 3AXXA 1CZ1A 2TSYA 1ZSXA 1O7AA 3IARA 4XZIA 5I3GA 4WXYA 3TJXA 3P93A 3GSMA 3C61A 4Y96A 5JUVA 3QKEA 2OYKA 3IIVA 1B4KA 1X39A 2OO0A 4EF9A 2JEPA 1B3VA 1FCBA 3B0VC 1W5NA 3R1ZA 3HQPA 3OQ8A 1JF6A 2Y8VA 5F2GA 2X05A 2EG8A 1U22A 1CPUA 1IWBA 3MS8A 3I7RA 4OE7A 3R6IA 3WLRA 5REQB 4JTTA 1UROA 1BRLB 3WL0A 3TV8A 1KLZA 4PMQA 4UCGA 1RSCA 4PEKA 3H21A 3IUIA 1TV8A 3A3WA 4RZ5A 2W91A 1ISXA 3GVGA 2YBVA 1KM1A 5GNZA 3G1YA 3RO6A 3VC5A 1BQGA 1XRTA 2P10A 3K1GA 1PL9A 3GK0A 2GL5A 3EWZA 2QAPA 2Y89A 4HA4A 1OABA 3AWNA 1GOKA 4C6JA 3DFSA 4QNEA 3CAQA 2E6DA 4NKCA 4LX4A 3AIQA 2OLHA 3GU2A 1LROA 5ABEA 3VC6A 1F05A 5HMFA 3NQ6A 2Z1XA 2FMNA 4ALDA 1N7KA 3N2BA 3WMCA 2WSYA 3AIVA 3GR8A 4JQAA 5GPRA 2BG5A 5D2YA 1ZAIA 1E73M 3TOYA 2DZAA 2X42A 3AO0A 2C3ZA 1UR3M 2BBFA 3H6OA 1QRQA 4RJEA 4XZMX 2QT3A 3N12A 2AGKA 3BDKA 3NL5A 4MDOA 1M53A 1KV8A 4GE8A 3VNLA 1W1TA 1TZZA 3WNKA 3VYLA 2PRHA 3NURA 5CC6A 2WZHA 1Z89A 4BF9A 3H24A 1QCWA 4LUYA 4F0MA 2OODA 5AVHA 4C6BA 4MYAA 2RH9A 5EYWA 5LNVA 1UG6A 3C0SA 3TXVA 1TG7A 4O19A 4S3FA 1E6RA 3CUJA 3OYZA 3W72A 4EVZA 1XISA 5C0QA 3K5XA 5HNUA 3S47A 2Z2AA 1E71M 1XYZA 3G18A 1DQUA 4ONVA 1F7BA 3H7RA 4L4OA 4INFA 1F76A 1RP8A 4K7YA 2NVDA 2PEVA 4PC8A 3PSWA 1KM0A 1IIHA 5HJYA 3WK2A 1WBJA 5FEPA 1UWRA 3SR7A 1WNOA 3W0KA 4DF1A 3MWAA 4P5UA 4DM2A 3UZ5A 1P6BA 4GXPA 5FF0A 4NXKA 2CXGA 1CGTA 3MHGA 3WQFA 2IQDA 5XIMA 4S3CA 3UWUA 1JDAA 4IG2A 1KGWA 4IQDA 4B5UA 2BVDA 4NAEB 4IP7A 2YCJA 3L4XA 1EGZA 2G4JA 2C0HA 4V15A 1R9ZA 4EKJA 5AOUA 1DJNA 1TRDA 3ABOA 1UD8A 1TE1A 1UOZA 3S2LA 3KEHA 1G5AA 3M6DA 4FSAA 1D7KA 2HQAA 1TWSA 3HPSA 4GIAA 1PAMA 1NU5A 2NQ5A 3TW9A 4Q33A 1OM0A 4BFAA 1BGAA 3GNPA 2VX5A 3N04A 3F03K 5IBXC 4WQ6A 2YL6A 4JIPA 4PSPA 2PDBA 3UR2A 4RW3A 5I77A 1IWAA 1P0DA 1GEHA 4HNLA 2NWRA 4H9VA 2GGGA 3EWCA 1RAKA 2FPYA 4AQLA 3TYCA 1NAL1 1JZ2A 4KGLA 2E67A 4N6FA 1FXQA 4JTKA 4MFDA 4CN4A 5IXEA 3GXIA 3KOYA 2NLIA 2OXNA 2EJ1A 3OVPA 1HT6A 4C6EA 4D9PA 4NJHA 3REQA 4HK7A 1UD6A 1VBHA 3E38A 4MWAC 4B5XA 2BXVA 1H2JA 3W53A 3BGGA 4UR7A 5JXQA 4Q4QA 3D46A 1UOKA 2X0HA 3EAUA 1RJRA 2OTDA 3NQMA 3IGXA 3B03A 4KCWA 1PS9A 1GT8A 3NOYA 3N6HA 3GFYA 1KRBC 4JY8A 3SRFA 2OG9A 2XGBA 4WJXA 3WYZA 4EWJA 5I6SA 5A6BD 3DBNA 3HGOA 4H19A 3PNZA 1JI2A 1TO3A 3AZRA 3BAWA 1J0YA 1OGBA 3GNDA 4YNGA 4BI7A 4C7DA 2I16A 1EL3A 1HIZA 1XCXA 3VTRA 5DMYA 3UT0A 1UPMB 4PB5A 3TYUA 6XIMA 1B3XA 4W86A 3TVAA 2HJPA 3S42A 3A64A 2OSXA 4QHRA 4OT7A 4QITA 3NPXA 1E9YB 3M41A 1GOIA