1LLQA

Crystal structure of malic enzyme from ascaris suum complexed with nicotinamide adenine dinucleotide
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
599
structure length
599
Chain Sequence
SVAHHEDVYSHNLPPMDEKEMALYKLYRPERVTPKKRSAELLKEPRLNKGMGFSLYERQYLGLHGLLPPAFMTQEQQAYRVITKLREQPNDLARYIQLDGLQDRNEKLFYRVVCDHVKELMPIVYTPTVGLACQNFGYIYRKPKGLYITINDNSVSKIYQILSNWHEEDVRAIVVTDGERILGLGDLGAYGIGIPVGKLALYVALGGVQPKWCLPVLLDVGTNNMDLLNDPFYIGLRHKRVRGKDYDTLLDNFMKACTKKYGQKTLIQFEDFANPNAFRLLDKYQDKYTMFNDDIQGTASVIVAGLLTCTRVTKKLVSQEKYLFFGAGAASTGIAEMIVHQMQNEGISKEEACNRIYLMDIDGLVTKNRKEMNPRHVQFAKDMPETTSILEVIRAARPGALIGASTVRGAFNEEVIRAMAEINERPIIFALSNPTSKAECTAEEAYTFTNGAALYASGSPFPNFELNGHTYKPGQGNNAYIFPGVALGTILFQIRHVDNDLFLLAAKKVASCVTEDSLKVGRVYPQLKEIREISIQIAVEMAKYCYKNGTANLYPQPEDLEKYVRAQVYNTEYEELINATYDWPEQDMRHGFPVPVVRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the malic enzyme from Ascaris suum complexed with nicotinamide adenine dinucleotide at 2.3 A resolution.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords NAD-dependent malic enzyme
total genus 211
structure length 599
sequence length 599
chains with identical sequence B
ec nomenclature ec 1.1.1.38: Malate dehydrogenase (oxaloacetate-decarboxylating).
pdb deposition date 2002-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00390 malic Malic enzyme, N-terminal domain
A PF03949 Malic_M Malic enzyme, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1370.30 Mainly Alpha Up-down Bundle Hemocyanin, N-terminal domain Hemocyanin, N-terminal domain 1llqA02
3.30.2330.30 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold arginine biosynthesis bifunctional protein fold 1llqA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1llqA04
3.40.50.10380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Malic enzyme, N-terminal domain 1llqA03
2HJSA 3IJPA 5L7TA 5LDGA 1RM4A 3EC7A 1GZ4A 4BNFA 2HJRA 2JHGA 3QE3A 5I7EA 3TZCA 3RI3A 4DC0A 3NTQA 1X7DA 5TQVA 3OQ6A 3TRIA 3GA0A 2V7PA 2VT3A 3PQDA 3TF5A 5IDYA 1GUYA 1PZEA 2EP5A 4KUGA 4WLUA 2EWMA 4DLAA 5JDIC 3A28A 1GV1A 2PGDA 4Z3KA 1I36A 1O9BA 3RC1A 1GUZA 4EYEA 1HE3A 4NU5A 1E0DA 5IDXA 2X9NA 1F14A 2E6UX 2YUTA 1GADO 1LSJA 4BQPA 5BSGA 1EMDA 1GQQA 1SPXA 3HADA 3CXRA 3KM0A 4IZIA 4CR6A 2CUKA 4CQMA 5C5IA 2YY7A 1DIHA 5JAIA 2CMDA 1MX3A 2CVOA 1R0KA 5ITVA 4M8SA 5KIAA 3PJGA 4R3NA 4JBHA 5T8KC 4UEJA 4U8GA 1A4UA 4OO3A 3KHUA 4WCFC 3GGOA 2EKQA 4JIGA 5I7FA 3M6IA 4UAGA 3PHJA 3ZN2A 4BNKA 1P0FA 1XELA 4JJGA 1YB5A 4IJWA 3ONFA 4YB8A 2GUGA 3SLGA 2EEZA 1JN0A 3QVWA 1HT0A 3ZWMA 1E77A 2Y1FA 3DZFA 3JQAD 3ZV6A 3WWZA 1I3LA 4GWGA 3HJAA 3R0IA 4GQAA 1AXGA 3AUUA 3PYMA 4AJEA 3VHRA 3T4EA 4UUNA 3KBOA 4UEOA 2NVBA 3GOHA 4IMPA 3DBRB 4BGVA 1QMGA 3QVXA 4ALMA 1VI2A 5CFZA 1KEPA 3E6AA 5AVOA 4R9SA 2NADA 3TFQA 1GDHA 4WE3A 2TMDA 2DT5A 7MDHA 1QRRA 3G0OA 4LMPA 5T57A 4MP3A 3ZI0A 4NH4A 3PQFA 4KZPA 4BO6A 4E30A 3QWBA 3BHJA 3NT4A 1DC3A 1IE3A 2PZJA 3WJAA 4CMEC 2YJZA 4XDYA 2NU9A 2QYSA 4CLXA 4D0SA 4EJ6A 3UXYA 3I6IA 3TDKA 5BNIA 4RPKA 3VPSA 3DMTA 5DZSA 4HUJA 1BHSA 3MEQA 1LQTA 1U3WA 4E31A 2WE8A 3UGKA 2VNSA 3TZKA 2GYYA 1P1KA 5HTOA 4BQRA 1M75A 8LDHA 3PRJA 2A94A 3WGIA 3JD0A 3NRCA 4II3A 2ET6A 4CMCA 1E3WA 1ENOA 1YBAA 4JBIA 3ZU3A 3FWNA 1ZXLA 5FF9A 4AFNA 5BQFA 1T2EA 4JROA 1TVEA 2F1KA 5DULA 1FDTA 4GLOA 1UDAA 3VPHA 4D3FA 3VVBA 4DUPA 3KZVA 3BMNB 4RCVA 5DF1A 2QX7A 1YXMA 2CFCA 2G5CA 3CIFA 5JNLA 3QVOA 4DYVA 1IULA 3WSWA 1T24A 3E5RA 5C7IO 2DUUA 1O89A 5JPIA 4DIOA 5LDHA 4R51A 4CMGA 4ALNA 4FS3A 3NAQA 3QRWA 1XWFA 3LYLA 1UDBA 3TOXA 3IAHA 5A3JA 1U3TA 2VYVD 2EKPA 3DFZA 1E6WA 1VRWA 3IIEA 3R3SA 2C2XA 1Z45A 4J90A 1SEPA 1PQUA 2FZWA 1K6JA 4CLOB 1LLQA 2EW8A 1MXFA 1JKJA 3A1NA 4L8VA 5JMWA 4BKRA 4Y9DA 3LDHA 5IDQA 1NFQA 2X5JO 1BGVA 3EK2A 4IQ0A 1P1JA 3EHEA 3RJ9A 4A26A 4PG7A 3ZV3A 4GGOA 1KVUA 2IZZA 3A4VA 1VL0A 3PVZA 4PRKA 3SJUA 1OFGA 2UYYA 1SO8A 4AVYA 2UDPA 4GMGA 3ZU2A 1JLLA 4HV4A 2ZB3A 3JYPA 3JSAA 3TWOA 4GLLA 2O3UA 4AJKA 4YCAA 3E9QA 5FI5A 3VKVA 1KIFA 4R9RA 1T2AA 1JAXA 3HNPA 3ITDA 1NPDA 1ONPA 2B35A 4KDFA 5A3VA 5C7LO 1V35A 3RUCA 3COSA 4YQYA 3D4NA 2HK8A 2VWQA 5DCWA 3W8EA 3WQSB 2Q4EA 4KP7A 4BO1A 4UUMA 5F1OA 1BXGA 3RASA 1P1HA 2D0IA 3C24A 4FB5A 1ADFA 3OF2A 4B3JA 4DQVA 4ILKA 3E82A 4IJUA 1SEVA 1HEUA 1Z6ZA 2O3SA 3KSUA 5FYDA 5G0SA 4GX5A 3KLMX 3H8VA 4CL8A 3I6QA 5DBIA 5HRUA 1MG5A 4IDEA 4J9VA 2PA3A 5B37A 1A5ZA 3T7CA 3R1IA 2F00A 3E48A 4BL5A 1NPYA 1ISGA 3VAZA 3JYNA 1PR9A 2AQ8A 2GZ2A 2ZB4A 4TKLA 3GNSA 3DOOA 4RDIA 4WGGA 4BO7A 1H6AA 3GEMA 2NLOA 4XJSA 3L4SO 4LMRA 1MB4A 5KVQA 3U3XA 1EE2A 3VZPA 1HYGA 1L7DA 3O9ZA 4R69A 4W4TA 3G3EA 1NQTA 3FCOA 4OIMA 3PJDA 4L9RA 1PJCA 3ST7A 5EPOA 4AJNA 1LDBA 4CLRB 1H9AA 2Q49A 1PGPA 1PL8A 1WZIA 3H2ZA 5H83A 3WQQA 4KQXA 5LC1A 3L6EA 1BW9A 1DIGA 4A7PA 1Z73A 3I1JA 1NFRA 5KVCA 2PY6A 2UUOA 4RVFA 1UDCA 3W8DA 5JC1A 3TOZA 2PKQO 5AXBA 3WR5A 4O59O 5EQDA 5A1TA 1PR3A 3DOJA 4E6PA 1NP3A 2EJVA 3TPCA 3DBHA 2GN4A 1EEHA 1JWAB 5A5FA 1KY4A 1XKQA 4ZQEA 4C7KA 3EVNA 4G5HA 4I5FA 2DTXA 4MVJM 1CQIA 2P9EA 1DRUA 5BSHA 3Q6IA 2AXQA 4J0EA 3U9LA 2FWMX 4K6FA 4ZD6A 1QSGA 4IDDA 4HWKA 1E7WA 2HRBA 4CV2A 1QYCA 1OMOA 2BHLA 4JN6B 2JFFA 4GWKA 3L6OO 4EDFA 1P1RA 2Y99A 3E5MA 3GUYA 1E7MA 3Q2KA 2G76A 5JC8A 4XRRA 2AE2A 3MTJA 4M55A 4CQMD 2I67A 1GCUA 4ZVVA 3C7AA 3RBXA 3GDOA 2VRCA 4D79A 1MC5A 5IZ4A 4XD2A 2EIHA 2JJYA 2Q50A 3GVXA 4BNXA 4CM7A 4B4VA 2BI8A 2RBEA 2YYYA 3JV7A 4XQ9A 1KS9A 1N7HA 4DBZA 1GYQA 3L0DA 3MJEA 4PIVA 2FOIA 1MGOA 2HQ1A 6ADHA 4RPJA 1W8DA 3FI9A 1GU7A 1JW9B 1N9GA 3ETGA 5TS3A 4CM9A 2AG5A 1DAPA 1EDOA 1J49A 3GVCA 3CMMA 1U9JA 2X4GA 3WBFA 4Z9FA 4U5QA 2RHRA 4PLTA 1BVUA 5JY6A 3U09A 3ZNPA 3RKRA 2AQHA 1M6HA 3ABIA 1ULUA 2FPIA 1CQJA 1DC4A 3P2YA 2DFVA 2Z1MA 1H9BA 1WWKA 3DBVO 4JCOA 3I9NA 4GKVA 1G1AA 2PH5A 2OO5A 3LC1O 1PGQA 4D0RA 4K26A 3OA2A 3RUIA 1A72A 2VHZA 1N8KA 3MWDB 5I7SA 1WAMA 1GTMA 4JBGA 4DPKA 2ZYAA 1DRVA 1GPDG 2PFGA 2PTGA 4BGIA 3DMTC 2OL4A 2NV6A 4J2HA 3OJOA 1YL6A 5KNLA 3WFJA 4FFMA 4PG5A 4QSMA 1GUFA 4OH1A 2UAGA 1RYEA 1U2GA 3GQVA 4LRTB 4D44A 2J5KA 3EYWA 2JAHA 4PZEA 1DXYA 3Q2IA 3D3WA 4MVJH 4RF4A 4NBRA 4TZKA 1LLUA 4Z6KA 1CYDA 1H5QA 1NM5A 4DBVO 4IDGA 3DC2A 1ONOA 1HRDA 1QLHA 4JXKA 1ISJA 4ZN6A 2PLAA 3NGLA 4FFRA 2NWQA 1B26A 1WP4A 1MG0A 2Y68A 4TVOA 3RQSA 4DLBA 1U3UA 3E18A 2W2LA 5IAAA 1PL7A 3F4LA 2I9PA 4NK5A 3IOYA 4XCVA 5G0WA 3AOGA 4EITA 5B4TA 4PLCA 4ND4A 3GZNA 3WMWA 2VWGA 4N5NA 4IUYA 3AM5A 1EVIA 4IQ8A 4BGEA 3S55A 2YFHA 4HFMA 3V2UA 2GERA 3SJ7A 5AXAA 3OM9A 3RIHA 2D8AA 2QG4A 5IN4A 2GPTA 2VCYA 4JLWA 3KXDA 3JQFC 3CTMA 5A9TA 1N92A 1J4AA 2AA3A 1DEHA 2UUPA 3ZWWA 1GV0A 1XR3A 4KUHA 3GUCA 3GT0A 1I0ZA 2JCVA 1Q1NA 1P44A 4F3YA 3EZLA 4YAIA 2X58A 4I5GA 2C59A 4ITUA 3UH1A 2NNLD 4NQZA 1GEEA 3HB4X 3D7LA 3LC2O 3QJ5A 1F0YA 3NDRA 4XZ3A 4A5OA 4DREA 2X1HA 1PL6A 3RVDA 1H93A 2HU2A 1U8FO 1VLLA 4H3VA 1I3NA 1VSVA 4U6QA 4YYZA 2VN8A 4J4TA 5JLAA 1QLJA 3HDJA 2E4AA 3SBOA 2JKVA 3AFNA 4LSWA 5T67A 2PH3A 1LNQA 1ZVMA 3O38A 5CEJA 2A4KA 1A9YA 2YV1A 3INTA 4F46A 1K89A 3RBVA 3K5PA 2WTBA 1B15A 5J23A 4AJPA 2FMUA 1ZCJA 3JYOA 4EJ0A 2EJWA 3E1KA 1ISIA 3G1UA 4R5HA 3WGOA 4ESOA 4EGFA 3O03A 1E7SA 4W9NC 5HWSA 3NKLA 5IXSA 1WMBA 2GO1A 1LRKA 2EP7A 2YV2A 4W82A 2D1YA 2HK7A 3OHSX 1LA2A 3WNVA 1DO8A 2E48A 5FEUA 5L95A 3ON5A 4PG8A 2NTJA 3I83A 3PZBA 5DP1A 1T2DA 3NDJA 1UAGA 1OC2A 5ENVA 1LDEA 2BGMA 4BKQA 1YGYA 3K73O 5HS6A 4OXYA 1ZUD1 3S8MA 4HNHA 2C29D 2PZKA 4RF3A 2P5UA 2O3QA 1ZW1A 4M89A 2W90A 1PJ2A 3F5SA 3WXBA 3AJRA 3C7DB 2ILTA 5DBFA 3PTZA 3N7UA 4Z9XA 1SBYA 3ZDFA 1ZO8A 1F06A 2ZCVA 2O23A 1FJHA 1VL6A 3MOGA 4Y67A 3ZWOA 5T8KA 5FWNA 2Y93A 3NGXA 5DT9A 1UR5A 4ZA2A 1QV6A 4RVSA 1T1RA 2BFPA 4NBTA 2RHCA 1YWGO 4UVEA 2QRKA 2P68A 3QVTA 1HYHA 4WCDA 4Y8VA 4YT2A 1O5IA 3QWIA 5F1KA 1BTOA 3ZZNA 5GZ3A 5JXWA 4QQRA 3AK4A 5L7WA 1RM0A 3PLNA 4BO5A 3PFFA 4BNTA 3RUAA 3L4BA 5ER6A 3C1OA 2O4CA 6LDHA 3TNLA 2Q1TA 1KVTA 3VPFA 1DHTA 4K6CA 3H5NA 4FDAA 4J16A 1LDMA 2J3JA 3HSKA 4RLHA 4WLEA 4CMAA 4XRGA 4PLHA 3DFUA 4FIZA 3ENKA 4E12A 2X22A 3M1AA 3ROKA 4BMSA 2RAFA 3PWSA 4BUCA 3AUTA 4IZHA 3DAGA 2GRAA 3UCFA 2H63A 4TSKA 4CMKA 1UP6A 4D42A 4Q3NA 1AHHA 3KB6A 4UVDA 2X0RA 4CUKA 4YJGB 4G2NA 3AW9A 3RAJA 2BD0A 3GFGA 1E6EA 4LSMA 1EBFA 2B4TO 4OYRA 2HAEA 5LCXA 3ZV5A 4JK3A 3BHMA 2Q2VA 3KV3O 1PQWA 3D3EA 4URFA 5TLSA 2DUWA 3ZU5A 4L73A 4RVGA 1T25A 1BXZA 4BV8A 1V6AA 3DAPA 1ZSVA 4XYMA 1ZMOA 4PLGA 3GVIA 3AY7A 2J5QA 4WOKA 3U49A 1O94A 1ZSNA 4P38A 1I2ZA 3PPIA 3JQDA 4WLVA 3VVCA 2NU6A 2JHFA 4UREA 4CR8A 4TKMA 3SC6A 4R5MA 3C7CB 2P9GA 1F12A 1PJ4A 4XB1A 3DHNA 3ZWXA 4FD3A 1ADGA 4OMUA 4D7AA 2NTVA 4Q3CA 3FPCA 4RVUA 2FHSA 3I4CA 2Y1GA 4DTIA 3IUSA 3QY9A 4J1QA 5IDWA 1YQDA 4HKTA 3GAZA 1LI4A 1HWYA 1WVGA 4EUFA 4OXKA 4KOAA 5GMOA 3IS3A 4II2A 4AL4A 5JCJD 1ZEMA 3Q0EA 2I5PO 2P4HX 1KEUA 2VHVA 3NT5A 3AU9A 2WYVA 2FR1A 2NVWA 3ZNOA 4ALJA 4BNZA 5K9ZA 2WM3A 5EIOA 2I65A 4QFCA 3M2TA 4CLRA 2ZTUA 3D5QA 1CF2O 4RORA 4CQLB 3KYCB 2O3RA 1BG6A 4A10A 3H3JA 1NQ5A 2JL1A 2AEJA 2PKRA 4JNKA 4U6SA 1KEVA 4GL4A 3PHIA 3ROPA 1Y1PA 2D3TA 3DBLA 4JGBA 3ZHBA 1EDZA 4BNIA 3K2EA 4YJFB 3AOEC 4YAKA 1Y9EA 2AW5A 2PK3A 3OQ1A 4U0KA 2X8LA 3JTMA 4J7CA 2B4QA 4OKNA 4GGPA 5COAA 5G0VA 2EERA 2H9IA 5L4SA 5EL0A 1TT5B 1DHRA 4B8ZA 1HE4A 3OIFA 3DWFA 3PWKA 4TVBA 3ZWVA 2WSBA 5L7YA 1XIVA 1BXKA 2EW2A 2FSVA 5CDYA 2GF2A 3I9KA 3MJTA 2GCGA 5EESA 4FJ1A 4ZJUA 1UZMA 5K6AC 3JQ8A 5IFLA 4NHEA 4XKJA 1UJMA 2O7SA 4N18A 1GPJA 3LZ6A 1NNUA 1LXCA 1YVEI 2DKNA 1B16A 2EKLA 2NVUA 4P4LA 4E2WA 1PIWA 5A9RA 2ZTMA 3ADPA 1DOHA 2VNAA 1VJTA 1ZH8A 3MJCA 5H82A 3RD5A 3BMQB 4MVJP 1XQ1A 3ZHYA 1XSEA 3S2GA 4WPGA 4CM8A 2I6TA 1VL8A 1PJSA 2A35A 4D45A 2FPPA 2ZQYA 4B4WA 1Y5RA 4D43A 3AM4A 3RFTA 3F5QA 2C5EA 5EMHA 4K9DA 4M49A 3QIVA 2Q46A 2OORA 3K9QO 1XQ6A 1MFZA 4CLDA 1JTVA 3RKUA 3RJ5A 9LDTA 1LBEA 4WOJA 1DC6A 3QQPA 1T1SA 5JS6A 3U0BA 1EK5A 2XOXA 4WNIA 4DIFA 1U3VA 1NHWA 3TN7A 4N5MA 3WGHA 1YB4A 1U7TA 4PZDA 3LQFA 1S6YA 3WGTA 1DIRA 3LLSA 1YL7A 4P8RA 1ZK1A 4IJKA 5T64A 3DEYX 4LGVA 1PJTA 2Q1UA 4WNCA 4DQXA 1EQUA 1KETA 1Y8QA 4M1QA 1MFPA 1P45A 2X7HA 4IJVA 4H15A 1HYEA 1YKFA 3EAGA 1IY8A 4MKXA 4WLOA 5CPFA 3D3WB 4BHTA 5ILOA 3X2FA 4IINA 1B8VA 3W4KA 1V0JA 4E5MA 3WWYA 4DGSA 1Y9AA 4FSHA 5TX7A 4A2CA 4BNJA 3VDQA 4IY1A 2CF5A 5A4DA 2CD9A 4KQWA 2PD3A 1EUZA 4B7UA 4MIYA 1Y8RB 1NWCA 2PNFA 3K6JA 3P7MA 3OMLA 2Y0EA 3PI7A 2RCYA 3IJRA 3ENNA 4Q39A 1GQYA 2DPHA 2OUIA 4MVJG 4E33A 1AE1A 3GZNB 1FDSA 3JQBC 5T6BA 4AJ2A 5CDTA 1P74A 1VC2A 2ZB7A 3QWAA 4XX0A 3DTTA 1GYRA 2IYOA 4I5EA 3I9JA 4CODB 3B1KA 3UUWA 2EV9A 4K28A 2QRLA 1Q0HA 1M2WA 4DPLA 3F4BA 2Q4BA 5I7VA 3NDIA 4CV1A 1VPDA 1FDVA 3AFMA 3IUPA 2O2YA 1EUCA 3OFSA 3QSGA 5JAMA 2DTDA 4HXYA 4IDFA 1UH5A 1DJNA 1PGJA 2EF1A 4J4HA 2POQX 2X0JA 1YO6A 2GZ1A 3C8MA 3I23A 4TQGA 5KJ1A 2CDCA 2NACA 2DBQA 1MA0A 3WLFA 1E7YA 4U7WA 1I3KA 2Q1WA 5I8ZA 2Y1DA 1Q7CA 1ADBA 3H9GA 2HMVA 5BR7A 3DMYA 5HBRA 3UF0A 3LT2A 4RF2A 4PCVA 4FOOA 4YEDA 3FR7A 4WK6A 4IDCA 2GGSA 3AUSA 1QYXA 2LDBA 3WYEA 4NMHA 4M87A 1CDOA 2P9CA 3V1YA 8ADHA 3GPDG 4KTVE 5F5LA 2IXBA 3WS7A 4CM6A 4J6FA 4TZTA 4WCFA 4F6LA 1ORRA 1LX6A 3IQDB 4BOYA 4KMSA 4BNUA 5G2OA 3H3FA 3HDQA 5G4KB 2CVZA 2BH9A 2DQ4A 5JO9A 2R2GA 3ZW8A 1H6DA 5TIIA 1UAYA 2DTEA 4MP8A 1LEHA 3R3JA 2C7GA 1XGKA 2VQ3A 1R0LA 3OETA 5ES3A 3FSRA 3LF2A 3BMCA 5L9AA 2GN6A 3JQBA 2ZIZA 1X1TA 4QO8A 2I3AA 2OP1A 3I4FA 1ZFNA 4HX5A 2B4RO 1I30A 1PTJA 4H16A 5DP2A 3IKVA 4YWJA 3UCXA 4EUHA 1H94A 1ZKMA 4O0LA 3RSHA 3U4CA 1ID1A 3MZ0A 1GR0A 2B37A 3DQPA 3R6DA 5F5NA 2EG9A 3HN7A 5KKAA 5KJ6A 3K30A 1JKFA 5TRTA 3BTOA 4Y6RA 1Q7BA 3ZWYA 3HN2A 3O4RA 1SOWA 3ZWCA 1IHXA 2GN9A 2HK9A 5JYDA 3VZSA 4XEHA 3PGJA 4BO3A 1SNYA 3KYDB 4IDBA 4A0SA 4E5NA 2R00A 3ULKA 2Z1NA 2Z5LA 5F1PA 3JQ7B 3B1FA 4NBUA 3MCVA 1I32A 1XCBA 4Z0HO 1E1KA 3I3OA 5ICSA 4ZHSA 3VPXA 4CV0A 4GI2A 4HY3A 3TZ6A 1JQBA 2Q2QA 3Q1LA 1CEQA 3WYBA 4BNHA 2QZZA 1Z82A 1BVRA 4J91A 1X15A 3C1AA 4FOSA 4TRMA 2Q3EA 4GAEA 3NX4A 3GFBA 4KWIA 2X5OA 1EZ4A 4EZBA 2XXJA 2C5AA 1VSUA 3KYDA 2BI7A 1DAOA 4DPMA 5AOVA 1DLJA 3RFXA 5G0UA 1R66A 3KEQA 1GL3A 2VOJA 3FHLA 2W4QA 2YHIA 4N7RA 4XYBA 3F47A 3G49A 3P5SA 1LRJA 1TI7A 4L0QA 2VOEA 4E3ZA 2IE0A 2VZ9A 3N74A 5G4LA 1KEWA 4LCEA 1W4ZA 4XWYA 5DNAA 2GLXA 4FCCA 3KYBA 1KVSA 2C20A 1KY5A 4FW8A 4BNGA 2O7QA 2O3JA 3ROQA 4HBGA 2XAAA 3IMFA 4R68A 4ND1A 3KUXA 3OH8A 2D5CA 4BB6A 2O48X 1XEAA 3GZ4A 1NAHA 4BVAA 1I3MA 3K2BA 3NEPX 4ZQHA 3ZH2A 1IB6A 1I01A 2C07A 1NFFA 3WTCA 3ETDA 2CDAA 2I99A 1UXIA 2VYND 4RQUA 1T2CA 2H6EA 2OMEA 4PGFA 1ZXBA 4B7CA 1HLDA 3UICA 1ZK4A 1N7GA 1UXJA 3ZU4A 4BNWA 4RVHA 3RC2A 3W4IA 2VUTA 3I52A 4AJ1A 1T4BA 1IZ9A 4D3DA 1NR7A 3RU9A 5JDCA 1SB9A 1KYQA 3BMOB 2HMWA 1NBOA 2HUNA 4ZRNA 3GNTA 2V6BA 2VT2A 4W7HA 2TMGA 3GEGA 3OP4A 3VPGA 3OA0A 3DBLB 3ICCA 5B1YA 1Q0QA 4AJIA 3BTUA 1TXGA 1T2FA 1B3RA 1R4MB 3KOUA 1PGOA 3IP1A 2XPCA 5CDUA 3P2OA 3JQGA 3BHIA 3E9NA 1LDNA 1B8PA 3VH1A 1QV7A 2AHRA 1ISHA 3JYQA 1YQGA 5JBIA 2QYTA 2ZTLA 1DBVO 4QUKA 2IRWA 1WW8A 3GNQA 3VH2A 4EJMA 5B4UA 1OZAA 4NFYA 4L4RA 1A7AA 5ER9A 3AI2A 2IEBA 4YAJA 1H2BA 2B5WA 4NBVA 3TL2A 2OZPA 4CM1A 5CHEA 2G82A 4DRYA 5JCJA 2E82A 3PIIA 5U4QA 3GC6A 1A7KA 1R37A 1IHYA 3GG9A 4YJFA 1NYTA 2NVUB 1SZJG 3K31A 2ZYDA 3FPLA 2OFPA 1EUDA 3NJ4A 3W1VA 4CM3A 2C2YA 2HO5A 4BB5A 4FFLA 3VH4A 3ANNA 5C7OO 4E5KA 1MV8A 3HG7A 1WLYA 3DR3A 4QFDA 1J0XO 3PFWO 2DBRA 4RV9A 1D1SA 5ITWA 2CNBA 2J3KA 1E7RA 1UXHA 3GN2A 2WD7B 5A03A 3BAZA 2PD6A 5L4LA 3KRTA 3PIDA 3HWRA 1D7OA 1A4IA 3G17A 1OC4A 4AJ4A 1K0UA 4PFJA 1U1IA 1XA0A 2HLPA 1D3AA 1K6IA 3FBTA 4NPCA 4CL3A 4MP6A 1QP8A 1X0VA 3BMQA 4UUOA 4CV3A 5K6AA 2BFAA 1CJCA 4ALLA 1JA9A 3CZMA 3RBZA 1GD1O 4AG3A 1P9LA 1I5RA 4NFSA 4GMFA 4O5OA 5JY1A 4GH5A 2HRZA 4XR9A 4DIBA 2YFQA 3WB9A 3LU1A 5IZCA 1M6WA 2GD1O 4TWRA 3WBBA 2QRJA 1E3LA 3WX0A 1RM5A 4B4UA 3QW2A 1QYWA 3ZWNA 3HZZA 5ILGA 3HUDA 3RU7A 3PHHA 1IZ0A 2AE1A 4DL9A 4JJFA 2VRBA 2XF8A 4OGWA 1HDXA 2OP0A 3TZQA 1MC4A 5A5EA 1I33A 3ADOA 5L40A 4RPHA 3WDSA 4MIEA 4OXNA 1QG6A 1ZNQO 5FI3A 4Q3EA 5JO0A 3QVSA 1R4NA 3JQ6A 4YDRA 3WG9A 2VUSA 3PYLA 1EFLA 3FD8A 3MWEB 4ZQFA 1BWSA 3GVPA 1YBMA 2FPGA 4CQLA 1X7GA 2YV3A 1T26A 1U8XX 1AHIA 3VZQA 1KC3A 4BO4A 2RH8A 3NYWA 1H6CA 3FN4A 4S3MA 4LK3A 2CF6A 3UW3A 4P4NA 2E37A 1HL3A 3OJFA 1E5QA 2EXXA 3M2PA 4RL6A 4X54A 3I5MA 1X14A 3QP9A 1IL0A 2OBYA 2QW8A 2C54A 4J43A 1WXDA 2X9GA 4IXWA 5KWEA 3WFIA 3HFGA 4RJTA 4Y98A 5CAEA 3EUWA 1XU9A 3KTDA 4O63O 1T4DA 4N5LA 4CLHA 1VJ0A 4CUZA 3EW7A 3P19A 4OQYA 3U5TA 4BO8A 3GAFA 2YDYA 1XU7A 1Y8RA 4YJHA 1EVZA 2PZMA 4E2XA 3LF1A 4RZHA 2IXAA 1LDGA 1S7CA 3DXFA 5T5QA 4GKBA 2A9FA 2O2SA 2BFMA 4INAA 2EGGA 1KVRA 4PLPA 4PRLA 2HDHA 1ZZEA 3G1TA 3F9IA 4Z3DA 1E3SA 4LVUA 1Y5MA 1BRMA 4ND3A 2VTEA 4XIYA 5I9MA 3V2HA 4ALIA 2ZCUA 5L4NA 1ARZA 2G1UA 3LC7O 1VKOA 1NX6A 2NU7A 1LU9A 3NUGA 3LLVA 2EHDA 2HMTA 5COBA 4CUJA 4E32A 4D46A 4CMIA 1I10A 3GDFA 4F6CA 4YT8A 2GASA 1VKNA 1X7HA 1PZGA 1V9LA 2OHXA 5JAZA 2D4AA 3RWBA 4FR5A 3DDNA 1U5CA 4QECA 3ETEA 1HXHA 4DLLA 3BMCB 4YQZA 3GRPA 3MJSA 1CWUA 3S2IA 3T7EA 5L3ZA 5EJ2A 5A05A 4BNYA 1RKXA 5G4KA 4NU6A 2VUUA 3AI1A 1PJQA 2CDBA 2NQTA 1JAYA 1A27A 1I8TA 4UUPA 4TMFA 2Y1CA 1N1GA 1MLDA 1I2CA 1OOEA 3JD4A 5K0ZA 1G6KA 1HSOA 2G17A 3D1LA 3WMXA 3FRJA 4J4BA 4CJXA 1W73A 1KBZA 4Y6PA 5BNTA 1QYVA 4R1SA 5TC4A 3VKUA 1Z7EA 1LUAA 4ROSA 3PQEA 4BNNA 3D5TA 1Q2XA 1YOVA 1BDMA 4FFOA 2YQ5A 1A71A 1DRWA 2CZCA 1U5AA 4KWHA 2DBZA 2VWPA 4CPDA 5F3RA 4MKRA 2WJPA 2OXIA 3U62A 4FN4A 3BTSA 2B69A 4BO0A 1YQXA 1EK6A 3DZJA 4DXHA 4ZQGA 4J2OA 1EVYA 1PZFA 2IZ1A 2AEFA 1JVBA 4QT0A 1CRWG 1NAIA 1U7HA 3GK3A 5HS4A 4A03A 1ZK2A 2BF7A 1HDGO 1EE9A 4I8XA 4Q3BA 1XG5A 3UOGA 2ZQZA 1H2HA 3IC5A 1C1DA 1U4SA 1ISFA 1YRLA 4YAEA 5TT1A 2X0IA 3ASVA 3EMKA 3F6YA 1OAAA 4YT4A 4XB2A 4WKGA 3A14A 3LT4A 2HCTA 3ONEA 4XIJA 1K2WA 3D64A 3MTGA 4O6VA 1D4FA 1FK8A 1JU9A 1UZLA 2ZYGA 3ANMA 3H7AA 4AJHA 1E5LA 1X1EA 5TJHA 4GX2A 3TQHA 3JQ7A 4DVJA 4R1NA 5IXYA 3F1LA 2WWRA 4MDHA 4LCJA 3GLQA 3H9EO 3RUEA 3RUFA 1KERA 4BIIA 7ADHA 2DAPA 1NVTA 2Y1EA 4UVIA 3DOCA 5DOZA 3JD1A 3NV9A 1GY8A 4P22A 4MKZA 4J1NA 4MVJF 4PLVA 5A9SA 4NJMA 1LLCA 5JMPA 2QIOA 1G0NA 2HSDA 3FR8A 3WYCA 4CMEA 1MUUA 4C7JA 3BXXA 1WDMA 1LC3A 2GNAA 3WNQA 4B3HA 5AQ1A 2X0NA 1Y81A 2X23A 4R54A 4OAQA 4L76A 3W8FA 2PGLA 3B20A 4I9HA 1HDZA 2NQ8A 1Z74A 1ISMA 1Q7GA 1GCOA 5U9CA 1PX0A 3S2FA 5A9SB 2JD1A 1GZ6A 1ENZA 2WYWA 1IOLA 5JSFA 4RVDA 1HDCA 2ZB8A 4J7UA 2P2SA 2FY8A 2NM0A 2FR8A 1WMAA 3WICA 3TFOA 2GR9A 3GMDA 2OGUA 4GSLA 2JD2A 1D8AA 3AUAA 2QZ9A 3GF4A 1FXSA 3K92A 3OICA 3EVTA 4BNLA 2JD0A 4L4XA 5JAQA 4BO9A 4ZICA 4HP8A 4IS2A 5DDIP 3FWZA 3PDUA 4WCFB 1B8UA 1BW9B 3FTNA 4JJIA 1DSSG 3QA9A 2I66A 2BMAA 4MVJE 4ZRMA 3BA1A 4J7XA 4J1SA 2J8ZA 2QHXA 3QHAA 5BSEA 1WZEA 4FJ0A 4YXFA 3PLRA 5TSDA 3PWZA 1ONNA 4FFNA 3DZBA 4HFJA 4Y6SA 4BV9A 4NDNE 1HETA 3O8QA 2NSDA 3BIOA 2I76A 4XGIA 4BKOA 4QXMA 2CY0A 3V1TC 4D3SA 1E3JA 4MJLA 1YS4A 1PU2A 1C0IA 4EEZA 1DLIA 3JQFA 4LRSB 2WDZA 5AXCA 1I2BA 5HA5A 2EGHA 1PQPA 4HNGA 1EBUA 3OECA 3ZCXA 2OBNA 1O8CA 4MO2A 1JVSA 5IG2A 1PZHA 2PKQP 2BLLA 1NHGA 1YBVA 4GX0A 3CEAA 1ZK3A 3JQ9A 4IIVA 1B14A 1SB8A 3GN1A 2C7VA 3I9MA 4WJZA 4M54A 4WASA 3FF4A 1VM6A 1ENYA 3U4IA 2D59A 3DAFA 4B7XA 3TZHA 1U4OA 1WNTA 3OEYA 1L1FA 4BMVA 1EFKA 3N58A 3VC7A 4Z0TA 4PG4A 3H65A 1LRLA 3B1JA 3GDGA 3V5NA 4F45A 2AG8A 2Z95A 2VZ8A 5CG1A 1K3TA 3OIDA 4IMRA 1SAYA 1YL5A 4EEXA 4NIMA 5DBGA 1ML3A 3L07A 4WLNA 3WIDA 2AQKA 4E5YA 5EINA 5EERA 1LQUA 1NASA 4B3IA 3KSZO 3VTFA 5EN4A 3GHHA 4KTTE 3F1KA 1GQ2A 4YRBA 2NUAA 3UCEA 4IGEA 4XDZA 4RLSA 1B0AA 2BELA 1GFSA 4R1UA 2X5KO 4CLEA 4UVHA 4Q9NA 3RC9A 1AXEA 3QWFA 5F21A 1Y6JA 3GG2A 5GY7A 2BFOA 3V2GA 1R0SA 5MGBA 2JCYA 2W2KA 1L7EA 3B70A 3KVOA 4RF5A 5KJEA 4A73A 2YHIB 4RZIA 5EQFA 3Q9NA 3E8XA 4J0FA 4OOEA 2DBVO 1O6ZA 3UHAA 3ZHXA 5IZCC 5MDHA 2AMFA 1E6UA 3RROA 1RPNA 1LTHR 5COQA 5H81A 4YBZA 2FP4A 9LDBA 1YJQA 1P0CA 1W6UA 2BKAA 1QXSA 1X0XA 1DFIA 3EGOA 4DMLA 1Y8QB 4XQEA 3RCBA 3H2SA 3U4DA 3GGPA 3BYZA 3LT1A 1ZMTA 2X86A 1C1XA 4MVJA 4GPD1 3W6UA 3I9LA 3PYXA 4J1TA 3CMCO 2GN8A 3QLJA 4IDAA 4PLYA 4HFRA 1UUFA 3GR6A 4IPTA 4PG6A 1F8GA 4I08A 1YH3A 4RGBA 3MJVA 3K8ZA 1HDYA 1UXKA 2DFDA 3RC7A 1XLTA 3VOSA 1YONA 2P5YA 3GGGA 1B2LA 1WDKA 5B4VA 1NPTO 3A9WA 2Y66A 3BTVA 2O50A 4LN1A 5DOVA 4J3FA 3PDJA 4FFPA 2DPGA 4R1TA 4R4JA 4RPGA 3IKTA 1C1XB 4I1IA 4I9NA 5L51A 4XYLA 3HFSA 1R4NB 4NZ9A 2OOSA 4CQMB 3K96A 3WGGA 2XXBA 2AEMA 2ZK7A 4ZQBA 3UN1A 2VHWA 5KTKA 1W0CA 4WEQA 1TB4A 1ZEJA 3OJEA 1E3EA 1J5PA 3T4XA 3W4JA 3BMOA 3AY3A 1YDWA 5TNXA 3HB5X 3F3SA 3CKYA 3UFXA 5GZ1A 4DMMA 1UZNA 4OQZA 3HHPA 3IDSA 2ZJ1A 1ADCA 5JCXA 5TGDA 1PSDA 1E1NA 4IM7A 1CERA 3EY4A 3WJ7A 4IXTA 2VYNA 3DBHB 1B7GO 4XGNA 3JQAA 1HDRA 5THKA 4JP2A 1EQ2A 3JQGB 1TLTA 3DZIA 3PGXA 1VJ1A 3S1LA 4NNJA 1DB3A 2JAPA 1JDJA 3AM3A 4JP3A 4OKIA 3JQCA 4G81A 3ZGYA 5CEFA 3DBRA 3X2EA 3A06A 3VTZA 4IIUA 3GMSA 1PEDA 5TJ9A 5TF4A 3C3XA 4IBOA 4N54A 2YHUA 4QX6A 4L75A 1R12A 4RO0A 3SEFA 1PS9A 2ZJ0A 3JQAB 4CR7A 3LT0A 3I9OA 2NTNA 4ZGWA 4A27A 3AOEA 3LSYA 1AN9A 1YE3A 2D2IA 4E21A 1P77A 5IF3A 4YT5A 3H4VA 5JW6A 1PJLA 4D41A 2Q99A 2UV8A 4QEDA 1NVMB 4FBGA 3DL2A 5JDIA 3DHEA 2Y05A 3L6DA 1QKIA 2W8ZA 2PD4A 4YTEA 2FN7A 2H5LA 4CM4B 3D4PA 1R15A 2PGJA 4CM8B 1GYPA 1LSSA 2X6TA 3KO8A 3O26A 4JQCA 4E13A 4BMNA 1ENPA 4L4SA 2WD7A 1BMDA 3DZGA 2Q45A 4IGFA 1DPGA 4Z9YA 3VZRA 3ZHZA 1ZBQA 2J3IA 1OI7A 4M86A 4FC6A 3UVEA 3NTRA 2X9VA 3WGQA 4WEOA 1N2SA 3L4BC 3LVFO 5FFFA 2HMSA 4B79A 3DZHA 1CETA 4LISA 5JYEA 4EBFA 4OHUA 1G0OA 5BT9A 2R6JA 3BMNA 2Y0DA 4WECA 1XYGA 1TT7A 4NI5A 4CMHA 3CINA 5DCUA 2ZTVA 4WUVA 2P4QA 1F8FA 1N1EA 4MINA 2LDXA 1IUKA 3B6ZA 3ASUA 3L9XA 1HZJA 4OM8A 3WOHA 1NQOA 1YOVB 1C0LA 2B0JA 1M67A 3VDRA 2G0TA 1M66A 1HLPA 1V8BA 4GVLA 2FZEA 4J9UE 5JFOA 3BZUA 3NTOA 4I9UA 1HE5A 3OIGA 4XYGA 4AJOA 5KJFA 4I5DA 1C0PA 3U4HA 2V6MA 2VHYA 2Y67A 3GPIA 4P4GA 4MPDA 1QORA 1E7QA 3KETA 4RQTA 4YPOA 4LW8A 4U0JA 1HZZA 3S2EA 3ZNNA 2R00C 3GHYA 3V8BA 2FR0A 2FSSA 3FNGA 1ZK0A 4PVCA 5KVVA 3MJ4A 1FDWA 3UAGA 5A06A 1HF3A 4HFNA 1SC6A 4EUEA 1PS0A 3F46A 4XYEA 1LC0A 4B8WA 3JQ9C 3OJLA 1K6XA 4OJNA 4NJOA 4XQCA 1X13A 2IEDA 3Q11A 1AUPA 4PLZA 1XDWA 1DDOA 1FDUA 3EZYA 4MIOA 1LJ8A 3CZRA 4BKPA 2WYUA 2AQIA 2IYPA 4R16A 5CP8A 3TL3A 1Z75A 5C37A 1LDYA 2BGLA 3AY6A 4E2ZA 1BDBA 3ZWBA 1NWHA 1E3WB 4C4OA 4GBJA 3WTBA 4FJ2A 4FPXA 3PJFA 3NJ8A 5THQA 3ANLA 3OEWA 2GDZA 5G0TA 4CMBA 4GVXA 2SCUA 3NT2A 3D0OA 4PN3A 2RIRA 3KLPX 1V3UA 4J49A 3PXXA 4NJMB 4O1MA 1I24A 2YDXA 3AU8A 3E9MA 4YRAA 2GZ3A 1K5HA 1XHLA 5B12A 2O3TA 3KEOA 3HDYA 3KSDO 3OJ0A 1JKIA 1JWBB 4LVCA 3JD3A 3FNFA 3VH3A 4AICA 4YRDA 5L45A 3O8QB 1E92A 4NG5A 5AXDA 4E2YA 3DB2A 2IODA 1LLDA 4W6ZA 2YW9A 4CLOA 4K1LA 1C14A 3WSVA 1SMKA 4XQGA 3L9WA 2HMUA 1PWXA 1V3VA 2CVQA 3D4OA 3CE6A 1SCUA 3RFVA 2IDZA 1LSUA 3H9JA 3SVTA 2JFGA 4OL9A 1GAEO 5JDCC 4TRRA 2Y0CA 3HQ4O 3ZWAA 5KOIA 4TRJA 3JQEA 4FC7A 2WEKA 2DLDA 4Z0PA 3L77A 5HM8A 2P91A 2J3HA 4HADA 4DA9A 4R01A 3IL2A 1R16A 1R6DA 1DJQA 5CEEA 1UXGA 3IP3A 2B5VA 4BO2A 2V6FA 4UULA 2DVMA 3SLKA 4CM9D 4GX1A 1NQAO 1HDOA 2DU8A 4JX8A 4Q3AA 3ZNQA 3HDHA 3FBGA 2PR2A 5GZ6A 1ZIDA 1GZ3A 4ND5A 5BNFA 3C1TA 3C85A 1P33A 1U28A 4B4OA 3DZKA 5JE8A 1DFGA 2VTDA 3PHLA 3GH3A 5CDSA 2B83A 4PLWA 3TSCA 5ADHA 2A92A 1C1DB 5KCZA 1RJWA 4XA8A 1P1FA 4BKUA 2FRDA 3GY0A 1WPQA 4YAGA 2V6GA 4EW6A 5IJZA 4ONEA 1Q0LA 3SXPA 1LSOA 4E4YA 3H9UA 3SX2A 2JFHA 2W2KB 2ZKLA 5IN5A 3DONA 4UEKA 1E3IA 4WLFA 3SC4A 3V1UA 3E03A 1ZJZA 2NU8A 3ZWPA 3WLEA 2VZ0A 5KVSA 1QYDA 4DWVA 3OQBA 3GVHA 3JD2A 3ZV4A 1YDEA 4XJTA 3GEDA 4YJGA 2BGKA 1E1LA 2E49A 2ZATA 5A04A 1VE9A 3OSUA 1NTOA 4PLFA 4CM5A 5I8WA 4E5PA 1A9ZA 3INGA 4FQ8A 2JCXA 2O4UX 1DFHA 3PHGA 1KOLA 1H0KA 4DC1A 4NK4A 1PGNA 2YZ7A 1C3VA 1O0SA 1P3DA 1NVGA 4UVGA 1MXHA 4R41A 4XGKA 1QR6A 4PZCA 1DIBA 3OBBA 4DQUA 1DIAA 1BXGB 5L53A 1YB1A 2J5RA 3DO5A 2UVDA 1F17A 3ZW9A 3TJRA 3MOIA 3CSDA 1EVJA 3PJEA 5AYVA 5CDGA 3M1LA 4NBWA 2VRCD 1ULSA 4FGSA 4QTZA 2I3GA 1Z7BA 3GRKA 1BSVA 2Q1SA 5ENDA 5I9NA 4OSOA 4AJLA 2C82A 4S1VA 4W9NA 1C0KA 3STHA 4RPLA 1O95A 2RH4A 4TRNA 3H9QA 5I9LA 1ZSYA 5TT0A 1YJ8A 2VWHA 1IPFA 2PWZA 3AWDA 2J6IA 4QO7A 5CPBA 4ND2A 2GSDA 4H7PA 1RYDA 3FNEA 1FF9A 2W98A 3HE3A 4E0BA 2HKIA 5KJCA 1NXQA 2BRUA 1FMCA 1KVQA 2WD8A 1P31A 3ROMA 1DC5A 2WE7A 4YA6A 1PJ3A 1IPEA 1P1IA 1UP4A 3CH6A 1B3BA 3H5RA 3INRA 4MOWA 1WDLA 4YJDA 4W99A 1M76A 2DM6A 1U2DA 4GSKA 2VYVA 3UKOA 2PV7A 3RUDA 1E1MA 4IQGA 2PZLA 5KKCA 4NFHA 4L74A 2VHXA 2Y1OA 3H5AA 1RM3A 4DYDA 1UP7A 5A02A 4OSPA 1MP0A 3Q9UA 4MVJD 3CPSA 1R4MA 2DC1A 4ID9A 4CMJA 1HE2A 3PK0A 4R3WA 4BGUA 3DTYA 2Q2WA 2CSUA 5DCYA 4FGWA 4KUEA 4IS3A 1NR1A 2D5AA 4MVJI 3QWHA 4YACA 3JYLA 4EI2A 3KYCA 4YVFA 3PZRA 3AI3A 1TA4A 1ZJYA 4KDEA 1PWZA 3Q3CA 4YJHB 1TT5A 3G79A 3H6KA 2C0CA 3ORFA 1PJBA 3RUHA 4BNMA 1GEGA 4AJJA 4BNVA 1SOVA 1D1TA 3ONDA 1J6UA 5CG2A 3ITKA 4G65A 2WMDA 1Y7TA 3DHYA 3EDMA 4CM4A 4RDHA 3W6ZA 4CMIB 1RWBA 2QQ5A 1CIVA 4BS9A 4TROA 4Q3DA 1AGNA 3CUKA 3PEFA 5U1PA 1HKUA 4ALKA 3WIEA 3WQRA 2W2LD 1HSZA 5C3MA 3JCZA 4ZU3A 4XR4A 2IZ0A 4NR0A 1V3TA 1KC1A 2H1SA 1H6BA 4PVDA 5ICMA 3FTPA 1N9GB 3QV1A 1IYZA 3WGZA 5BSFA 3JQ8B 1TEHA 5DN9A 2V65A 1OBFO 1HTBA 3LK7A 3PP8A 1PS8A 4OOFA 3ICPA 3FNHA 1N5DA 2YQ4A 4W7IA 4YR9A 3WGYA 2B36A
chains in the Genus database with same CATH superfamily
3NIGB 4LDQA 5AJWA 3NHRA 4ZEOA 1QAMA 5L7TA 1ECGA 1GGKA 1RJ9A 5K8IA 5CCEA 4JBNA 4OL9A 3RC8A 3VJLA 4MKHA 1NE7A 1AC5A 2PX5A 2IL1A 3QPVA 3V4ZA 4QQFA 1GZ4A 2IHBA 3ENQA 1YS2X 1KO5A 3TTVA 4YRRA 3RI3A 3T3EA 3TZCA 3A2LA 4DN6A 5LMCA 2ZLBA 3GA0A 3K0KA 3U7JA 1WV0A 2N47A 1Q22A 4KUGA 3STUA 3TB6A 5FV4A 4RMJA 4NCBA 4LTDA 3W6NA 5JDIC 2BF4A 1DAIA 4B5KA 2PGDA 4BX2A 1K63A 3NATA 3RIEA 4G36A 4EG6A 1BKDR 2I03A 1Y4UA 3NFYA 4AMVA 1SXPA 3OLCX 1I36A 4P7JA 1O9BA 1W0JD 1D5WA 1L5SA 4C6TB 1FNMA 5ALOA 4M3NA 3OOEA 5E7QA 4EYEA 5KNBD 2G1KA 1C3OB 4KXFB 5DLEA 3DO8A 4PINA 5LU9A 2X9NA 4ARUA 2PA0A 2YUTA 2DPYA 2B8JA 4CG1A 3HYSA 1XJQA 5FOQA 2EFEB 4K3VA 1EMDA 1SPXA 1X38A 3NBYC 4GC9A 2VFAA 2VCHA 2XI4A 3OE7D 1E2GA 3DMRA 4XM1A 1M6VA 2YY7A 4L50A 4PPNA 3BRCA 4DNOA 2W4IA 5JAIA 2HT6A 3IHTA 1T3SA 1RPTA 4JBHA 4P1ZA 4X00A 4Q01A 5T8KC 2JGDA 1ORWA 3AKDA 4UEJA 2Q3FA 2R1TA 4M46A 4ZP1A 2I6GA 3U81A 3GGOA 3OMXA 1TJ4A 2IV7A 2ORYA 2ZBQA 1C3OA 2QD3A 2XYQA 3CYFA 3KZOA 1Y1KE 1YB5A 4IJWA 3RS3A 2QR2A 1YE8A 1PW7A 3ZE2B 2HIMA 2PS9A 2RCNA 3SLGA 1T5HX 4PICA 2FE1A 3QVWA 1HT0A 4NH0A 1E77A 3ROZA 1KYXA 4D80A 2J67A 4YFYA 3ZJ5A 3JQAD 3FF1A 5J2TB 1R9MA 2IPNA 3HJAA 3R0IA 4CCYA 5C18A 4US2R 3CISA 3G9UA 3PYMA 5CAEB 3VHRA 5IPFA 2EDAA 5JZOA 2QVYX 5I6DA 1SXJC 1KDTA 3OZSA 4DLKA 3K15A 3OQHA 2WV7A 3GOHA 4IMPA 1UPUA 2DSNA 3BSYA 3DBRB 5AQEA 3QELA 4AB1A 1MJGM 3HB9A 3AWIA 4GBED 3E6AA 2E0IA 2EZ8A 3T5TA 2NADA 4GNRA 2E4ZA 4WE3A 5KCMA 2QPTA 4R1LA 4C0JA 5M04A 4LMPA 4B31A 2C04A 1T13A 3W3AD 3ZI0A 1GVNB 4KZPA 3ZXYA 5KHLB 1DC3A 2ZIGA 2PZJA 4RD4A 1UFKA 3LFUA 2R11A 2W42A 2QYSA 1WXXA 3KQNA 5JXJA 2BOVA 2E89A 3UK0A 3C5EA 4EJ6A 5JH7B 5DGDA 2P65A 2GARA 1KOJA 3VPSA 3T5AA 2DXIA 4X5OA 1TZJA 2OLEA 3R7FA 1DNPA 3UHFA 4Y1FA 2W93A 4LC0A 5LJLA 2OCAA 3UGKA 1JHRA 4R8VA 3HR4A 3ND6A 5CXSA 1V2HE 3FPHA 3GMTA 3PGA1 1IDN1 2HZ7A 2FSVC 5J4YA 5HTOA 4B4KA 4IXNA 4C5CA 1GU0A 8LDHA 3B85A 2QZJA 5M3BA 2JFNA 3JD0A 2CLSA 3D7SA 3EIHA 2ET6A 3QTBA 4II3A 5AKZA 2YIJA 4J3NA 3RU3A 5A3QA 2HEIA 2Q8PA 3DP9A 4JBIA 4JEUA 1SVWA 3L43A 3ZU3A 5FF9A 3V6MA 4AFNA 4HLNA 1I6LA 4Y2HA 2XECA 4CIBA 2EZUA 2GCNA 3LXUX 4MJXA 2BZGA 2R87A 2D2FA 2F1KA 2IEGA 3HLTA 4KLNA 5JD5A 3S28A 5C1OA 2GJSA 4B5LA 1UDAA 3VPHA 1XCLA 1IN1A 3KZVA 3MOSA 1Q1GA 5D3MA 2CFCA 3EF0A 4OB8A 3A7EA 4DYVA 4WINA 6CHYA 4M98A 4YYEA 2W22A 1XPJA 2WWXA 2X3UA 2JB9A 5C7IO 1TCBA 2AR7A 2DWQA 3KYIB 4JVSB 5JZBA 1P9NA 3L6RA 2OHIA 1O89A 1UJCA 5G3YA 5JPIA 4A23A 1YS1X 4QJ5A 4UCWA 2LTAA 2XT9A 3LC0A 4OI1A 3WLLA 1SIOA 4HG2A 4L5IA 3TOXA 1NV8A 1GQRA 2DOKA 2I7XA 2GA8A 2QSYA 3ILHA 2JH8A 4BWVA 2VLIA 4JB8A 2XQVA 2XCTB 1Q6ZA 2C2XA 3MINA 4J90A 3IBFA 2Z9DA 1SUFA 1Q84A 3LUKA 3W5CA 4OUDB 2NSYA 1LLQA 1JKJA 3HLYA 4BKRA 4EA7A 4GQBA 1EWVA 4LZOA 3QEMB 3T1YB 1X39A 5A1JA 4H0FA 2BHSA 1CC1S 1XE3A 3EK2A 3MMXA 4GR5A 3CU5A 3U19A 3EHEA 4GUDA 4Q48A 2V7TA 4W5TA 1H8HA 3HXOA 4QM6A 3A4VA 4C7OB 1T5IA 3VU3A 3OBIA 3U16A 1Z83A 3QOXA 5G02A 1NF2A 3BGOS 3TPZA 5HCNA 1RLTA 2WIBA 4CZ2A 4B73A 2UDPA 1Z5UA 3FZYA 5HUJA 4HV4A 1ABBA 1UT8A 3IO5A 1Z5OA 1FP1D 4O5AA 5FI5A 3IODA 1KIFA 4DEVA 3IJ5A 3SOZA 4KR7A 1GIAA 2WKWA 4NV1A 1WXFA 3EIQA 3QMWA 5EY5B 3N1UA 1JAXA 4RKWA 3GJ0A 1X3LA 4L85A 5I01A 2B35A 3DE4X 2VS1A 4TQAA 3SK0A 2VJQA 1W35A 3NJRA 4FNMA 4ARSA 3COSA 1USVA 4YQYA 1J25A 1UM8A 2QPOA 3JSXA 4E5VA 3W8EA 5DCWA 1RJFA 4KP7A 4BO1A 4UUMA 3WQBA 1YS7A 4FYKA 3F6BX 1NJGA 4NSNA 1YRAA 4D6CA 3OKFA 1GFWA 3J7TA 1A9TA 1ADFA 1G4UR 1AGPA 1UBMS 4PQRA 3TZEA 2O2EA 4BRUA 1G8HA 3IRVA 2V0NA 2X8WA 1X74A 4G5XA 4HXFB 3WKEA 1DX4A 4IJUA 1SEVA 3CF2A 1HEUA 1Z6ZA 2JFBA 2O3SA 3KJFA 1G8MA 4LF7B 3O4FA 5HUHA 5FYDA 5I45A 1IBLB 1Z16A 4GX5A 1TM2A 4J9VA 4YJ3F 1THZA 4RM3A 2ETVA 5HW0A 1AO0A 4HNQA 4KIGA 5EMMA 3WWPA 3IEUA 1XPOA 4K6OA 4BL5A 5ALLA 4NJEA 3F90A 1ISGA 4H4CA 1K68A 1U2EA 2ZB4A 3J7AC 4TKLA 2H17A 3QLUA 4C87A 4YALA 4EGCB 2HL6A 2I6UA 3UMSA 2Z5GA 3EIEA 1W2GA 2MWMA 5E9WA 3GEMA 4Q9KA 3SZOA 1GPAA 1OX4A 1J9EA 1R1DA 3DEHA 4I14A 1NI3A 1MB4A 2R79A 3IMCA 2OD9A 5ULLA 1EJ2A 4JHXA 1Q7TA 2NV2B 4Q7QA 4OIMA 1W4CA 3PJDA 1Z18A 2NXJA 3KQKA 3ST7A 1XDZA 3KZNA 3D3NA 3O2JA 3P52A 5LC1A 1DIGA 3L8EA 4A7PA 4UXHA 3NHMA 3ZTWA 2PY6A 4AS3A 3PL5A 4RVFA 3ISVA 5JC1A 1H1DA 1HQYE 4TV8A 5K3CA 2PKQO 4D8YA 4KSBA 4E15A 4O59O 3LWDA 1ZNXA 5LXTB 1GKLA 1SZCA 4HGRA 3KJZA 1WCIB 4PAOA 2VSXA 5EQDA 4C7MA 3D6HA 2UUCB 3I6YA 4EHBA 1BD3A 3M49A 3RRXA 4E6PA 5CB6A 2EJVA 2FMIA 3PGMA 4UBOA 2GN4A 1EEHA 2RH5A 5H59A 5IDVA 3FWPA 3DGEC 5I5EA 1MEEA 2QX8A 3AQ4A 4EGAA 3WI7A 2YH2A 1A8PA 1YJXA 4RLQA 3RRYA 4J0EA 3ZHRA 1J1IA 4G6ZA 4K6FA 4HZGA 2PMCA 2FETA 3DTNA 2QQEA 4IDDA 4LX8A 4TS3A 4Z4FA 1UPAA 4HWKA 3UB2A 2A3NA 1OMOA 3L1IA 4KGVA 5AM2A 1K92A 1KE2A 4ER5A 4LRYA 1P1RA 3SZMA 3NWPA 1UMBB 4M0DA 5LUBA 4ZI2A 1PDVA 4I55B 4XRRA 1IZ7A 4GOND 2C88A 4M55A 1K08A 2Z8YA 3ND5A 2B61A 1N2ZA 4AWXA 4ZVVA 3RBXA 1JHQA 1E2EA 2NUTB 1MC5A 2HYDA 3K0EA 5IZ4A 4BRSA 5JXGA 4DLPA 4E14A 3L8HA 2XODA 2D2VA 2EIHA 3AYZB 1JEJA 1NVDA 4CM7A 4B4VA 1N6PA 4Q1FA 2YYYA 4RHFA 2BY4A 4XQ9A 1CYEA 5JCZA 4QUJA 3DKIA 1N7HA 3R41A 2DETA 4DBZA 1I1HA 2FUEA 4LQCA 1T5DX 2EG5A 3U1TA 4QPNA 2CMHA 4H1WA 6ADHA 3HPQA 3UWDA 2A1IA 2G1JA 4CM9A 2AG5A 4HH4A 1M2KA 4TN1A 2FKNA 3CMMA 1U9JA 4Z8YA 4DSNA 4IEIA 1XD2A 3OCCA 4U5QA 1IJBA 5F78A 4OBBA 2ZI3A 1BVUA 1KH2A 4NYJQ 3QU2A 3M8KA 5FTMA 3SI7A 3BT7A 2WQ6A 3K0HA 4G8DA 5IBRA 5F7XA 1I4LD 4RHTA 4D6IA 4V03A 1UKEA 3ZZMA 1I7QB 1TEVA 2QYHA 4UCFA 3BJMA 3P32A 4FGUA 4JCOA 5I5GA 3HXQA 1K66A 4KQ6A 3IPAA 3LDGA 4F5DA 1RXVA 3NTXA 2HA3A 3D59A 3LC1O 5JSHA 4D0RA 1K7SN 3KVYA 1J42A 1RKQA 3OVMA 4K26A 3RUIA 3WYNA 4CDNA 3MWDB 1SG0A 1UEIA 2XCUA 1BMFD 2Q4RA 4RD1A 1YZGA 4IH1A 3GLFB 3FOAA 1W94A 2PFGA 2KLHA 1NSYA 3C5HA 3PB3A 3QBVA 4GEGA 5ECGC 3HJHA 2OL4A 3DD5A 3HYCA 2CBZA 2G1AA 4A2QA 4RWEA 3WFJA 5KNLA 2OO7A 2VXOA 4PAGA 5FLXA 1GUFA 1WR8A 2IJGX 4OH1A 4HEA6 2H31A 2MTBA 1ULAA 2X14A 3IV9A 3WKBA 4XPIA 1U2GA 2PMEA 3ML1A 2J5KA 3EYWA 2JGIA 2A2ZA 1DXYA 3Q2IA 2IX9A 2P9FA 3F96A 5CA0A 5JS8A 1ABFA 4MVJH 3ZDZB 3F8WA 1SU8A 4NBRA 3HTXA 1WPGA 1PWYE 3A1DA 1AQNA 3MCUA 3IAXA 4BJ3A 5L3RA 1CYDA 4ASUA 5E8RA 3W7VA 1HGXA 3DC2A 4E2FA 1ONOA 1FRNA 2C2HA 1HRDA 1KAGA 1QLHA 3DOHA 1SUIA 2OFXA 3LAWA 3R3VA 1SUDA 4TT3A 2AZTA 2FJ0A 2PLAA 2PFKA 3RGGA 2J3QA 2NWQA 1B26A 1WP4A 2XTJA 2Y68A 5K3BA 3RQSA 3TAUA 4MW5A 3PWTA 4ZVTA 1KK0A 1H4VB 2CLEB 2W2LA 4EKNB 1N5IA 4NNOA 4ZT4A 5B7NA 3CGGA 4NK5A 3IOYA 5CYOA 1S2NA 3KKPA 4XCVA 5EWJA 4JI3B 1NJ1A 3AOGA 1E4YA 1GR1A 3MUOA 3S40A 1ZBDA 1P3JA 3G9TA 3I6MA 1NSFA 4K6GA 3WMWA 4BC1A 1A8IA 2G77B 3AM5A 4LOLA 3F9CA 3A1SA 3VI4B 2Z5FA 3G89A 4C2AA 3V2UA 2IHTA 3SJ7A 1DV1A 3TD6A 3OM9A 4YJKA 3RG8A 1P4SA 3RIHA 2D8AA 2QG4A 2PJRA 4ZOQI 2F4VB 1ACJA 4JLWA 3UWMA 3SP1A 2YJ3A 2CL0X 1X86B 1U9IC 3JQFC 5A9TA 3RIMA 1N92A 4BJ6A 1R6BX 3SLRA 3WMFA 4B35A 3KVNA 1N0IA 5JQGB 3ZQKA 4KUHA 3GUCA 4NYMR 4QG3A 2BTEA 1U0SY 3GT0A 4E94A 2R0QC 1I0ZA 3O31A 5KYNA 1P44A 4F3YA 3IOMA 5D84A 1DJLA 3GUZA 1F4VA 1JHVA 4LHVA 1M2OA 4I5GA 4LZAA 4ZXFA 4ITUA 1BEUB 4UPEA 3COWA 1O57A 2NU9B 2VXBA 4AZ3A 1QFSA 1SU4A 3HB4X 4BNDB 1XFDA 3D7LA 1D7AA 5KAPA 1J97A 1YASA 1FQOA 1FVFA 1A2OA 4RA9B 2OV3A 1H93A 3H9BA 3OT1A 2R8BA 2FLKA 2R6GA 1TLFA 2W43A 4R2MA 3WB2A 4D6HA 2NZYA 1I3NA 1VSVA 5TGTA 1O5TA 3SZUA 2VYCA 2Y6VA 3TRKA 3W34A 5IWAB 4JZKA 1QLJA 4NDZA 3NHFA 3PX7A 1R64A 5IW8A 2BUBA 3EPJA 4B09A 1NBIA 7AT1A 3UEOA 3C3CA 4EL0A 4RMGA 5T67A 2PH3A 1PL0A 3NBKA 2XVMA 4K0RA 3DTVA 4PIMA 4RYDA 1R8XA 3UAVA 3NU1A 4F46A 4GE3A 2HSJA 3N8GA 4RA9A 2C4NA 4WZBA 2YTZA 1LX7A 3FUTA 2IHNA 4M2LA 1Q5PA 3ESBA 1L4EA 4OHCA 4B48A 2HF7A 4BXOB 3DUWA 3E1KA 4N12A 4I1PA 2VA8A 3NYRA 2C7BA 3N2NA 4MB0A 1NJFA 3ESDA 1MAVA 4EGFA 2WUFA 3P4XA 5BYKA 5KSZA 3T95A 3E05A 2HRQA 3ORHA 3PT5A 5K8UA 1FFSA 4PXSA 1WMFA 2FF5A 2QM3A 1PE0A 2ATXA 3DF9A 1GO2A 2D1YA 2HK7A 3U7EB 2A5GA 3OHSX 3CKLA 1KKMA 1LA2A 3B3QA 1S9DA 4V39A 1MJHA 5KHOC 4V2UA 1RJ9B 3GBVA 2YXBA 1GTZA 3EH2A 2DERA 4C0KA 4HNSA 1UAGA 1C81A 1JDBC 1F48A 1NXVA 1PR0A 1YRHA 2K5UA 3RS9A 2C3PA 4BXOA 2FQ1A 4FE3A 4L07A 5HS6A 8GPBA 4OXYA 1ZUD1 5ED4A 2IYUA 3DCJA 3A9UA 4HNHA 1FNNA 1KMHA 3G13A 4RF3A 1NG1A 2O3QA 4S35A 3SFZA 1Y6FA 1XHEA 3NHPA 1T1JA 2J46A 2W90A 4D9NA 5AW0A 2GPAA 3L0CA 4W8GA 4M22A 4X3OA 3F5SA 1YA4A 4WBXC 3ZDEA 3LUDA 4GPTA 1YB7A 3N7UA 2INGX 1KDPA 4J0HA 2ZWMA 5KHAA 5ADUS 1ZS9A 4WXRA 4JLAA 4XIGS 3H1AA 3MNFA 4QOGA 1M5UA 4RQAA 4WKPA 4YJ3A 1YUBA 2ZCVA 1UQRA 2R85A 3EBLA 1VL6A 3ZWOA 4CKCB 2GEJA 2Y93A 2YNMD 5CNJA 3TZBA 3ETNA 3PNOA 3DW1X 4RQBA 3TXYA 2RHCA 3L6UA 2ODBA 1BDJA 1ZCFA 2HCRA 1KQ3A 2P68A 1DAFA 1DAMA 3CR8A 4QL3A 3GJ3A 3SZRA 1JLRA 3QWIA 2E4XA 1BTOA 4JOQA 5F1KA 3ZZNA 5JXWA 3BUSA 2J9XB 2ODPA 1OAOA 5IU6A 7MHTA 4EPXA 2VDJA 5KQLA 1RM0A 4BO5A 1JE1A 1YAJA 4YLGA 4OXIA 3FCYA 3E35A 3KLBA 5ER6A 3BEOA 2WQ7A 1WOYA 6LDHA 3EN0A 1R4AA 4IWXA 1U2QA 5KDDA 2G6TA 3BORA 3DSRA 3TBHA 2R60A 3BJIC 3HU3A 2VAPA 4QBTA 1R5JA 4BMSA 3PWSA 1CR2A 2DH5A 4YAUA 3T3PB 1NDUA 3SD7A 3HKBB 1SCDA 3WDLA 3NLLA 1TC2A 1KI6A 1SXJB 1UP6A 3HWSA 2CBGA 4OHBA 4TMYA 1AHHA 1B76A 3KV1A 4Q9LA 2QV0A 5DCLA 1IUPA 3K9GA 3VDNB 4YJGB 3SC3A 3AW9A 3R9IA 2BD0A 4YMIA 5A0TA 1ZRSA 2Z9BA 1EBFA 2B4TO 2E4VA 4W9RA 4WZBE 5FPSA 1Y4AE 3UJBA 2VYQA 1V5FA 3FPFA 4S1WA 3SR0A 4DMKA 3D3EA 3L41A 1FLAA 2LXNA 3CH7A 5TLSA 1B8OA 2X1VA 2XRZA 4L73A 4RVGA 4DMFA 2MMCA 2IFTA 2ZXFA 1T25A 2XVXA 1BXZA 1OA0A 4BV8A 2WUWE 3PNVA 3L2OB 2CSXA 1I1OA 1RVV1 2OKGA 1SXGA 4JIMA 4DIUA 1JXMA 5KTPA 3CX6A 5I9TA 3CG4A 2QMUA 1ZSNA 1EWYA 2GQ0A 2N0SA 2OUKA 4P38A 4ADSG 3JQDA 4WLVA 2NU6A 1UWLA 3THXA 1T8PA 4GVPA 4HGOA 4KEAA 4UCQA 1Q3TA 1YR3A 4TKMA 1JTEA 2DJIA 4R5MA 4DA0A 1G38A 3C7CB 4JUBA 3EXHB 2H4WA 3SICE 3TM4A 2JAOA 1FTGA 3TIFA 3G5AA 4ER7A 1N8SA 4FD3A 1ADGA 4D7AA 2J48A 1WE2A 4OD0A 1VE3A 2ZIFA 4ZAWA 3FPCA 2Q2NA 2WP8J 3JARA 3KSAC 3M3HA 2FHSA 2PRJA 4BLRA 2HJHA 4D3ZA 3U5ZB 1H0RA 4A91A 1AA9A 2G40A 2ZT6A 3VYVA 4L6IA 3RRNA 1DT3A 4DR3B 3NVAA 1ECLA 3NTVA 2FF7A 3RVKA 1HWYA 3BB4A 5KAMA 4DCSA 4UAJA 1R88A 2ERYA 1RZUA 1ACLA 1QGZA 2OBFA 4KOAA 4EX6A 2PUFA 1H8HD 1N2XA 2C3MA 3LIPA 4JODA 4EI9A 4II2A 1J5EB 2K2WA 3DJYA 1XUOA 1PNOA 2MJLA 3ETHA 3OD5A 3NT5A 3Q7SA 4Q4JB 3EARA 3H2JA 1T8RA 1QNLA 2VDQB 2H1IA 2WYVA 3ZNOA 2HX1A 1KI2A 2XA9A 2WM3A 3LLCA 5CVVA 4DV0B 3R8FA 1QVRA 4QFCA 4MW7A 3ZVKA 4CLRA 1KIAA 3UC5A 1CF2O 1RQLA 3MWJA 3AT1A 1NUQA 3KYCB 2COEA 1TQHA 2XT0A 4LG1A 3T3GA 1BG6A 1FSZA 4DGQA 5K0CA 1DEKA 3U3RA 5JNVA 3H3JA 4IYJA 1NQ5A 3FUCA 1MB2A 2TS1A 2H8KA 4P2GA 1ABEA 4RANA 4UOQA 4JNKA 4U6SA 1I3CA 1N1MA 1YZNA 4GL4A 5GONA 5DM60 1MHPA 4YUWA 2O5CA 1Y1PA 4BNIA 4BV2A 2GUWA 3N6XA 1DKUA 2Q5FA 2R6HA 2W71A 4YJFB 4TKVB 2GK3A 3CSUA 3VAAA 1Q15A 4MS4B 3X1MA 1CFZA 2AW5A 3AR2A 3FVVA 4GKAA 4GLJA 2G9ZA 3V8RA 3CVXA 2IH2A 4GP7A 1HE8B 3HHSB 3SXUA 2OORC 3VJMA 2RHWA 1W9HA 4G8JA 4KXMA 1ZGBA 3KJHA 4YC7A 3QPAA 3PKIA 2HF9A 3WIVA 4AJNA 2XYVA 4XFKA 5EL0A 4QT4A 1FMFA 4B8ZA 1IHPA 1GLVA 5CNIA 3ROEA 4ENWA 3OIFA 3K4QA 1Z4QA 2Z04A 3I09A 5AHWA 3ZWVA 2WSBA 5L7YA 1XIVA 1BXKA 5CDYA 3UTCA 2CJPA 4K87A 5EESA 4X90A 1UZMA 1I4EB 2DCMA 1Y9ZA 2XNSA 5AUPB 2IHKA 3M3DA 1OLOA 2B7LA 1A9XB 4DCPA 4BFXA 1E0AA 1W0JA 1AY0A 2FWBA 1NNUA 3ZHVA 2D0OB 4Y2RA 1Y6GA 1FYEA 1B16A 3T41A 2NVUA 3G9ZA 1E2UA 1V8ZA 3UAYA 1DGFA 2RD2A 1KMCA 1PIWA 4H3KB 3WB1A 1N57A 1HLFA 1EINA 2ZTMA 3ADPA 1MIHA 4FT4A 2AYYA 1ZNYA 2Y1LA 2JASA 1ZH8A 1O58A 2H9YA 4PPQA 5T4EA 5ESRA 5FADA 5H82A 3RD5A 1WBJB 4MVJP 4CT5A 2BPOA 5TEWA 1YHNA 1E1RA 2VK2A 4EVQA 5ALWA 3CRW1 2L0XA 4PF1A 4L02A 4WPGA 1I6MA 4CM8A 2ID4A 2G67A 5BMVA 1SVNA 2VDWA 4QJBA 5CMLA 1KP9A 3HHEA 2O59A 2A35A 3G0DA 2VC2B 3UAZA 1TJNA 1OFIA 1Y5RA 3AM4A 1XXHE 4XEUA 3RFTA 3BGVA 3WKAA 5EE3A 3R9XB 1XZEA 1ZAKA 5EMHA 1JR6A 4M49A 1F2UB 4LQ4A 3EIUA 4B17A 4BBZA 2PQMA 5LPNA 3QKUA 4K1XA 5C9ZA 1XQ6A 1MFZA 2BFBA 3AESB 3IVGA 3WDKA 3NEAA 3RKUA 2GJKA 3OMWA 3RJ5A 1IXSB 1M2VB 3HJRA 4Z54A 3C48A 2ZREA 4P3YA 4EDHA 4HQLA 4NULA 5C4MA 3K9FC 3UJ7A 2XOXA 4B83A 3KB2A 3UANA 5AK3A 1H5NA 3TVTA 2GO7A 4DKJA 4IYRA 1FB5A 2HPHA 2QT9A 1M6VB 1QQTA 2WIKA 1NV9A 3B82A 2PRIA 4GWLA 4N5MA 3WGHA 1VE1A 1YNSA 3LQFA 3BB1A 3WGTA 1H65A 1ZLYA 1YL7A 1Z3CA 5HRAA 3THYB 2Z6QA 4IJKA 2CHQA 2JFYA 4C88A 6PFKA 1UBRS 1K2VN 2X42A 4U2CA 4GUAA 5HG0A 2JLQA 2Q1UA 3CRMA 4L22A 2ZRMA 4WNCA 5EJ4A 3ZXUB 1P45A 3CW2A 4YLEA 2X7HA 4IJVA 3ONNA 1HYEA 4MKXA 3HO6A 1IY8A 1FRVA 1M2EA 2EX1A 1IN4A 3D3WB 3OLWA 3LP6A 1Z25A 1JU4A 2C3OA 3RGWS 1V9SA 3MMZA 1V0JA 4E7PA 4E5MA 4ETMA 1Y1QA 2I6FA 2VSNA 1TCAA 4DGSA 3OD1A 1Y9AA 4EK9A 4BU0A 2NP6A 3P94A 5TX7A 2DHEA 1V25A 1ZN8A 4OHKA 3U3JA 4IY1A 2XUZA 4MV1A 2CD9A 4RGQA 4AMYA 4EBBA 3NHLA 2JGEA 2TECE 1OQAA 2PD3A 1FFHA 2FZ5A 2K4MA 2YN0A 4GRIA 3K6JA 1DBIA 3P7MA 4HX9A 1P0MA 2WABA 3T3MB 3VGPA 3ZTYA 2OBMA 4C20A 2ZJ4A 1MW8X 1I94B 1K4KA 1ZHFA 1QZXA 3SJZA 3D2AA 2ZCJA 3JQBC 3G85A 1R0CA 4UJ5A 1TAGA 1TU0A 2ZB7A 3M33A 3ND7A 4XX0A 2CUNA 4CKXA 5JH7A 3ZHSA 1GYRA 2IYOA 4I5EA 1KAOA 4BN5A 4URUR 4ZYLA 3MLEA 3UWOA 4AN0A 4WVFA 4D0NA 3B1KA 2Q5EA 2QRLA 5EXDA 2XYHA 2J3DA 4JYMA 4JUFA 5I7VA 5EXSA 4BC0A 4PW0A 2HF8A 3IT4B 1QQ6A 1VPDA 4J0JA 4LV5B 4OB6A 3CNQS 2O20A 3ZBUA 4MRPA 5FHRA 2WYIA 4O4IB 3QSGA 5JAMA 2FV8A 3AONB 1JFRA 4N7MA 4X41A 5LNK6 3LKZA 3GLHB 1IFXA 1DJNA 3QQ5A 1QK5A 1S2IA 3O8OB 2ZE7A 3W1EA 3I0MA 3C8MA 4ZVPA 5KJ1A 3TLBA 1AZWA 5E0KB 1SUWA 3WLFA 4OATA 3L1HA 2Q1WA 4U7WA 4CHGA 4ABYA 3IXQA 3AINA 1DGHA 1UKBA 2B3TA 3PBKA 4XPZA 3TUIC 1VPVA 1G7CA 1CUYA 1O6FA 1TF7A 2IYNA 1EJ0A 4G1EB 6NULA 1SC1A 5G3ZA 1IG0A 4RF2A 3HYTA 2WILA 1ULZA 4DLWA 1Z4JA 3TS1A 4YEDA 4QWMA 5DJ5A 4WK6A 2GGSA 1WD5A 1A4RA 1QYXA 1LVHA 1W44A 2JGFA 1FBNA 3PDCA 5E6UB 1XMIA 1ECFA 1D2RA 1RYYA 5B3LA 1N77A 4D4GA 1KJZA 5JMOA 4M87A 4ZOCA 3TE7A 8ADHA 4RMIA 2WF5A 1TD1A 3L1JA 4MX8A 3QG1A 1FTQA 4KQCA 1RKBA 4RGVA 4CM6A 1XXHB 4MUKA 1A5SB 4JBXA 1S3FA 3G8DA 3A3OA 1DMRA 3KFVA 3K94A 5AT1A 2BSQA 3HDQA 1BNCA 4HB4A 3PEVA 3A3NA 4KIUA 4X1OA 5EJGA 3T7AA 2DQ4A 4GP9A 4P31A 3ZHOA 5FWYA 3ZW8A 2HN9A 1H6DA 4B2PA 2I91A 4BWGA 3U7QA 2P2LA 2DTEA 3I28A 1LEHA 5E6UA 3W2HA 3FSGD 2Q8QA 4AD8A 1R0LA 3RS8A 2QW1A 2FJPA 3FSRA 3QFSA 2ATCA 1AN0A 3LF2A 3IX7A 4P58A 1TUEA 2FWAA 5CB4A 4EJFA 2AWOA 1WZNA 1ZRNA 2ZIZA 4Q03A 1X1TA 5LUAA 1XZ8A 3WKYA 3DVRX 2CL6X 3H8JA 5CX1A 4H16A 5DP2A 4FMDF 2H4ZA 1CHDA 2WT8A 1TVCA 3AFGA 1H0SA 1SU6A 4UDYX 1CIJA 3B6KA 3DS8A 1H94A 4MITA 4EUHA 3V42A 1FIUA 3T5CA 4DSTA 3FETA 3KOYA 4OI4A 5F3DA 1QF7A 1ID1A 3FYDA 3OTQA 4OVKA 4UTRA 1RZRA 5LSAA 3AXTA 2IP2A 4OQEA 5KJ6A 4L1KA 5EJ7A 3L06A 3NBAA 1EFPB 3BTOA 3N2KB 4PC6A 3ZBPA 5CB4B 2CJWA 4LMBA 2KW5A 1IHXA 4TMKA 1P0QA 2OSVA 2V7QD 4R8KA 3ZWCA 1QIJA 2AN5A 4GOKA 4RM2A 3K72B 3O3MB 3WZLA 1JIJA 3PGJA 1SNYA 2HTEA 1M2OB 4BO3A 1T5TA 5F9FA 1XQXA 3TB4A 4EB0A 5TB5A 1DARA 4A0SA 4E5NA 3OZUA 2R00A 3ULKA 2Z1NA 1SGWA 3RYCA 4YJ2F 1VYHA 1KKLA 4YAOA 3JQ7B 4GKJB 3OUZA 1SHJA 2HRDA 2YBDA 3NAMA 2N75A 2PXAA 4W6QA 5ICSA 2WWWA 1QTQA 4HRVA 3RLFA 4GI2A 1I7NA 2WTAA 4IVQA 2Q2QA 3Q1LA 4JAVC 3HUFA 4NJEB 4BNHA 2QZZA 3JATA 2F8LA 4ZU6X 4MUXA 4J91A 3EQ6A 1E2MA 1KO4A 3C1AA 4YROA 5LP6F 4F9GA 4TRMA 2VSYA 4K0KB 1JEDA 4YCSA 4NCXA 3NX4A 3GFBA 4FDMA 1O9HA 3DW3X 2GZAA 3HL4A 4DXDA 1PNRA 2VUIB 4ZVSA 1VSUA 4O02B 1W5BA 1B6SA 4FR0A 3C16C 4QNNA 1CQPA 3RFXA 4PTZA 3D6AA 2A33A 2YHIA 2W6JA 3QITA 2YWRA 2AV6A 5J47A 1TI7A 5DHPA 4FQ5A 3FZNA 1O6BA 2YQZA 1XVUA 1KEWA 1W4ZA 3HBNA 2GLXA 4LOKA 1FS4A 1XKLA 1UPFA 3B9RA 3F5DA 3WRYA 1J8MF 1R6XA 1U1DA 1CR4A 2O3JA 2WJ6A 3HCFA 2AL7A 2XAAA 3AF4A 3H6HA 4RAQA 2H1OA 4DLSA 1B41A 1U0NA 2ILVA 2VDNB 1JE0A 2ZYSA 1VCMA 2KX7A 3OH8A 4KO3S 5IUJC 3ZXIA 5IJ9A 2XJ4A 5F2NA 3GZ4A 4H6WA 2BGUA 3NXKA 2PPLA 4ZQHA 1RLUA 2WY2D 3TSAA 3VDXA 3ESQA 2OHOA 2XGOA 3RADC 3O7WA 1BX1A 4HLQB 1AHPA 3QTLA 4WZAB 3LQKA 2JHCA 3FB4A 1ZGGA 1U1FA 1KU6A 1Y80A 3WTCA 2JANA 2I99A 4N3AA 4K6MA 3CIOA 2VYND 4ZEXA 1Z2EA 1ZGHA 1CCWA 2TMYA 4RKEA 4UASA 1RMQA 3ESXA 4RQUA 3UB3A 2OMEA 4PGFA 1ZXBA 4RD2A 1W93A 3EGEA 3N8IA 1KI9A 4RH0A 1X87A 4BVBA 1ZK4A 4ZCTA 5FDFA 4BNWA 4C2UA 3AFIA 2FYTA 4AZ0B 2AWNA 3I52A 1T4BA 1PAUA 4U3JA 3G6KA 5DBOA 5LZ8A 1NR7A 4B44A 4G0WA 4QREA 4JLPA 4X1KB 1J0DA 3UC9A 5JDCA 1U3DA 3BMOB 4IJ6A 4HF7A 1GSAA 1QE0A 4ZRNA 4JCCA 4CKCA 2QU7A 2GRJA 2V6BA 1FVHA 1DI0A 2AVDA 3OIWA 4NCIA 4XJXA 2TMGA 3DE0X 4P3PA 3OP4A 4QTTB 3VPGA 3D8TA 3VR4D 4O25A 1I13A 4KX3A 4N9QA 5EZ5A 5HM6A 2PLWA 3V1LA 2A0XA 2XTNA 1BE1A 1JQEA 2XUOA 3BTUA 3KAKA 4MWCA 3U17A 2GN0A 1R4MB 3KOUA 1EFRA 1N6IA 1PGOA 4JBLA 4J7AA 3MSCA 3V4PB 1QQAA 3E9NA 1QC5B 4KPGA 1X3SA 4JDUA 1JB9A 4PRZA 2QYTA 2R7MA 5LWHA 3D0RA 1H05A 2NYRA 4IV0A 1VQ1A 4YP1A 3SGLA 3VH2A 1MO3A 4DANA 4EJMA 2YMPA 3THRA 1SXQA 2C5GA 4X44A 4L8GA 4G1BA 3WLIA 4EW3A 1FJXA 1IAQA 2IEBA 1S8FA 2IEIA 1H2BA 2B5WA 2G04A 4FGKA 4NBVA 4YAJA 4ZRDA 4CM1A 4EENA 1DELA 3Q8WA 5EKTA 5JCJA 3OZWA 3GLUA 3IV6A 3OPXA 1KI6B 1OROA 1TM4E 3EOBI 1Q0UA 3NRJA 4RGYA 5EXEA 5KMGB 4FWTA 1R37A 1NYTA 1SZJG 2WVGA 4L8FA 5HK8A 2ZYDA 1KGSA 1Y48E 4QM7A 4H17A 3NJ4A 2B6HA 4CM3A 1GCIA 3KZKA 3RTCA 2VEOA 2FFHA 4ZO9A 2HO5A 4XVQA 5FKJA 5CLQA 1M5TA 1OSNA 1CR0A 1UC8A 2V3WA 3D7RA 1KFKB 2I3ZA 3VH4A 5C7OO 4E5KA 5E95A 4YRJA 4RV9A 4OP3A 5ITWA 2PL1A 4HQ6A 4V0MA 1P2UA 3ACDA 3I2JA 4GT1A 3VSDA 2VIIA 1WB4A 1AM4D 3W0LB 3Q5GA 1KSJA 3WGJA 4PYIA 4PYRA 3ZI7A 4IFBA 1YF3A 1HQCA 4U2EA 3SXJA 4BQIA 1A4IA 5IMBA 5KNCD 3E22A 3QLVC 3ILSA 2IE8A 5IUKC 3KUCA 4AJ4A 2BEVB 3O9VA 1K0UA 4CTMA 4PFJA 1AQLA 2CL5A 5GGYA 2EWWA 3I01M 4ZARA 2FWIA 3K9WA 3MRVA 3TIVA 2CKDA 4P0PB 3EGXB 3OPYI 2GEKA 1X0VA 4IJ5A 4TTQA 1O0BA 4YN3A 3PEWA 3ZGZA 3F8TA 2EL7A 4Z1OA 4L5YA 4QU8A 2CLIB 4DMCA 1SK8A 3LBNA 3M6FA 2Y9MB 1CNEA 1ZD2P 3RBZA 2EFHB 2CVFA 1NOKA 2CEKA 3JARB 1ZGJA 1I5RA 4NFSA 5JY1A 1JALA 4DIBA 1JIXA 3AF0A 4F97A 4ARIA 3JTEA 1YRBA 1Q95A 3IUNA 3WBBA 4YXWA 3WX0A 2REQA 4B4UA 3E22B 5DK4A 1I9GA 1XF9A 2AOVA 1QYWA 4EMTA 5DM70 4B1FA 2BEVA 1PWHA 3PSHA 1OYOA 3H86A 2NXWA 4D9JA 1JGTA 4OYHA 3WGMA 4DL9A 3I0NA 2VP0A 2HNKA 3O95A 1V5EA 4FHDA 5IM4A 3TZQA 2QT0A 1J20A 1GRNA 1MC4A 3RVNA 5A5EA 2E5LB 1QHNA 4YASA 2QG6A 4RPHA 5JO0A 1QG6A 2I87A 3PUZA 3VHXB 1GM5A 1XF1A 3TQCA 4YDRA 5HIIA 4RNCA 2K7FA 4Y3UA 4DDKA 3L79A 1O94C 3IAS1 1BWSA 3MWEB 2FPGA 2P69A 3KHKA 3Q8LA 4D8VA 3C5WP 1JHMA 5ADWA 2L19A 2O6LA 1H6CA 3FN4A 1V43A 1MTOA 2CF6A 1GPMA 3AEQB 2AOWA 2EXXA 3UMVA 4IEFB 4X54A 4XUEA 3I5MA 1Q16A 4ZCLA 1IZZA 4B3RB 2BTOA 1LW7A 2OBYA 4RD0A 1KZ4A 1C30A 2C54A 3N87A 4GYWA 4RV5A 1ZOSA 2RHDA 4BP1A 4M9XA 5HIMA 2VCEA 2R3SA 2ODQA 3D4IA 1T4DA 4CLHA 4F4IA 3EW7A 2XYPA 4HN9A 1U9IA 4BTEA 2EFJA 4I1SA 4DV1B 1MX5A 3BZWA 1K7CA 2K6GA 3A2NA 5HUQA 4PX2A 1Y8RA 4JWKA 4YJHA 1EVZA 3D6MA 5CHYA 3U7FB 6REQB 4C3OB 4RZHA 4W8HA 1UK8A 5HJEA 1S7CA 5ALXA 2WTXA 5T5QA 1QFJA 3AEQA 4W63A 4ER3A 4QNMA 1GWNA 1BC5A 1N2HA 5A5GA 3OI7A 1IOVA 2G70A 3R23A 4PLPA 4PRLA 5M34A 3LY9A 1ZZEA 2NGRA 2BDEA 3F9IA 3M4NA 1V7QA 1K8QA 3FYCA 4LVUA 1XRLA 1BRMA 4HYTA 4D8WA 4JLMA 5CIWA 3FUWA 2VTEA 4WUTA 5I9MA 3QKSB 3FDFA 1SA0A 4N6GA 5H68A 3LC7O 2E3JA 4X7BA 1GUDA 4ZOEA 2IKQA 5EQJB 3C97A 4DAOA 4DLTA 3BK7A 4NBSA 2O8CA 2JEYA 4Z4CA 2ZR8A 4HNAB 1DOZA 5COBA 3UV6A 4DR7B 4ISCA 4LI0A 1RXCA 2Z08A 5C8VA 5CDHA 5H8WA 3TR0A 3ADCA 4FWIB 5EWLB 2GASA 2OCDA 1QV9A 2QTTA 4KPUB 3E15A 4TQ9A 4EKEA 1OREA 3SMQA 5KQGA 2C7RA 1V9LA 3ZE9A 1F51E 4COKA 3RWBA 4QC2A 2DMRA 4KFSA 3B3FA 5D1NA 2WSYB 1UFQA 1U2RA 1XKXA 3W9SA 4EYSA 1PLKA 3BMCB 5BPFA 1NVWQ 3DP7A 4HEA1 5EJ5A 2C84A 3U61B 1TYBE 4RYLA 1M2VA 1CEXA 1XDUA 4E6EA 3T7EA 3KSMA 5EJ2A 5L3ZA 4ZV4A 2B4AA 1YQWA 4IF6A 5DHSA 1E63A 2VUUA 5G4KA 3AI1A 3I5XA 2P4EA 4UUPA 1AMUA 2H4FA 2YFYA 4QOFA 4PSDA 1QQ5A 1N1GA 3MB5A 1SCUB 3JD4A 3R09A 3RWMB 3O0DA 1G6KA 4J0KA 5A6VA 3THYA 3T0GA 4CJXA 1YCFA 3DZDA 3KTAB 4MS3A 4R1SA 4RVCA 1ODIA 5CT5A 5HKKD</