1LLUA

The ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
341
structure length
341
Chain Sequence
b'TLPQTMKAAVVHAYGAPLRIEEVKVPLPGPGQVLVKIEASGVCHTDLHAAEGDWPVKPPLPFIPGHEGVGYVAAVGSGVTRVKEGDRVGIPWLYTACGCCEHCLTGWETLCESQQNTGYSVNGGYAEYVLADPNYVGILPKNVEFAEIAPILCAGVTVYKGLKQTNARPGQWVAISGIGGLGHVAVQYARAMGLHVAAIDIDDAKLELARKLGASLTVNARQEDPVEAIQRDIGGAHGVLVTAVSNSAFGQAIGMARRGGTIALVGLPPGDFPTPIFDVVLKGLHIAGSIVGTRADLQEALDFAGEGLVKATIHPGKLDDINQILDQMRAGQIEGRIVLEM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alcohol Dehydrogenase
publication title The ternary complex of Pseudomonas aeruginosa alcohol dehydrogenase with NADH and ethylene glycol.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 103
structure length 341
sequence length 341
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2002-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lluA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1lluA01
5JMPA 1DC5A 3OSUA 1B0AA 1LA2A 1KVSA 1DC4A 2H1SA 1MV8A 2WYWA 4BO8A 4IXTA 4BO9A 7ADHA 3O26A 2YV2A 1KOLA 3D3WB 3DXFA 1N1EA 1A5ZA 2DFDA 2IXAA 3JV7A 4LCEA 4ZQHA 1ULSA 3DBLA 3B20A 2JCVA 3ITDA 1P1FA 5A3VA 3HDJA 2A92A 4DQXA 2B35A 2ZJ1A 3L07A 4OAQA 1QV7A 4RVGA 1SPXA 2HDHA 3VHRA 5C7LO 4OMUA 1Y8QB 1XYGA 5J23A 2HO5A 1HLPA 3TZKA 5G0VA 2P9GA 1XELA 1U8FO 2Q1SA 5TRTA 5C7IO 1LLDA 2QHXA 3LT2A 1E1MA 5TGDA 1ZW1A 5EERA 2VWGA 1CQIA 2JFFA 4A10A 4D0SA 4CLDA 2ZYGA 3SC6A 1HXHA 2VHZA 4YRDA 3ZWBA 5BNIA 5ENVA 3FWNA 2A9FA 3ONFA 1XR3A 1LSSA 2O2SA 4J0FA 1TLTA 4CLOA 1N5DA 3MCVA 5C37A 1YO6A 4U0KA 1Y6JA 1BTOA 3QVTA 1W73A 2VRCA 1BXGB 5CEEA 3PWKA 4LISA 1LEHA 1HDCA 5THQA 1AGNA 4DMLA 4YRBA 3TRIA 1YGYA 4R5MA 4LRTB 4NNJA 1T1RA 2FRDA 2QZZA 4CQLB 1GYRA 3RU9A 3ZNNA 5JLAA 3DONA 3ZWPA 3CH6A 4BQPA 4MPDA 9LDBA 3OJFA 4OKIA 2AQHA 1AN9A 1HDXA 1PWXA 3GDGA 1H93A 3ENNA 1B7GO 3RI3A 3FR7A 4IJKA 3INGA 4OXNA 5G0TA 1PL7A 1JDJA 4PGFA 3OA0A 3ZU5A 3PLRA 3TOZA 3GLQA 5BSEA 4FJ0A 5T64A 4E32A 5C5IA 5H82A 4Q9NA 3T7CA 2HCTA 2BGLA 3CZMA 1AHIA 1GPDG 3ZV4A 4PZCA 4YXFA 3AUAA 3WGTA 1HYHA 1DLJA 1I30A 4CQMA 2I65A 2VHXA 5F1OA 3F9IA 3HJAA 3QHAA 2FR8A 1G6KA 1D8AA 4YPOA 1YKFA 1PJQA 1Z7BA 1JTVA 3MWDB 2PNFA 2OP1A 3LU1A 4J4BA 5TJ9A 3E18A 3RC2A 3GEGA 3GPIA 1A7KA 1PX0A 1HSOA 4R68A 1N7GA 5G4KB 4ALKA 3HDQA 3LYLA 5I9LA 5EQFA 3RAJA 3RBZA 3PVZA 3W4IA 1YXMA 6LDHA 1ZK3A 3CEAA 3I9MA 4D43A 3V2GA 3TL3A 2VYVD 4Z9YA 5FI5A 3DZGA 5A06A 3MEQA 4NJMA 4FPXA 1K3TA 2P4HX 1LSUA 1NXQA 1X7GA 2NVWA 2W98A 3VPSA 4DGSA 1UP6A 2GF2A 3GAFA 3U3XA 1E77A 4RVFA 4U7WA 2WM3A 3PQDA 2X23A 3CMMA 3NDRA 4H7PA 4OYRA 2YHIA 3TN7A 4JROA 4M87A 1IZ0A 4E0BA 1D1TA 1ZMOA 4EUEA 3EZYA 3KB6A 1RM0A 4OOFA 2FN7A 3KV3O 1K6JA 3WJ7A 4ALMA 1U4OA 3ADOA 3UCXA 5CEFA 1J5PA 2E6UX 3BMCB 4KUEA 1AHHA 1SCUA 3K73O 2AHRA 1LLUA 1JQBA 4BNIA 1T2EA 1WMAA 3L6DA 3FTPA 4BNMA 4XR4A 4OO3A 3NDJA 4PLGA 3D0OA 4WLFA 4XYGA 3BMNB 4KQXA 4CM7A 1GR0A 4CR7A 3IQDB 2I67A 5LC1A 4E13A 2D59A 4RLSA 1J49A 1HYGA 3KBOA 4G65A 3GUCA 4MJLA 5I7EA 3DBHB 3WNQA 5JO0A 2CY0A 1QYCA 1ZH8A 3H2SA 3HG7A 4GWGA 2NQ8A 3ABIA 4XIJA 2RBEA 4E2YA 3PJGA 3WIEA 4DMMA 1X0VA 3PQEA 1V8BA 3H6KA 1FF9A 1GCUA 3LVFO 4XQCA 4MOWA 1DJQA 3VZPA 4DL9A 4N5NA 5ICSA 2CDBA 3ZU4A 3Q3CA 1QSGA 3PHLA 1Q7CA 4UVIA 4IPTA 1CIVA 1UP7A 2YHUA 3RJ5A 1DFGA 1V3TA 3QVSA 2JJYA 4I08A 1BGVA 1V3VA 4QEDA 4EDFA 2J5KA 1TT7A 1ZEJA 3R0IA 3GDOA 1V0JA 4YT2A 4Y67A 4J43A 3IOYA 2VYVA 1OMOA 3OJEA 4AJIA 3JQGA 4EJ6A 3VZSA 2NTNA 1W6UA 4E5NA 1Y9AA 1RYEA 3M1AA 5I7VA 1A27A 4YQZA 4DREA 5BNFA 1H94A 4CMIA 1LDMA 3QVWA 4GPD1 4J7XA 1NBOA 3PIDA 2IZZA 2J3IA 1KY4A 1DPGA 3DFUA 1UXIA 4JCOA 3DWFA 4E31A 4INAA 2VZ0A 4U6QA 2B5WA 3PQFA 3UN1A 4CLHA 2A35A 1BW9B 3WGZA 4MVJG 3SJUA 3N7UA 5F5NA 1P1KA 2Q2WA 4ALLA 5A5EA 3GVXA 3P2YA 4TVOA 3C1TA 1ZFNA 3CMCO 1T4BA 5G2OA 2X5JO 4DYVA 3WYCA 4TSKA 4R3WA 1DAPA 1H2HA 1PQWA 4BGUA 4YT8A 1E6WA 2DQ4A 3L77A 4CODB 2BF7A 4E12A 4ZD6A 1ZIDA 1KVUA 3DDNA 1WXDA 3DBVO 4RF3A 3O8QB 3R6DA 1MG5A 2ZKLA 4J91A 4L9RA 2B37A 4D41A 3OQ6A 1HE3A 2YW9A 1HYEA 4I9NA 4KQWA 1IZ9A 3OJLA 5F21A 4AJ2A 1P1JA 4NQZA 3ZZNA 1YVEI 2P2SA 3CUKA 3EYWA 5KVSA 3PXXA 1M2WA 2XOXA 4CLXA 3G3EA 3VTZA 2OL4A 3FNHA 4XDYA 1Y5RA 3AOEC 1UAYA 1U5AA 5ES3A 2ZYAA 2EF1A 4HUJA 1EMDA 4YRAA 5KJFA 1UXGA 3E1KA 4TMFA 4E30A 5JDCC 4CLOB 3W1VA 3K6JA 3PP8A 2BGMA 4WASA 3UUWA 2NTJA 3FCOA 1U7HA 1NHGA 3B70A 4TRJA 1E0DA 2TMDA 1N92A 1U4SA 2P4QA 5IJZA 1WVGA 3UXYA 1FJHA 4XJSA 2E37A 4UUOA 3RFTA 5JYDA 4ROSA 1ID1A 1X14A 3PK0A 3TZCA 3HN7A 4U6SA 3SXPA 4GSLA 2B83A 4XQGA 2CF6A 3E5RA 3KYCB 3ZWCA 4BNYA 4B3HA 1Q0HA 1YBMA 5IG2A 1FXSA 3TFOA 4AICA 4YTEA 4PG6A 1E3SA 1XCBA 4IDEA 4PZEA 1VRWA 2AQIA 1SMKA 3GEMA 3D64A 2JL1A 2PZJA 2Y0CA 5EESA 2DTXA 3DOJA 1GDHA 1LQUA 4DUPA 1Y5MA 4CM8B 3JQAD 1PTJA 4PLCA 4YB8A 3V1YA 3AOGA 4XIYA 1QYDA 3GEDA 3WSWA 4MKXA 1IHXA 5CFZA 2O2YA 4WJZA 3PIIA 2RIRA 4Y6RA 4PG4A 2Y0DA 1ADBA 1R15A 3OQBA 2QX7A 1GU7A 2Z5LA 5EJ2A 4Z0PA 4LVUA 3MJVA 1YDEA 1G1AA 3NAQA 4GSKA 3PI7A 1QORA 4PLYA 2Q2VA 3FD8A 3IJRA 4IJUA 4MP3A 3DL2A 1R4MB 5TT1A 2OXIA 5IZ4A 4B3JA 1WWKA 5JMWA 4B4VA 3P5SA 2AQ8A 3DZFA 5AXAA 4XZ3A 3ZW9A 3CZRA 2W2KA 1YQGA 4ZN6A 1MXHA 5B37A 1LRJA 4MP8A 3ZW8A 4BKUA 5FEUA 5DF1A 5TQVA 4IDFA 5K9ZA 1VL8A 2D0IA 5ER6A 3K30A 2Y67A 2AEJA 4AJOA 4UEJA 2PWZA 3MJSA 3RC9A 2P5UA 1K2WA 1I3NA 3DBRB 3IS3A 2DTDA 4R4JA 2D1YA 1ISFA 1E3JA 2AXQA 4IMPA 1KERA 4YJHB 2RCYA 3EUWA 2GASA 5A9RA 3AI1A 2X86A 3IC5A 3IUSA 4ZGWA 4NBWA 1FK8A 2X0NA 4WCFB 1R16A 3GVCA 3I9JA 2H6EA 1E3EA 2X7HA 2IZ1A 5AXCA 5JAQA 3ZWOA 4CLEA 5A02A 1KVTA 1UDAA 3ZU3A 4IS2A 3DZBA 4RF2A 2C54A 3E9QA 2W90A 4JX8A 2FR0A 2OUIA 3KTDA 3L4BC 4J6FA 4K26A 1H9BA 1TEHA 2NU7A 3HSKA 2CVZA 4J9VA 3H4VA 3SX2A 4RF5A 3NTQA 4GVLA 3EZLA 3PZRA 1HSZA 1C0IA 1IULA 1EZ4A 1GFSA 1ML3A 3AM3A 2X0RA 3RC7A 3DHEA 2WSBA 2CDCA 1Y7TA 2QYSA 1U2GA 1TT5B 1NFQA 4FFPA 3K9QO 3CE6A 4LN1A 1Z82A 4RPHA 4J0EA 1DXYA 4JK3A 2O3TA 1XU7A 4EYEA 3WMXA 4OJNA 3UCFA 2IDZA 1T26A 3NTRA 1CYDA 4O6VA 4CMAA 1SBYA 4IDGA 4QFCA 1O9BA 3JQ7A 3SEFA 2VYND 3JQDA 4G2NA 5GZ1A 3PRJA 5A9SA 2Z1MA 3AU8A 3A9WA 3M2PA 4J4HA 1BXKA 5JE8A 1P45A 4UVEA 1YBVA 5I8ZA 4ND4A 3BIOA 3VZQA 3AFMA 3UKOA 4EBFA 2YDXA 3BMOB 2VOEA 4BNNA 5IZCC 5IXYA 5KJ1A 4IZHA 1GEGA 2BFPA 2JD0A 3LLSA 4YCAA 3ZNPA 3JCZA 1UR5A 3NTOA 5ENDA 3AOEA 3F4LA 4S3MA 3CPSA 4XA8A 3RBVA 1MGOA 3VPXA 1CEQA 4DIFA 4BKRA 5JDCA 1VSUA 2JFGA 1L7DA 4GMFA 1EVZA 1IYZA 1HETA 2V7PA 2PR2A 4C7KA 2DKNA 4G5HA 4X54A 3QA9A 4TROA 4Z6KA 1XDWA 1GTMA 5KOIA 4HP8A 4JBIA 4PLVA 2FPPA 4E3ZA 2DVMA 1Q1NA 4EJMA 4FDAA 3LT4A 3OIDA 1HF3A 4J7CA 1X1TA 1PGQA 1MXFA 4EEXA 3QVOA 1NFRA 4P8RA 1PJSA 2O50A 4CLRA 3ZWYA 2OBYA 2NSDA 2XPCA 1F12A 1SOWA 4MVJP 1NWCA 3WGYA 2CF5A 2NVUB 3IDSA 2I9PA 2VTDA 5I7SA 3F1LA 4TZTA 4YJDA 3V5NA 3ZWAA 3LC2O 3S1LA 3KVOA 4RVSA 2Y1CA 4MVJF 3AW9A 2BFAA 4P4LA 2C5AA 1ZO8A 2Q46A 2XXJA 1R0LA 3BXXA 3BMQB 3F1KA 1LLQA 4RJTA 4NG5A 5G4LA 1CRWG 2GRAA 3EVTA 4Y6PA 2HJRA 5AXDA 3OICA 4XB1A 1H6DA 4YACA 4EEZA 2VYNA 3GA0A 3M2TA 2NNLD 2TMGA 4WE3A 2FWMX 1NVGA 2Y93A 4GX1A 2EP5A 1U1IA 2H63A 3U5TA 1YQXA 5DBFA 4UUNA 3VVCA 1I10A 3Q2KA 4GMGA 4PIVA 4DBZA 3NKLA 4GX2A 5THKA 5L40A 1YOVA 3ICCA 2DBRA 5JCJA 1V35A 2PY6A 2X6TA 4UULA 3DC2A 3FSRA 4FC6A 4JBHA 3VDRA 1P0FA 3EHEA 4RL6A 3NT5A 1P0CA 3GFGA 1I33A 1N9GB 3JYOA 4OXKA 4I5FA 2O23A 3NYWA 2OP0A 3IP1A 1KC1A 4FFRA 3PLNA 5HBRA 3H9EO 5CDUA 2GNAA 4AL4A 4O0LA 1T25A 3PFWO 5KVVA 4JQCA 5TS3A 1J0XO 3KSDO 2NU8A 4ND1A 5G0UA 1UAGA 4R54A 3VH1A 5CPFA 5CHEA 1LQTA 2FMUA 3LDHA 1VKOA 2WYVA 5U9CA 3KEOA 1U2DA 2GD1O 4AVYA 4DC0A 4OL9A 3PGJA 5LDHA 1HE5A 3VAZA 3L4BA 1WNTA 1O89A 4FD3A 3ZHYA 1CJCA 3CXRA 2R00C 1IB6A 1E1KA 3HDHA 1NHWA 3RASA 2G5CA 2CZCA 1HKUA 4J4TA 4UVGA 3ZN2A 3KRTA 3OBBA 3ZWWA 5I9NA 4B7CA 4YAKA 3A1NA 3R1IA 1KEWA 5IDYA 3GH3A 4NBVA 2C7VA 4QFDA 1PWZA 4BNFA 2NWQA 2OOSA 4J49A 1NASA 1B16A 2WWRA 5DP1A 4YVFA 1D4FA 1U3VA 4JBGA 1LU9A 3A06A 3L9WA 4B4UA 1LUAA 2E4AA 1LDBA 4PRLA 3F6YA 1EEHA 1DIAA 1X7DA 3G17A 4YAGA 3ON5A 5JCXA 1GUYA 1YS4A 1I24A 4XDZA 4DPMA 2QW8A 2E49A 1KEPA 4DLBA 4DIOA 1LSOA 1AE1A 4E5PA 3IL2A 1E6EA 2O7QA 2VZ8A 4KUGA 4NFYA 3OP4A 1IL0A 1LC3A 3RBXA 4IS3A 2V65A 3W4KA 3WGIA 3KXDA 4FB5A 3KETA 1X0XA 1UXJA 2JCYA 1S7CA 2IXBA 4CV3A 2W4QA 1A4UA 1UH5A 4J1TA 4IDBA 4CQMD 5CG2A 1CQJA 2P68A 3DEYX 2O3SA 3JQCA 2AEFA 4FN4A 3HWRA 3GNQA 4L4XA 3SLKA 5IZCA 1EDOA 3EGOA 1R0SA 2OHXA 2FSVA 3AY3A 4A26A 1E1LA 1F8GA 2A4KA 3JQAB 2HRBA 1E5QA 4A7PA 5A03A 3OQ1A 1JKJA 1GUZA 4YT5A 1A71A 4BMNA 2VNAA 4D3DA 4M89A 1E3WA 1RM4A 3WQSB 1L1FA 3JD3A 1IOLA 4NBRA 1MA0A 4P38A 4RV9A 1PL6A 3IP3A 1V9LA 4YAIA 3BHIA 4J1SA 4MVJE 4RPLA 3EDMA 5JPIA 4B8WA 2EEZA 2ZB3A 3GG9A 1DHTA 1EBUA 2AMFA 4BV8A 4D42A 2WTBA 3JD4A 2IZ0A 3DAPA 4BO7A 4D0RA 3VH2A 4MP6A 3WYBA 1GY8A 1QKIA 3C24A 3QP9A 4QO7A 3SBOA 3HZZA 1QR6A 3P19A 1HDGO 2Y68A 3TPCA 5JY1A 4BO1A 2BI7A 1TA4A 4DLAA 1DAOA 2D4AA 2GR9A 4HY3A 2GZ1A 1MLDA 1YQDA 1FDSA 3LT0A 5HM8A 4QXMA 3JYQA 4B79A 3QRWA 2EP7A 4L75A 2HMWA 3I52A 1TB4A 4E5KA 3FF4A 3PHGA 5C3MA 2BD0A 1XKQA 2VWQA 5HRUA 1B26A 3DAFA 4FSHA 1EUCA 1XIVA 4Q3CA 3WFJA 4D46A 1IE3A 1GUFA 2F1KA 3OECA 3H5NA 4GBJA 4K28A 4CL8A 4Z3KA 3AWDA 3O38A 4WLOA 2D3TA 3WTBA 4PLTA 4ITUA 3P7MA 4J2OA 3PZBA 1B8VA 4UAGA 3WS7A 9LDTA 4MDHA 3JYLA 3VPHA 1MB4A 1Y8RA 2UDPA 4FFMA 4JNKA 4QT0A 2IODA 1NYTA 4BO6A 2ZTUA 4PLFA 3ROQA 2EKQA 2DU8A 4HV4A 4TWRA 2NM0A 3BZUA 1HL3A 1VL6A 2BLLA 4ALIA 2FSSA 1ORRA 5COAA 1LRLA 2B0JA 2C82A 1WW8A 1U3WA 3B1JA 4O59O 2QG4A 3ZDFA 4U5QA 1NTOA 4MKRA 4AJEA 1XQ1A 2IYPA 4Z0HO 2W8ZA 3MJ4A 5MGBA 3DB2A 4HXYA 3EK2A 5JAMA 1FDUA 1LSJA 1XG5A 3ST7A 3KYDA 1C0KA 4QO8A 8LDHA 1X1EA 2O48X 1VL0A 2GLXA 3KSZO 3F47A 4AJLA 5ITWA 5U4QA 2EERA 1LI4A 2DBZA 1GQYA 2ZB8A 1IHYA 3FBGA 2VHWA 3H9QA 3NGLA 2NTVA 2P9EA 1R4NA 1SZJG 4DA9A 5CDTA 4AJ1A 1M76A 3NJ4A 5L4NA 2R00A 4OSOA 4R1SA 4YAJA 1R12A 1XHLA 3LF2A 1O5IA 4IY1A 3DO5A 4FJ2A 4ZQEA 3V8BA 4XQEA 4UEOA 4HBGA 4YJFB 1ONNA 1KVRA 1ZSVA 1VLLA 3U62A 4IQ0A 4BNWA 4WLEA 2BH9A 4XYBA 3RUCA 2AW5A 1MP0A 3K31A 1RWBA 3TZHA 1MC4A 3NUGA 4UUMA 2C2YA 4AJKA 4M54A 1PJ2A 3RQSA 4OGWA 4M86A 4XYEA 2BFMA 5JAZA 1P1RA 3AY6A 3ETEA 3OFSA 3WFIA 3C85A 4XEHA 4H15A 2BKAA 2NV6A 3UVEA 1PQPA 3GNSA 3O03A 4EGFA 5BSGA 4YEDA 3H5RA 3PTZA 3E6AA 2HRZA 4ONEA 3ONDA 2B4RO 1QLJA 3U4CA 3CKYA 3OIGA 1V3UA 2DC1A 2X58A 4WK6A 4DXHA 4IJWA 4WEOA 4U8GA 3ZU2A 3WNVA 5AXBA 2WMDA 2SCUA 1E7MA 3FI9A 4L4RA 3NDIA 3OMLA 2FPIA 2CD9A 1OC2A 4IBOA 2GYYA 1RM3A 1XWFA 3BTUA 3ZV5A 2PH5A 1P77A 5EPOA 1BMDA 2Q2QA 5AVOA 4S1VA 3PYMA 1B14A 4C4OA 2OMEA 4M55A 3V2UA 1KEUA 1UZMA 1JW9B 2X1HA 1PL8A 2X5KO 1ULUA 1LTHR 4W7HA 5F1KA 5L7WA 2DUUA 3R3JA 3K2BA 5DDIP 3ZV6A 2G76A 4GLOA 4ZVVA 5H81A 4FFNA 1NNUA 4Q3AA 4WCDA 1K0UA 4AJHA 1ISMA 3VKUA 2I3GA 2J3JA 1B8UA 3DAGA 1HTBA 1PS8A 3P2OA 2EW8A 1GZ4A 1D7OA 4I8XA 1T2CA 5TNXA 4EUHA 3F5SA 4XQ9A 2PKQP 2G82A 3DBLB 2DM6A 5JO9A 4R1TA 2NVBA 3O9ZA 4E5MA 3UF0A 1FDVA 4PG5A 3I9KA 1I8TA 3B6ZA 3Q0EA 4R3NA 3AUSA 4F45A 3BA1A 5HS6A 5JY6A 2DFVA 4W4TA 2I5PO 3H3FA 4KTTE 2GSDA 4JN6B 4OQZA 3HN2A 2PGJA 4RLHA 3GT0A 2IEBA 4XRRA 3GZNA 2HK9A 4JIGA 5CP8A 3DZJA 1JU9A 4AJPA 5GZ3A 1EK5A 1SOVA 3WDSA 2JFHA 3C3XA 4OSPA 3ZNQA 2V6MA 3OEYA 4ALNA 2ZTLA 2PLAA 3IIEA 4J2HA 5BSFA 4HKTA 3H5AA 2Y1OA 2V6FA 3GVPA 4N18A 1VPDA 1I2CA 2GN8A 4PRKA 5I8WA 1ISJA 2E82A 2C0CA 1X7HA 4JJFA 3UW3A 3ZGYA 1MFZA 5B4VA 1KEVA 3TF5A 3WGOA 4ALJA 5IXSA 3EMKA 1H0KA 3I5MA 1DSSG 4N54A 4RVHA 4E33A 4O63O 4Y6SA 4F6LA 5L95A 3WWYA 5JBIA 2HU2A 2A94A 3GAZA 3JQ8A 3WGGA 1YE3A 2Q1WA 4WPGA 2C7GA 3WBFA 1LDNA 3S8MA 1I2BA 4QECA 4WUVA 4YJGA 3UOGA 4AJNA 2I76A 4BNVA 1I3LA 2XAAA 5A3JA 2OORA 2WD7A 1TVEA 4CQMB 3L6OO 2PK3A 1EQUA 3D4PA 4RDHA 1JKIA 3GRPA 2X4GA 4BGIA 2JD1A 4YQYA 5DOVA 1DRUA 4NZ9A 5COQA 3G1UA 3BAZA 1IPFA 3ASUA 1E7YA 2RH8A 3F46A 3LLVA 5TIIA 2DTEA 1I32A 2PKQO 4LVCA 2VHYA 3FHLA 4DPLA 3RD5A 1NQOA 5EINA 1E7QA 1WLYA 2AA3A 2IYOA 1OZAA 2I99A 1F06A 2C59A 1ISIA 1K5HA 2JKVA 2FR1A 4J9UE 1Z74A 3N74A 4IINA 4NJMB 2ZB4A 1ZNQO 4RQTA 3E5MA 3MOGA 4BNKA 4BHTA 1YWGO 4I1IA 2WE8A 5CDSA 4Q3NA 2OZPA 3VKVA 3MTGA 2I66A 3WQQA 3D4OA 1C0PA 1R4NB 3VDQA 3ZV3A 2YHIB 4BVAA 2HK8A 3NT4A 2Y66A 4JJGA 1K6IA 1M6WA 2QRKA 3LZ6A 3L6EA 1ZZEA 4CR8A 2EKLA 3E03A 3TOXA 3W6ZA 1WDLA 1LDEA 3U4IA 4LCJA 4MIEA 4OKNA 3Q1LA 1YB1A 5HTOA 5KVCA 1H6BA 1QRRA 1D1SA 4BNHA 2YQ4A 1OI7A 4HFJA 4HWKA 1RJWA 4P4GA 4ZRNA 2J5QA 2VTEA 4PG8A 1VM6A 2AEMA 2VCYA 4ZRMA 1JWAB 3I6QA 5EIOA 4LMPA 3BTOA 4J16A 4O5OA 3LC1O 1XU9A 3RC1A 4ZICA 1GV1A 1IUKA 3CSDA 3QVXA 5H83A 3WOHA 3KM0A 5B4TA 4PCVA 4DWVA 2FY8A 4CL3A 1KVQA 4UEKA 2HAEA 2EWMA 2LDXA 2RHRA 3GGOA 3ANNA 1YL5A 4LW8A 5JFOA 3RSHA 3GC6A 1L7EA 2YV3A 5T67A 5TX7A 2PA3A 1ZXBA 5L45A 2PTGA 2HUNA 3C1AA 4XB2A 4CV2A 3FTNA 2X22A 1NPTO 4PFJA 5CAEA 4UREA 2OO5A 1W4ZA 4QQRA 8ADHA 1VJTA 1Q7BA 3X2FA 2X8LA 3GDFA 2X9VA 4RO0A 3HHPA 3TSCA 1Y81A 3U4HA 5EMHA 3D3WA 3RUAA 1U8XX 3K8ZA 1H6AA 4IZIA 1X15A 1RM5A 4BGEA 3JQGB 1DFIA 1KETA 1NX6A 3IUPA 1NQTA 4HX5A 5KJCA 4GLLA 3U9LA 5K0ZA 5LDGA 1QMGA 5BSHA 4BS9A 2ZJ0A 4XYLA 4WNIA 1Y8QA 3I9LA 4CMIB 3V2HA 5JCJD 1NFFA 4AFNA 2X9NA 4BO2A 5KKCA 2HMSA 2EKPA 2YFHA 3E9MA 5KKAA 3EW7A 1P1HA 3ZHXA 2P5YA 1MFPA 3WBBA 4PN3A 1UUFA 4HNHA 2EJVA 4GKVA 4KP7A 5L53A 1BDBA 2QYTA 3H65A 3NJ8A 2Y05A 2VN8A 3ITKA 3BTSA 3KLPX 4CMEC 4F3YA 3Q6IA 2UVDA 1KIFA 2CFCA 5DBIA 3S2EA 4Z9XA 2DLDA 2WD8A 5TSDA 4A03A 3EY4A 3D3EA 5HS4A 4C7JA 4R9SA 4D79A 2AE2A 1UZLA 1PJ3A 2G17A 4EI2A 1E1NA 3QE3A 3KLMX 4EZBA 2JHGA 3PHHA 4PLZA 1HDYA 1UZNA 1YL6A 4MINA 3ONEA 3V1UA 1JVSA 4E5YA 2WYUA 4QX6A 5KCZA 2Q99A 2B36A 3JYNA 2AQKA 1EBFA 1QYWA 1SNYA 5FFFA 1E6UA 4R01A 3H2ZA 3WGQA 1BDMA 2Y1DA 4R9RA 3V1TC 3RROA 4IIUA 3VTFA 5KIAA 1EQ2A 1I2ZA 5JDIC 3ZHBA 1YH3A 2O3RA 1BHSA 4HFNA 4DYDA 4E21A 4GWKA 4B3IA 3DQPA 1VE9A 1E7RA 1LDYA 2EHDA 1D3AA 1PJBA 4GGPA 3A14A 2IEDA 2VWPA 4TQGA 5T6BA 1P74A 3TFQA 4W82A 4XJTA 4B8ZA 3JQ6A 1NVMB 2VHVA 3IKVA 2Y1EA 4NBTA 1DJNA 1ENPA 5L7YA 3RFXA 1ADGA 1Z73A 1ZCJA 4TKLA 4NIMA 5K6AC 2IE0A 2ILTA 1PJLA 4A2CA 2V6BA 5L4SA 4U0JA 4WNCA 3AM5A 2W2LD 3ANLA 4YJGB 2CSUA 2PD6A 5DNAA 1B8PA 2BMAA 1HDOA 1JAXA 4RDIA 3OETA 3WJAA 1YDWA 5ICMA 3O4RA 3EC7A 4OIMA 5DT9A 2PZMA 4NMHA 3GY0A 2B5VA 2CUKA 1N8KA 1Q2XA 3RUIA 1LRKA 4CM3A 2AG8A 3MZ0A 1MUUA 3GPDG 1HLDA 2E48A 3ZI0A 3VH3A 3BHJA 4CUKA 4NPCA 3NV9A 1ZBQA 2YY7A 4FBGA 2VT3A 4ZHSA 3KHUA 1E3IA 4IGEA 4KTVE 1IY8A 2Y1FA 2NQTA 3AUUA 1GD1O 3S55A 2W2KB 2EGHA 3AM4A 3I1JA 1KC3A 1OBFO 2C20A 1EVIA 1GADO 3QIVA 4A73A 1MC5A 1G0OA 1JAYA 1Q0LA 2DBQA 4EJ0A 5DULA 3FBTA 3AFNA 5AYVA 5DOZA 3BMNA 1PIWA 3GZ4A 1G0NA 2JD2A 4F6CA 5A9TA 1C1DA 3U09A 4L73A 1ZVMA 3DBHA 4R51A 4CUJA 4ZA2A 1A72A 1K89A 5A5FA 3WGHA 4FR5A 3WLFA 4CM1A 2J5RA 2GO1A 3I9OA 4B4OA 1U3UA 2Q1UA 5TJHA 1DO8A 1F14A 1C0LA 2EW2A 1N7HA 1GYQA 2O3JA 3EVNA 2ZTVA 1J4AA 4YA6A 1RKXA 2EXXA 4GH5A 1CF2O 1NQAO 4TRRA 1IPEA 4R5HA 3RWBA 1KY5A 2UV8A 3FR8A 1HDRA 3KOUA 4QUKA 4WCFC 1VI2A 1O8CA 4DVJA 3HADA 2J3HA 3ZWNA 2W2LA 3U4DA 3DTTA 2C07A 3E9NA 2JAPA 4FGWA 4FIZA 3U0BA 3RU7A 1T2DA 3H9JA 1C3VA 4FW8A 4WECA 1Z6ZA 3GK3A 5A04A 3PEFA 2DAPA 4BO3A 3JD2A 1XLTA 2GCGA 3LK7A 2D5CA 3RCBA 1I5RA 3GNTA 1NM5A 1Z75A 4WLVA 3NRCA 4FQ8A 3I4FA 2ZQYA 1R0KA 3C1OA 4TVBA 1GAEO 3L4SO 3NX4A 4IMRA 1O95A 4ZJUA 2RHCA 4TRNA 5U1PA 1DIRA 3GHYA 4CMEA 4IXWA 3GHHA 1PGNA 1EDZA 3QV1A 1BW9A 1Q7GA 1K6XA 3JQ7B 5MDHA 4QSMA 1NR7A 4BKQA 5A9SB 5ADHA 2Y99A 3MJCA 3RKRA 3INRA 3NT2A 4DPKA 1Y9EA 2EJWA 2ZATA 4KDEA 3GR6A 1OOEA 3F3SA 2V6GA 4Z9FA 2OFPA 3FN4A 2PV7A 4UUPA 3KO8A 4YDRA 3O8QA 4R1UA 3PJDA 2YQ5A 5B4UA 5KJEA 1GZ3A 3H9GA 1T2FA 1ADFA 1H2BA 1VSVA 2C29D 3TDKA 5C7OO 1BXZA 5JDIA 1ONOA 1ZJYA 4BNLA 4MVJA 4Q3BA 1GV0A 4PLPA 2O3QA 5DZSA 4CPDA 2GDZA 5IF3A 2BGKA 1CETA 4A0SA 5KWEA 2UAGA 2FZWA 4FOSA 3GMDA 2VUUA 3ROMA 1DB3A 4MIYA 1LC0A 3PFFA 3ZNOA 4E2ZA 1QXSA 2FHSA 3INTA 3KYBA 4XWYA 3HE3A 4Y98A 4RQUA 1ISGA 1A7AA 3AI2A 2NADA 4E2WA 3D1LA 4N7RA 4J7UA 5F5LA 1UP4A 3QWIA 2HKIA 3TWOA 5K6AA 2DPHA 2HQ1A 1P9LA 1B15A 3DHNA 5G0SA 4CLRB 1F8FA 1A4IA 4HFMA 4NFSA 3TNLA 1I01A 3ROPA 3KYCA 1JWBB 2Z95A 1XSEA 4BOYA 3G0OA 3DR3A 3PWZA 1NAHA 1BG6A 1XQ6A 3PDJA 2WJPA 4XGNA 1I36A 4TKMA 4BO4A 2FOIA 4FS3A 4XGIA 1O94A 4IQ8A 3ICPA 1WPQA 2JHFA 4KWHA 1R37A 2B4TO 4J3FA 4KZPA 4BMVA 4NH4A 1PZHA 4CM8A 5T57A 3GN1A 5GY7A 2DUWA 1H9AA 1KYQA 4FOOA 5EQDA 4BKOA 1HWYA 5AQ1A 3NGXA 1M6HA 3GN2A 1E3LA 1DC3A 1PZEA 5F1PA 5HWSA 3JQEA 1PR3A 2X0JA 4WOKA 3A28A 3MTJA 3WR5A 3BHMA 1DRWA 1HE4A 1M67A 2YYYA 4QTZA 1YOVB 3GGGA 4NK5A 1S6YA 3H7AA 5JXWA 1R4MA 2AG5A 3FPCA 4BNUA 3M1LA 1ZXLA 4NU5A 1QYXA 4BUCA 3AJRA 3HQ4O 2GUGA 1O6ZA 1W0CA 4LK3A 5TT0A 1EUZA 1TXGA 1YONA 1DRVA 1GPJA 3Q2IA 4BQRA 5L3ZA 1SEVA 1PR9A 1LDGA 3ANMA 2D5AA 4IDCA 1Z7EA 3W8DA 1GYPA 5DCYA 1F0YA 2HJSA 4MO2A 3HNPA 4I5DA 4RVDA 3DBRA 4GL4A 3D7LA 1PZFA 4YT4A 3HB5X 2D8AA 4PZDA 1JKFA 1PSDA 1MG0A 1A9ZA 2B4QA 4YJHA 2ZTMA 4JGBA 2VZ9A 4LSMA 4RORA 4OH1A 3WQRA 5IDXA 1SC6A 4WCFA 3W4JA 1NAIA 1NP3A 3CIFA 3K2EA 4O1MA 1GL3A 5KNLA 4M49A 1EVYA 2Q3EA 4M1QA 5DN9A 3DZHA 2EV9A 2UYYA 1ENOA 4Z0TA 3WXBA 5KTKA 1WZIA 4LMRA 1C1DB 1DFHA 3OEWA 3RKUA 1QG6A 2Z1NA 4FFOA 1DLIA 3OJOA 1PGJA 2C5EA 1LBEA 1ADCA 1C1XA 1LNQA 5L51A 1PJ4A 1MX3A 3JQFC 1XEAA 4W9NC 3WTCA 1U7TA 2EG9A 3QSGA 5DCUA 1PJTA 4RCVA 1NPYA 3PHJA 2GGSA 4KOAA 4LGVA 2VUSA 1TT5A 3H8VA 1EUDA 1ENYA 2FP4A 2PD3A 3T4EA 2C2XA 1WDMA 3Q11A 2HMVA 4BNTA 4RZIA 1Y1PA 3KZVA 3K5PA 5DP2A 1R66A 3A4VA 4ND3A 3PDUA 1I3KA 1LX6A 3E8XA 4Q3EA 3Q9UA 2YV1A 1EE2A 4DLLA 3I9NA 5JW6A 2YZ7A 3GFBA 2ZCUA 3ETGA 5I7FA 4BV9A 3GG2A 3WSVA 4BL5A 1HRDA 3RIHA 3FRJA 1EE9A 1GZ6A 1PEDA 3K96A 3JD0A 1HE2A 1C14A 5F3RA 1PS9A 3PJFA 1LLCA 1E3WB 3BMOA 4EITA 4WLUA 2I6TA 1ZK4A 4IDDA 4FGSA 4B7XA 3G49A 4I5GA 3X2EA 5AOVA 4KWIA 3C8MA 4Y8VA 3MWEB 3NEPX 1U28A 4Y9DA 5FWNA 3IAHA 2CDAA 3VOSA 3IMFA 4GVXA 1ZKMA 2P91A 3DMTC 3H3JA 4PG7A 1BVUA 3EAGA 2VUTA 2ZQZA 3ENKA 1JLLA 4MIOA 4MKZA 4MVJH 4NBUA 4WOJA 1QYVA 5IN5A 3ZWXA 2X5OA 3I6IA 2CMDA 4BMSA 1PZGA 4YBZA 1HDZA 3HFGA 4HADA 3F4BA 1CWUA 4II3A 4CM4A 3UICA 1VJ1A 1O0SA 4ZQFA 1WP4A 3WG9A 5A05A 3RUFA 2GPTA 2PZKA 3UAGA 3UHAA 2OGUA 3PYXA 1ZUD1 3AY7A 4L0QA 1UJMA 3WYEA 2QRJA 1RYDA 2UUOA 2NUAA 4OXYA 3GQVA 1H5QA 5CDYA 2QZ9A 2DT5A 2O4CA 4ID9A 1BRMA 4BNZA 1P1IA 2BI8A 4UVDA 3I83A 4GKBA 5DCWA 1I3MA 2H9IA 1E7SA 2NVUA 4LRSB 4RZHA 1PS0A 4XCVA 5T8KC 1F17A 3AUTA 3GVHA 3SLGA 3T7EA 1QV6A 2Q1TA 1Q0QA 3BTVA 4DRYA 3GOHA 3BMQA 4CMBA 3L0DA 2BRUA 5GMOA 3IJPA 4UVHA 1FDWA 1Y8RB 3I23A 5KVQA 3UGKA 2QQ5A 3OF2A 4DTIA 5L9AA 3RJ9A 3M6IA 2ZK7A 1J6UA 3G1TA 4E6PA 3AK4A 3PYLA 3D4NA 3LSYA 3DOCA 4CM9D 1RPNA 3TZQA 4ND5A 1PJCA 5BQFA 1CERA 4J1QA 3QQPA 4XYMA 2OBNA 2Y0EA 1ZK1A 2HMTA 5L4LA 5B1YA 2CNBA 3ASVA 3ZCXA 4I5EA 4PVCA 5LCXA 5G0WA 3OA2A 2Q45A 2YFQA 3MJTA 2NLOA 2Y1GA 3QLJA 1ZEMA 2D2IA 3UH1A 3I3OA 2GN9A 1BVRA 2J6IA 2WDZA 3G79A 4KDFA 1N9GA 2PZLA 1ZMTA 3PPIA 2ZIZA 3KYDB 2J3KA 2RH4A 4CJXA 4AJJA 3LF1A 3WICA 1T4DA 1YB4A 3WB9A 4GGOA 4WLNA 4PVDA 5K1SA 2R2GA 5FF9A 4D3SA 1P3DA 1DEHA 4NK4A 3GRKA 3ZWMA 2R6JA 4NDNE 1T2AA 1PGPA 4XD2A 5TF4A 4FJ1A 1FMCA 3VC7A 1PGOA 3VPGA 1HZJA 3AU9A 1X13A 2ZYDA 1WMBA 3GMSA 5CPBA 2PGDA 5CG1A 3LT1A 1T24A 6ADHA 2PH3A 4IM7A 1ISHA 1HZZA 1WZEA 4WKGA 2WE7A 1PQUA 2F00A 3KEQA 4R69A 4A5OA 4AJ4A 4K9DA 4BNXA 1DC6A 4TZKA 3ETDA 4CUZA 1SEPA 4N5MA 3DTYA 3PHIA 4BB5A 3JQFA 4W9NA 2X0IA 1JVBA 3W8FA 4L4SA 3IKTA 5FI3A 4BIIA 1ZK0A 3VPFA 4BKPA 4DC1A 2QRLA 3B1FA 3OM9A 3C7CB 4TRMA 4BO5A 4BO0A 3JD1A 2Q4EA 4CMKA 3D5QA 2BHLA 4ZQGA 1ARZA 4K6FA 4M8SA 3WIDA 4IDAA 4II2A 1EFLA 1CDOA 2PGLA 2XXBA 5IAAA 2GERA 1WDKA 3JQBC 4PLWA 4D3FA 4DIBA 4ZQBA 3QWBA 3HDYA 3UFXA 2Q49A 5EN4A 4CM9A 2O4UX 3OJ0A 2P9CA 4Q39A 3D5TA 1YL7A 3HFSA 2GN4A 3R3SA 1HEUA 4K6CA 3E48A 5ILOA 2JAHA 2QIOA 3W6UA 4RVUA 3T4XA 4NI5A 1AUPA 2BELA 1OFGA 2HK7A 2PFGA 1C1XB 5ER9A 1W8DA 4YYZA 2ZCVA 3QY9A 1VC2A 4FFLA 3DZKA 4MVJI 4H3VA 5JC8A 5TLSA 3JQAA 1FDTA 4OHUA 4RPGA 1AXEA 2VNSA 2YDYA 3GGPA 2IRWA 1HT0A 1XA0A 2H5LA 1DIBA 3PWSA 3JQ9C 4CMCA 4DQUA 4YAEA 4EUFA 4LSWA 2FPGA 2RAFA 4R16A 1QP8A 5EL0A 5FYDA 3DMTA 4RPKA 4EW6A 3RUHA 1PU2A 5JYEA 1V6AA 4OOEA 4AG3A 3PJEA 2EIHA 3DOOA 2GN6A 3GVIA 2HSDA 3COSA 4NHEA 1JA9A 4B7UA 4BNJA 1NPDA 4RF4A 1T1SA 2CVOA 3H9UA 4GQAA 3I4CA 3KSUA 4RGBA 5JS6A 2ET6A 3MOIA 3LC7O 3L9XA 4ESOA 1OC4A 2I3AA 3SVTA 1ENZA 1B2LA 4JP2A 1NQ5A 3U49A 1N1GA 3GUYA 3WMWA 4B4WA 4XX0A 3B1KA 4OM8A 4W6ZA 1DDOA 4MVJM 4K1LA 1E92A 4WEQA 5ITVA 4D44A 4IUYA 4D7AA 1DIGA 3Q9NA 4R1NA 3VH4A 3S2GA 2YUTA 1R6DA 1BXGA 2O7SA 1GQ2A 3WWZA 3JSAA 1KS9A 1SAYA 2DPGA 2LDBA 2PD4A 4XGKA 3GZNB 3VZRA 2UUPA 5T8KA 2HMUA 4PLHA 3ZHZA 3KUXA 1VKNA 4CQLA 2CVQA 5JNLA 1I0ZA 1YRLA 1UDBA 2XF8A 5GZ6A 3QWFA 5I9MA 3TZ6A 4DQVA 5CDGA 3QJ5A 5COBA 4BNGA 4Z3DA 4HFRA 1SO8A 3MJEA 4NU6A 4CMGA 4CM4B 3FPLA 3N58A 4NJOA 3QWAA 3FNEA 4HNGA 1M66A 1N2SA 1AXGA 4N5LA 4URFA 1YB5A 4CM5A 4KMSA 4W99A 5DBGA 2PKRA 4W7IA 4FC7A 3SC4A 3ROKA 4I9UA 2NACA 2VOJA 1U5CA 4JLWA 4NFHA 3WLEA 1ZJZA 1WAMA 5ILGA 4CV1A 3TQHA 1P31A 2AE1A 1YJQA 1NVTA 3DFZA 4YWJA 1ONPA 3OHSX 2ZB7A 4KUHA 4Q3DA 1DBVO 5IDWA 5L7TA 3W8EA 3S2IA 1KBZA 4I9HA 3JQ8B 4XKJA 1ZSYA 2J8ZA 4L8VA 4IQGA 5G4KA 3SJ7A 1U3TA 4GX5A 1UXKA 3ZH2A 2GZ3A 1BSVA 1LXCA 5BT9A 3RVDA 2WD7B 4A27A 4CMHA 4RPJA 2X9GA 3LQFA 5CEJA 1VJ0A 5A4DA 1E5LA 3AI3A 4E4YA 3OIFA 4WGGA 1UXHA 3RUDA 1E7WA 4YR9A 1ZK2A 4GAEA 1DIHA 4J1NA 3PGXA 2JCXA 3RUEA 4E2XA 1OAAA 1H6CA 3ZWVA 1EK6A 2FZEA 2NU9A 4L74A 3ULKA 5JC1A 5HA5A 1DHRA 2DBVO 2G1UA 5T5QA 1ZSNA 2HLPA 4CR6A 1XGKA 1B3BA 4F46A 3QW2A 4J90A 4YJFA 2NU6A 3JTMA 3VVBA 1U9JA 3QWHA 1YJ8A 2GZ2A 3BMCA 4ZU3A 5BNTA 1GCOA 4CMJA 5IDQA 4XRGA 2Q4BA 3CTMA 1GQQA 1BWSA 4ILKA 4FCCA 4G81A 1JN0A 3ORFA 3JYPA 4P4NA 3RFVA 2WEKA 4XR9A 4ND2A 4DBVO 3JQBA 4OQYA 3F5QA 5JSFA 3UCEA 1Z45A 2BFOA 4MVJD 3FNFA 1QLHA 2Q50A 3DMYA 3ADPA 5A1TA 4GI2A 3S2FA 3TJRA 1SB9A 3TL2A 5BR7A 3STHA 3FWZA 5B12A 2YJZA 2VRBA 4IIVA 1GEEA 3FNGA 4D45A 1NR1A 2VWHA 4JP3A 4R41A 4BGVA 4IJVA 4CV0A 1SB8A 2G0TA 4CM6A 3E82A 7MDHA 2VT2A 5TC4A 2VRCD 3OH8A 1YBAA 2POQX 4JJIA 4P22A 1M75A 5IFLA 2EGGA 5KJ6A 5IN4A 1DOHA 3C7AA 3JQ9A 3DZIA 1UDCA 2VQ3A 4GX0A 4IGFA 1P33A 3HUDA 3HB4X 1A9YA 3BYZA 1NWHA 3K92A 5JAIA 4BB6A 2O3UA 3DHYA 3GF4A 1P44A 3C7DB 4L76A 1LJ8A 1B3RA 4JXKA 4NR0A 3WX0A 1EVJA 2B69A 3CINA 1TI7A 1EFKA 4H16A
chains in the Genus database with same CATH superfamily
3G5UA 2AKYA 2JDIA 5CIQA 3WKCA 1DC5A 1O94D 4RZQA 3CCCA 4WH0A 4C7MA 1XRLA 4IIBA 1PK7A 3D3QA 1KSFX 1DC4A 1JZSA 4B7AA 4O4LA 1ZMBA 3FUXA 4LOHA 2WYWA 2HO4A 3ZY4A 4BO8A 7ADHA 4V39A 1A95A 5AJZA 1XMPA 1GFIA 4M0FA 4TS9A 5ALZA 2X76A 4WXRA 1C4WA 4DLXA 4F5WA 4IOKA 3BJIC 3FE2A 3U4GA 1WKCA 3CN7A 3KJNA 4MDFA 3QPAA 3HJNA 3BEOA 3SDBA 3N7TA 1SVKA 2JCVA 2PDAA 2DKFA 1BE8A 1YE8A 5DVZA 3S8EA 2HHCA 3NG1A 2D7CA 4OAQA 4AWBA 1G7CA 4C5AA 3L43A 1GG9A 1SZCA 5LBIA 2HO5A 2ZRCA 1HLPA 4JODA 5HOQA 4O4HA 4MS3B 4Z3OA 2Q1SA 2K5UA 4NCKA 1P2UA 2RI6A 3B7GA 2XVZA 3B36A 2IYRA 2PX5A 4Q1DA 4EPWA 1LLDA 2KPOA 4Q9IA 1YZHA 3RK0A 2CMGA 1E1MA 5TGDA 3WHKA 4KQEA 2HN9A 2VDKB 1FL9A 2LW7A 5BV8A 3OZ7A 3UTCA 2D2FA 2VWGA 4DR7B 4CF4A 3QUTA 4D0SA 2V7EA 2I2AA 2ZYGA 4R31A 3SC6A 2CHFA 3IUMA 3VU1A 4DJEC 1HXHA 5JQGB 4E5VA 3LXRA 2R1UA 4YRDA 3ZWBA 1EFCA 2I4NA 4HNUA 3PRKE 5LB4A 5I48A 4EZEA 3K70D 2KS6A 2CZQA 3HB0A 4L8YA 4YWHA 3U4MA 2AC4A 1N5DA 3MCVA 5C37A 1YO6A 1NC3A 2G63A 3AR4A 3L1UA 2AFHE 3QVTA 4M37A 1T8TA 5CEEA 3PWKA 1XQ9A 2G7ZA 4NBLA 3KJIA 2X2OA 3ZIAD 4ERXA 1AGNA 4DJTA 4DCVA 1N25A 4DMLA 1YGYA 2BEUA 2AZMA 4R5MA 1DQZA 3U61B 1SELA 1G9SA 1YFJA 4NNJA 2QZZA 2PMEA 2I9KA 3GARA 3DONA 3Q98A 1PTKA 3A2LA 3QA3E 4IFBA 4HGOA 4M6WB 5JASA 3GT3A 3CEHA 5LP6F 2ZIVB 3R4VA 4Z4CA 1GG5A 2VQEB 1TVKB 1PWXA 1U2QA 1H93A 3KKMA 3L02A 5ARDA 3RI3A 3T7RA 2W93A 4C0JA 3STXA 5G0TA 4MV9A 2WHPB 4PGFA 3OA0A 1Z8HA 4C20A 1YS1X 3PLRA 1M8JA 4QQKA 4BBAA 5K8UA 3SQWA 4MQ4A 5I4IA 2BGLA 4Z8XA 3SEQA 1NW9B 1OFTA 3VPAA 3ZV4A 3CNOA 1U7ZA 3PPYA 4YMTA 3AUAA 2I6FA 2ZGVA 4GMDA 5IUKC 1I30A 5H0IA 3UQZA 1A1VA 1ZVVA 4MS4B 1KJQA 2OHGA 3PUIA 5F1OA 3QHAA 1A2KC 3PXBA 1D09A 5IT5A 1XALA 1R9JA 2J4DA 4TSFD 3ROEA 1H2WA 2JIBA 3KKKA 4EPXA 5ALNA 5HW0A 4OQNA 2PNFA 2OP1A 4RQAA 1PL0A 3TOVA 4UU1A 3BZWA 5F4BA 6ABPA 5BN3A 1HFKA 4X95A 2Q0SA 4FFBA 2ZU0C 1JFLA 2VDQB 1PX0A 4QYTA 5P21A 4M3NA 3SMQA 2ZI6A 5G4KB 2J9XB 4UNQA 4BV2A 1KFCB 5F12A 2B5OA 3GD7A 6LDHA 1YXMA 2PL1A 3ZDCA 3FOFC 2SBTA 5HP4A 1C4OA 4P0TA 4X1OA 1LI5A 3A4TA 2A5YB 1I4EB 1QONA 1T2UA 2VH5R 3DZGA 4GU5A 1GFZA 3ZHRA 3FBWA 4DCSA 4KNYA 4I8DA 3KYIB 2JZOA 2XBLA 10MHA 1YRHA 4IKOA 4R2JA 4ZARA 3L0CA 5KQPA 3VPSA 3HU1A 5K3FB 2CNNA 3N28A 5KC8A 1FQKA 1XNHA 4UAVA 4U7WA 3AEZA 4I3HA 3PQDA 3VYTB 1XVAA 1LVUA 1NULA 3R3ZA 3A4YA 1KMNA 1B1AA 1PV2A 3E9YA 3GFSA 4HEA6 4B73A 3H99A 2IELA 2FSGA 1YU9A 4H7PA 2VNKA 2BL4A 2GPJA 3FCUB 3HVIA 3I04M 2VK8A 3E1GA 3ZLVA 4M87A 4Y2JA 5EJ9A 4Z4FA 4KYTA 1SK9A 1PVVA 1XTBA 4OB8A 3LC0A 4BJHB 1UANA 1A96A 2GA9A 1L3CA 1J9GA 2QVLA 3NOXA 2ZW9A 4ITRC 2E6KA 2O8FB 1XZGA 4ALMA 2JAOA 4WVLA 4BZQA 3BMCB 2VYFA 1PAUA 1PKXA 2BC9A 1SCUA 3QBVA 1W96A 3FUTA 4EI8A 1PHRA 4UTVA 2H17A 3L6DA 4BNMA 3BVPA 2PVSA 2NZVG 3BE4A 4HNVA 1RXUA 2CLDX 4Z9AA 3A9VA 3KXKA 5MHTA 5JI2E 4MW0A 3AWIA 2CK3D 3OZEA 4G8JA 4WLFA 3TXYA 5AW3A 1G291 3ESYA 4F3NA 5JATA 2ERYA 4KBYA 4OP2A 2MDTA 3IQDB 2QU7A 4F2DA 1TMYA 5ARBA 1MEJA 4B48A 3BN3A 5I7EA 4FWBA 3DBHB 1GSAA 5EZYA 5BPFA 4GWGA 4QYXA 4HF7A 3EFBA 2FMTA 5D1NA 1U63A 1VDMA 4XIJA 1GOTA 1GPUA 2X3UA 3PJGA 4P4SA 1TD9A 2CUTA 3NQ41 4QTXA 1KH2A 3O8CA 3PQEA 4UDOA 4QG3A 1V8BA 1G5RA 3GJ0A 2IOFA 3AEXA 1GCUA 3JASB 3LUJA 3IA7A 3LVFO 3NGMA 2DEUA 2RB4A 1Z47A 4DL9A 821PA 2C3PA 5ICSA 3ZWQA 1A8IA 4KPEC 3L5OA 3ZU6A 5JBNA 1E9SA 2IU6A 1FW6A 3AVYA 2QJFA 3TTTA 1C7RA 2X19A 3G8CA 1PT8A 2GB4A 2XA1A 2XCLA 4LOIA 4M7RA 3UGQA 4C89A 1K1EA 1UP7A 4U9IS 1AUQA 1DFGA 2YZMA 1D6SA 3N2GB 2VI5A 3QVSA 3RT9A 3WO1A 2JJYA 4EY4A 2O0LA 1BGVA 3N7AA 1OLUA 2HUPA 5A6SB 3SCZA 5EE5B 4CHGA 1YJAA 1TT7A 3OT5A 1ZJJA 1V0JA 1NN0A 3K35A 2FZVA 3PL5A 3I4LA 2TRSB 1N2EA 3IOYA 1E60A 1SKYE 2OV2A 4XUDA 5HF5A 3VFDA 2A59A 4EQ6B 4PR3A 3VZSA 1NSTA 1W6UA 4N3GA 4E5NA 1ESZA 3NBUA 3MB8A 3TLMA 2R96A 1T1GA 2VQDA 3M1AA 4Y2VA 5I7VA 2JLUA 2VDJA 1CTQA 1QKKA 1H3FA 3VISA 3HNRA 2V98A 3M3DA 3LDUA 1E4EB 1LDMA 3QVWA 4FR0A 4J7XA 4LOJA 1OPXA 2VPTA 2IZZA 3DFUA 1DRJA 1KY4A 2G6BA 2R6GA 2QRPA 1UXIA 4X90A 3DWFA 4I55F 4EGJA 4Q7QA 1MOZA 2FX2A 4HGQA 3H8JA 1USIA 2CGEA 2WPDA 1RJ9B 3IX7A 4EH1A 8AT1A 3D4BA 1I4LD 5LA6A 3SJUA 1YIAA 1B42A 3S44A 1C3LA 3KR1A 4UD2A 1N2XA 2ADMA 1S4MA 2I6UA 3C1TA 2ZT6A 4DYVA 3ZDQA 4D9NA 4TSKA 1Q1BA 4R3WA 2Z3VA 5IUJC 4HDQB 2PSHA 3S2SA 4BGUA 1W88A 4YT8A 4X3CA 2DQ4A 1H1LA 2FWRA 3L77A 3PE4A 4E12A 4OQPA 4R9VA 1KVUA 1JFFA 4REQA 2PSSA 4MZDA 2N1MA 1MG5A 1CYEA 4WOBA 2QM8A 2B37A 2ZSHA 4D41A 4A2WA 1HE3A 5JXJA 1IZ9A 3N8DA 3B85A 1P1JA 2CNLA 3V4VB 5BORA 1G6HA 5J58A 2OCAA 1U9IC 3TGPA 3O74A 1CPYA 2XGMA 4WBXC 3TQQA 4BEJA 3CXUA 4YGYA 1XYVA 2ZRAA 3EYWA 3QKIA 5EJMA 4KPFC 1TGYA 4D3YA 2XWSA 1DQRA 4TM7A 2OL4A 3VTZA 4HXFB 3S70A 5IRCD 2O5RA 1Y6GA 3RADC 3NC1C 5ES3A 1U5AA 2EF1A 4UBMA 4CF6A 4CTMA 1EMDA 5KJFA 2BYTA 4I81A 1M83A 4FSDA 3GLUA 1ZRNA 3W1VA 3PP8A 3UUWA 4CT4B 4PNZA 3AV0B 3FCOA 4XXHA 3FSEA 2V97A 2YTZA 4MUMA 4RKWA 3ZH9B 1E0DA 1N92A 1VPVA 1CP2A 2V96A 3BWYA 2QX9A 3M83A 3OPQA 1UJ6A 3AZQA 1MAHA 1UWLA 2EFCB 3E84A 1QF6A 1A7UA 5IJZA 1M0EA 1SQFA 1WVGA 1XZBA 1R5NA 3O8LA 1V7ZA 4J7AA 1SUFA 1Z83A 4G36A 3T35A 2WF6A 4UUOA 4K87A 2AFHB 4X85A 4CIWA 4ZODA 1DCKA 1N5KA 5JYDA 1ID1A 3PK0A 5AOAA 2IBMA 3HN7A 4U6SA 5HE8A 1NUAA 3NALA 2X2FA 4HUQB 3DLAA 4PYRA 1CJUC 2B83A 1TECE 2WWFA 3D6AA 3HP4A 1OYWA 1TDJA 4RQBA 3FUWA 3ZWCA 4Q6BA 3GBPA 1Z0UA 4TTQA 3LY5A 3ZQ4A 2DERA 3E3MA 4NYIR 4ERNA 5A4MS 4I4TB 4DWJA 4PG6A 2NZ8A 3I6BA 1ODJA 3UHJA 2PBLA 1CS0A 2Y92A 2J9RA 3COYA 1E2PA 3IVXA 2ENWA 3LYAA 5EESA 1QO9A 3MBOA 1GDHA 1W2HA 1KIAA 1NVBA 1YS9A 2YVAA 4AG5A 2HHAA 4AURA 1WMSA 4Y0NA 4Q1VA 2WAAA 3JQAD 3MWFA 3AR6A 5HVNA 4PLCA 4RULA 1EFVB 4KFTA 1IDOA 3GAMA 1IHXA 3N0WA 3OU2A 4TXJA 2HK6A 2MU1A 5EJFA 1ADBA 1H8HA 4JA2A 4D8TA 1J07A 2Z5LA 3IAFA 1KYWA 1YDEA 1FFGA 1Z4PX 2YZKA 4GSKA 4IHKA 4PZPA 4QBGB 5TR9A 5TQ2A 3ZDYB 2CSXA 4IJUA 5ALGA 1QQAA 4TT3D 1XEXB 1N75A 2CJXA 3SHOA 4B3JA 1D4ZA 2RD2A 4ZAXA 5JMWA 1IM2A 3DZFA 1Z88A 1VBKA 1KR5A 2MSWA 2W83A 2J3MA 4KWCA 5FHRA 4XZ3A 2VA8A 3ZW9A 2G83A 1GTVA 2W2KA 3I04A 1YQGA 1FVFA 2C0QA 3HWWA 1JBKA 3KCNA 3W2HA 1IZZA 1U8CB 4QU9A 5K8LA 4DSUA 4G0XA 5CA1B 4BKUA 2I62A 4RJJA 1E5TA 1YTLA 3RRXA 1E3MA 5IFKA 3N2KA 1BU5A 4IDOA 1OT5A 1DMRA 2QK4A 3AQIA 4U63A 2D0IA 3NHPA 2AEJA 2BI4A 3R7AA 4H4EA 1GTJ1 2P5UA 2MMGA 4WKOA 3DBRB 4HC4A 2PL5A 5FUBA 5NULA 5IKXA 3CIOA 1QIMA 3OUZA 4INOA 4R4JA 5EVCA 1YRYE 1CRZA 1DKRA 2UUAB 2AMJA 4LDQA 3H84A 2JI7A 4GR4A 5F77A 3TW6A 4PAOA 3EUWA 3IC5A 2JJ1A 3IUSA 4JI6B 3VR0A 4HJRA 2CJPA 3HO6A 3O75A 3P0EA 4WCFB 3VYRB 5K5EA 3M4XA 4OQEA 5AXCA 5JAQA 1E3EA 1U2DC 2HF8A 2XGJA 5DISB 4N7BA 1UDAA 3ZU3A 3MSXA 3MRSA 1D1QA 3AEQA 3B8EA 4RF2A 4ZZ1A 2PUGA 2W90A 4G41A 5CRIA 3W77A 2BGRA 4QA9A 5JTTA 2HF2A 4XQ0A 3PTAA 2DWOA 2ZI9A 1FLVA 1WLSA 2CXXA 2A1IA 3ESAA 3IBFA 3L40A 4C6TA 4XW2A 4J9VA 3H4VA 4FINA 1RJGA 3TLBA 4UM9D 4EECA 3P26A 3TUIC 4XWTA 3ETHA 4EHJA 2ZJ4A 1C0IA 2LXNA 1Q3HA 2RI1A 1CEEA 5FLYA 4FYKA 1EZ4A 1Q84A 2PQMA 2X0RA 3GZJA 1XJWA 1MB2A 1HK7A 1GQOA 4PS1A 2UZ1A 5CD1A 3NBQA 2DYKA 3RS9A 3GLIE 2VCEA 4LN1A 1Z82A 4EDHA 1DXYA 2DPXA 1XQXA 2XSZD 4JDPA 1DBWA 1E9FA 1XU7A 2J0EA 2PKXA 1G5PA 3UCFA 3WMXA 5ALVA 3QKSB 4PSAA 4R83A 1CYDA 4C6SA 4CTOA 1NJFA 2RAUA 5EWLA 4OA8A 3PICA 1SKBA 4F5EA 1OCEA 1NP6A 2DR0A 4WJKB 2HREA 2FUEA 2VYND 2X2EA 1IG3A 1RZVA 2EJCA 4NNOA 4ZYLA 5GZ1A 2XCTB 2IC5A 4HZGA 3RG2A 4EO9A 3GRRA 4JCCA 1WMDA 1AKTA 4PNPA 3M2PA 3LKVA 3MNFA 1BXKA 1V2GA 1WXWA 4G1UC 5GAJA 5JE8A 2Q28A 4UVEA 4J1TC 4UAJA 1TU4A 2LVBA 3ORYA 4KXUA 4OLHA 3TBHA 4EEKA 5BYAA 4I1YA 1PN3A 1Y9JA 5I7UA 3BMOB 2VOEA 5IXYA 3EVBA 1U9IA 1V41E 4G63A 4XOUA 4IZHA 3T15A 1Q14A 3KB8A 3Q87B 1EBBA 4ZZ0A 5EXSA 3T06B 1MJGM 2QQ0A 3G2QA 3KUUA 1E0AA 2WUDA 4WXEA 4CKBB 1X7YA 1X1BA 4Y2PA 1UR5A 2O8NA 1LH0A 3NTOA 1XEFA 5DWQA 4XA8A 4GLFA 2J0UA 2CDNA 3KSBC 1CEQA 2H1LA 2QQEA 4JC5A 4BKRA 3A1WA 4QBTA 4B31A 3W5IA 1XMQB 2D2VA 4GO1A 4OHVA 4WMLA 1W94A 3OTHA 4GMFA 5FTJA 5DNUA 2YIVX 5EE0A 3UG7A 4ZI7F 2WSSD 3BDIA 5M34A 1DJOA 1IYZA 3DH0A 1SC1A 1Y9ZA 4C7BA 2SNIE 3EZGA 3AETB 2PR2A 1W1UA 1FUKA 2Q0HA 1T2VA 4KL8S 2QB5A 1RVDA 3LNTA 1P75A 2AFIA 2QTTA 3ADKA 3NBAA 3C6QA 4XCQA 2Q8PA 4GW3A 3WYNA 3LNCA 4JB3A 3ZLBA 1K8QA 4BFXA 2RHMA 2WJHA 4HP8A 1V5WA 1RI1A 4QODA 1P7ZA 1TKCA 4EL0A 4GL2A 1OKKA 2OXTA 1W30A 1HF3A 5LBTA 5AKKA 1PGQA 5ALXA 2C8VA 2F90A 2NZUG 2M6RA 5HZGA 1XMJA 4P8RA 5DGTA 1N4DA 3ZWYA 4QDUA 1P7VA 2NSDA 3TSWA 1F12A 2B98A 3PXEA 4JLUA 2OFXA 2CF5A 3D54D 2I9PA 3C70A 3EZ7A 1AVTA 5I7SA 3F1LA 4TZTA 3QTBA 3V5NA 2PUHA 2XBMA 4ITVA 2AT1A 4GPTA 1E2BA 3KVOA 4URHA 1KU6A 3MT9A 1M3SA 3GIWA 3QUCA 3FDJA 4R05A 5JBQA 1EH5A 1XLUA 1R10A 2Y0BA 3S5UA 3BXXA 4RJTA 3G68A 3C5VA 4YV1A 1N6OA 5GOZA 1I4OA 3BWBA 3FLBA 3HJRA 4H17A 3NANA 1AG9A 4LDPA 5A4FS 4MUFA 4XB1A 1H6DA 2PG3A 5JS1A 1OROA 2VYNA 5CM2Z 1C2TA 3OLVA 1LI7A 2Y1KA 1PFKA 3PHCA 3L1JA 3N86A 1QQ7A 5AW6A 1MBZA 3TRKA 2JLAA 2JH3A 4GX1A 2OKGA 4QUHA 1YQXA 1W34A 2GJ4A 5F23A 2UYQA 2REQA 2ETXA 3AEKA 4N5DA 2B6HA 3Q2KA 4Q19A 5DBFA 3TX2A 1XCMA 3UJ3X 3VVCA 2VSNA 2WTMA 1PNVA 5L40A 1N33B 2FPOA 4DKXA 1F51E 6YASA 5BR8B 2Q5EA 3B7PA 1JHRA 1SURA 3PQ3A 3GELA 2JCBA 3DC2A 1P62B 4NRDA 2P1DA 5BN5B 1FXUA 1P0FA 3ETCA 4RL6A 3SYKA 5AW2A 4Q4HA 3T12A 1E64A 1YQEA 2O8VA 1GARA 4TQUS 1LCIA 4B71A 4X6XA 4HDMA 4MQUA 4I5FA 2O23A 3A3NA 4YP1A 3NYWA 3AM1A 2OP0A 4FFRA 3R3YA 1JJFA 1AX9A 1VIVA 3PLNA 3QEMB 4BVFA 2GNAA 3VHQA 4KZKA 4LI0A 3V9PA 1NJ5A 4AL4A 4O0LA 2V7BA 4ABYA 3PFWO 1VBMA 2BKLA 2V9CA 4OHOA 1BS9A 3H11B 2NU8A 2WSSA 4ND1A 5E7JA 1UAGA 5CHEA 3LDHA 2FMUA 3TOCA 1VKOA 4QFBA 3OLZA 3TNYA 4NVRA 3SYNA 3ZI4A 2VBFA 1U2DA 4G1EB 1M0WA 4OL9A 4QNNA 4HBZA 2G71A 1MAAA 3PGJA 3QEJA 1YBFA 1T4MA 3EA5A 1N8SA 4NOJA 1UQRA 1VECA 4J0QA 4RTJA 2W6MA 3VAZA 1H23A 4KC0A 1GPWB 3Q7QA 1O89A 4DHEA 3ANTA 3QEBZ 4LTMA 1CD5A 3O3CA 3RASA 3S3TA 4J4TA 1HKUA 2BHRA 2CYCA 3AB7A 4NMXB 4UM5A 3OBBA 5D7NA 2XT9A 4ZMBA 3DDWA 2M6LA 4N8EA 1QJCA 2GF0A 3EJ6A 4EABA 3A1NA 3PSHA 3R1IA 1KEWA 2FF5A 2CXTA 3GH3A 1RIIA 3A6HA 5CHYA 1D2HA 1YR2A 1Q0RA 2HCBA 1PWZA 2NWQA 4HGNA 5JJCA 2P9YA 4J49A 2W4MA 2WWRA 3OJWA 5DP1A 1OA1A 3W6PA 4EJ2A 4LF5B 4IYJA 1GRVA 3KKLA 4EQZA 5FBKA 1LU9A 1QIIA 2IDMA 3L9WA 4YPFA 4B4UA 4C4TA 2E4AA 4PRLA 4RYLA 1BGWA 1DIAA 1Y1KE 3OCUA 3OX3A 3DD5A 1KPHA 2D2XA 1F7UA 1XPUA 3UKDA 2BGUA 3ON5A 1GUYA 2J6BA 1EM8B 3CF0A 4UATA 3PJRA 4ZDJA 3UB4A 4Y0AA 4X41A 4BP8A 1AQUA 1E3QA 1R00A 2E49A 2QW8A 1KEPA 1G64A 2VJPA 2WIJA 3WRXC 4DLBA 3FAKA 3RYIB 3D3KA 4P35A 4P1ZA 1E6EA 1JXMA 4ED9A 4NG4A 1IL0A 1P7CA 3RBXA 3UMSA 4E88A 5LQMA 3DEKA 3BQNB 3I8XA 1M74A 3C3PA 4P36A 5ALYA 3COZA 3ENZA 3ZY5A 1WVIA 5DSZA 2EBUA 4FB5A 3KETA 1UXJA 2WICA 5ESWA 1X80B 4Q21A 4YRRA 2BFEA 3OTOB 1LZKA 3VKWA 1UH5A 4J1TA 1Z33A 1UJ2A 4UBJA 3B5EA 2GM4A 5HCUA 4P4TA 4QDXA 3JQCA 3SLKA 4YHBA 3ZPXA 2AEFA 1E9RA 1O9HA 3HWRA 4EGSA 1R0SA 4G0PA 1ZMRA 5L3QB 5TPWB 2MSEB 2Q29A 4MYRA 3WVNA 4E14A 4QKQA 1E5QA 2CJFA 2OV6A 3HJHA 1XTPA 2GEVA 3FKQA 4IXDA 4PCAA 1JKJA 4XVHA 1A71A 1V45E 2VNAA 5A0FA 1T6YA 2NO1A 1E3WA 3N2NA 3ILVA 2GAOA 2FPGB 3MG9A 5DWVA 1JEYA 4O5AA 4K2HA 1IOLA 4NBRA 1MA0A 3ZJTA 2OBLA 2WFMA 1V4NA 3QJYA 3LLMA 4JENA 1MORA 1P4HA 1VA4A 1FS4A 3AW8A 3C43A 3BHIA 2COEA 5K8VA 4RPLA 3A1EA 3GLIB 2Z09A 4B8WA 3PENA 2EEZA 1EE1A 1DHTA 1EBUA 4JBYA 2WTBA 2OXFA 1L8XA 3U31A 2JLWA 4BO7A 5G1PA 1O0CA 3VH2A 4AZ3A 3RVPA 2GXQA 2A33A 3T3DA 4G25A 2EZTA 2CXNA 1ZKDA 3EW9A 3OKFA 4L7QA 2WYIA 4AMGA 4EJSC 2IYVA 4H59A 3SM9A 1NLFA 1UMBB 2QTRA 2R85A 3C24A 3IQGX 1MIHA 3QP9A 4JY7A 5KYUA 4RFLA 2PHZA 3W9YA 5CM9C 3GJ4A 2VA9A 4QBHA 1JJIA 1JHVA 5C1DA 3DP7A 1FXWF 1H0RA 3TUJC 5I47A 1OXVA 5SYMA 2O1XA 2Y68A 2ZJBA 4MYTA 5KPJA 3I61A 3SD7A 3D31A 1TPZA 2HOQA 1F48A 2QM3A 5FPQA 2PX4A 2GR9A 2WWIA 1DS6A 1YQDA 2R5NA 3LT0A 2OZLB 5BVHA 3DZCA 1USWA 3A4NA 3AVQA 3AUFA 4B79A 3QRWA 2EP7A 3QU7A 4KVZA 3O92A 4R7TA 4WNYA 3AEUB 3S5JA 2DSNA 2G9QA 2VWQA 5LP6C 3EZ6A 2QVBA 3DAFA 1OIXA 5AK0A 2B3DA 3R7WA 4EG6A 1UM9B 5HRUA 4C7OA 2XZDA 1G8YA 2X41A 5CH5A 3WFJA 4Q3CA 3VR3D 4WNAA 1HOXA 2JGDA 3S1SA 3THYB 3CX8A 3OECA 4Z3KA 3H5NA 4GBJA 2HGSA 4QOIA 4HN2A 2VHEA 3P9NA 4H77A 5JJ5A 2OHHA 1ZQ1A 1KDVA 4A8TA 2D3TA 3WTBA 1ZL0A 3NP9A 2HM7A 9LDTA 3SU8A 4MR9A 4QU0A 1M2KA 1Y6RA 2G3YA 4RFSA 3PQ5A 4N6NA 2C2OA 4YRLA 5ILQA 2UDPA 4QT0A 2A5GA 1DCTA 4RK5A 4HXEB 2IODA 5HQJA 3SE7A 3BRWA 2ZRNA 4DT1B 4PLFA 1J0BA 3WLPA 4N12A 5E0OA 4GQBA 4MLCA 4B3TB 2NM0A 3BZUA 3EY9A 1BHO1 2EF0A 2BLLA 4B6OA 3GFFA 2FSSA 2NXNA 1LRLA 2B0JA 1HH4A 2L69A 4QPJC 1WW8A 1BX1A 1U3WA 3KR9A 3FMOB 2WK1A 4HWOA 4MKRA 3DVAA 3RABA 4R6WA 3RSCA 1P9RA 1Z06A 3HJBA 4DCPA 4EHFA 2IYPA 4KPUB 1OY1A 2J4CA 3V7WA 3SYRA 1Z8DA 4FHEA 2I3BA 3R3VA 1UDXA 4Y6QA 1QQTA 4HXYA 3ER8A 3ZVLA 1FDUA 1F5NA 2NO6A 1CU1A 3V46A 2ST1A 3U44B 3ST7A 1NLUA 3ZHVA 1EQAA 3H13A 1C0KA 4LY0A 8LDHA 3D7NA 2VJMA 3KSZO 4AJLA 3Q9LA 2VZLA 1Z08A 5IJ0A 3QE9Y 2CEAA 1EAYA 1S8FA 2OE2A 2ZI3A 5U4QA 1DC8A 2JVKA 2DBZA 4RK7A 1UBJS 1LBQA 2V03A 3ZDAA 2VHWA 2O8EB 2HEGA 5KSPA 3AR9A 3H97A 2NTVA 1KAQA 1Z3CA 1R4NA 2C4UA 2P9EA 1RXSA 4I4NA 5AICA 4GI1A 4DA9A 4H6WA 3HUTA 4AJ1A 5L3SA 1XHLA 1O5IA 4EB0A 1AQNA 1T9HA 4FJ2A 2JIRA 2UYGA 3BB3A 3ZHOA 4YJFB 3K32A 2NU6B 2Z9CA 2G9VA 4CKCA 2JJQA 1ONNA 2BHNA 2ODAA 1KQOA 1UMCA 2C2WA 2BKEA 3EUEA 3QUAA 3U62A 5BMVB 4HWGA 4XYBA 3RUCA 4UHEA 4QEZA 2W2QA 2XA9A 5CURA 3TZHA 1D8TA 3OE4A 1H4TA 3FDXA 3NUGA 4TV9A 3NKVA 2YZNA 2R8PA 1TAGA 1DAMA 4RELA 4E46A 4M83A 2A8YA 1QH8B 4KK3A 2MYTA 2BFMA 3BQMB 1P1RA 3LBFA 2Q6KA 2D0PB 2CHGA 4GRAA 2JLSA 1O6BA 1YT5A 3C85A 3WRXA 4QLOA 4XEHA 3NRBA 2A0WA 3O2SB 2XMQA 3TAUA 1QG0A 3P2JA 2NV6A 3BGWA 4K3VA 1V47A 3GNSA 2QJOA 1GPMA 4DYHA 3I09A 2R8YA 3UV3A 4EYGA 4PC7A 3JZMA 4YNBA 5K0JA 1ABFA 3KZ1E 2ZYRA 2DC1A 4DILA 2X58A 3HJFA 1TO2E 2R87A 1USKA 1I2DA 1DTWA 4WEOA 2WJJA 3IOMA 5FAXA 2VF5X 5KUTA 3IVCA 4LGCA 1GR1A 2IS1A 3L41A 4IIJF 5EQJB 1V96A 5FR2A 1EDBA 1CR1A 4RXMA 2IU0A 2SCUA 3H0CA 1N2JA 5LQSA 5KQRA 3E3NA 1KMHB 1KI3A 1IQRA 4L4RA 3WWDA 2HR1A 3B60A 4B5LA 1SVLA 1JWLA 1OC2A 1Z2PX 3ZDDA 1S01A 4G86A 5I6DA 3C87A 3A6DA 3NO4A 2L17A 3UYLA 2PXXA 2P9FA 3ZHUA 4EFNA 5JPCA 1BMDA 2QP4A 1I94B 2C4VA 3FGOA 4EF4A 1TQ2A 3AGPA 2IP4A 2OK8A 4J16C 4ZI3A 1KGDA 1NZFA 2C3YA 2ZJ8A 3PYMA 4C4OA 4DARA 2GXAA 4JEUA 3D8HA 2XJ9A 3CUEF 2FTKE 1N3BA 4MGYR 3DDHA 4W5JA 3V2UA 5C52B 3BQ9A 5ENZA 3R9IA 1LTHR 1O96B 2CYBA 3L7DA 3R3JA 5F1KA 4LF8B 1ZN2A 4I50B 5H81A 4ZVVA 2YKGA 4UPVA 4EJSA 4Q3AA 5K3DA 3BSWA 2BY4A 1KI7A 1W19A 4HRXA 4DKJA 1I9CA 3FNQA 4QXPA 3VKUA 1L5GB 4QOSA 5DO9A 1B8UA 2JI9A 2PVCA 3DMRA 2BMFA 1A5BB 3P2OA 1PS8A 5HIMA 2EW8A 1UC4B 1G9TA 3NNNA 5K3AA 4LCBA 5KYTA 1T2CA 1YDHA 4EUHA 2QN9A 3F5SA 4AULA 1EXWA 2C7BA 1K7SN 2IY8A 1CUHA 2PKQP 2TS1A 2XNSA 3DBLB 2E2WA 2H1WA 2DM6A 3IE2A 3HDGA 4YJ2F 1YCDA 3T5MA 3W79A 1PV4A 4ND6A 1CB0A 4YN3A 3UF0A 5FIUA 1EK0A 4PG5A 4E5MA 3HC7A 3OCVA 3DWIA 1EDDA 3I9KA 1ZC3A 1ZCAA 1ODIA 5LP6A 3MLEA 2P9HA 3Q0EA 4LZWA 5T41A 4F45A 3IIMA 2G5TA 3BA1A 3ET4A 4OJYA 5JY6A 1B6SA 1PRYA 1RHRA 3H3FA 3TDNA 4ZYTA 5BRJA 2PGJA 2J7PA 3V7FA 1X1SA 3GT0A 4G5FA 1CQZA 4YYEA 4KXNA 4HPWA 3L46A 2VZEA 1R8YA 3FYCA 6PFKA 4L57A 2ZJAA 1EWQA 1EK5A 3I73A 2E0IA 3K1AA 3QMMA 2GCOA 2GA8A 2JFHA 2P3SA 2E5FA 1BRTA 1T4CA 1G5FA 3GFOA 2V6MA 2C96A 3KQYA 1TCAA 4S1TA 1J0CA 1LZLA 2ZWIA 3OEYA 2QORA 3NHYA 4JYAB 3B89A 4FXPA 3TJMA 2AN4A 4Q03A 1OREA 3KKEA 1O03A 1UOOA 1YS6A 3EIXA 1JZTA 4F4JA 1WZCA 1MOSA 2DE0X 3NI2A 2VTBA 1J90A 4PRKA 1ESCA 2GVZC 5DH9A 3PD7A 4KITB 4NULA 3WLHA 3I12A 2G1JA 1X7HA 3EAQA 1MFZA 4NU8X 1BX3A 3KQMA 3TF5A 1TIBA 4KBFA 5CBPA 1ZR4A 1H0KA 3I5MA 5B1HA 1DSSG 3D02A 4M1MA 1ST2A 4JYCA 2W58A 3QFHA 4XVRA 1TQ6A 4N1AA 3NBXX 1NI5A 3S7TA 2XD9A 3GCWA 4L28A 3FB1A 3C74A 4KXXA 2R5WA 4OV6B 3GAZA 1PFGA 3CF2A 1KJJA 1QTRA 1X9IA 4JITA 2OSBA 1IATA 1UPUA 1XNGA 2ZUVA 4FBLA 1Z0JA 2C7GA 4JQYA 3DVRX 4J2TA 3TG2A 1LDNA 1QE0A 2JS7A 5DXAA 3J80A 4N9QA 1TAUA 4HGRA 4F11A 4HQOA 1SOAA 5HFJA 2XAAA 3DW3X 1LJUA 1BD3A 1XCGB 1D2MA 1XTSA 1VGQA 3DHWC 3CUWA 1FQJA 3L6OO 2XUAA 5CVDA 4MRMA 3I3SR 2QY6A 4B3BA 1BJRE 2HBYA 3IT2A 1L5FA 1P29A 1SCNE 1X74A 3GRPA 2BT4A 4MUYA 4YQYA 2G36A 1M1NA 1ZICA 5FDFA 2W2TA 3ECCA 2FKAA 2QPLA 1G2OA 1PW7A 3AVPA 3BAZA 2V54A 3KBBA 2V1XA 4C0LA 4BEWA 1E7YA 5TIIA 5J4HA 1CRQA 1JR3E 1I32A 2PKQO 4LVCA 3EVZA 4PHHA 5DBHX 4DPLA 3JALA 4OK5A 2IV7A 1EHYA 4P81A 2QU8A 1JQLB 3ELBA 3PS9A 4C0SA 4EKDA 2H11A 4J29A 4LRUA 2QT0A 2RGEA 1Y6FA 1OZAA 2ZE6A 4LJKA 4ZQIA 1ISIA 2Y1XA 2OG1A 5JVDF 3WMEA 2HJHA 4AF6A 1JPJA 3OQMA 2OV8A 4FYMA 2QN3A 2CJYA 2ZB4A 1ZNQO 1GNSA 3SI7A 5B2FA 2GEFA 3MOGA 1XF9A 2LPMA 1VG0B 1C7IA 1ZCBA 2LRHA 2X7JA 3KXPA 1RC8A 4G0UA 4BHTA 4HB0A 3U6KA 1OFIA 4U6NA 4LS3A 2FMFA 3TTSA 5I7OA 1HR0B 2XGOA 3AP3A 2OZPA 4PX5A 3PWTA 2HBQA 4TLAA 3VKVA 1IAQA 3DUWA 4PYQA 2EX4A 3WQQA 2XUFA 2IXGA 2PT6A 4D9FA 2XUIA 4PTLA 5FEUA 1UT8A 4Y6GB 2B0CA 4BVAA 1W9MA 2XB4A 2MHCA 2Y66A 4GIBA 3UAZA 1GN9A 3DV0B 1K6IA 1M6WA 2RG7A 2ZSKA 3IB6A 3LZ6A 4YASA 5ALTA 5KDDA 1P72A 3H9BA 3TDMA 4GM1A 3R8CA 2I1LA 3T7JA 1KQFA 4JH0A 1EP3B 1U1FA 1WDLA 1LDEA 4MHTA 3QM1A 4LCJA 2GH1A 4LBZA 3U1TA 4MIEA 3TQRA 2AG1A 4GP9A 3CNBA 2GAJA 1H6BA 3FWYA 3MC1A 4RAOA 1KHTA 5HTOA 3WGNA 1D1SA 2AJLI 3QTTA 4TL7A 1MPXA 1MIOB 1ZGGA 2YQ4A 4IQFA 4EZIA 3JAKB 5MGNA 1T43A 4CDNA 2O2HA 3QJGA 4ZOBA 2J5QA 2VTEA 5CK5A 4ZRNA 1OGIA 3NHUA 4YALA 4GMHA 2AEMA 2RHHA 2A9RA 1JWAB 2WYHA 2XTJA 3GEEA 1WD5A 1LBSA 1L5NA 4DLYA 5CBKA 4LMPA 4C87A 3F2VA 2OFFA 4J16A 4MWSA 3U56A 2N42A 1GV1A 5K0SA 5LQJA 5H83A 4AO8A 1KYXA 3LDAA 3VM6A 2JNWA 3DWGA 1II0A 2PX0A 4I55A 1ZOSA 2FY8A 4P80A 4DWVA 2RB5A 4UEKA 1L4YA 4MXDA 5KTMA 1LNZA 2NQ2C 2OWEA 2LDXA 4RHXA 1OIWA 2JARA 5EKSA 2ZXEA 3BK2A 1Y5LA 1RWNA 5DIFA 3FPHA 3GC6A 3ZHTA 1Q22A 1YQQA 2P67A 4A2PA 1UPBA 1WUJS 2YV3A 3LPNA 5D7BA 2R8ZA 5T67A 5TX7A 2IWHA 5L45A 1Z0ZA 2HUNA 3G2JA 1GZSA 3HXQA 2VJBA 1SKMA 1NPTO 1WF6A 4PFJA 2R8EA 4A6PA 3HRKA 1IEVA 3I01A 1NBHA 1B23P 1Q7BA 4WKPA 4JT8A 3C41J 3SQDA 1RPTA 2X9VA 3HHPA 3TSCA 2IYZA 2PR7A 2QTAA 3EISA 2VYQA 4IZIA 1X15A 5HNKA 2ZTHA 2RGBA 4OGLA 3JQGB 3MTEA 4NDAA 3T4UA 4ADSG 1JJBA 2QGNA 2WAMA 1MRNA 1JEAA 4QDOA 1NQTA 3IRVA 1WTAA 1W5SA 3P2MA 1O6CA 1RRPA 1W59A 1AGPA 4HX5A 3U9LA 2OV1A 2WJIA 4H7JA 3CUYA 4HMPA 4WNIA 4BS9A 4XYLA 1FA9A 2X9QA 1VTKA 2GPYA 2W0MA 4KQHA 3V2HA 1ONSA 2CFIA 4MGIR 1PZNA 2DPMA 4Q9KA 2EKPA 1HEIA 4C03A 1RTKA 4FYPA 1THTA 3TLZA 3DL7A 1GSIA 3EW7A 1CY2A 4JT9A 5KKAA 4HL6A 2NYAA 2VT6A 1N8TA 4MQFB 3THWA 4BJ5A 4ZQCB 1XDDA 1FP1D 3M82A 4OUDB 5L53A 2QNBA 1PDWA 1EGAA 2OBFA 2GN0A 4B34A 2GAFA 3WAJA 4K8OA 2VN8A 1VKJA 3ITKA 3IP6A 3KLPX 4OHCA 1V5IA 2I8CA 3M6VA 4UUQA 4Z9XA 2DLDA 3BILA 2OAQ1 2IYLD 3EN0A 4G8DA 4DANA 1CUXA 1D5CA 2CE7A 2EYQA 1Z4KA 3D3EA 4XCXA 3R0XA 4C7JA 5JD4A 2I2CA 1XMIA 4EI2A 4A9AA 4MSUA 3DJYA 3LJKA 1WW3A 2OV4A 3MJHA 3II6X 4TTVA 1QPBA 1LW7A 3WZ2A 1NOIA 2R8BA 1S5PA 4PLZA 4X1YA 3RRMA 3N2LA 3P52A 4LFBB 4DB4A 2DWUA 1YL6A 2IHNA 2JKYA 2WF7A 2PBZA 3ONEA 5KCZA 2VAXA 3JYNA 2GWHA 4REMA 2AQKA 1SNYA 4HMOA 4UU7A 3V6MA 4CE6A 1RHJA 1XE3A 4MB6A 1E6UA 3TW8B 3AO0B 1G4HA 4A6XA 1BDMA 3ZI7A 3VOBA 1EGVB 5F3WB 3EG9A 1YK1A 4IIUA 2WR8A 2HDOA 1O1YA 4Q01A 3AI7A 4P83A 1YJXA 2V9ZA 5EHQA 3UENA 3ZHBA 3WC4A 2LBPA 4V1CI 4S1WA 2J45A 2Y9MB 3A27A 3JRWA 1Z28A 3R09A 4GYYA 1VE9A 2ZJYA 1ESDA 4MW1A 4B3IA 3HH8A 2EHDA 2WJVA 5EHZA 4G8BA 5JHHB 3HYSA 1NUHA 1FNCA 4GGPA 5AW8A 5J1SB 5AJUA 5EVJA 4O02B 2YCLA 3AHJA 3BXOA 3R5XA 5JCOC 1W4RA 1PR2A 3EXEA 1TK2A 4GEGA 3WLKX 1T36B 1SY7A 4PQRA 2BEWA 5FNZA 4ZAFA 2XB6A 3PI6A 4JUBA 1KWGA 5ALPA 1JSCA 4CCYA 5JISA 5I7AA 1YHNA 2AXPA 3MWDA 2XGSA 2VL7A 1VHJA 5K2MA 2Y1EA 4NBTA 1DJNA 1Q1AA 5L7YA 2O19A 1YR8A 2NO4A 1ADGA 1ZCJA 4TKLA 1GZDA 4NIMA 5K6AC 4A2CA 4DLRA