1LLUA

The ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
341
structure length
341
Chain Sequence
b'TLPQTMKAAVVHAYGAPLRIEEVKVPLPGPGQVLVKIEASGVCHTDLHAAEGDWPVKPPLPFIPGHEGVGYVAAVGSGVTRVKEGDRVGIPWLYTACGCCEHCLTGWETLCESQQNTGYSVNGGYAEYVLADPNYVGILPKNVEFAEIAPILCAGVTVYKGLKQTNARPGQWVAISGIGGLGHVAVQYARAMGLHVAAIDIDDAKLELARKLGASLTVNARQEDPVEAIQRDIGGAHGVLVTAVSNSAFGQAIGMARRGGTIALVGLPPGDFPTPIFDVVLKGLHIAGSIVGTRADLQEALDFAGEGLVKATIHPGKLDDINQILDQMRAGQIEGRIVLEM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol Dehydrogenase
molecule tags Oxidoreductase
source organism Pseudomonas aeruginosa
publication title The ternary complex of Pseudomonas aeruginosa alcohol dehydrogenase with NADH and ethylene glycol.
pubmed doi rcsb
total genus 103
structure length 341
sequence length 341
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2002-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lluA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1lluA01
3GVCA 2I66A 3JD3A 1C0LA 2HRZA 4CQMD 1E7WA 1QYCA 3I5MA 2A9FA 3CIFA 1DPGA 1XKQA 2BGKA 4DWVA 4J7XA 3L9XA 4U0JA 3NJ8A 2WD8A 3RFVA 1A4UA 2AQHA 4GVLA 1EK6A 3VH4A 3WJAA 4A73A 4D41A 1P1RA 4EGFA 2AQIA 3H5RA 3PDJA 3WGGA 2HMWA 2OL4A 3UAGA 3QVXA 1DIGA 5T6BA 2QX7A 3FSRA 3T4XA 4JROA 3NDJA 1NFQA 1XDWA 4NJMB 4UUOA 3GDGA 2OXIA 1ZIDA 5G4LA 2ZIZA 1U4OA 1VL6A 3JQ7A 2PD4A 3TOZA 3AM4A 2HJRA 5BNTA 5IF3A 2W2LD 1B14A 1FJHA 4JX8A 4NJOA 4DREA 4YRAA 4JJIA 3JQBC 5AOVA 4CM5A 2R00A 3PFFA 5T67A 3O38A 4RPHA 3I6QA 4TZTA 2X22A 3WGZA 3KYDA 1DIBA 2PH3A 1HE5A 2P91A 1N7HA 2PZMA 3EVNA 4R69A 2NU9A 3S1LA 3EHEA 1OBFO 3PHIA 4J0FA 4W6ZA 1CWUA 1LBEA 1YB5A 4ND1A 3ZWXA 1XU9A 3C1AA 3IQDB 3AW9A 3ROQA 1EDOA 1OAAA 3GEGA 3G3EA 3VAZA 2QYTA 4IDEA 1WP4A 4BHTA 2G17A 1Y7TA 4GVXA 4LN1A 3H5AA 1K3TA 5JCJD 2QG4A 1MX3A 1NX6A 2G5CA 5MDHA 2HRBA 2DPGA 1UDAA 1V9LA 2QRLA 3I6IA 4RGBA 4ZJUA 3CZRA 4R3NA 5TQVA 2Y1DA 5L4LA 3MOIA 1LA2A 4WLVA 2GN6A 5TGDA 4R9RA 4WCFA 2DLDA 4BNXA 2YHIB 1NQOA 4BOYA 3HUDA 4CQLB 1KY5A 1HDXA 1ZCJA 4BMNA 3ASVA 3JQFC 3WOHA 5TIIA 4YACA 2NACA 1J6UA 3L4BA 4KZPA 4GLLA 4LVCA 3H9UA 3OJOA 3CPSA 4J7UA 1B8PA 1P0CA 3O9ZA 3VDRA 3VVCA 4W7IA 2D1YA 1AGNA 1PS8A 2IRWA 1M2WA 1NASA 1P77A 3JCZA 3ANNA 4RVUA 1UXIA 3WQQA 5L51A 4ALLA 5L4NA 1VE9A 2OHXA 3MJ4A 3DAGA 1B3RA 1ZNQO 3RC7A 3Q6IA 4MKRA 4IMRA 1PJ4A 1GYRA 3N74A 2W2KA 1B0AA 2VN8A 5JW6A 3NTOA 1ZVMA 4IJUA 1BG6A 3WB9A 1NPYA 3PZRA 4CLEA 3BZUA 3BHJA 4A26A 3QA9A 4CLRA 2HMTA 3NV9A 4J3FA 4F6LA 4R54A 3ZWVA 4PG8A 4D7AA 1HDYA 2VYNA 3BYZA 4DIFA 3WG9A 3WX0A 3MJCA 1NWHA 4E5PA 4CL8A 5T57A 1XSEA 2NVBA 3KVOA 1YL6A 2D3TA 4R1UA 1A72A 1DC4A 2H5LA 3PDUA 4DYDA 1PWZA 1Y1PA 1KVSA 1ZEMA 1HRDA 3PWZA 5JC8A 3FF4A 1QLHA 3HADA 5FI5A 4M1QA 3FTPA 2GN8A 2Q2VA 4IUYA 1LDMA 2NTJA 1QORA 4IIUA 3NT2A 4BKUA 1YL7A 4PG4A 2W4QA 2WD7A 2E6UX 2VNSA 2PFGA 4N5LA 1WDMA 1DSSG 1F12A 4YJHA 2Q50A 5CEJA 3NDRA 4R1NA 3LT1A 2AW5A 3INTA 4WUVA 3WFJA 2Y1CA 3BTOA 2VZ0A 4OGWA 4CMCA 1U8FO 4Z3KA 1EVZA 3DBVO 4YT8A 4BNHA 3FWZA 5DCWA 4G5HA 1YQXA 4PG6A 4J1QA 1U5CA 3RI3A 1JAXA 1SB9A 2IZ0A 4CJXA 3V5NA 4DUPA 4FGSA 4P4LA 5F3RA 4ALIA 2PY6A 3H65A 4O5OA 1DFGA 3HJAA 4WNIA 3AOEA 2JCXA 5JO0A 3W8DA 1BXZA 3UOGA 4ZRMA 5BT9A 1EUDA 2C5EA 3DL2A 1I32A 1G0NA 3EVTA 1F8GA 2BI8A 4UEOA 1M6WA 2NSDA 3VTFA 2PD6A 1LSSA 4J43A 2FOIA 2ET6A 2WSBA 1GYQA 3P19A 2GNAA 2X9VA 2G1UA 3CINA 3GK3A 1IB6A 3JQBA 1E3LA 1H9AA 4OKNA 2DQ4A 1YDEA 1BWSA 1Q7GA 1BXGA 1DLIA 4GWGA 5CEEA 3LLVA 4J2OA 2DUUA 2WE7A 4ZVVA 2AG5A 1U28A 4LSWA 3TNLA 1HYHA 1PJLA 1EDZA 1LQUA 2YV2A 3HN7A 3AI1A 1E1LA 3TFQA 4CM8A 3E9MA 2VZ8A 1T1RA 3E48A 4DQVA 2JD2A 5CG1A 3JQGA 1DIAA 3DFUA 4Q3EA 4KUEA 1MC5A 4M49A 4B7CA 4EEZA 4ESOA 1WNTA 1PEDA 3KO8A 3JTMA 1F14A 4I8XA 4B4VA 2GSDA 3G79A 4TKLA 2WJPA 2EP7A 2J3IA 4HX5A 3I9KA 4PLCA 3EAGA 1M67A 1TLTA 3S2FA 1XG5A 1ENPA 2BI7A 3CE6A 3LF2A 4XDZA 3GG9A 1ADGA 3GGOA 4KTVE 3S2IA 1NVGA 3W6UA 1KEWA 4CR8A 3ZW8A 4IZHA 5CDGA 4BNIA 1WAMA 2C82A 3NT5A 3HE3A 3IL2A 2CZCA 3JQGB 3RQSA 1HXHA 3IS3A 5HM8A 2Q1WA 1ADBA 4RDHA 5AQ1A 4NBVA 5CEFA 1HE3A 1DHTA 4MVJP 5ICMA 1X13A 3V1UA 1Y6JA 3WNVA 1SB8A 2B4TO 5DBIA 4H7PA 1YQGA 4W7HA 4IDDA 4YWJA 3VZPA 4YRBA 3SVTA 3RFXA 4XGIA 3DEYX 1RYDA 3NTRA 3G1UA 4PZCA 1AUPA 1E6EA 5ITVA 4EUHA 2D2IA 1MV8A 4X54A 2WD7B 3AU8A 3IDSA 3OF2A 4XIYA 3IAHA 4JIGA 4OIMA 3ZWYA 3GOHA 1TXGA 1N9GA 4KWIA 1DFHA 3HDJA 1YQDA 2C2XA 2H1SA 2GERA 4WCFC 3C85A 1HSZA 4CR7A 4AJHA 1NFRA 1OI7A 3PJFA 2OBNA 4L4XA 3OA0A 2ZYGA 4WASA 4CODB 4EEXA 5A06A 4L76A 1SAYA 1U4SA 4I1IA 2C7VA 4GLOA 4CMJA 4DLAA 5KCZA 4J4HA 3ZV3A 3C1OA 1LDNA 2CMDA 3VKVA 4E33A 4UUMA 1LU9A 1QYWA 4RVFA 1JKIA 1X0XA 2FZEA 2AG8A 5A1TA 2B5WA 3E82A 3GVPA 4FCCA 4RLHA 1HF3A 3ZNNA 4IPTA 3LU1A 5AXBA 1P0FA 4FFPA 1B8UA 2CD9A 3GH3A 3JQFA 4L4SA 3E9QA 3INGA 1LI4A 5KJEA 4PRKA 2X5JO 3TZQA 4GAEA 3TSCA 2ZKLA 3JYNA 1KY4A 1KC3A 1BXKA 1Y5MA 3FRJA 1UH5A 2C5AA 5H81A 1V8BA 3L6OO 4IQ0A 5ILGA 1CEQA 1PL8A 1X1EA 2EIHA 4A2CA 5A3JA 1T2FA 2EGGA 4BO7A 2CDBA 3VTZA 1X7GA 3IKTA 4BO6A 3G0OA 1Q7BA 4N7RA 5KVQA 4E5MA 5H83A 4FS3A 3RUCA 3QIVA 1XIVA 3WLFA 1BHSA 4CM3A 2V6MA 1ISIA 5U1PA 5K0ZA 1VSVA 3RU9A 2DBRA 2J3HA 3FCOA 3IJRA 5IDYA 4E4YA 4CM9A 4TRRA 1GPDG 1ONPA 1ZSYA 3L77A 2G82A 3D3WA 3DHNA 4OO3A 1NR7A 3IUPA 1Y8QA 5CPFA 1VM6A 4UVGA 3O26A 3TZKA 2RAFA 1PJ2A 4M86A 2HCTA 4JP2A 3RKRA 3RVDA 1Q0HA 1VSUA 1ONNA 4FSHA 5DBFA 4GBJA 4BKRA 1GZ3A 1D1SA 1NP3A 2BGLA 4PLZA 3OMLA 5B1YA 4CM4B 1B8VA 1SNYA 1LLUA 1ZBQA 2GDZA 2RH4A 3BA1A 4UVDA 5F5NA 5CPBA 1UXHA 3NKLA 3UF0A 5KTKA 2P9CA 4Z6KA 3L6DA 3EC7A 1Y5RA 4WEOA 4ND3A 2YUTA 1WMAA 2PH5A 2PZJA 4Q3BA 1AXEA 4E2XA 2YV1A 1LSUA 1PZFA 4AJOA 1P1IA 3KBOA 4AJEA 2Q3EA 3C7DB 5L40A 4MPDA 3TN7A 3OFSA 2RBEA 5JNLA 5DT9A 1U3WA 4D79A 5IXSA 1Y81A 4BNYA 4OHUA 3P2OA 1U3UA 3I4FA 3QQPA 3FR7A 1LUAA 2FR8A 6LDHA 1NR1A 2Y66A 2PGLA 4E3ZA 3ZWMA 2Q1SA 3HFGA 2OFPA 4C7KA 1E7QA 4BNNA 1MP0A 1LRJA 4K6CA 3RROA 4LMRA 5KKAA 5T64A 2OP1A 4BNLA 4LRTB 3L4BC 3WQSB 4IZIA 1CQIA 3T7EA 1DJNA 1BVRA 2VHWA 3EY4A 3SLKA 5A9RA 1UZLA 5DP2A 4RF2A 3OP4A 4B7UA 3U5TA 1NAIA 3GLQA 3EMKA 1E3WA 1DHRA 5I8WA 2X1HA 1D3AA 1DXYA 1E1MA 3OIGA 4W9NC 3MJEA 4R41A 3NJ4A 2Y1OA 3M1LA 4LVUA 4XIJA 4I5GA 4OSPA 2FN7A 3M6IA 3SC6A 3TDKA 1AN9A 1QKIA 3JQAD 4YT5A 2QRKA 3ADPA 1PU2A 3DZKA 2GLXA 4WOJA 3GZ4A 4E2WA 2CDAA 1KBZA 1QYVA 4PG5A 3V2GA 4EW6A 5LCXA 3OJEA 4WLUA 3JQ8B 1IL0A 3RUAA 1D8AA 1XLTA 3FPLA 1GADO 3ROKA 9LDBA 2EG9A 4IBOA 1N1GA 2B69A 3UKOA 3ETDA 4WLFA 2VYVA 2X8LA 2BFPA 4PIVA 4DQUA 1UP4A 4RO0A 5DDIP 3WWYA 3EK2A 4FPXA 2PV7A 2PD3A 9LDTA 4JLWA 1JVBA 3LVFO 4DMLA 4EUEA 3MTJA 3IC5A 3MTGA 5C3MA 1PIWA 2HK7A 3K6JA 4NIMA 1XGKA 2JJYA 3S8MA 4DLBA 5L7WA 2Q2QA 3KV3O 3C7AA 2QQ5A 1LNQA 2Y0DA 2ZB3A 3ANMA 1M6HA 3L9WA 5COBA 4N54A 3VPFA 5G0VA 4IM7A 5KJFA 1PSDA 2FR1A 4P8RA 2NUAA 4L74A 4QSMA 5A05A 1T2DA 3LC7O 1PTJA 4YTEA 4D3SA 5U4QA 2C0CA 3QE3A 1D1TA 4BNTA 1P74A 3OQ6A 4ZN6A 3AUTA 5ENDA 2SCUA 4ZRNA 3WR5A 4IXWA 1HE4A 3DQPA 5JS6A 5EMHA 2O3SA 1WW8A 4FIZA 4XX0A 2ZB7A 4RPLA 4TKMA 5COQA 4KMSA 2RHRA 4DYVA 2DT5A 2YYYA 1QV6A 2VHZA 4P38A 2P5YA 2O4CA 1HE2A 4CLHA 2V65A 1VJ0A 4YEDA 2PZKA 4W4TA 3WGQA 1K89A 3ST7A 1QYXA 1IUKA 3MZ0A 1UAGA 1YBAA 2CVQA 1JQBA 1O89A 1T1SA 2OMEA 4FFLA 2PLAA 4R68A 1Q0LA 1RM3A 1EUZA 4BGEA 5T8KC 3GPIA 5IFLA 2VT3A 5B4VA 4GGPA 4FFOA 1R12A 3QVOA 4RZHA 3GRPA 1FF9A 4KUHA 1P45A 3AUAA 2CUKA 1UUFA 1C0PA 1XU7A 3ON5A 2DUWA 3ZNOA 4OYRA 4BB5A 2P5UA 3JQCA 1T2AA 4NBRA 4TWRA 4YRDA 2DTEA 1BW9B 1PJTA 4J4TA 4PLYA 1NTOA 2H9IA 2I9PA 4OXNA 1NYTA 1A4IA 1DJQA 5LC1A 3DZJA 1GZ4A 2VWGA 1TT7A 3D3WB 1ENYA 1GCOA 3Q11A 4JQCA 2W2KB 1NAHA 3UVEA 4I9HA 4URFA 3ZU4A 3CTMA 3D5QA 2J8ZA 2B0JA 2C7GA 3BMNB 5KVCA 1GQQA 1NPTO 3OSUA 1ZMOA 3WWZA 3K9QO 1K6JA 1XCBA 2X0RA 3NRCA 3KYBA 3DONA 5G0UA 2VWPA 3HSKA 3JSAA 2OO5A 3DAPA 3UCEA 1BTOA 3TQHA 1JWBB 4JBIA 1QRRA 5JMPA 1CJCA 2NU8A 2ZTLA 3BIOA 3E5MA 4GMFA 1C1XA 4FFRA 3OQ1A 4Z0TA 4PLFA 4YJFB 1HZZA 4QX6A 3VC7A 1CF2O 2DKNA 2NADA 3I9NA 1OC4A 4ZQEA 4KQWA 4DPLA 2BKAA 3UXYA 1IYZA 2DBVO 5T8KA 1ZZEA 3U3XA 2BFAA 1YO6A 2J5QA 4NMHA 3RUIA 3UCXA 3ETEA 3UHAA 3GGGA 5TNXA 1F0YA 2BLLA 3WTCA 3TF5A 2Y0CA 3B20A 1L7EA 4J9UE 2GR9A 2ZB4A 4BMVA 4U8GA 3AUUA 3GGPA 5EQDA 5L53A 1P3DA 1L1FA 2GN4A 5JAIA 1BW9A 3WICA 1J0XO 3LLSA 4MKZA 2DTDA 4UEJA 2HDHA 4YAEA 4R1SA 5DBGA 5JAZA 1AE1A 3OIFA 1SOWA 4JJFA 4MVJE 5GZ3A 4P22A 1I2BA 3RC9A 1G6KA 2XOXA 3SC4A 5CDYA 4IJKA 4CM7A 4M55A 1WDKA 5ITWA 2PWZA 1R0KA 2YZ7A 1IPFA 1PX0A 2OBYA 4HWKA 3MJSA 4OH1A 1RPNA 4TVBA 3ZU3A 4FJ1A 4YQYA 4OOEA 1YBVA 2GUGA 3GMSA 4D3DA 4OKIA 3ITKA 1LQTA 1J5PA 4GX0A 1FDSA 5JDIA 5G2OA 1P9LA 3ADOA 1YB4A 4ZQGA 3DMTC 3KEOA 4FD3A 3V2HA 3DBRB 3R6DA 3DMTA 2OZPA 3KB6A 2ZYDA 3P5SA 3TL2A 4KP7A 3H5NA 3PHGA 2C20A 1VPDA 4IXTA 1PJCA 2I65A 3DBLA 3GQVA 3O8QA 4I9UA 1VKNA 2JFGA 3H2ZA 2CF5A 2X0JA 2JKVA 2Z5LA 4B3JA 3BMQB 1TVEA 2GPTA 1RWBA 4ONEA 2C07A 3NGXA 2O7QA 4FJ0A 4Y6PA 3JQAB 4BS9A 5CG2A 2AE1A 2Q2WA 3WGYA 3DBHA 4MVJF 1R16A 1ZXLA 4WJZA 2H63A 3GN1A 3LDHA 4CMIA 1NQ5A 3A4VA 1EVIA 1GUZA 1O0SA 4OSOA 3HB4X 3WIEA 3VKUA 2IDZA 5JDCC 1E7YA 1UXKA 4O0LA 3WLEA 1ZK2A 5HTOA 1F8FA 1I3LA 2XXJA 1GR0A 3FI9A 1BXGB 2HMUA 2FMUA 2VHXA 4TRNA 4BIIA 3B1KA 4RVSA 1XWFA 4E2ZA 4PFJA 1S6YA 2NVWA 4BNGA 3D0OA 5B12A 3X2EA 4S3MA 1ISMA 2BMAA 1ZSVA 5A03A 5KJCA 3GDOA 1M75A 1SEPA 3JQDA 5COAA 3JYPA 1OFGA 2VHVA 1MC4A 4UULA 2HO5A 1U2GA 3ZU5A 2VWHA 1ZJZA 2D0IA 4ND4A 1ZJYA 4MO2A 1QMGA 1LTHR 1C0KA 1E77A 1W8DA 4NFHA 3RC1A 1LDBA 1LLQA 3KZVA 3MCVA 1V35A 4CM1A 1UR5A 3EGOA 1R15A 3ONEA 1BDBA 1M76A 3HZZA 3E5RA 3QWHA 3VDQA 5C37A 2JAPA 1N8KA 2O7SA 4FR5A 4HFRA 1VRWA 1YBMA 2Z1NA 4O6VA 4IDBA 4DXHA 3L6EA 2CSUA 1LSOA 3H2SA 3ETGA 4E30A 5KJ6A 4XB1A 3KYCB 2JL1A 3FNHA 3NDIA 2EW2A 3UICA 4KWHA 4WGGA 2A35A 4YXFA 1U3TA 3C8MA 1MFPA 5G0WA 5GZ1A 4BO2A 4EUFA 4F6CA 4XA8A 2QHXA 4LCJA 4II3A 5TJ9A 4MINA 1YB1A 4C4OA 1QLJA 3ORFA 3LT4A 1Z75A 1NHWA 4QXMA 4BQRA 4UVEA 2NNLD 5F21A 4GI2A 3ZNPA 4YR9A 1ZH8A 1RM4A 1A7KA 4HP8A 3EW7A 4YT4A 2DU8A 4D44A 3DBRA 3A9WA 1XEAA 4BKOA 2GZ2A 4DC0A 4ZQFA 2NVUB 4BO1A 1ZXBA 1HLDA 3PP8A 4YAIA 2BD0A 2NQ8A 1O5IA 4Q3DA 3RAJA 4O63O 8ADHA 2EJVA 4ZGWA 1TT5B 2R2GA 3PI7A 5KJ1A 5CHEA 4U7WA 2BHLA 1WZEA 2B37A 3JQAA 3O4RA 4NQZA 1P1HA 1ZUD1 1T26A 3D5TA 4PN3A 3ICCA 3WMXA 5JYEA 1Q1NA 1C1XB 1FDUA 2G76A 4E32A 4MP6A 3QWAA 1MB4A 4BNUA 2FWMX 2PKQO 4HUJA 1UXGA 4KDEA 1B2LA 4ILKA 4TVOA 2Q4EA 5JAQA 1DIHA 1Y9AA 4F3YA 2RIRA 3K96A 5JY6A 2ZJ0A 5TS3A 4TQGA 3P7MA 1PGPA 4PLWA 1IY8A 3H3FA 1P44A 4PLVA 1I33A 4XJSA 3VH1A 4MP8A 2IEBA 4XQEA 5THQA 3AM3A 2AEJA 2X0NA 3FNEA 2VT2A 3F47A 3RUEA 3W1VA 2VTDA 1Z7BA 2JHGA 1KS9A 1UAYA 2ZTMA 3GT0A 2OGUA 3TPCA 5JYDA 1FDVA 4RF5A 5U9CA 1NFFA 2YFHA 3BTUA 4DA9A 1WZIA 2E48A 4BV8A 2RCYA 3FR8A 2FR0A 1AHIA 3WMWA 5KVVA 2HU2A 3JD1A 4H15A 3KRTA 1FK8A 4LGVA 3U9LA 5A5EA 5TF4A 1HDGO 1TA4A 2NTNA 3PFWO 1R37A 4NG5A 3BMOA 1R4MB 3JYQA 1K6IA 4DLLA 1ML3A 5L95A 2IYOA 2IZZA 4L75A 3GHHA 3SX2A 4JBGA 3DHEA 4WK6A 4A27A 2P68A 1JAYA 1JVSA 1LC3A 2ZTVA 5HBRA 5TJHA 1MA0A 2DBQA 2AA3A 3M1AA 3R3JA 5BSEA 1CETA 2WYWA 5KWEA 2I99A 5L3ZA 4XR9A 2YW9A 1V3UA 2ZCUA 2VUUA 4ROSA 1UP6A 1N92A 4RCVA 1VJ1A 4FQ8A 4MVJD 4WCDA 3LQFA 4IQGA 4DC1A 4XZ3A 1I2CA 2Q99A 2D4AA 4D45A 1U7HA 4RLSA 4ZU3A 4RPJA 1ENOA 5EINA 5I8ZA 4JK3A 1KC1A 2X58A 2XAAA 3OA2A 1JWAB 4D43A 2EW8A 4U6SA 1R4NB 4BO4A 1K6XA 2DM6A 2B35A 1E6UA 5I9LA 3PJEA 1BRMA 3FTNA 4EJMA 2O2YA 2DFDA 4ZD6A 4XD2A 5JE8A 2EXXA 3DBHB 1EMDA 2O3QA 3W6ZA 2QIOA 4AJIA 4Y6RA 1FMCA 4J90A 2VRBA 2JFFA 4QECA 4TZKA 1PZEA 4P4GA 1Z45A 3F1LA 4FC6A 3SJUA 3ZHBA 5JO9A 1P33A 5IZ4A 1YOVB 3DWFA 5GMOA 2HSDA 2WTBA 3KSDO 1KVRA 2OP0A 4FB5A 2FRDA 4Z9XA 1PJQA 2O3UA 4LCEA 4CMBA 2ZQZA 1EVJA 3RKUA 4M89A 5K6AA 3H9GA 2GF2A 3G1TA 3AFMA 2NQTA 5A04A 2PR2A 4D46A 1EE2A 4NR0A 2DBZA 1CQJA 1HEUA 1MG0A 5K9ZA 1T2CA 3QWBA 5I7EA 3L07A 4M87A 3V1TC 1NVMB 3VPSA 4CV2A 3ZV5A 5C5IA 2A92A 2O3RA 1AHHA 2EERA 3M2PA 1C3VA 1P1FA 1UXJA 1NNUA 5JSFA 4QTZA 2I6TA 3DR3A 5CFZA 5IAAA 3D3EA 4JP3A 4EZBA 1PL6A 2I5PO 4MVJM 4RZIA 3IP1A 4C7JA 5AYVA 2A94A 3RD5A 2EP5A 1MG5A 1Q0QA 1R0SA 2GZ3A 3HWRA 3ZNQA 4CLDA 4W99A 3JYOA 3W8FA 1YVEI 3OHSX 1KOLA 1ISHA 1B15A 3HN2A 3RWBA 3W8EA 2J5KA 2VNAA 2J3KA 2X4GA 1YL5A 3LC1O 1NWCA 3PWSA 5F5LA 3GN2A 3QRWA 3WFIA 4FJ2A 4MVJH 5EQFA 1JN0A 3WGIA 1LRKA 5HS6A 2GGSA 1ENZA 3KSUA 4A7PA 1DAPA 5TRTA 1EBFA 4YAKA 3DMYA 2HK8A 3H8VA 4KTTE 5B4UA 4U0KA 1W73A 2W2LA 4D0SA 4OQZA 4UEKA 4YQZA 2NU7A 4NBWA 1BGVA 1E7MA 1KVUA 1U7TA 1ZK0A 3VH3A 3LF1A 3RFTA 1KEUA 1NPDA 4I5EA 3AUSA 2V7PA 1JKFA 2ZQYA 4IINA 1SO8A 2AMFA 3KEQA 2D8AA 1JKJA 1ZSNA 5AXAA 3G49A 4BO0A 3U4HA 3A1NA 1EE9A 3OJFA 5F1KA 3GNQA 2VZ9A 3GVXA 2O4UX 2E49A 5JLAA 1N2SA 2P9GA 4II2A 3R0IA 3E03A 3NYWA 3DXFA 3WGTA 3N7UA 5IJZA 5LDHA 2NV6A 3GG2A 4NH4A 3ZV4A 4A5OA 4ALNA 2HQ1A 4B4UA 1E3SA 2J6IA 4YVFA 4A0SA 2VUTA 3WSVA 5IZCC 2YHUA 2HKIA 1GV0A 3ASUA 4GSLA 5JAMA 1I3NA 2BFOA 4MOWA 1A9ZA 1I01A 3MEQA 5DP1A 1QV7A 4XGKA 2IEDA 3F9IA 4M8SA 5JXWA 1XR3A 4WKGA 4BO5A 1LSJA 4BNJA 5HA5A 2Q1TA 1ID1A 1SBYA 3PIIA 1DFIA 3SXPA 4PLPA 1ZK4A 1K5HA 3WQRA 3CXRA 2VOEA 1H93A 4K1LA 5BNIA 5ILOA 5IXYA 3W4IA 3PJDA 4UVIA 1ISGA 2FPPA 3ZI0A 4XYLA 2BELA 5TT0A 1EZ4A 4IY1A 3LT0A 4R51A 4XQGA 5TC4A 3VZQA 1HWYA 3KOUA 2I67A 5FYDA 2O50A 4Y9DA 4CMIB 3GNSA 4HFJA 5A9TA 1DRUA 4RPGA 4XEHA 1HSOA 2FHSA 4ZQBA 2HLPA 3OJ0A 1E7SA 1KVTA 4Z9YA 3QHAA 3WBBA 3ZWWA 3RU7A 2QZZA 2Q49A 3OETA 1E3WB 4OOFA 5IN5A 3HDYA 5ER9A 4WLOA 4QQRA 4L73A 3WSWA 4RVGA 1LRLA 2FPIA 1TT5A 4CMGA 2VOJA 5BSHA 3GMDA 4LISA 4J4BA 2VCYA 2D59A 1AXGA 2PK3A 3T4EA 2NLOA 2YDXA 5TSDA 4BNKA 2X0IA 2NTVA 1QR6A 1W4ZA 3IP3A 2G0TA 3D1LA 1SOVA 4TMFA 4RL6A 3ZWBA 2GRAA 1ZK3A 2JCVA 2WYUA 2ZK7A 3GR6A 1PS9A 3PWKA 5JDIC 1C14A 4GWKA 4BUCA 4XDYA 3F5SA 4YJGA 1SZJG 2LDXA 4XKJA 5CDUA 3VHRA 2Q46A 2Y99A 4YB8A 3PRJA 2O48X 2EKPA 3L4SO 4JN6B 3CMMA 2Q45A 2P9EA 3GPDG 3WGOA 1A7AA 4HV4A 4RV9A 1JW9B 2WDZA 5G0TA 4YJDA 3ZU2A 3WXBA 4AJNA 5JFOA 2W98A 5KNLA 4MIEA 4YJGB 4CUKA 1IE3A 2NVUA 3DFZA 2YV3A 4HFNA 3QWIA 4KQXA 1YXMA 4O1MA 2GCGA 1KIFA 1KVQA 2ZCVA 3E8XA 4B8WA 4XQ9A 1VKOA 4O59O 5A9SB 1V6AA 5DNAA 4IDFA 4J16A 4E21A 2WM3A 4XYBA 2UUOA 2WWRA 1ZEJA 1HLPA 4ID9A 2VYVD 3B1JA 4LK3A 4E5KA 4IS2A 1FDWA 3GUCA 3PYXA 3PZBA 4WECA 5ENVA 1LDGA 2P4HX 4EJ0A 3K5PA 5CAEA 3EZYA 3RBVA 4DVJA 3MWEB 1GCUA 3KETA 3JYLA 4AICA 1XQ1A 4UAGA 1KEPA 4ALMA 1PR3A 5F1OA 1E7RA 4NNJA 2PKQP 4CM6A 1C1DB 4Q3CA 3QVTA 3RUHA 2O23A 2AEFA 3B70A 4XRGA 2BF7A 2UDPA 6ADHA 4S1VA 3OM9A 3IKVA 1BSVA 1H6AA 4CMAA 2Z95A 4K28A 1DOHA 3PYLA 3CUKA 1DO8A 5IDXA 3F4BA 2FSSA 1I2ZA 3F1KA 4CPDA 4J1NA 1GYPA 1O6ZA 1LEHA 3DZBA 4NJMA 4PCVA 3BXXA 3BHMA 3DDNA 3U4IA 3E18A 1UDCA 4K6FA 1I5RA 3K2EA 2IE0A 3K92A 4OJNA 2VWQA 3KM0A 1EEHA 4GX2A 1ZKMA 2RH8A 4FGWA 2B4QA 1PQWA 1RM5A 1K0UA 1YS4A 3ZWOA 5A02A 3OBBA 4HADA 4XYEA 1R4MA 1GPJA 2VTEA 4XB2A 4B3HA 1B26A 4M54A 2WEKA 3KHUA 4AFNA 5B4TA 5T5QA 1XELA 4RF4A 3VVBA 1I30A 5MGBA 2AE2A 1NHGA 2UAGA 3H7AA 2C59A 2PA3A 4E2YA 1DEHA 2ZJ1A 1R6DA 2O3JA 4R4JA 1M66A 7MDHA 1I36A 4DMMA 4QT0A 4RQTA 1N7GA 4IIVA 5A4DA 5C7OO 3PHHA 5TT1A 3D64A 4JXKA 5DOVA 1B16A 1YRLA 3JD4A 2QYSA 3VZRA 5L7YA 1GD1O 3D7LA 3JD2A 4XCVA 3DBLB 3O8QB 5FF9A 2Q1UA 4B8ZA 1E3JA 2O3TA 4CQMA 3WYEA 4CM4A 3NEPX 4MP3A 2XF8A 2A4KA 4EJ6A 3I9OA 2O2SA 4MDHA 3JQ9C 1GEGA 1C0IA 4E6PA 3TWOA 1HDRA 4A10A 5IZCA 3A06A 4P4NA 5I7SA 1VL8A 1H6BA 4ND2A 2PGJA 2X23A 4J49A 4XYGA 3UN1A 4BNZA 4CM8B 1P1KA 3WYCA 2YJZA 4R16A 4E13A 3DZIA 1LX6A 3TFOA 3TZ6A 2D5CA 3TJRA 4I5DA 3AU9A 5FFFA 4ND5A 3PGXA 5BQFA 4PVCA 4QO8A 4OXYA 5EESA 3IMFA 2X5KO 2QW8A 1WMBA 4NI5A 3C24A 3GF4A 3JV7A 4TROA 5B37A 2HJSA 1U9JA 2IYPA 3BTVA 4HBGA 3I1JA 2JHFA 4ALKA 3INRA 4MKXA 1X7HA 4CR6A 3PQDA 4WE3A 1PGQA 3IIEA 1NQAO 3RJ5A 3QVWA 3K2BA 4J0EA 4AL4A 3CEAA 4Q9NA 3HB5X 4PGFA 1U3VA 1ZK1A 1LJ8A 2DAPA 4EITA 1WXDA 3JQ6A 3Q9NA 3DTTA 4G65A 3QVSA 1B3BA 4FC7A 1DRWA 1EQUA 3E6AA 4QEDA 3SLGA 5GY7A 2ZYAA 4WNCA 3F46A 3PLRA 2BFMA 4Z0HO 2F00A 1CIVA 1W0CA 3PEFA 2J5RA 4EDFA 1LLDA 3K30A 3FBGA 4GQAA 4QO7A 1O94A 1VJTA 2PZLA 2C2YA 3RC2A 2JD1A 4LSMA 5DZSA 1T24A 3C7CB 1I3KA 2VYND 1FXSA 3PQFA 1KEVA 5K1SA 4H3VA 1IZ0A 2TMGA 1HZJA 1Y8QB 3U0BA 3UGKA 3W4JA 1DB3A 3Q0EA 5L9AA 1LC0A 1A9YA 1DAOA 4I9NA 4QFDA 4G81A 3C1TA 2GD1O 4IJWA 3D4OA 2DTXA 4N18A 3WIDA 2AQ8A 3KLMX 5K6AC 4L9RA 3OQBA 4B3IA 1BMDA 1EBUA 1E3IA 1FDTA 1GQYA 1S7CA 3H9JA 1E1KA 1T2EA 3GEMA 4CQMB 4BO3A 3FWNA 3DZHA 4IJVA 2CF6A 4LRSB 5G4KB 4DL9A 4BNVA 3JQ9A 3ZHYA 2ILTA 1QYDA 5DF1A 3DOJA 4CLXA 3DB2A 1DC5A 3H9EO 3HDQA 4RVDA 4BQPA 1RKXA 4YJHB 3GFBA 1J4AA 4RPKA 3ULKA 3WTBA 3UUWA 1E3EA 4IDGA 4J7CA 4JBHA 1ADCA 2GN9A 4OAQA 4L4RA 3EUWA 2AQKA 3HG7A 5TX7A 1I0ZA 4QFCA 1IPEA 3PHLA 2X7HA 1GU7A 5I9NA 4GKVA 1IZ9A 4NFSA 4D0RA 1CDOA 1RJWA 1KYQA 4DGSA 1UP7A 4IGEA 2AEMA 4KDFA 2EF1A 4PZEA 1A5ZA 4J1SA 1YOVA 3QW2A 2Y05A 4HNGA 2E4AA 1GTMA 4JJGA 3C3XA 2B5VA 4WLNA 4E5YA 3AFNA 3SJ7A 5THKA 4PRLA 4IS3A 5AXCA 4DBZA 4BNFA 4AJLA 2NWQA 2X86A 1GQ2A 3R3SA 8LDHA 3BMCB 2Y0EA 4U6QA 2E37A 4W9NA 4Y98A 4XWYA 3TL3A 1E6WA 1LDYA 4YAGA 1PQUA 5KIAA 3QSGA 1H2BA 3KYDB 2UUPA 1PZGA 2DC1A 4MIOA 4R5MA 2ZB8A 3UCFA 3GC6A 4RDIA 3ROMA 5C7LO 1X15A 3V1YA 4WOKA 4RJTA 1MGOA 1N5DA 3IUSA 3NUGA 1YJ8A 3RCBA 3FHLA 3EYWA 1DIRA 1YDWA 4IGFA 1VI2A 2Y1EA 3BHIA 4IMPA 4Y6SA 4OM8A 1ONOA 1XQ6A 4Q39A 3GVHA 4E5NA 5A3VA 3JQEA 5CDTA 3ANLA 3U4CA 1R0LA 3Q1LA 4YT2A 5JBIA 4NZ9A 1NBOA 3GZNB 3MWDB 1T4BA 4R9SA 1JLLA 1P31A 4RF3A 4Y8VA 5JDCA 1O9BA 3LZ6A 4GX5A 1U5AA 1OC2A 1YKFA 5KOIA 2JD0A 1HL3A 3OICA 4UUPA 3H3JA 1Z73A 3CSDA 4B4WA 1GAEO 1MUUA 1F17A 1GZ6A 3I23A 1U2DA 4G2NA 1GV1A 4DQXA 1E5LA 1VL0A 2H6EA 2PTGA 4D3FA 1LDEA 3WYBA 3DAFA 4E0BA 4NK4A 2FY8A 4CLOB 1SMKA 1R4NA 3PK0A 1D4FA 1DRVA 4WPGA 5EN4A 2VRCD 3PJGA 2PGDA 4JNKA 3GZNA 3E9NA 3ZHXA 3OEWA 3PHJA 3U4DA 3FNFA 2HUNA 3P2YA 5A9SA 1PS0A 3I4CA 3LYLA 3OIDA 5JPIA 4R3WA 3V2UA 5DN9A 1A27A 3DHYA 3JQ8A 4HNHA 4BGVA 5I7VA 3WDSA 3I3OA 3NTQA 1LLCA 3OH8A 3DO5A 2X9GA 2B83A 3CKYA 2HMVA 3UH1A 1SPXA 1ADFA 2HK9A 2PNFA 3GDFA 3QP9A 4ITUA 1HDOA 2P2SA 3KLPX 1H0KA 3ZHZA 3Q2IA 2ZTUA 4Q3AA 2BH9A 2EWMA 2VUSA 5CP8A 2CVOA 3A14A 3CH6A 3S55A 1E1NA 4TSKA 3X2FA 3WGHA 3HNPA 5G0SA 4ZQHA 4TRMA 3R1IA 1DC3A 4E12A 5J23A 5IDQA 5IG2A 1YJQA 5ADHA 2YFQA 2Y68A 2C54A 5JY1A 3RBZA 1HTBA 4AVYA 3S2EA 2XPCA 1GDHA 5JCJA 1Z82A 2POQX 4WEQA 2YQ4A 3HDHA 4NU5A 5HRUA 3QY9A 3G17A 3ABIA 3PTZA 1I3MA 3UFXA 1K2WA 3JD0A 4ALJA 3B6ZA 5GZ6A 3NX4A 2LDBA 3GRKA 4YAJA 3DZGA 1TEHA 2FP4A 1LXCA 3PLNA 4N5NA 4PLTA 2EKQA 3F6YA 3QV1A 2QRJA 3RUDA 3ZWAA 4CM9D 4R01A 3BAZA 1MLDA 3GHYA 4ZHSA 4GSKA 5FI3A 3TZHA 2VQ3A 5LDGA 3GVIA 1GL3A 4PZDA 3K31A 1OOEA 2GASA 2R6JA 1ZFNA 2CDCA 3RUFA 3RSHA 1E5QA 1GUFA 1V0JA 4DRYA 5I7FA 2WYVA 5DOZA 3WS7A 4CMEC 1C1DA 3BMNA 4MIYA 5EIOA 2VRCA 1PZHA 2JAHA 4CMKA 1E92A 3BMCA 1MXFA 3LT2A 4WCFB 4CV0A 2P4QA 2E82A 1QG6A 3KYCA 4PLHA 4FOOA 5FEUA 1ARZA 4RVHA 4PLGA 1W6UA 3ZWPA 1L7DA 3Q9UA 2Y1FA 5JC1A 1HYGA 3F5QA 5F1PA 1EQ2A 4AJPA 3I9LA 3GNTA 1PL7A 1X14A 1GUYA 1Z7EA 2YY7A 4HXYA 2GO1A 2YDYA 3MJTA 1NVTA 3GAZA 1O8CA 4K26A 2FPGA 3U49A 2R00C 3K8ZA 3NT4A 2FSVA 4XGNA 3STHA 1Y8RA 4J2HA 4WLEA 1X1TA 1UZMA 3LSYA 1ZO8A 3BTSA 3BMOB 1PJBA 3H4VA 3GUYA 4UUNA 4AJ1A 3GA0A 2YHIA 4BVAA 4R5HA 5A5FA 3I52A 1Q2XA 4AJ2A 1VLLA 3VZSA 2UYYA 5AXDA 3ZH2A 3ENKA 3L0DA 4CLOA 3OECA 3ZN2A 3AI2A 2GYYA 2X6TA 3PQEA 1PGJA 5TLSA 3ENNA 1H6DA 2XXBA 4JCOA 4IDAA 2UVDA 2J3JA 5EL0A 4EBFA 3HHPA 1TI7A 4DTIA 1H2HA 3PIDA 2RHCA 4JGBA 1H9BA 5BNFA 2YQ5A 4YPOA 3GEDA 3TOXA 3ZWCA 4CQLA 3DC2A 4IDCA 5AVOA 3AM5A 3WJ7A 1NXQA 4YCAA 3HQ4O 2Y1GA 3S2GA 4AJJA 4L0QA 3IOYA 3ZW9A 2IXAA 4J9VA 4BKPA 1HKUA 4BMSA 1H5QA 2BRUA 4PG7A 1EVYA 3FD8A 3PGJA 5G4KA 1ORRA 3Q3CA 1HDCA 4XR4A 1QXSA 1RYEA 1CYDA 1HETA 4PVDA 5DCYA 3U09A 2DVMA 3PYMA 5DULA 1U8XX 3LC2O 3ITDA 2WMDA 1SC6A 2HMSA 4BO9A 4CMEA 1R66A 3W4KA 4TRJA 1G1AA 3DOCA 1ULSA 3B1FA 3FPCA 3ROPA 4F46A 3PXXA 2OOSA 3EZLA 3PVZA 4AJKA 3IJPA 5HWSA 3NGLA 3ZDFA 3V8BA 2TMDA 3WBFA 2VHYA 3AI3A 3AJRA 3ZWNA 1IHYA 3ICPA 2W8ZA 3VH2A 1DBVO 1PJ3A 3CMCO 4DPMA 1IHXA 4LMPA 3KSZO 2EV9A 1PQPA 4AG3A 4NK5A 4EYEA 2WE8A 5IN4A 1ISFA 2QZ9A 4W82A 1DLJA 2I76A 3RASA 2B36A 3D4NA 4GH5A 1HYEA 1V3TA 3F3SA 1I10A 2EHDA 2DFVA 4FW8A 5KVSA 1YWGO 3H6KA 3Q2KA 2F1KA 4FFMA 4YYZA 5EERA 1CRWG 3HFSA 2I3AA 4CUZA 1PWXA 1PGOA 4BV9A 3GY0A 4LW8A 5HS4A 1ULUA 4J1TA 4IQ8A 3AY6A 3FN4A 1MFZA 1X0VA 1ZMTA 4DIOA 1IOLA 4U5QA 1YE3A 4HFMA 5BR7A 3KXDA 1GY8A 1Z6ZA 3DZFA 2EKLA 4NBUA 4F45A 3AY3A 4NHEA 2OORA 5H82A 1Z74A 3NAQA 4Z9FA 2Y93A 4Z3DA 1WLYA 2Q4BA 3A28A 1JU9A 4J6FA 1G0OA 4BGIA 1XYGA 4BNWA 3VPGA 4XQCA 2CY0A 4GGOA 1SEVA 3SEFA 3VPXA 2UV8A 1YONA 4OMUA 1JA9A 3D4PA 2ZATA 2D5AA 2EEZA 1O95A 4GKBA 4I5FA 4HKTA 4N5MA 1P1JA 3EDMA 4BNMA 4XJTA 3AK4A 1X7DA 5L4SA 1H94A 4EI2A 2AHRA 2X5OA 4I08A 1MXHA 5L45A 2OUIA 1BDMA 1YGYA 1PGNA 3ZGYA 3ONFA 3QWFA 3JQ7B 2CNBA 1GFSA 1HDZA 3BMQA 3K73O 2JCYA 1CERA 3I9MA 1NM5A 3FBTA 5JCXA 5DCUA 2IXBA 3AOGA 3F4LA 1IULA 1EFLA 4UREA 1XA0A 1UZNA 1KETA 3I9JA 4A03A 3PPIA 4GL4A 3QJ5A 1ISJA 3COSA 4FN4A 1U1IA 1ZW1A 3GFGA 4K9DA 4B79A 4OXKA 5FWNA 3AY7A 3VOSA 5I9MA 4INAA 4MVJA 2IZ1A 2EJWA 1EFKA 4YDRA 2B4RO 3OEYA 1YH3A 2Y67A 1XHLA 1H6CA 3KTDA 2GZ1A 3OJLA 2EGHA 1PR9A 3DOOA 1PJSA 1KERA 2FZWA 1WWKA 1WVGA 2AXQA 3LK7A 4FOSA 3RIHA 3H9QA 4YA6A 4XYMA 4MVJG 1NQTA 3MJVA 2PKRA 4NBTA 5ER6A 1T4DA 3U62A 1N1EA 1V3VA 3WNQA 5IDWA 2IODA 3ONDA 4KOAA 3RJ9A 4H16A 4CMHA 5L7TA 1OZAA 3GAFA 2C29D 3ZCXA 1QSGA 5KKCA 1SCUA 1D7OA 4GMGA 1EK5A 1WPQA 5BSGA 2NM0A 5BSFA 4NPCA 3AWDA 1Y8RB 4ZICA 2V6FA 1JTVA 4FFNA 4ZA2A 4J91A 1QP8A 5JMWA 1DDOA 3TZCA 4CL3A 4OL9A 4DBVO 3ZZNA 1A71A 1B7GO 4QUKA 1J49A 1BVUA 1GEEA 4XRRA 4R1TA 1OMOA 3DTYA 4Y67A 4KUGA 1E0DA 1T25A 4BKQA 3I83A 3AOEC 4NDNE 4RQUA 2Z1MA 3E1KA 1JDJA 1Q7CA 1UDBA 5CDSA 4MVJI 2HAEA 1Y9EA 1TB4A 3ZV6A 1RM0A 5ES3A 3T7CA 4B4OA 1F06A 4FDAA 4OQYA 4CLRB 4DPKA 2W90A 2NU6A 4GPD1 4L8VA 3TRIA 3VPHA 1UJMA 1I24A 4BGUA 4B7XA 3UW3A 4YBZA 4DIBA 4CV3A 3MOGA 4MJLA 4BO8A 2V6BA 1WDLA 4UVHA 7ADHA 4NU6A 4Z0PA 1EUCA 2V6GA 4FBGA 4YJFA 4BB6A 3CZMA 1N9GB 4GX1A 4RORA 3O03A 3QLJA 1DC6A 2JFHA 5EPOA 4CUJA 4E31A 2BGMA 1HT0A 5C7IO 3N58A 2DPHA 4AJ4A 1VC2A 3FNGA 4BL5A 3SBOA 2CFCA 3M2TA 4HY3A 3RBXA 2CVZA 4NFYA 5ICSA 2X9NA 1I8TA 4CV1A 4D42A 2I3GA 3KUXA 4Q3NA 5EJ2A
chains in the Genus database with same CATH superfamily
3GVCA 1Z29A 1C0LA 1E7WA 3I5MA 3PEWA 1YGPA 2CLSA 2BGKA 4DWVA 4CE6A 2XKKA 4U0JA 2ZRBA 2A8YA 1SBZA 5FHQA 4LYDA 3LKVA 5IASA 2ZYIA 1JNYA 2WSIA 4MS4B 3WJAA 1BIFA 1P1RA 4RUKA 4ZTZB 2HMWA 3PDWA 1JBKA 3UY4A 1ZL2A 3ADDA 1RWOA 2QX7A 4I19A 2Z6QA 4DDUA 3AP1A 2CHQA 3NDJA 4LBYA 4PQEA 1PUIA 2HWKA 1AG9A 1SVKA 1Z8HA 4DIUA 2ZIZA 1JEYA 2PO5A 3HA7A 4UAJA 5AHOA 2P9TA 1W46A 1AQUA 4HQ6A 1FJHA 3BE6A 4H4CA 4HMPA 4YMWA 1FC0A 1XZHA 4YRAA 2JFYA 2YJTD 1QNLA 3CZAA 4CM5A 3O95A 1PJ8A 4CIBA 1W52X 3EEIA 4ZV7A 1JQKA 3I04M 4C43A 1N3BA 4KIUA 1DUIA 2QD2A 3GRYA 3NHYA 2F8SA 3G0BA 4FZRA 4DCSA 2P91A 2OV4A 4B83A 3EVNA 4G1BA 1TAGA 2JJMA 3R7FA 3B3FA 4MUFA 2Q1YA 4GKJB 1OBFO 3ER6A 2E1PA 2H7VA 5DEIA 3WYDA 1JUDA 1E20A 1XB2A 3AW9A 3ROQA 1OAAA 2OFWA 3GEGA 3CN7A 2QXUA 3G9UA 1F6BA 4Q02A 1SVIA 5HIJA 4P4UA 4ENRA 1WP4A 3TQRA 4X64B 3IIJA 1Y7TA 3OBIA 4C21A 1PL0A 2H59A 2DKOA 3HY3A 1BXRA 5MDHA 2HRBA 4ZJUA 2HA5A 2G0NA 7AT1A 3MOIA 3AC0A 1LA2A 3KL2A 2LXNA 4Q1CA 2IZOA 5TGDA 1A2OA 2OCIA 1N6KA 4S04A 1KKLA 4ICIA 5LP6F 2YHIB 3HKEB 3G8AA 3OE4A 4ZZIA 3KJGA 4UJ5A 3ROZA 1BKSB 1ZCJA 2FMXA 3ASVA 4KBYA 3CJRA 4ZODA 4BMNA 4NXMB 2NACA 2CBZA 2HADA 3DZ8A 4KZPA 3HKCA 1KWGA 1EP9A 5EC8A 2F3QA 1KF0A 3QU9A 1SUCA 2BFCB 4DA8A 2VDNB 4INOA 4LZAA 2NU8B 3VVCA 4L27A 2WLTA 3T3DA 5DI3B 2BZ1A 2LUOA 2Q6OA 3WQQA 1YZNA 2Z83A 4EYQA 5MN6A 3I8XA 5EZSA 1LWNA 1XAGA 2B6NA 2NYAA 1POWA 1VE9A 2QZSA 2YWXA 3FWYA 1EUYA 2WF9A 5HP4A 1BN6A 2OORC 4W5TA 1EM8A 3TW4A 3DHWC 1B3RA 4IFIA 3RC7A 1TFUA 3M6VA 2IF2A 4YRJA 5JD6A 3E53A 3SR3A 4Q21A 1VBNA 1TF7A 3KAKA 4KBGA 1V11B 1EKXA 2UYQA 1QC5B 1MU0A 2W2KA 2IFTA 2EBFX 2VN8A 3JRNA 5JW6A 4IJUA 1BG6A 2ANBA 4Q9IA 4Z1MA 4CLEA 1U1DA 3BHJA 1N34B 1L7QA 3N28A 3QA9A 1IZYA 3C2QA 3GP5A 1ND5A 4DEYA 2UKDA 4PG8A 3ZWVA 1A7UA 1US8A 5AKEA 4D7AA 4MV0A 3BYZA 1ADJA 1JQJC 3HZRA 1ZN8A 5BY2A 4FNAA 5HM6A 3UOAB 4D8VA 3PRHA 3PHCA 2C94A 2B1GA 1WCIA 2C2KA 2P3LA 2VFAA 2GTHA 5TMBA 4LC1A 5T57A 3S2SA 1G4AE 1JKJB 1RNLA 1YL6A 2D3TA 3AP2A 1YVUA 3VYWA 4DYDA 5B7GA 4KR7A 2DEUA 2RH9B 3WYAA 1U4NA 1HRDA 1JDNA 1XVTA 3JQQA 4LPKA 4BBAA 2J4CA 4CHTA 3FF4A 3ZD8A 2P1RA 3B52X 4QPJC 2Z3VA 1GA4A 4GRDA 1KYXA 1XD8A 5HG0A 3ZY6A 2ODQA 4B7AA 1RVV1 4IUYA 4BRWA 2DETA 1O7JA 3P20A 4PR3A 3WK5A 4AROA 4Z8XA 4IIUA 1TEXA 3H97A 3NR2A 4MYRA 4AWAA 4DLRA 1UBKS 5REQB 4F06A 2E5WA 3WK4A 5LWHA 3TJZA 2PFGA 1E2JA 3V8VA 2I2BA 2Q50A 3I3SR 4PCUA 3LT1A 2BWJA 1I6MA 4WUVA 5CA0F 4LZLA 3UJPA 3ZY2A 2DULA 1GPLA 5IVKA 3GFSA 2HCRA 1JR3A 3DKIA 2JA2A 1KARA 2VKTA 3N8HA 4Y1RB 4G5HA 2BMEA 3PQ7A 3H0KA 1W5FA 3RI3A 3UUGA 1SB9A 2IY9A 3NONA 3OM0A 2ASVA 4KVZA 4PNPA 4NQRA 2I4MA 4JC4A 4YX9A 1YMVA 3H65A 2Q21A 4IOJA 3P9XA 2PRZA 4WNIA 4A8JC 5A2QA 1W93A 6YASA 1PJZA 4R1MA 3H99A 1BXZA 2J09A 3D7NA 3DF9A 5DNDA 1EFRD 1RT9A 2O1EA 5EXEA 3U7EB 4KK3A 3FUUA 5ALDA 3VXKA 2RHHA 3EVTA 1AKUA 3A4YA 2QV7A 1VI5A 1M6WA 1RYMA 2JCSA 3AEYA 3R2JA 4LUCA 5KQPA 3Q85A 5L6LB 5CDFE 4N48A 1P5ZB 3Q10A 4HEHA 3OUUA 4BN0A 1XZNA 2GNAA 4KIFA 1C9NA 5L6MB 1MRNA 2DLCX 1QHNA 3PNLA 2JH9A 4TOIA 4NCIA 5GIPE 2ZJ6A 2D4HA 4I50A 2DQ4A 2JLQA 5HWSA 4MNTA 1OYYA 2VJMA 1WUYA 3PEUA 1MW8X 1QFSA 2JEYA 4ZDJA 5CEEA 4WY5A 1S9DA 4HO1X 3CSUA 1MHTA 1K4YA 1FSGA 1IBMB 4XPZA 2DUUA 4IQFA 1OHHD 4G1UC 1AUVA 1THZA 2OCAA 1DKPA 1EDZA 1LQUA 1JSZA 1ZRMA 5AVYA 4F1KA 1HQCA 5I9SA 1I3CA 3L8DA 3TDNA 2XLCA 3MK31 1P2GA 3V9PA 4DQVA 4PWZA 5CG1A 1GAQA 2AKAB 2CJWA 1L4UA 3DFUA 1ZU4A 2R6AA 5C8YA 1WNTA 3PC2A 5CA1B 4OK5A 1OJ7A 3V00A 3OPXA 1G9SA 4I8XA 4B4VA 1U8YA 2GSDA 3AMVA 3OJCA 3ILYA 1UBOS 2C99A 2AFIE 3KU1A 2I8AA 1E0SA 5HPYB 3K2IA 2WSSD 4HNUA 2JFBA 4AT1A 4PLCA 3SSOA 1KXJA 1YIAA 3UA4A 1EWVA 1QOZA 5LJIA 3B82A 1G8JA 3LX8A 1LPBB 3M34A 1WMDA 1TQHA 1XG5A 1I7SB 3T1YB 5K8IA 3CE6A 2QRUA 3LF2A 3GA5A 4XDZA 1K8YB 3GG9A 1XHEA 3GGOA 3LLUA 4IZHA 1WAMA 2QI9C 3NNNA 1IN1A 4HDSA 1GJRA 2CZCA 2PV0A 3IT1A 4CGYA 1EAYA 4OBWA 4C04A 1IY2A 2GXQA 3ECAA 1WUJS 4RDHA 5ICMA 4NBVA 3OY2A 4MVJP 2N46A 3C5EA 4R2WA 5F33A 3D4LA 3F9CA 2ZBPA 4Q9LA 2ZUTA 1SB8A 2B4TO 1FS6A 3WNVA 4W1QA 3U3DA 1YQGA 4BLQA 4HL6A 3DLPX 4FVTA 3MPOA 3CX3A 2ZZMA 4OPMA 3I0ZA 1CZKA 4PANA 4WZBE 5D87A 3TCXB 1T0JB 5B3AA 3GOQA 1EFCA 3M1IA 4AMBA 3SVTA 4WDQA 2RKWA 3NTRA 2NZYA 4RTJA 3U0VA 4FFBB 2WAOA 4QXRA 5ITVA 2O6HA 3QVMA 1F5NA 2D2IA 1CLEA 4X54A 2WD7B 3AU8A 3IDSA 3OF2A 4KVGA 4XIYA 4XTCS 5TMDA 1PR4A 1JYEA 3TAHA 3ZWYA 2UUBB 3TI9A 2BJWA 4R0MA 4N6OA 3AB3A 3QKRA 4JHXA 1G66A 3C85A 1V4VA 3CLTC 4KL8S 2AGVA 1JYSA 1AB6A 2G80A 2IYWA 4RD6A 3TM5A 1NFRA 2HLDA 5FWAA 4DVGA 1TYZA 1IU9A 3EVEA 1ZRHA 3D54D 4ND8A 4PSVA 4E2FA 1HYBA 2ZYGA 4CODB 2G7ZA 1IFXA 4HXGA 1XI2A 2QUKA 2C7VA 5EQJB 1Z5GA 4CMJA 3P9PA 4GDMA 5KYNA 4J4HA 3C5CA 3WA7A 2J3DA 2IUYA 2H11A 1YVRA 2LVBA 3DL0A 1UKCA 3MSCA 4G3XA 1UC9A 3WHKA 4DCVA 4IIJB 1G6HA 3ECSA 1LU9A 4PYJA 2QGNA 4AXXA 1G17A 1Z34A 2AG8A 2PN1A 4PR0A 1G6Q1 3AHJA 4R7TA 3GVPA 2RGDA 5FH9A 4F9EA 4RLHA 4FYMA 5HXAA 3S28A 4JP5A 4DCOA 1DMSA 5AXBA 1P0FA 4CG0A 1L8LA 1V26A 2CD9A 3K72B 3JQFA 4RE6A 1TUBB 4FEEA 3P0HA 1AO3A 2HIHA 1JE1A 3V3KA 4C4SA 1KY4A 1YTUA 1DX4A 4L4UA 3FCAA 1MQ8B 1NJ6A 4TV8B 1Y5MA 1Q15A 1II8A 3FRJA 4OP2A 3TR0A 5H81A 3A9CA 2BEVA 3O1HB 3KJHA 4WD3A 5KSOA 1NR5A 2UUAB 3K5HA 4IQ0A 3M82A 3L7NA 4XVCA 2EIHA 5JH7F 2CYAA 1CU1A 2NO0A 4ZXPA 1T2FA 3GZJA 1I4EB 3ZXXA 2RFLA 3O8OA 3S3TA 3I64A 1C81A 4E5MA 5KVQA 2BEWA 3KJEA 4LDNA 3KYJB 5H83A 2WPDA 4JBWA 4BC0A 2DX7A 4FS3A 3S99A 3RUCA 3QIVA 4BY9E 3M5PA 3SQNA 4TQUS 4GICA 3OTQA 3BCRA 5LN1A 3W78A 4TPKA 1UPXA 2FQQA 1OFUA 2HJVA 2XWJI 3VISA 2AK3A 1JEOA 1VSVA 4GI3A 2W6JD 3HKBA 5EKUA 2BYTA 5DTRA 1C8VB 4CM9A 5DPMA 5JQGF 1ZSYA 1XKXA 2H85A 2X1VA 3K0BA 3O4GA 3Q8XB 5JFGA 1GGMA 2Y4OA 3AHCA 3DHNA 2INGX 1FQWA 2IHTA 1DXHA 1VLMA 1A9TA 1Y8QA 2LZ0A 4IFEA 4NYJR 2EFEB 2O8BB 1PJ2A 1O1YA 2VF7A 3HGMA 4OBBA 2Q7XA 1S96A 4PRZA 3VPDA 1DCFA 3VR3A 1WM1A 2WB4A 5CA0A 4COOA 4FLMA 1ANKA 5DBFA 2IY7A 3DLCA 4GBJA 2RBGA 2JJ1A 3BZWA 2H1CA 3KR1A 4MW1A 4B3CA 1CJBA 4C2AA 2BGLA 1HX7A 1WQ3A 3OMLA 5B1YA 2VPTA 1GPUA 1AK1A 1B8VA 2B7BA 3DMNA 3LWDA 1ZBQA 2GDZA 4UVDA 4ZEWA 3KXLA 5IJWA 1S2IA 5F5NA 5GJBA 1OJLA 3A4NA 2MINA 1RWVA 2NXEA 3HDTA 5KTKA 3G2NA 1KH3A 3L8YA 3L6DA 1H1LB 3EC7A 4GE3A 1K6EA 4GEKA 4V0KA 4ND3A 4WEOA 5FTWA 3NWEA 5B53A 1TGVA 1XZQA 2PH5A 3CZCA 4RD1A 1GCIA 3L8MA 1WXHA 4H1HA 1S89A 4AW9A 2YV1A 3DCIA 4Y0AA 4AJOA 1IY0A 1WSDA 3KBOA 4AJEA 3C7DB 5L40A 1O54A 1SUEA 4MPDA 3TN7A 5JNLA 1KDYA 1TNDA 5FUWA 3U3ZA 2XD4A 2FSHA 3MFQA 4D79A 5K6TA 1Y4UA 4EG3A 3QPVA 3PU6A 5IM5A 4YRSA 1GPKA 2H2FA 4F92B 1XZPA 3I4FA 5A1JA 3FR7A 1LUAA 4E3ZA 2Y66A 2PWYA 4E94A 1EFTA 4AN0A 2WJWA 3QY0A 1C3JA 1M3SA 3HFGA 3X0DA 5AVSA 3WO1A 3ZDCA 4RIGA 1WQ1R 2Z2YA 5KSPA 5ALLA 5C2JB 3TS1A 5JANA 4D8TA 2Z9BA 4EYOA 1YK0A 1BCRB 1WUIS 2ZG6A 4LMRA 4Y7DA 5KKAA 3RFCA 2QT1A 4BNLA 1SD2A 2CB9A 2L2QA 3GB9A 4MWZA 1JSLA 3S2YA 4TYYA 1CUJA 3LPAA 3TEJA 1UBNA 2VHWA 4JQOA 3SLKA 3PEYA 1Q20A 4EFDA 5A9RA 3IXLA 4EJSA 4KR6A 1JKXA 2OV2A 4D57A 1ZUHA 4PO3X 3GLQA 2XNCA 2IVZA 2P2NA 3EMKA 4P3KA 5I7AA 1HORA 2POCA 3ZV7A 1DX9A 3GCZA 2WABA 5CGQB 4GUDA 4URHA 4M9QA 1D1PA 4R41A 3NJ4A 1SCNE 4MLDA 3AHGA 4LVUA 5IC5A 1NVUQ 4I5GA 2FN7A 1I0IA 5CLQA 3RYHB 3RJTA 1ODKA 3KHTA 2B1RA 3OCXA 4DLUA 4PW0A 1AN9A 4NCJA 5FNVA 3SC6A 1Q11A 1D9ZA 3TDKA 4EHLA 2L18A 4LDQA 3UJ6A 2HLHA 2MU1A 2BFCA 2O0JA 2QRKA 2PL9A 3ADPA 3EIWA 4LJ9A 1OLSB 4C3UA 4E2WA 3KTAB 4NZOA 1H23A 2F1OA 2XW6A 1UIRA 5DI3A 4CKBB 3V2GA 3OC6A 2X2OA 2JC3A 3JVIA 2P62A 2C4KA 4JODA 3VR4A 4IZ6A 3ZJ4A 1YHZA 4D3ZA 3OQHA 3ZDAA 2F8TA 3I9V6 3NW9A 4RIEA 3MD9A 1EJ0A 3QKWA 3WLPA 4X60A 4ARZA 1IL0A 3RUAA 1QR2A 1XLTA 1XEWY 3NP7A 3OCZA 3GLVA 3ROKA 2CVPA 1NN5A 1N1GA 4KFSA 4M6WA 1MN6A 3SVZA 5KI6A 3ZCSA 1SWVA 2VT6A 3PRYA 1IAVA 5M2QA 3HO1A 4L3WA 5HR5A 4DQUA 1ZGHA 4CEHB 3NC0C 5BUCA 2XODA 3CNLA 4RO0A 3OVMA 2BEUA 3O3NB 3WJ1A 3S7ZA 3ADKA 5LYYA 1RI1A 4D2IA 3TW0A 5IX8A 4RZSA 3UGJA 4JLWA 1JVBA 2VBGA 2VBIA 3KZXA 3V7FA 3IC5A 4M0UA 1L4NA 2ZI3A 3D43A 4NCKA 5HMMA 4YMHA 2PNJA 2XYVA 3TVYA 4NY1A 2IYYA 1S2GA 1NI4B 1ZBDA 4RSHA 5A4IS 5HX7A 4MIKA 1N5KA 5JVDF 3BXZA 1E0KA 1LNQA 2CYCA 4HNAB 4KYTA 1CUFA 4XGRA 2MSEB 4N54A 3AF6A 1QF6A 3H2IA 4KO3S 5EZ5A 1PSDA 2LBPA 4JKIA 4EI8A 1PTJA 3G82C 3QGMA 5IZ4A 2AOTA 5AM3A 2LR0A 3AUTA 3WHLA 2OGSA 1EQAA 2I1LA 4IXWA 1HE4A 3DQPA 5F3DA 1VL1A 3PRKE 5LFAA 2PKEA 3UMVA 4RPLA 4DV0B 5F12A 2GJ9A 4QDUA 2MR5A 5K8VA 2LRHA 4H7FA 4LYEA 4EGSA 3T7IA 4EEKA 3HLKA 2H2IA 2D13A 3HU5A 5TVGA 5DGHA 3Q8MA 1XVUA 4Z49A 4V0SA 4LOHA 3EASA 1HE2A 3UMRA 1F2DA 4NOKA 1VJ0A 2WVGA 4UASA 4UUQA 1K89A 1QYXA 1FDIA 1IUKA 2NYRA 3MZ0A 1UAGA 1ZH4A 3A3YA 1N3YA 3I04A 2IW3A 1HFEL 3N39C 1KK0A 4FFLA 4O29A 5ERYA 1EFHA 3ZQ6A 1Q0LA 1KEEB 4BGEA 1EUZA 3P4XA 4BBZA 4C88A 2ZAOA 3DFMA 5T8KC 4C7VA 1I5OA 1ZOSA 3E70C 3FMIA 3CVUA 3D02A 1PSWA 3Q7TA 3KPYA 2OHGA 2Y1LA 3FLBA 4YAWA 3UENA 1Z6AA 3NLLA 5B4VA 1PTKA 4GGPA 5CGZA 3EIHA 3QVOA 4K6KA 1E4YA 2W6QA 5A5DA 1S9HA 1GTZA 3KFLA 1W76A 2R60A 4R6XA 1P45A 3CT4A 4MB6A 4YCDA 1SIUA 3ROTA 4ZI7A 2VLBA 3UM9A 2CUKA 1UUFA 3ZWDA 4TXNA 3Q8KA 2HYIC 5ALTA 4LXQA 2OV6A 2XDWA 5EPUA 1W581 2XA9A 1YA6A 4NBRA 4LQDA 3N8KA 1XAIA 5AKXA 3WNZA 3ZHRA 1NOJA 4KXNA 4YXWA 5EKXA 3IE2A 1A4IA 3NYQA 4QULA 3CKLA 1T2NA 2HWXA 3DVLA 3RYTC 5B55A 1TU4A 1YDHA 5H4GA 5AKHA 4AU1A 4X92A 1KAEA 4DE5A 4JQCA 3BJMA 3UVEA 1QIEA 4L0DA 5AOCA 4IJQA 3RE1A 1SBQA 1YSCA 2B0JA 5AKJA 4R3UC 4ZYYA 5FL7A 1NPTO 4NE2A 3WWZA 1L5FA 1JZSA 1ZS9A 2X0RA 2QE7D 3OLXA 2VWPA 4RY2A 3HSKA 2PGNA 2REOA 3AT1A 4HS9A 3JSAA 3SHOA 5LMCA 3NANA 2EATA 2WZDA 3DVAB 3F49S 1BTOA 3GJ3A 3UMGA 5A02A 4UBOA 5M7EA 5LQAA 1CJCA 1N2HA 1ZM7A 1E32A 3BIOA 4PXAA 5FUXA 2BJHA 1X8LA 2QD5A 2G77B 2I80A 5FPPA 1BQ3A 2JAXA 5CNMA 3OQ1A 4Z0TA 2VH2A 1GNVA 1EUCB 3VOTA 5KTSA 2IX3A 3BJIC 2QIPA 4FWIB 2DKNA 2ZIXB 1V8DA 3KWFA 3ND5A 1OC4A 2BTEA 3AVXA 1QWSA 4HZUB 5HW0A 5BN3A 4X93A 3L0SA 1D0IA 1C2YA 2V4UA 3FSGD 1H0HA 2BFAA 3FPBA 4MAAA 2BKEA 3PA8A 1A76A 3H1AA 1EX6A 9MHTA 3WTCA 3FF1A 3B20A 3C3EA 2GR9A 2OZLA 4MQ4A 5KSYA 3N8DA 2G0AA 2NT3A 5EQDA 3GGPA 5K0GA 2WWYA 2BBSA 4HNTA 3NIGB 2GN4A 4GWLA 4G1FA 1UT5A 4MS1A 2FN3A 2D8MA 1AURA 4RS3A 3LLSA 5EVJA 1LCIA 2HDHA 2QN2A 5J59A 5JAZA 2KSQA 1NIPA 4DNXA 4JJFA 4CDNA 3G7SA 4P22A 1K5GA 1G6KA 4EW3A 3OZBA 4FMDB 3T8YA 2GA9A 4DSAA 4PN7A 5A7FA 3UG7A 1TADA 3N2NA 1R0KA 2V7VA 3ZU3A 2J07A 4OH1A 3MJSA 5AHWA 4HAWA 3LPLA 4FJ1A 3GFOA 2GEBA 2ZE7A 2EQAA 4QOFA 1VXRA 4YFYA 3RU3A 4YRCA 4AN1A 5CB8A 2X1LA 1F7VA 1USWA 4RVCA 3EXHA 3QLVC 4WOCA 1Q91A 1J5PA 3HJBA 1U0SY 4GX0A 1M33A 4AZSA 3UAVA 4N03A 5CB0A 4W1PA 5DM1A 1OB5A 3DTVD 1GG8A 2F3SA 3TIIA 1SKYE 2IITA 3R74A 5BP7A 3BGSA 1YB4A 4ZQGA 1IG3A 5KTTA 1ZJ4A 3V33A 3U37A 2LE0A 4NKRA 2YCLA 4ZQCB 3AKEA 1P0IA 2HN9A 1NM5C 2VL7A 1EX9A 3P5SA 4C3OB 2XUPA 4ADSG 4E03A 4KP7A 3H5NA 3MAJA 4I6EA 5CLIA 2C20A 4IXTA 5EE0A 1MD9A 5AW0A 3AO0B 4ND8B 1PJCA 1V16B 5BW5A 3GQVA 3O8QA 3OU7A 2BM8A 1VKNA 1CIJA 2VBCA 2CF5A 2X0JA 2JKVA 3TXAA 4UDYX 4B3JA 2HRDA 3JAKA 3GLRA 1TVEA 4ONEA 3TIFA 5C8XA 2C07A 5LIPA 5A4JA 5LIRA 4DANA 4BPRA 4FJ0A 5MF6A 4RDXA 5EJ9A 4BS9A 4FZ5A 2AE1A 2NZ2A 2RGXA 1SPBS 1R16A 2E9SA 1ZXLA 1W59A 2NP6A 5C53B 1NQ5A 2BGUA 4QASA 4JB3A 4QXQA 3WIEA 1CUSA 1YQ9A 3R6LA 5JDCC 2QAGB 4MCAA 1V71A 5HTOA 2H1WA 4B7ZA 2ACKA 1I3LA 1MPTA 1Y8AA 1Z0IA 2XXJA 3DEIA 3FI9A 4WA8A 4C1BA 3UK2A 4QDOA 4BIIA 3B1KA 4R9VA 4N7BA 1S6YA 2RGGA 2NVWA 3NH6A 4M1TA 4E1AA 1NSYA 3MOSA 5B12A 3K0CC 2F2TA 2I3DA 1GQSA 3EVFA 4NCNA 3X2EA 2BMAA 1IMOA 1SVUA 3B36A 3PQ8A 1M75A 4ZPXA 1AKMA 1OFGA 3WMGA 4LC9A 4GFDA 5U4XA 4BGDA 3EPLA 2FTKE 1EHIA 1PZMA 5BWNA 1ZJZA 1CQPA 1T8UA 2ZRQA 3QENA 2AN4A 2FPRA 2QMUA 1QMGA 2EGUA 3N2KB 4G85A 5TPZA 3PL5A 1E77A 2M6RA 3QOWA 1YK1A 1LLQA 2QMEA 4DZRA 3FVQA 2HJGA 2QTRA 2R11A 1Z83A 1V35A 4M1SA 4QHYA 3O2JA 4NFLA 1H66A 4YJ3B 4ZCIA 4U7DA 5DNYB 1M76A 5C32A 1IQUA 4RAQA 2JAPA 1Y5IA 1JLLB 2O7SA 2PEZA 4FR5A 3I72A 4YMSA 4O6VA 1YBMA 5ALYA 4ZVTA 2F4NA 2CN1A 1KDZA 4BZPA 3L6EA 4OL0A 5FRDA 1A5AB 4WT7A 3IFSA 2GI4A 5E4YA 2F1RA 5SY4A 4XB1A 1QP4A 3U4MA 1R0BA 2V7BA 2PH1A 1QZ3A 3NDIA 2EW2A 1EP3B 1PI3A 2XSZA 2ZWIA 2K5UA 2ZEJA 4QDXA 2A35A 1YBFA 5DM0A 2G6BA 1GLGA 1I9GA 2O5RA 2MWMA 1IXKA 1BKYA 2VP0A 4L1KA 2ORYA 5B3LA 1M34B 5BRJA 2L82A 3VO8A 3G6WA 3P9SA 4BJHB 4BO2A 5HJ5A 3R6GA 1FX0B 2IYFA 4FMDF 2YX1A 2LCIA 4LCJA 1L9KA 3DDSA 3MINA 4MINA 4UFNA 5F7OA 3KQWA 3BFKA 3LT4A 1Z2EA 2HCJB 1B93A 4BKMA 3KQPA 4ZKEA 3H9CA 4KPFC 1PZNA 4TLMB 1ZNXA 1KZGB 1UPFA 4DCUA 4YT4A 2HJWA 2A9VA 3FRIA 4UOQA 2B3DA 1OBHA 3L7CA 5FORA 5GAJA 2Q6TA 2DU8A 1AS0A 2ZIEA 2A14A 3IODA 2X8JA 3A9WA 3EFHA 4K8RB 5BXQC 5IJ9B 3SYRA 3CVWA 5JAHA 1VDZA 1NL3A 2P1DA 2GPBA 4NONA 3TRHA 4KPUA 1Z5VA 2NVUB 2ZSUA 1U1EA 5E4TA 3S5JA 3ZJTA 2WMYA 2F6RA 4IO1A 4GPEA 3NI2A 1UBEA 2NQ8A 1J21A 1O5IA 2CXOA 4LK2A 2WT8A 4YMIA 1KJWA 1Z33A 3EGXA 3RAJA 3KWLA 4XSHA 2EJVA 3IAXA 3QMMA 1U1GA 3R5KA 3PI7A 1VPVA 5CHEA 1DKRA 1OB2A 2UXDB 3TGLA 3ZYCA 4MYDA 3ZS9A 1UBMS 4PN3A 1T9GS 1LQ2A 3D5TA 1J8MF 4HEQA 2P7HA 3FKSA 1Q1NA 1C1XB 2PL5A 2R2AA 3AR5A 4W5JA 2ZSAA 1BA3A 2B9EA 2XGMA 2RK6A 2YY6A 3P9ZA 1YKSA 2PJZA 2PKQO 1QU2A 1OGYA 2XUAA 2EDAA 1QKJA 4JH0A 4EO4A 4UMVA 1FS5A 3NOOA 1B2LA 3UH0A 1TKBA 3HL4A 2Q4EA 1U81A 3OOHA 4TWJA 3AZOA 3KVNA 3W5UA 1G64A 1DBPA 1UBHS 1USGA 4DLTA 1NMXA 2UZ3A 3K96A 5EP4A 5TXGA 3JU3A 5JY6A 5TS3A 1UM9A 4PO8A 3P7MA 3UKJA 4C0XA 1ZISA 3AUJB 1PGPA 3H16A 1KO4A 1QBKC 4JC8A 3D4BA 3ITNA 3AFHA 4X8LA 4D3YA 1I33A 2G67A 1TPZA 4RK1A 2FK8A 1CNMA 2IEBA 3FZYA 2JAOA 1W87A 4MP8A 4FT4A 4UDXX 4MJXA 1YZTA 2X0NA 5THQA 1K08A 1T3LA 3L7MA 4F5ZA 2VT2A 3W1VA 4YDQA 2XR1A 1LBQA 1ZD9A 3ED5A 4U2FA 3HVUA 2Y0BA 1KS9A 2QN6A 4RSMA 3GT0A 5G40A 3IAFA 1XRMA 1Y1RA 4P58A 1YR2A 1GPWB 4WK2B 3TPCA 5JYDA 1XA4A 2I03A 1JIQA 1XCOA 3A3NA 3O4IA 4IH1A 1C1HA 5CX4A 5U9CA 4CFZA 2OWDA 4HS4A 4X66B 2E48A 2I3BA 2OILA 3IO3A 1QNFA 1IJFA 3F8TA 3MPUA 2CHFA 4H15A 2NUTA 5M5BA 3GEEA 1FK8A 3SQXA 4C4ZA 2GK3A 3TRFA 3HXMA 4AY2A 1NONA 1A4XA 3KEFA 3PFWO 4BP8A 5B30A 2JANA 2FFQA 4GOXA 3RPEA 1ABFA 3SX2A 4WFIA 4RMHA 4WK6A 1V1RB 4XX1A 1RCTE 4YIKA 1LC3A 2GBGA 5TJHA 2FDXA 2FF7A 4A27A 1NLZA 4QU8A 3VZCA 2AA3A 2QMYA 3GROA 3HJRA 2V97A 3R0VA 1XAJA 2WYWA 2GHRA 2ZE6A 4ZT5A 3TXXA 2H00A 4Q03A 2E18A 4JY7A 5TDHA 3ZE0B 4YPVA 2P8JA 2I55A 4MVJD 1A9XA 4PAQA 4Q34A 1GITA 3CWCA 1UDXA 2FPXA 4EHNA 5DM60 3U44A 1P4HA 1ACLA 3IYLW 1W2HA 4JJ4A 4RLSA 4D96A 1ZH0A 3NM4A 4RPJA 4AMGA 3W34A 3QYAA 2BHRA 4RCYA 1YJCA 1KC1A 4BWVA 1FYXA 2OT3B 2XAAA 4D43A 1E1CA 1JWAB 1NJ1A 2EW8A 1R4NB 4L5JA 1A8PA 4BO4A 2FZ5A 2XT9A 4BMDA 4G0WA 3JWHA 3E7FA 5FWXB 2R6R1 4HEA1 1VPTA 3JTEA 4JOBA 1Q0SA 1RQRA 2ON6A 1X9IA 2EXXA 1J33A 2H4HA 3HI6A 1EMDA 2O3QA 3LL4A 3IUEA 4MPTA 1KJYA 4Z7QB 2VRBA 1LY1A 1X6VA 5EWJB 1NP7A 1WXQA 4QECA 3UUFA 1M1ZA 3QUSA 1A5TA 1PZEA 3EH2A 3W5IA 1P75A 3SJUA 5KHLB 2C5BA 2MYNA 2ZJZA 3B9QA 4KN6A 1XZBA 4QSHA 2IU0A 5KYVA 3L7LA 4LEIA 4OTZA 1SVLA 2C7BA 2WTBA 3OG9A 5PGMA 1NUUA 1HGXA 5C52B 2GD6A 3T34A 4V39A 4TV9F 5ALUA 1NATA 5K0TA 4QPDA 2RAVA 4CNBA 2WKWA 1UJ4A 4LCEA 2NXJA 1EVJA 4OU5A 1FP4B 1XMJA 3W6OA 5F2NA 2ZWPA 3DW3X 3H9GA 4JLSA 3A6PC 3SZLA 5BMVB 5JMTA 2B4KA 3AETA 2RKBA 4MQUA 4JSYA 5A04A 1M2OB 1R5NA 2VJQA 4UXHA 3FUCA 4D46A 1CQJA 2PX8A 5K9ZA 1H5NA 1L7OA 5KQSA 2OCYC 4RFSB 3RK4A 3CB2A 3WLQA 1BS9A 3L07A 3LW8A 5FB3A 4HK4A 3U2QA 2WNSA 4X6YA 5GVRA 2GESA 4S2EA 1AZLA 1BKDR 1ODLA 2X2FA 1P1FA 1UXJA 5EFZA 4D8UA 2ZDQA 4O1HA 3L7OA 5FFMA 4L07A 3W5JA 5JSFA 2CFOA 4EKDA 1NG1A 3LLCA 4JP3A 2JZOA 3R8XA 4EZBA 2EJUA 1CUYA 4RZIA 5H7XA 3SX0A 4BV3A 5D3MB 2A94A 2HSWA 1Y4DE 2DRIA 3EF0A 3RD5A 1T0IA 1GAWA 1MG5A 2WIAA 4G89A 1U7PA 4BRUA 1G18A 1JHQA 3HWRA 4I2VA 1XLWA 2QS9A 3L0CA 3W8FA 1SU6A 1C1YA 3DA8A 1CIPA 2FXVA 4MS1B 4JYCA 3VBCA 4JEHA 1EXMA 3M4ZA 2VNAA 2X4GA 1W29A 2XT6A 3KNZA 4X7BA 3U9TA 3VJKA 5CNJA 2R86A 3FH0A 4YHHB 1PNRA 5B5SA 1XCGB 3CF4G 1B00A 1LRKA 1XLTC 3QBTA 2EDCA 2LW7A 2JFQA 3BKXA 4JCCA 5BUZA 1Z4JA 2PWBA 1RPAA 1RXIA 3AJEA 5B6PA 1IN6A 3NVKI 4KTTE 3H8VA 1VPLA 1GARA 2DFNA 2K7ZA 4XM2A 4YBRA 3TLGB 4QOGA 1GU1A 3GW8A 3JQRA 4YQZA 2FW0A 4OGFA 3LXXA 4J0KA 4JT2A 1KVUA 1ZK0A 3TBHA 1AQYA 1K8RA 4M7RA 1B76A 1VJCA 2ZU6A 1KEUA 1NVXQ 2WJAA 1ZLXA 4N1AA 2V7PA 2W6CX 4L0MA 2H2GA 2PSFA 4RU1A 1RBMA 3SSMA 5CFQA 1W36C 1ZQ1A 5HOEA 1AT1A 1GRQA 1SO8A 1MNQA 5BN4A 3MVEA 1JKJA 1ZSNA 1VPEA 3K3PA 1THMA 2HLDD 3G49A 3P96A 3DS8A 3U4HA 4TYMA 5HF9A 4RH3A 4ZARA 2IU6A 2QQGA 3CRNA 2HI0A 1RAHA 1GL9B 4IF6A 3L0YA 4YAOA 1OKKD 3A7DA 3OCUA 4EPVA 4GECA 4ENTA 3F5FA 2E49A 2OHVA 5KOJB 1H2AS 2P67A 1SOMA 5JLAA 3HYRA 1XTBA 3UHPA 2SICE 2DPXA 2WAAA 2EZUA 4WXHA 1BN7A 3T6KA 2NV6A 3HEMA 2PS1A 1N0IA 1FA9A 3F6EX 4NH4A 4JJAA 4ALNA 2HQ1A 1T3TA 1E3SA 2J6IA 3IIMA 1V7CA 2H4XA 3N3AC 1NE7A 2VUTA 3BK2A 3H2HA 3KLNA 1T9AA 3EG9A 1P62B 5FT9A 3TEMA 5IZCC 1X94A 4IKPA 2AOXA 2HKIA 3KQTA 3RIMA 1R4AA 4B6SA 3TIVA 5KWVA 5E2AA 1L8OA 1JHXA 2CW5A 4PAWA 4TKVA 2HEIA 2P4SA 3MEQA 5DP1A 1GFZA 1QV7A 2IEDA 2ISSD 4K7JA 4XGKA 5MFPA 3GUZA 3DMPA 2C4TA 3HJHA 1TUBA 3HPQA 5IUJC 3BK7A 1WP9A 4OI2A 2UXCB 1EFDN 4BNJA 2BCJQ 4RE5A 3I45A 2J6BA 3VR4H 1QRDA 2AHOA 1ID1A 1SBYA 1DFIA 4CIXA 4PLPA 5EIXA 1K5HA 1JECA 3RODA 2W2XA 3OT1A 2XKJE 4ESVA 2CNKA 3MJDA 5IYZF 3CNQS 1EBBA 3KFVA 2CYBA 2PR7A 2PMBA 3E2IA 1FFDA 4GPBA 1SC3A 2FPPA 3ZI0A 721PA 1BHO1 3E2PA 4EMSA 4XYLA 3IEVA 1EZ4A 5EGNA 5JECA 5ALGA 3GJ5A 3EQ7A 1F9EA 4UNIA 8AT1A 2I67A 2ZS7A 3BWBA 1O6CA 3HFJA 2G1AA 3T3NA 3ERCA 1NMEA 1NXVA 5A9TA 1G5QA 3QMPA 4HEA6 3QKSA 1FSPA 1W0JD 2PUFA 2FHSA 5CLFA 3D6NB 4ZQBA 3AL3A 3OJ0A 3QEAZ 5ALOA 5E8JA 1DAHA 1XE3A 2VYFA 1YB2A 1ESNA 4NMXB 1PFYA 3WBBA 3RU7A 5CDHA 4OOFA 1E96A 1L5SA 4JB2A 3VNBA 2OCLA 3DKRA 3ESAA 1WULS 4L73A 4CMGA 1IXZA 1PJRA 2VOJA 5BSHA 1RFLA 5BUSA 5JASA 1U8AA 2GAIA 1W94A 2H9AA 5JWRA 1SXJC 2A5DA 2AYZA 3EG5A 3TCKA 5GIOE 1AKEA 1LW6E 1YC5A 2HX1A 3CRZA 2V5UA 3ZE8A 4MTLA 1A5SB 3OCCA 4JDUA 2BFBA 1Z5OA 4EGAA 1W4ZA 4X63A 3UPUA 3IR5A 4G0QA 1SOVA 4EHFA 3AXTA 5FWYA 3IERA 3T5PA 4HJRA 1LBIA 1T5HX 3MGAA 5GV7A 1V7ZA 1S2MA 2LWIA 2OFFA 4E5VA 1R6AA 3E58A 4XDYA 4YJGA 3LMKA 3WSTA 3KQYA 2FMHA 1SG9A 5DH9A 4L8GA 2QBYB 2VJMB 3PRJA 4K9NA 4R9NA 1ZN7A 1XDSA 3K70D 1PK7A 4A2WA 3ECCA 4XD7D 4IICA 1K88A 4RV9A 3DO8A 3KDSE 2BGIA 2PUAA 3M89A 3PCRB 1VKHA 2O19A 2GKSA 3LC0A 4ZIRA 5JFOA 5KNLA 3UXHA 4H1VA 4MIEA 2II6A 1Y3IA 3DYBA 4M7WA 4ZQIA 1GTG1 2GQ0A 3BF8A 4FE7A 2FWRA 4YREA 4M22A 4CUKA 1NLUA 1BNCA 5IVPA 2VA9A 3LD9A 4OQDA 4P53A 5EIBC 4WNAB 1OFTA 4HUTA 3ZBTA 3B8EA 3PQ6A 4P2BA 4V0RA 4BFZA 3PXGA 3IE1A 3E8XA 4UFPA 4XQ9A 4O08A 4O59O 3IQFA 4IG9A 5DNAA 4CF5A 2Z4TA 3QUTA 3UT5B 3FG9A 4WZ6A 3ZHCA 4DIEA 3KL4A 1FS4A 4E21A 2P6MA 2WNIA 3R5XA 1ZEJA 1JBQA 2AEEA 4ID9A 2ZETA 3KKQA 1OBOA 3B1JA 4PQGA 1Q50A 3H6GA 3PUYA 4ZOAA 4B9EA 3JSXA 3PYXA 5CDFA 1CXZA 2QYOA 3DH0A 1UMDB 4WECA 2ECOA 1KDPA 4FK8A 3K5PA 2J4DA 3AZPA 3EZYA 3RBVA 5CAEA 1D4OA 3T4UA 1K98A 3CO0S 3CZPA 4QEKA 3UANA 4AX4A 1KEPA 5JCZA 3DEFA 3AVUA 1M2FA 3EXHC 4I66A 3UGTA 2PCJA 4KC0A 5KQRA 1RXYA 1E7RA 3U31A 1IBKB 2PLWA 4RTMA 2HREA 1KMHA 2MSDB 3MLEA 4ZDIA 1C1DB 1MTZA 3DV0A 3QVTA 3S40A 1NI5A 3RUHA 1KK2A 1OZGA 1T4MA 2FW7A 2NZVG 5K0JA 3ELWA 2AEFA 3HKDB 4ARSA 3ASZA 5B58T 3LBIA 3KZNA 2WA2A 3IKVA 4L0CA 1H6AA 4LY3A 4CMAA 1J1UA 1XZIA 3VKGA 4DG5A 3GFTA 3H83A 3PYLA 4G1MB 4MO9A 3EEOA 3S1AA 5BOSA 4XIGS 5BW4A 5IDXA 3UEOA 4Q7LA 1IBRA 3WL7A 1PRYA 5HZKA 1FFWA 4J1NA 1O6ZA 1LEHA 2R3SA 2RHMA 3C3DA 3DZBA 4JI5B 1MOSA 1N75A 3FDZB 3EPJA 2B3TA 2NO5A 3LBHA 3QVGA 2PQ0A 4IXDA 1QU3A 1Q16A 3A4TA 3FWPA 4N3BA 2IE0A 5JZBA 1RJ9B 3K92A 4UJ3A 4LJSA 2IYTA 3KZMA 3G0CA 4BVFA 2BGWA 2V1XA 4KQFA 1ILEA 5ES4B 2RH8A 5FULA 4JI6B 1L7VC 1PQWA 1OILA 1K0UA 1TDJA 2B4QA