1LLUA

The ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
341
structure length
341
Chain Sequence
TLPQTMKAAVVHAYGAPLRIEEVKVPLPGPGQVLVKIEASGVCHTDLHAAEGDWPVKPPLPFIPGHEGVGYVAAVGSGVTRVKEGDRVGIPWLYTACGCCEHCLTGWETLCESQQNTGYSVNGGYAEYVLADPNYVGILPKNVEFAEIAPILCAGVTVYKGLKQTNARPGQWVAISGIGGLGHVAVQYARAMGLHVAAIDIDDAKLELARKLGASLTVNARQEDPVEAIQRDIGGAHGVLVTAVSNSAFGQAIGMARRGGTIALVGLPPGDFPTPIFDVVLKGLHIAGSIVGTRADLQEALDFAGEGLVKATIHPGKLDDINQILDQMRAGQIEGRIVLEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The ternary complex of Pseudomonas aeruginosa alcohol dehydrogenase with NADH and ethylene glycol.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
molecule keywords Alcohol Dehydrogenase
total genus 103
structure length 341
sequence length 341
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 2002-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1lluA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 1lluA01
2Q1WA 1GQQA 4LMPA 1ZW1A 3OH8A 4GVLA 1O8CA 1C1XA 3JQBC 3GVXA 2FPGA 3MTJA 2SCUA 4ZICA 4R9RA 3K73O 3H5NA 5KJ6A 2W2LD 4WLNA 3ZWWA 5KVVA 2Q3EA 4RPJA 1HE2A 5T64A 1NQ5A 1Z6ZA 3ANMA 3DAPA 4K6CA 3VOSA 2DU8A 5G4LA 3VZPA 2QHXA 3PLRA 3S2FA 4CMIB 5FYDA 1UDCA 4TKLA 2O3JA 2VUTA 5I7EA 1L7EA 3I9JA 1CWUA 1GADO 2HMSA 2PH3A 4N54A 3WWYA 1F12A 4IGFA 3LT4A 1ULUA 4BNGA 3U49A 1BW9A 1X7GA 2RHRA 1C0LA 1LNQA 2I67A 1Y7TA 2A94A 5COBA 5HS4A 5IDYA 3IKTA 4BV9A 1N7HA 3IKVA 2QZ9A 3C24A 4GX1A 2RAFA 2IZ1A 2ZYDA 4BIIA 4GI2A 5GY7A 1ZSYA 1V0JA 1KVQA 1UXHA 2BMAA 3ZHBA 1Y1PA 1H6AA 1YDEA 3C7CB 3U3XA 5A05A 3L4BA 3RU9A 4ZU3A 4J6FA 3G1UA 4MKZA 5DN9A 4D42A 2VHYA 7ADHA 2BGKA 1G0OA 3H3FA 4IQ0A 1HYGA 1I10A 2GGSA 3HDHA 1GTMA 5TSDA 4GMGA 1P44A 4N18A 4DC1A 1Y8QA 1U3VA 3HQ4O 1OAAA 4R1SA 4WCDA 2NTVA 5KJEA 1HETA 4XX0A 4OH1A 2Q45A 3K9QO 3VHRA 5ITWA 1LU9A 5IDWA 3N74A 5DCYA 3H2ZA 3NJ8A 3A28A 3AI2A 2YDYA 4CUKA 2O3RA 2H9IA 1V35A 3K31A 4JN6B 2ZYAA 2FHSA 2OP0A 4G2NA 2J5KA 3ZWCA 1ADBA 2I9PA 2AE1A 5H81A 5I7SA 4JP3A 4MVJA 1DFGA 5I9MA 3PK0A 4MOWA 4CODB 4ZD6A 4R69A 5JO0A 3L6DA 2PV7A 4FDAA 3RC7A 3VTFA 3FF4A 2ZQYA 1JN0A 2NU8A 4BOYA 4O5OA 4RPHA 4WOJA 4I5DA 2Q1UA 1NASA 1Q0HA 4E2XA 4QFDA 3GMSA 3JD3A 5FF9A 4L74A 5TF4A 3SXPA 3OA2A 2ZTMA 3DFZA 4B3IA 1EVZA 3ROKA 2VRCD 3EYWA 1EK6A 3CSDA 1LRKA 1J6UA 2Y1EA 4XDYA 4PLWA 3KOUA 2G17A 4QEDA 5THKA 3DMTC 4YAJA 4CQMD 4CV2A 1Z75A 1FF9A 4CM9A 1B3RA 4OQZA 1X1TA 5A4DA 2Q99A 3RKRA 3PXXA 3EZYA 1XWFA 1QV6A 3PVZA 1U28A 1B15A 1X1EA 2NU9A 3GPIA 3M1LA 3V2UA 1D3AA 2VUUA 3L07A 1HTBA 2NUAA 5JDCA 1XQ6A 1YOVA 2YZ7A 1P1KA 1TXGA 2RHCA 4WLFA 1KVRA 1IPEA 2Y1DA 3GRKA 2PK3A 2IODA 4YEDA 4QQRA 3RC9A 4QO7A 1ADFA 2VHWA 4A10A 1HE3A 2AQKA 2QRJA 3JD1A 4MIEA 1YB5A 2WD7B 5ER9A 3DBRA 1ISHA 2JFHA 3CZRA 5A5EA 1HKUA 3IMFA 4E21A 1ZEMA 1LC0A 3SLKA 4MIOA 3NT5A 2FPPA 3AY7A 1OBFO 2I76A 1I33A 4II3A 4DYVA 3I23A 4UVEA 4BO2A 1NBOA 4E5MA 5HM8A 3ZW8A 4UUNA 4YAGA 5C37A 4BKRA 1A9ZA 4CMHA 4B3JA 3GY0A 3RUHA 1NQAO 3QV1A 5AVOA 4NBWA 4YB8A 3I3OA 3RWBA 4N5LA 5I7VA 2EJWA 3QVWA 5KWEA 4PG6A 4HY3A 3HNPA 2EF1A 1NPDA 1HT0A 3H65A 5JYEA 1V3TA 4IINA 1VI2A 1RYDA 1Q0LA 3BHMA 5GMOA 4LCEA 4DLBA 2Y1FA 5EPOA 2LDBA 1IY8A 1K6XA 4KWHA 3DWFA 4D3SA 5JFOA 1A27A 5L45A 2JFGA 2UYYA 4QECA 5G0VA 4CMAA 3V1UA 4WEOA 4Z9XA 1BDMA 2O7SA 1HSOA 1JA9A 4GSLA 1E7RA 1PQUA 1HDXA 1T25A 2FRDA 3DTYA 2B4RO 1JKFA 4Q3EA 1OMOA 1KS9A 1PGNA 3WMXA 5AYVA 3DBLB 5F1OA 4NBRA 3IUPA 2NQ8A 4NJMB 3CZMA 2BH9A 1ZBQA 2E4AA 3SC6A 4MVJE 3H9EO 3GH3A 5IZCA 5ENDA 1L7DA 2DC1A 7MDHA 3OJ0A 1AGNA 2F00A 3DOOA 1TT7A 1EVJA 4CM6A 4JX8A 5THQA 1LDBA 1HYEA 4IXWA 3N58A 3AK4A 2VYNA 5FEUA 2AG8A 3VZSA 3R1IA 3I9LA 1EUZA 1R4MA 4DTIA 4ILKA 3I1JA 3L6OO 2PZMA 3RFTA 4DUPA 3SJUA 3GGOA 3U62A 1N9GB 1HLDA 3H4VA 4MP3A 5U1PA 3WGHA 3ETGA 2Q49A 3JYQA 3KB6A 1SC6A 1ISGA 3OJEA 2NVBA 4DXHA 4IS2A 1MGOA 4WECA 5JAMA 3KEOA 2C2XA 4KP7A 1G1AA 5JSFA 1EVIA 4J91A 5GZ6A 1E1LA 4DBZA 3GK3A 1GYPA 2QX7A 1Z73A 3GAZA 3OBBA 4R01A 1FDWA 3BZUA 4YRBA 1R12A 1VL0A 3GZNB 5I8ZA 3V2HA 2UAGA 3JYLA 3ZWXA 3H5RA 2NTJA 4RPLA 3WMWA 4IDCA 2CSUA 1YBVA 1OC4A 2PGLA 4YYZA 1GCOA 3KBOA 4M49A 4ZN6A 5JAZA 2IXAA 4H15A 1V6AA 4OKIA 1U3TA 4M8SA 4YJFA 3G0OA 1WDKA 4KUHA 3W8DA 4WPGA 5L9AA 1DIBA 3MJTA 4EUFA 3DZHA 3T7EA 2X9VA 3TSCA 5T57A 1ZK4A 3HJAA 1P74A 1OZAA 3IAHA 4E4YA 1M75A 1QYDA 5CEFA 1LQTA 4OJNA 1Y6JA 2B69A 4A27A 4NFSA 3KM0A 3OSUA 3Q3CA 2EP7A 1LSUA 4UVIA 4S1VA 4LISA 4YQZA 3OETA 4ND4A 3QVXA 5GZ1A 3JQ8B 4JK3A 4FJ1A 3ORFA 5G0WA 4FJ2A 4AJ4A 1PGPA 4J7CA 5K9ZA 2I3GA 2JD0A 1XYGA 3NT2A 4P38A 2BFOA 3X2FA 3MCVA 1ADCA 5TIIA 2FMUA 1YKFA 1FDTA 3A06A 3L9WA 2H63A 4E2YA 4BNNA 4PZEA 3WYBA 1XGKA 1WWKA 3F4LA 4Z9FA 1LQUA 3DTTA 3LF1A 3SBOA 4KUGA 3P5SA 4CUJA 3PHGA 3L9XA 2J6IA 3WTBA 2D3TA 1MC5A 4L8VA 4IDFA 1NQTA 1JAYA 2JCYA 5DCUA 1ENZA 4BO8A 1N5DA 1W0CA 4BKQA 5KVCA 1GQYA 1NXQA 4RF5A 3WGTA 4O1MA 2AQ8A 2Y1CA 4J1SA 2PWZA 4YVFA 4WCFA 1EUDA 1AE1A 2NVWA 1XEAA 3ONEA 4N5MA 3F4BA 1PJTA 3OMLA 4KQXA 2DT5A 3KXDA 2CDBA 4E32A 2Y99A 4TMFA 2GR9A 1BW9B 3NT4A 1P77A 1I3LA 3FCOA 3GQVA 2X8LA 5EMHA 4MKRA 3I4FA 5KTKA 2J8ZA 4HNGA 5C3MA 3C85A 3LC2O 1XIVA 4MVJD 3ZU3A 1SOWA 1LDGA 2JCXA 2B0JA 1A4UA 4YJHA 2OBNA 1P33A 3WIEA 3JSAA 5DF1A 1ZUD1 1GV1A 3KLPX 4HKTA 1VJTA 1C0IA 4YT2A 5BR7A 1CERA 3JCZA 1J5PA 3GGGA 4XD2A 5HBRA 4YAKA 3OEYA 1X0VA 5H82A 2D2IA 1BVUA 3OFSA 2ZKLA 4TRNA 3RUCA 3GT0A 4YWJA 4XWYA 2R00A 5FI5A 4RVFA 3KV3O 4ZRNA 2D1YA 3HSKA 2D59A 2VWQA 1Y8QB 5JY1A 4NI5A 4E5KA 4AJ2A 3NDIA 3COSA 5DULA 5L95A 1ZMOA 1LUAA 4PZDA 1KOLA 2VCYA 4FFPA 4GLOA 1HDYA 2V6MA 3FHLA 1O5IA 3B1KA 4K26A 3P2OA 1E1MA 1PX0A 3PHHA 2DPGA 3EDMA 3PWKA 1YGYA 4OYRA 5CEEA 4TROA 4IMRA 1RM5A 1X0XA 3GAFA 1X7DA 3RUEA 4RDHA 4RLSA 3W8EA 2YQ5A 1JQBA 1YB1A 3PLNA 4ZRMA 2PFGA 3C3XA 4XYLA 1Y8RA 1PJQA 4Y6SA 3WGOA 4CLDA 4GGOA 4EJMA 1B26A 2J3HA 1XR3A 3RAJA 4B7UA 1VL6A 3RIHA 1NFRA 4EGFA 1SB9A 2YHIA 1U2GA 3JYOA 3PWSA 3GHYA 3QA9A 5LDGA 1GYQA 4YAIA 3BMOB 4CL3A 3WICA 4BVAA 4BKOA 1JVSA 1R6DA 4DC0A 3IDSA 1I24A 3O03A 4XGIA 1UP7A 2WMDA 3D64A 2Q2QA 1P1JA 5HS6A 1HE4A 4TZTA 4E0BA 3RUAA 4E2WA 5L40A 5IXYA 4XR4A 1ZEJA 3TL3A 2DM6A 5DBIA 1N2SA 1LX6A 1ZNQO 2QRKA 2WE7A 4PCVA 3UOGA 4FJ0A 5A5FA 4CM7A 3HB5X 1IYZA 1PWZA 1KC3A 3HDQA 3QSGA 4TZKA 1HDZA 1U5AA 4WNCA 2YY7A 4IDEA 3IC5A 3CPSA 4CPDA 4P4NA 3JYPA 3H6KA 4RVGA 5A3VA 2QRLA 4MO2A 1KEWA 4CMIA 4LRSB 4UEJA 3TZ6A 4J9UE 1CF2O 1GFSA 3KYDA 3ZV4A 1N1GA 3RUFA 3JQAD 1PQWA 2UV8A 2NVUA 3DBHA 4PN3A 1W6UA 1TVEA 3MJVA 4FBGA 1AHIA 1FK8A 1N9GA 1R4NA 1VSVA 3D0OA 1PJCA 1R66A 4J7UA 4E33A 2O48X 1B3BA 3TF5A 1ZSNA 4QUKA 1M66A 4CLOA 3I9MA 3H7AA 2CF5A 4ZQBA 2DBRA 4IIUA 5JBIA 1E3EA 1IOLA 3EAGA 2OUIA 3WBFA 3SC4A 3LC7O 4E3ZA 4GLLA 4L0QA 1ORRA 2P2SA 5AOVA 1EQ2A 2Z1NA 2IE0A 1I2CA 1E7SA 3DEYX 1ZXBA 2EHDA 2EKQA 3I83A 3ZU5A 1ZK3A 4EITA 3HZZA 1I2BA 2VTDA 1EVYA 3AM3A 2UVDA 4J7XA 4L76A 4DREA 5B37A 5F21A 4C7JA 4EYEA 4L4XA 4M54A 2BI7A 2IEBA 1E6UA 2HK9A 3PWZA 2PGJA 2FWMX 1AN9A 3G1TA 3TZHA 4WK6A 3WJAA 1E92A 1EQUA 1BDBA 2P5YA 3ENNA 4OQYA 5CPFA 1NQOA 4PLFA 4MINA 3GDFA 4GGPA 4RQUA 1PJLA 5ICMA 1U9JA 1UAGA 4K1LA 3ZW9A 4J4BA 4AJIA 1SCUA 1YBMA 2X0RA 3FPLA 4CR6A 1R15A 5DZSA 4R9SA 1YL5A 4BMVA 3SJ7A 5CAEA 2I65A 1QKIA 2X5JO 4JCOA 1TLTA 3LK7A 2GLXA 2B4TO 3ULKA 3WB9A 1BXZA 4UUPA 4IY1A 3V1YA 3UVEA 4HP8A 4B3HA 4RV9A 4XQEA 4F6LA 3U4IA 1EMDA 1ONOA 5K0ZA 3DAFA 3NV9A 2ZCUA 4AJKA 3UF0A 4TQGA 3VAZA 4OXNA 4WNIA 3LZ6A 3H9JA 1RM4A 1DIHA 2JD2A 2ET6A 2CY0A 3PTZA 2TMGA 1XCBA 4FOSA 1B14A 1DJNA 4LW8A 4XQGA 1T4DA 4XGKA 3CKYA 4DRYA 1DC3A 2ZB4A 4GWKA 9LDBA 3CTMA 5HRUA 1LSSA 1VM6A 3GUCA 4II2A 1YWGO 1LRLA 1B8UA 1BTOA 1FDSA 4L75A 1PEDA 1P9LA 3B6ZA 3AW9A 3JQ6A 3JQCA 3ZI0A 2PH5A 9LDTA 1YO6A 3ON5A 4WOKA 3ZWOA 1N1EA 1F8GA 3ZWBA 2X0JA 4MP6A 3V2GA 4Q3DA 1DHTA 1YL6A 4I9NA 3S2IA 2ZATA 2DKNA 5KJFA 1YOVB 4GWGA 1T1SA 2CNBA 2NLOA 3QWFA 4BNYA 1LLCA 2HK7A 2IYPA 3C1TA 1E0DA 4HFMA 3UW3A 3E5RA 1YONA 2EW2A 4YJFB 1E3WA 3OIGA 4AFNA 1DRVA 4L73A 2HRZA 2FZEA 3GNQA 3EVTA 1RKXA 2P9GA 3DZKA 4DYDA 1XLTA 2GN4A 2ZB7A 5IZ4A 1DBVO 1QYVA 1X15A 4XEHA 3NUGA 3GN1A 5TS3A 2O4CA 5KVQA 1XDWA 5I7FA 3DZJA 4BMSA 2PA3A 4A73A 1D1TA 3PIDA 1DC5A 1BXGA 4C4OA 1H6CA 4RPGA 1P1FA 1YL7A 1U3UA 2Q1TA 4F3YA 1ZK0A 1ZXLA 4CQMB 4EJ0A 1E7QA 2Q2VA 2O4UX 5A06A 1DXYA 1PZHA 3W6UA 2FSVA 3Q6IA 3NKLA 4GVXA 3WGGA 5C5IA 4D0SA 3ZV6A 2P5UA 3GRPA 4JBGA 3PYXA 3U0BA 5IN4A 3T4XA 5JDIC 3GEGA 3SX2A 1T26A 2NU7A 4NMHA 4OXKA 3UCEA 5G0TA 3ROPA 3GF4A 4CLRA 2P91A 5JCJD 2FSSA 1U7TA 4GH5A 4MKXA 1YBAA 2LDXA 2YV2A 4YQYA 4YAEA 3G3EA 3O8QB 3V5NA 4OMUA 3D4OA 1FDVA 2ZYGA 3GVCA 1AXEA 5CFZA 3QIVA 4MVJP 4LK3A 1B8VA 2BLLA 3DXFA 1L1FA 3ROQA 4XIJA 3W4KA 4ZQGA 4AJPA 1K2WA 4I8XA 2VHXA 1GR0A 3LF2A 3PHJA 2PD6A 5JAIA 4PLVA 4EUEA 1PIWA 3NDJA 3LQFA 2FPIA 2JJYA 4ZQHA 2GN9A 1WZEA 3AY3A 4DPLA 1UP6A 5G2OA 2DAPA 3D5QA 3PQFA 1M76A 5COQA 4K6FA 1ZJYA 4MVJF 4ALNA 3DHEA 3WLEA 4ALLA 2AW5A 3H8VA 5IN5A 4FGSA 4D79A 2X6TA 3HHPA 4DLAA 4BO5A 1LRJA 1WXDA 4CV3A 1ID1A 5FWNA 3VVBA 3S55A 2GASA 4KZPA 5JXWA 5FFFA 2HMWA 3TZCA 1XU7A 1LBEA 4FFLA 1B0AA 4PG8A 2CDAA 2BGMA 2W90A 3PQEA 4OSPA 3DZBA 3QJ5A 2W2KB 1E1NA 3GMDA 4HFJA 3JQ7B 4A26A 1HDOA 1T24A 2CUKA 3H3JA 4A03A 5CDGA 3ZWNA 2GCGA 4FW8A 5ER6A 4Z0TA 2GYYA 1KETA 1NYTA 4AG3A 3EK2A 2AEFA 4J16A 4BGVA 4LVCA 2WWRA 2P4HX 1GDHA 1H9AA 5IJZA 4IS3A 4WLVA 3K30A 3GGPA 2X7HA 1DFHA 1SEVA 2RBEA 2WM3A 8LDHA 1ISIA 1QYXA 1IL0A 4FPXA 2DUWA 1E7WA 4DIOA 3DBVO 3BAZA 2EKPA 4FFMA 1SO8A 1PZEA 4OAQA 2GNAA 1DRWA 3JYNA 5B4VA 3NEPX 4AJEA 3LVFO 1UZMA 1CQJA 3AOGA 3D3EA 1TT5A 1MA0A 1I3KA 2VZ9A 4M87A 1K3TA 4OIMA 1KBZA 2PKQO 2HMTA 1MX3A 4FGWA 1KEUA 1F06A 2Q46A 3MOIA 4NK4A 4RZIA 3I6QA 5KKCA 1GPJA 3AI1A 4WEQA 1D8AA 1WAMA 4OOFA 4J9VA 2QYSA 5ILGA 3N7UA 1RJWA 5F1KA 3D5TA 3GVHA 3F47A 3LYLA 1EDZA 3DZFA 1R37A 1DHRA 3ZDFA 1UP4A 2ZQZA 5AXCA 3M2PA 4I9UA 4BL5A 4EBFA 4R41A 3UN1A 1Q7CA 5BQFA 2X1HA 2HK8A 5MDHA 3ZWMA 3B20A 3DBRB 1PJ3A 5CDSA 4HX5A 4RVUA 1S7CA 4U7WA 3WXBA 5B4TA 4IUYA 4Z6KA 1HSZA 3AWDA 3H9QA 1HDGO 1H5QA 3O9ZA 5T67A 2IXBA 1RPNA 1O0SA 4MDHA 3UICA 3WS7A 5L4NA 4PG4A 4PVDA 3MJ4A 4AJJA 3V1TC 2Q4EA 2G1UA 1KC1A 5IF3A 4BNWA 3RVDA 3FR7A 2TMDA 2QQ5A 4UAGA 1RYEA 4WCFB 1VJ0A 2AQIA 4R16A 1U4OA 1VC2A 3K92A 3MEQA 3FD8A 1MXHA 4CR8A 1BSVA 1SBYA 2X0NA 2OP1A 4P8RA 4XR9A 4Y6PA 1V3UA 4WLOA 2Z5LA 3RBVA 1YQXA 3CE6A 4OL9A 3LC1O 2VHVA 2UUOA 5A04A 1ZFNA 3NDRA 3VPFA 4D0RA 5CDUA 4TVOA 1W8DA 1Z74A 1DB3A 2HO5A 5TT1A 1TB4A 5DNAA 3WBBA 4IQ8A 4O59O 3WGYA 1P1RA 3U4DA 1C1XB 1LXCA 3CH6A 4DIFA 2YW9A 3BHIA 4NG5A 1Q7GA 2XPCA 1ARZA 4R3WA 2Y67A 1UXKA 5A9TA 2XOXA 3EGOA 3KSZO 4FR5A 3TWOA 4BO1A 2OXIA 5ILOA 3R3SA 4NU6A 8ADHA 2Y68A 4XB1A 5MGBA 1WNTA 5IG2A 2YFQA 5TGDA 3QWIA 4EJ6A 1PZGA 1YDWA 1ISMA 2G82A 3BTVA 3OF2A 4Q3BA 3PGJA 3WDSA 4CM9D 2C7VA 1R4MB 3IIEA 5CDYA 2ILTA 3A4VA 4ALKA 3ZZNA 2A92A 1IE3A 4PRKA 1VL8A 3WQSB 3RC1A 3RBZA 4BNKA 4DLLA 2R00C 3PHLA 4MVJI 1LSJA 2YQ4A 2ZCVA 5KNLA 1MV8A 2BRUA 3AOEC 1F8FA 2P9EA 3W6ZA 2EEZA 4R5MA 2O3UA 1UZLA 1SAYA 1FJHA 4CM3A 4B7CA 1NP3A 5LDHA 4Q39A 2GN8A 2JD1A 4RGBA 1NPTO 3CMMA 1WP4A 1G6KA 4XZ3A 4Y67A 4CLHA 3GNSA 1DPGA 3DZIA 2X0IA 2E37A 3ZNNA 3NTQA 4JJIA 4U5QA 5TJ9A 1U5CA 2C82A 3W8FA 5KCZA 2AHRA 3P19A 2VTEA 5DOZA 4J4HA 1ZMTA 3FPCA 3VPSA 2GRAA 2YHIB 5CDTA 1K89A 1DIAA 5B1YA 1HDRA 1B8PA 4I9HA 3BMOA 1T2EA 4FIZA 2ZJ1A 4DIBA 3FN4A 4PLPA 3BHJA 3BMNA 1R0LA 4RORA 2G5CA 5L51A 4GX2A 4IMPA 2H6EA 4OGWA 2WD7A 5JLAA 2H1SA 4BHTA 2D0IA 1H0KA 4NNJA 3SEFA 2PD4A 3KYCA 3BMQB 2WTBA 5TQVA 1E1KA 3K8ZA 4QT0A 1EEHA 5C7IO 3DOCA 3D4NA 3AFNA 5ES3A 1A72A 1ZZEA 2NNLD 3ROMA 3CINA 3TFQA 3BTSA 3ADOA 1X7HA 1J4AA 2WYUA 4E5NA 3MJSA 1QRRA 4J4TA 3GEDA 2RIRA 3NGLA 1MFZA 2WDZA 3B1FA 2ZK7A 3CIFA 4RF4A 3TNLA 2AEMA 4NBVA 4LCJA 1OC2A 3HN2A 3ADPA 2HQ1A 4PRLA 2V6FA 1SB8A 1PR9A 2PZJA 4W9NC 2O2SA 3KYDB 1E3WB 4ZVVA 3IL2A 1FMCA 1GPDG 1Y9EA 2NVUB 3WR5A 1IHXA 4YT4A 3RROA 4JJGA 4A0SA 4RO0A 2OBYA 4EW6A 4W99A 3P2YA 4XRRA 1ENPA 3PQDA 1UZNA 2NQTA 4MVJH 4E2ZA 4RL6A 1BMDA 2V6GA 5HTOA 2VT3A 4WJZA 4RJTA 2PKRA 2W2KA 1XU9A 4JROA 4IDBA 1PJ2A 3GLQA 4XYMA 1BXGB 2JHFA 2OOSA 3NTRA 4XKJA 1LDMA 1GY8A 3VVCA 3C7DB 3JQFA 2BI8A 4O0LA 4HFNA 4NDNE 3H2SA 4BMNA 3RSHA 3KSUA 3QLJA 2OZPA 4NBTA 1DAOA 2E48A 2UUPA 1Q0QA 2CVZA 2POQX 3DB2A 3JV7A 3TQHA 4OSOA 3AU9A 1HZZA 3BTUA 1PR3A 2FP4A 4BNVA 1IZ9A 2QW8A 1HEUA 5CG1A 1KVUA 5JC8A 3K5PA 4PLCA 1BXKA 2WJPA 3ZWPA 4W9NA 2FZWA 2B5VA 4YJHB 3A1NA 4C7KA 3EVNA 3VH4A 2C5EA 4B7XA 2V7PA 3QWBA 3QY9A 2HMVA 3TN7A 3KO8A 4E31A 3JQAA 5ADHA 5KVSA 4CM4B 3W4JA 2EP5A 4UUOA 1W4ZA 4J2OA 2VQ3A 2YJZA 3DL2A 3EHEA 1ZIDA 4BS9A 5EINA 4I5GA 1PJ4A 1GL3A 1R0SA 5CPBA 1O95A 4YPOA 2VNAA 4D3FA 4ONEA 2ZB8A 3ONDA 1EE9A 2GO1A 2NV6A 3T7CA 4F45A 3ASVA 4CV1A 2DBVO 3G79A 2HU2A 3ASUA 4YT5A 2QYTA 4CMJA 1V3VA 4Q9NA 4GPD1 4NH4A 4GBJA 3ZHZA 2EWMA 4NFHA 1YJQA 2ZB3A 2W8ZA 4OM8A 1DLIA 3OQBA 1KERA 3ZNQA 1H2BA 4RDIA 3VDRA 1NFQA 5TRTA 2Y1OA 4QO8A 2VYVD 3VTZA 4EEXA 3GFBA 3JD0A 3PZRA 3HN7A 4BO3A 1CJCA 4IDDA 1M67A 1G0NA 4XJTA 2WYVA 2OGUA 3QRWA 2B83A 2E82A 4G5HA 3DC2A 1LLDA 3JQAB 3FSRA 1MLDA 4FFRA 5AXDA 1KY4A 2Q1SA 2GF2A 2GERA 5COAA 2FR8A 3E8XA 1B7GO 1NHWA 3AOEA 3AUTA 3JD4A 4TKMA 4EDFA 4NR0A 4D46A 3IJPA 1C0PA 4NU5A 4B79A 3LT0A 3UH1A 1KEVA 4X54A 3C8MA 5F5NA 3IS3A 1MG0A 4BO7A 1WLYA 4TSKA 3HDYA 2DVMA 5JDCC 4BO6A 2GZ2A 2X23A 3AY6A 4KOAA 4CV0A 1O9BA 2CMDA 2WEKA 2F1KA 5G0UA 3LT1A 1YVEI 4BGUA 1EFLA 4NIMA 2DFVA 3CMCO 1IZ0A 4KTTE 1EDOA 3GHHA 2O23A 4AJOA 4LVUA 1V9LA 2O3QA 3U09A 4GX5A 5A03A 1HE5A 2OO5A 2B35A 2EW8A 3FRJA 4W82A 3EY4A 2VYVA 4NPCA 4BNIA 1GCUA 4ID9A 3PYLA 5U4QA 4YACA 1E3JA 2I6TA 3PFWO 2VOEA 1E5LA 2DFDA 3QVOA 2NM0A 4FSHA 4CM8A 2EXXA 3ST7A 2DQ4A 1KVSA 4TRMA 2OFPA 3GPDG 4M55A 3EMKA 4WKGA 5TJHA 3SVTA 4KWIA 3L4SO 2Z1MA 3RQSA 1Z82A 2O7QA 3WX0A 4CLOB 2Q50A 2YFHA 4K9DA 4NHEA 3RC2A 3WG9A 1CQIA 4XIYA 1DO8A 2G76A 3FR8A 4RF2A 3E1KA 2YV1A 4DWVA 4TWRA 4N7RA 2YV3A 4BV8A 3L6EA 1LEHA 1PL7A 1PZFA 1U8XX 1T2DA 3M1AA 4LGVA 3HUDA 3OQ6A 5DOVA 4NBUA 3WLFA 2P68A 5F5LA 1MUUA 1NFFA 3OHSX 4YT8A 1HWYA 1JU9A 3OEWA 1OOEA 4XA8A 5I9NA 1LC3A 2FN7A 2O50A 2Y1GA 3S2GA 1EE2A 1XHLA 3LDHA 4P22A 3TZQA 3PIIA 3DMTA 4YJGA 1J49A 2YHUA 2EG9A 3PJEA 5CP8A 4BUCA 3TL2A 5L4LA 1JW9B 3KHUA 2D8AA 1ZVMA 1QP8A 4H16A 5IDXA 3ABIA 4RPKA 3DMYA 1BVRA 3UCFA 4CJXA 4FN4A 2Y05A 1PJSA 4UVDA 1ISFA 1NM5A 4OO3A 4W7IA 4M86A 3WGQA 1FXSA 4IQGA 2AQHA 3ZGYA 4WASA 4D43A 5JYDA 4DGSA 2CZCA 4R51A 3GVPA 2X58A 4EEZA 3H9GA 4URFA 5B4UA 2VWGA 2O3SA 3FI9A 3SLGA 3M2TA 4OXYA 4W4TA 2JFFA 1DAPA 4FQ8A 1W73A 3JQ9A 1JTVA 3ZU2A 2PZLA 1A5ZA 3E6AA 1P45A 2X5KO 4Z3KA 4GSKA 2ZJ0A 3I6IA 2YDXA 3GOHA 3IP3A 4ND5A 3UHAA 5BNFA 3B70A 1NTOA 4OOEA 2C7GA 4Y98A 4ZQFA 1PGOA 4MVJM 4AICA 4CMKA 4CMBA 2OMEA 3DAGA 1LTHR 3PYMA 2HMUA 1B2LA 4YXFA 3FNEA 3VPHA 5G4KB 1GUFA 2X9GA 1WMBA 4M89A 4YTEA 4BGIA 4QTZA 1E3LA 2GUGA 1I36A 2HSDA 2Y93A 3F5QA 4A7PA 4E5PA 2PTGA 1HF3A 3EUWA 1GZ6A 3EZLA 3I9NA 4BKUA 3KVOA 1NPYA 3INRA 3K6JA 5IAAA 4JBIA 1PL6A 4B8ZA 6ADHA 1A4IA 5KJCA 2BGLA 1EZ4A 3GUYA 3JQDA 5EQDA 2OL4A 5A1TA 3WFJA 1K6JA 5L53A 4CLEA 2D4AA 1PQPA 4BNHA 4AJNA 2OHXA 2UDPA 2GD1O 5AQ1A 3RCBA 1CEQA 1E77A 1H9BA 3BTOA 1UAYA 3PRJA 5EQFA 4DA9A 3D1LA 4AJHA 3IQDB 1Y9AA 4G81A 4GQAA 2ZTVA 4QXMA 1IUKA 3WQQA 4E30A 5JMWA 3WGZA 1FDUA 3D7LA 4J90A 3JTMA 2IYOA 1DIRA 5EN4A 1GEEA 4UUMA 1ADGA 1U8FO 1E7YA 1NWHA 2AEJA 2DLDA 4PLHA 2XXJA 1MFPA 1DEHA 3JQ9C 2X4GA 4ROSA 1B16A 4RCVA 2W2LA 3GFGA 4GKVA 5JS6A 4Q3CA 4AJLA 1PWXA 2XXBA 2I3AA 1N8KA 5T8KC 2E49A 3Q0EA 3NJ4A 2EV9A 3TJRA 2JHGA 1RWBA 3WSVA 4JQCA 2BFPA 4B4WA 4CMGA 1IPFA 2QIOA 1VE9A 3C1AA 1PL8A 1PU2A 3JQBA 1QV7A 1TI7A 5DDIP 1M2WA 1ONNA 4ND2A 2DUUA 1GZ3A 3VZQA 4PIVA 4CUZA 3K2EA 5JC1A 1M6WA 1PS0A 2EJVA 3OP4A 3FNFA 2A35A 1KIFA 4Y9DA 2JKVA 1QMGA 3QHAA 1NAHA 2H5LA 4TVBA 2OORA 3U4CA 4ALMA 1YQGA 1E3IA 1NR7A 3KLMX 2CVQA 2QZZA 4KMSA 4LSMA 4Y6RA 4BO0A 1C1DA 1LDEA 2WSBA 4ND1A 3AUUA 1LDYA 3UXYA 1ENYA 2W4QA 3VPGA 1LSOA 1Z7EA 4CR7A 1JWAB 2HUNA 5DBGA 4LSWA 3VKVA 4D44A 4PGFA 4JLWA 1CRWG 3GZNA 2X86A 4B4OA 3WGIA 1RM3A 1T4BA 2EGHA 1P0FA 1TT5B 4Y8VA 3ITDA 4OHUA 4DQXA 1YS4A 2WE8A 3OM9A 4UVHA 1YE3A 1P1HA 3VDQA 4LRTB 5TC4A 5A9SA 2VZ8A 2NADA 5B12A 5KOIA 3HADA 3MJEA 3NAQA 1Q7BA 2O2YA 3IOYA 4RF3A 3GC6A 2WD8A 4AVYA 5IDQA 1XSEA 5U9CA 6LDHA 2AE2A 3C1OA 4WGGA 3GA0A 3R3JA 1Q1NA 3WQRA 5DP2A 2P9CA 1GQ2A 3ZU4A 5DP1A 3WNQA 1YRLA 1O94A 3V8BA 2AG5A 3E5MA 3IJRA 4IPTA 5DT9A 1UXJA 3ZWYA 1E7MA 3TPCA 1F0YA 4XRGA 2DTXA 3PJGA 4IBOA 4BNFA 3PDUA 1P3DA 3ZHYA 4ESOA 3KETA 4FC7A 4RZHA 3ZN2A 1NWCA 1K5HA 1WMAA 1ZJZA 5DBFA 3WOHA 4E13A 5HA5A 1XELA 1CIVA 4NQZA 4PLGA 4IJVA 4O63O 4FCCA 3UAGA 1UDAA 2VYND 2GN6A 4U0KA 5HWSA 1DC4A 2B4QA 1GUYA 2FR1A 3ANLA 2NACA 4GAEA 4XYGA 2VRCA 1BWSA 3F5SA 4G65A 3PDJA 3LLVA 1LJ8A 1Z7BA 2HCTA 2R6JA 2PNFA 4NZ9A 4XYEA 5IXSA 5A3JA 3WWZA 3ETEA 4CQLA 3E9MA 2Y0EA 1QG6A 1DIGA 3DONA 3Q2KA 1I32A 1RM0A 4J1QA 4E12A 2D5CA 4K28A 4E5YA 3WFIA 5L7TA 3UKOA 4DVJA 2ZIZA 2EIHA 4JNKA 3B1JA 3UUWA 5GZ3A 1EBUA 3DFUA 3ONFA 4BQPA 2IRWA 3Q9NA 4GX0A 3LLSA 4I08A 4RVHA 1QYWA 4TRJA 1I01A 1GV0A 4FS3A 3QVTA 3WJ7A 2PD3A 3WNVA 3IUSA 1SPXA 3F6YA 4I1IA 3C7AA 2JCVA 4XQ9A 5BSFA 1DSSG 3OIFA 2BELA 1T2FA 1ML3A 4E6PA 4R4JA 3PPIA 3O4RA 1VLLA 2HKIA 4Z3DA 4BNXA 3IP1A 1BGVA 3WSWA 5C7OO 5L7WA 1VJ1A 2C20A 2R2GA 3ENKA 5K1SA 3BIOA 1DDOA 1IHYA 2VN8A 1KY5A 2HAEA 4L4SA 4R54A 3Q11A 5KIAA 1K0UA 1PGQA 4KDEA 4I5EA 5K6AC 3HFSA 4HUJA 1D7OA 1E6EA 1C0KA 2HLPA 1Z45A 2HJRA 4HFRA 4S3MA 5LCXA 5CEJA 3NRCA 1SNYA 3T4EA 3JQ8A 2Q4BA 3OQ1A 4J1TA 3RUIA 1ZSVA 1BHSA 4DMLA 1I2ZA 1QORA 3ZV3A 4HWKA 4RQTA 4J0EA 3ZH2A 1F17A 2NSDA 3JQFC 1HXHA 4IZIA 2QG4A 2RH8A 3F1LA 3OIDA 2RH4A 3DHNA 4J0FA 4D3DA 4BNLA 3CEAA 4U0JA 4DL9A 4FFNA 1K6IA 3KEQA 3PZBA 5EL0A 2HRBA 1U2DA 4XQCA 3S8MA 3BYZA 1E6WA 1J0XO 2VWPA 3O38A 1H6DA 1SEPA 3AFMA 3R6DA 1T2AA 2YUTA 4JBHA 4ZHSA 1TA4A 4IDGA 2GZ1A 4B4UA 1Y8RB 2CFCA 1KYQA 4PG5A 1CDOA 5JCJA 3CXRA 3PHIA 4GMFA 1I30A 2J3IA 3WIDA 1NVTA 2IZZA 2HJSA 4HNHA 5JPIA 2DBQA 2E6UX 1DRUA 4RVDA 4CQMA 1BRMA 3DR3A 2EGGA 3PGXA 3RFVA 3NTOA 1ULSA 4IM7A 1LDNA 3F46A 4U8GA 1Y5MA 1QLJA 3WTCA 3PEFA 4DQVA 4FOOA 3TFOA 2VNSA 1MC4A 4R1NA 1U7HA 4MP8A 1Q2XA 3VH3A 1EFKA 1NX6A 2I5PO 4QSMA 1E3SA 5F1PA 3GVIA 1ENOA 3E9NA 2AA3A 5EERA 1A7AA 1NHGA 5BNTA 4YBZA 4Z0HO 1TEHA 4HADA 4IGEA 3L4BC 2PZKA 3S2EA 2C54A 3L77A 3QP9A 5AXAA 4BNTA 5I8WA 2Y0CA 4HBGA 2Z95A 3TZKA 2J5RA 1GAEO 2VUSA 4BNZA 3DHYA 3HG7A 2PLAA 2C0CA 3LT2A 3NGXA 1CETA 4WUVA 1HRDA 1S6YA 2DTEA 1C14A 4MPDA 3ITKA 3D3WA 3TOXA 1UXGA 3HB4X 3L0DA 5CHEA 5L7YA 1HL3A 1UDBA 3GG2A 3OA0A 1WZIA 3CUKA 4Z0PA 3ZCXA 4ZJUA 2GSDA 3GDGA 4B8WA 3KYCB 4DBVO 3U5TA 4NK5A 4LMRA 4N5NA 4WLEA 3I9KA 1EK5A 5JE8A 4W7HA 2DTDA 4PG7A 2G0TA 4PLYA 4LN1A 4UVGA 1JKIA 3K2BA 1I3MA 3ICPA 3ZHXA 2X9NA 3FTPA 2FOIA 1A71A 4IJKA 1YB4A 4CM4A 3LSYA 5ICSA 1H2HA 1SOVA 4Q3AA 2I99A 1WVGA 4FC6A 1HYHA 1VPDA 2XF8A 4ALIA 3UFXA 1QR6A 4EI2A 3WYEA 3INGA 3DQPA 1H6BA 1Y81A 3VKUA 4A2CA 1XQ1A 3ZNPA 1T1RA 1UR5A 5JNLA 1IB6A 3E9QA 3VPXA 1AUPA 4ITUA 4L4RA 1ZCJA 1O89A 3GNTA 3MWDB 4UEKA 1U3WA 1U4SA 2C29D 1YXMA 3E82A 1JWBB 4HXYA 5TLSA 3INTA 4WCFC 3FWZA 4XYBA 1DC6A 5JO9A 3RJ5A 2VZ0A 4UULA 1EUCA 1V8BA 3TDKA 4YA6A 2X22A 3LU1A 5JCXA 1I0ZA 2AXQA 5EESA 5TNXA 2BD0A 1DJQA 5IFLA 3QWAA 4FB5A 1I5RA 3MOGA 1ZH8A 4BNUA 3G17A 1DLJA 3HWRA 1A7KA 1PGJA 3GG9A 4GKBA 4JJFA 2PGDA 5FI3A 3ZNOA 3PJDA 2FY8A 4PLTA 2X5OA 1MXFA 1UJMA 2J3KA 1N7GA 3ANNA 1M6HA 5ENVA 3BXXA 1LLUA 4F46A 3WYCA 3BMCA 1YH3A 4XGNA 2IEDA 1X14A 1R4NB 3F3SA 2CD9A 3MWEB 3K96A 4PVCA 5T6BA 1P1IA 3JD2A 3G49A 4OKNA 2A9FA 3DZGA 3GN2A 2C07A 2C5AA 1QLHA 3RKUA 1D1SA 1GD1O 5JW6A 2I66A 3QQPA 2A4KA 2IDZA 3JQEA 3JQGB 3UCXA 3QE3A 5BSEA 5JDIA 4J49A 3RFXA 3TOZA 5I9LA 3QW2A 4KTVE 4XB2A 1GEGA 1XKQA 1GYRA 4MVJG 5JY6A 4IJUA 2HDHA 3D4PA 4BO9A 5JMPA 3HE3A 1NNUA 2NWQA 2CDCA 4DQUA 2XAAA 3I52A 2WYWA 4F6CA 4WE3A 4WLUA 1DOHA 2B36A 4R1UA 2B5WA 2ZTLA 4ALJA 1HZJA 1OFGA 3MJCA 4CM8B 1WDLA 1GUZA 1QYCA 5LC1A 4IDAA 4QFCA 3BMCB 4O6VA 5K6AA 2V65A 3U9LA 1VKOA 2VOJA 3H5AA 5TT0A 4D7AA 4H3VA 4EUHA 1GZ4A 4CLXA 4J3FA 4AJ1A 1UUFA 3QVSA 4TRRA 2GDZA 5CG2A 3AUAA 3Q2IA 4QX6A 4DPMA 3P7MA 2GZ3A 4FFOA 4DMMA 3BA1A 1MG5A 3JQGA 1DFIA 3DO5A 1R0KA 3Q1LA 4JP2A 4CMEA 2PR2A 3OJLA 4R3NA 3RUDA 2JAPA 2BFAA 1A9YA 5BSGA 3ZWVA 3E48A 1QSGA 5JAQA 5L4SA 5G0SA 4YR9A 3MZ0A 4YJGB 3UGKA 4IXTA 1NR1A 1O6ZA 3DDNA 3KRTA 1UH5A 2P4QA 5EJ2A 3FBTA 2IZ0A 3PI7A 4CLRB 5EIOA 2JL1A 1F14A 4M1QA 3VC7A 1ZO8A 2DPHA 1NVGA 5BSHA 3TRIA 1KEPA 1I3NA 2EERA 1VRWA 1ONPA 3FTNA 4RVSA 4XDZA 1YJ8A 2DBZA 3VZRA 3ETDA 4CQLB 4BNMA 1C3VA 1T2CA 2Y0DA 1PS9A 5AXBA 4I5FA 4EZBA 3F9IA 4NFYA 1LLQA 4P4LA 1QXSA 2CVOA 1MB4A 2PY6A 4L9RA 1UXIA 3M6IA 3ZV5A 2C59A 1LI4A 3OJFA 4Q3NA 3U4HA 3E18A 1ZK1A 4BKPA 3I4CA 1SMKA 3EW7A 5DCWA 2VRBA 4B4VA 4A5OA 3FNGA 3OECA 4PFJA 3A14A 3RBXA 3MTGA 3GDOA 3OICA 5BNIA 3I5MA 1P0CA 1PSDA 4BB5A 1N92A 2RCYA 3FNHA 1JDJA 3OJOA 3AJRA 4MIYA 3STHA 2ZTUA 4D45A 3A9WA 3AUSA 3GEMA 1LA2A 4KQWA 4ZGWA 3BMNB 2NU6A 2Q2WA 5A02A 4CM1A 2PKQP 3O26A 3S1LA 2BHLA 3W4IA 4U6QA 1GU7A 4CL8A 4J1NA 3JQ7A 2O3TA 1JKJA 1JAXA 1MP0A 3BMQA 4BGEA 2J5QA 4IJWA 4CMEC 4YRAA 4NJMA 4Z9YA 4AL4A 3AM4A 2EKLA 5J23A 1HDCA 1I8TA 1P31A 2D5AA 4KUEA 3QWHA 1D4FA 4BQRA 1ZK2A 4PLZA 2BKAA 1XA0A 1WW8A 4YCAA 3DOJA 4ZA2A 5A9SB 4R5HA 1NAIA 3HDJA 3X2EA 1JVBA 2Y66A 5C7LO 4YRDA 5TX7A 4RLHA 4KDFA 3W1VA 4CM5A 1VSUA 2CF6A 1E5QA 1VKNA 3O8QA 3KSDO 4JXKA 3PP8A 4YJDA 1YQDA 1EBFA 2VWHA 4PZCA 3ICCA 4UREA 4ND3A 4P4GA 1AHHA 1PS8A 1OI7A 1H94A 4IIVA 3Q9UA 4J2HA 5KKAA 3F1KA 4U6SA 3RJ9A 3NX4A 5L3ZA 3RD5A 1AXGA 1PTJA 2BF7A 1KVTA 1ISJA 4FD3A 5A9RA 2YYYA 5G4KA 3DBHB 3VH2A 1U1IA 4R1TA 4J43A 3ZWAA 3AM5A 4XJSA 1BG6A 4XCVA 3AI3A 1R16A 5KJ1A 4NJOA 2B37A 2AMFA 5ITVA 3R0IA 1ZKMA 1WPQA 5T5QA 3I9OA 3NYWA 1HLPA 3E03A 5H83A 2VT2A 3EC7A 1JLLA 1CYDA 2V6BA 1Y5RA 2GPTA 3GZ4A 4JGBA 5IZCC 2FR0A 5T8KA 3KYBA 3PFFA 3FWNA 1C1DB 4DPKA 4BB6A 4MJLA 3RI3A 4BO4A 2JAHA 3AU8A 3PJFA 4INAA 4D41A 2C2YA 4CMCA 2NTNA 2BFMA 4IZHA 4ZQEA 1X13A 2VHZA 4H7PA 4YDRA 1H93A 3KTDA 4JIGA 3KZVA 1WDMA 1XG5A 3VH1A 3DBLA 5F3RA 3HFGA 2W98A 1NVMB 1SZJG 3FBGA 4W6ZA 4R68A 1PJBA 1IULA 2J3JA 4BNJA 4GL4A 3H9UA 4UEOA 3D3WB 5BT9A 4HV4A 3RU7A 3GR6A 3RASA 3KUXA
chains in the Genus database with same CATH superfamily
2Q1WA 3R7BA 3WZLA 2V0GA 1VG0B 4G0WA 1SOMA 1U94A 2FMTA 2IXDA 1DADA 2FPGA 3P27A 4MS3B 4RESA 2SCUA 1SKUA 2AKYA 2GWRA 3CWQA 3V32A 4ZICA 1IK4A 3H5NA 2W2LD 3ZWWA 5KVVA 1HV8A 3AHIA 1UMBB 3IBTA 4PANA 1W2WB 2RCNA 3KWFA 3JRWA 2IX9A 3ACCA 2XF2A 1BJKA 5G4LA 2WWTA 4ZVPA 4JL8A 1D2NA 2I6FA 3I42A 2PO7A 2FCAA 2QL5A 1GIAA 5C34B 3S2FA 2XJ9A 4TKLA 4AUNA 2OHOA 2VUTA 1H4SA 4UU7A 2X8JB 3COVA 1T3HA 1CWUA 1G5HA 1OAOA 1Y8AA 3OJWA 3OVMA 4AECA 1GADO 1VCHA 2PH3A 3A2MA 4LRXA 3WWYA 4BWGA 2OV2A 3B8HA 1ULUA 2RGDA 5CH5A 4CEHA 3THXB 2WINI 5HF5A 5JNRA 1C0LA 3WV4A 1LNQA 4QZVA 4LECA 2I67A 1SQGA 1Y7TA 2H3HA 1AS0A 3K5HA 3KCNA 4EW1A 1RZRD 3VU3A 1ETUA 4Z9AA 5HS4A 1QG4A 2J4CA 1OR8A 1N7HA 2WSSA 4GX1A 4DCMA 2RAFA 2VPIA 2XRFA 1QVZA 4DR3B 3MBKA 1VG1A 1N1MA 4GI2A 3MJHA 4KHPB 5FTNA 1LFAA 1UXHA 2PKWA 2OHFA 3ZHBA 4AS1A 1Y1PA 4TQAA 1S2MA 4AWXA 5ADUS 1V95A 3C7CB 3C8HA 3MMXA 4G07A 1T35A 4URHA 3U3XA 1RZUA 4KR0A 4WBNF 5JIBA 2X2FA 1GZUA 3L4BA 3I3SR 1OROA 3EASA 3ORSA 1NP7A 3PNVA 3ZQKA 1WXGA 2V3VA 3OG9A 3K53A 3ACBA 3ROZA 3IX7A 4NEQA 5AKEA 5DLYA 1OJLA 4GMGA 5FNVA 5ADWA 1P44A 5DHSA 2DH6A 3QENA 4N18A 4ILEA 4CDMA 4DC1A 3RDPA 3HQ4O 1D04A 1JA0A 3OKPA 4WCDA 4FW9A 4QDOA 5BY2A 1IEVA 4YDSA 1HETA 2B1JA 4OH1A 2GZRA 1LZLA 1JMVA 1W44A 1L5SA 5IDWA 4Q15A 1A8SA 1R6AA 2C1EA 2BFFB 1CUBA 3AF3A 3NJ8A 3RLIA 2AXNA 2YDYA 1FFXA 4RTPA 1DBWA 1R6TA 4KRGA 1E8DA 4C9BA 4G0ZA 1NJSA 1AK2A 2FHSA 4G2NA 3ZWCA 3IT3A 1K4KA 4LRWA 1BKYA 1NBME 3FWHA 4MVJA 5I7SA 3T3PB 2TSYB 3LQKA 3PK0A 4AJ9A 1A8HA 1BDIA 4ZD6A 4UCQA 1IBRA 3TLEA 1W5FA 3AVYA 1H2EA 3RC7A 3FF4A 3PQ5A 4PBSA 4H6XA 4W63A 1JALA 1TW3A 6ABPA 4O5OA 1LJLA 3RYIA 1LTQA 2R47A 1A2QA 1TCVA 1JTEA 3Q3HA 1D2EA 2QROA 3M6XA 4LBYA 3S27A 3VSCA 5DN6D 3UWMA 4BQNA 1HLGA 1VIMA 1GLGA 1XRSB 3ETLA 3ILSA 5AKLA 5SYAA 1TKCA 4L28A 5TF4A 3SXPA 1MMFB 3T54A 3IVCA 3KPWA 4LNUB 2XDQB 2QT9A 2YL2A 1E2LA 3ROGA 3CSDA 3SS9X 1RYYA 4EHLA 1N0HA 3CKMA 3WXMA 4XDYA 1HE8B 3AUYA 4PLWA 4QEDA 2QM0A 4F9GA 2FEAA 1DWQA 2BGTA 1DQZA 2QVCA 2GO7A 3DMTC 3E4CA 3KP1A 4MCHA 3T4UA 3TQSA 2NNWB 4CQMD 2PYZA 4H08A 1Y5LA 5E4TA 1JSRA 4NESA 4EOGA 2BDUA 1Y1KE 2BBTA 2B4KA 2Q99A 3PVSA 1Z4KA 5C31A 1FEZA 1I4OA 3PVZA 4BZPA 3AB3A 4IHJF 2NU9A 4G4SP 4HS4A 3SCZA 4B44A 5CVEA 1I3OA 3QHQA 1VMIA 3LOQA 1Q3KA 2A9JA 4Q9DA 2NUAA 5EGNA 3GPLA 1GPMA 1D2CA 3G2QA 5IANA 3KLOA 2VPQA 3RHZA 1AKQA 1Y4AE 5BR8B 4G0QA 1SUWA 4DA8A 1QQ6A 1FSGA 2Y1DA 1NBEA 3D59A 2IODA 3PKZA 4I2VA 3UPUA 1TUIA 4O2LA 2O2CA 5AW7A 5I4BA 3FY4A 2QRZA 3GLHE 3QKRB 2IPXA 3A9RA 4WKCA 2AQKA 2X3YA 3VISA 1ZGJA 1KDTA 4Y1EA 3WI7A 1DBQA 1U90A 2D2FA 2EKDA 1G3MA 2GEUA 2R8YA 1YB5A 1OX4B 2VT7A 3G9TA 4LI0A 5H9WA 1YMQA 4FT2A 4YUYA 5IVPA 1YCDA 3QSYA 1ISHA 1NDQA 1ZRSA 2IKQA 3CZRA 3FPJA 1DTSA 5FUYA 1SCNE 2W2OA 3IV7A 5ARDA 3IMFA 2JGDA 4X24A 3W9YA 5JSYA 2IYWA 3SLKA 4MIOA 4TWIA 2CBGA 3LYUA 4Q48A 1NW7A 3RC8A 2J85A 3I23A 4PWYA 1MIOA 1NBOA 4BO2A 3LHDA 2C96A 2JFZA 5HM8A 3WWEA 2HR1A 2ZRBA 4UUNA 3I32A 4QOHA 5J2TA 1J1UA 3IAFA 3SQLA 1A9ZA 4BDSA 5EWJA 3UOWA 3BKWA 3GY0A 5FWXA 4B3JA 3RUHA 1G6HA 3H5WA 3QV1A 3TQRA 4I0WB 2QTAA 3MCZA 1T36A 4X5OA 4NMWA 3A7DA 1ML4A 4Q4AB 5K3BA 3U7IA 5I7VA 3IAS1 2VDMB 5KWEA 3LVBA 1LI5A 1UKZA 1T6ZA 2HPHA 2EF1A 4PG6A 2Q5HA 1NPDA 4EDHA 1UMDB 3H65A 3VOAA 1X8XA 1J9ZA 1GVNB 4KO4S 1RYDA 2P35A 1TM3E 2HA5A 1T9KA 4LCEA 2RGXA 1Y8ZA 1UPXA 4BTLA 4QFBA 2AYYA 1IY8A 1FS6A 3AR2A 3QVJA 4A0RA 2GHRA 5JFOA 3F0TA 1QH1A 3DWFA 2ZW9A 2BBOA 3EEFA 3IQEA 3KKNA 4Z9XA 4AROA 5KYWB 2O7SA 2MSWA 2W6MA 3Q5DA 4KG7A 2D3WA 2G9RA 5L7TA 2B4RO 4R8VA 3QMVA 4XE5A 2P3OA 3KFLA 4UFPA 5JSZB 1OMOA 1PGNA 1OV6A 2P0EA 1RXWA 4OLBA 4NBRA 4NJMB 2BFEA 1QTIA 3FGPA 4OQXA 2JGJA 4NZYA 1G18A 3RSSA 5K45A 3OWOA 2RGEA 3OPQA 5IAKA 1VDZA 3SC6A 2P6PA 4MVJE 1SJ9A 4MGYR 1YBHA 4BE7B 4HLUC 4MW9A 4I19A 1J0CA 1AGNA 1YVDA 2WWGA 2AH5A 4FINA 4IWXA 2I55A 5E2BA 3BSFA 4IXWA 2I29A 3D8HA 1N0IA 2EJBA 2FPMA 3B2QA 3ZQ4A 3T1YB 3VZSA 2VNHA 1MIHA 4XD7A 1DWUA 2JFVA 1KK1A 2A14A 4YN3A 5LZ8A 2P0AA 3MYRA 2PBLA 5DB4A 1HLDA 1OIVA 3OQIB 4M0CA 1L8OA 3VJLA 4R6WA 3JYQA 2CFTA 1Z0ZA 3PLAE 2NVBA 1T91A 3HS3A 5IABA 2V7TA 3INNA 5K0JA 1XA4A 2I91A 2FEKA 2ATCA 3FHJA 2P9HA 1U0SY 3GLFA 1JIXA 4KP7A 1G1AA 3KE9A 2GBGA 5DHQA 5GZ6A 1E1LA 4NCXA 4DSOA 1GYPA 3U44B 1Z73A 1TEZA 1FP2A 3S6JA 3BZUA 5AP9A 1R12A 4Z51A 4E70A 1USWA 3QXHA 1M6VA 3V2HA 2ZBPA 4R0MA 2XVXA 1MABB 3ZWXA 3H5RA 1JLMA 1X7ZB 2GBIA 3ZGZA 2FLVA 3TB6A 3IBYA 3HU1A 1XD8A 2GAFA 3ZDEA 4D8UA 1Y6QA 2UYOA 2CFSA 2Q4RA 5KYGA 4JGGA 1CTQA 4A0QA 1L7RA 2IXAA 6PFKA 2JLXA 1SKMA 3OOJA 5KTNA 3EIQA 3PFHA 3G0OA 3QV2A 4A82A 2BMVA 1TUBA 2ZSIA 4GOOD 1WDKA 3N7AA 4KUHA 5CXQA 2CLEB 5L9AA 4HRAA 5EIXA 5IYZA 2QN2A 3B2NA 3O8OB 1W6RA 4GOLD 2CHVA 4KQIA 1GFWA 4LUCA 3T7EA 2JFUA 2W6PA 4RW0A 3WLQA 4P2GA 5IVIA 4JOCA 1R3DA 3HJAA 4MB6A 4NFLA 2AV6A 3OQIA 5G02A 3GLHA 3SFZA 4HGQA 1I9GA 2H06A 2NZUG 1QHXA 3MGAA 3SHWA 3LRPA 1QHIA 1KMMA 4CKEB 2GBLA 2PH7A 1OA1A 3RTDA 5DHPA 1Y6JA 1WM1A 3FB1A 4CFYA 3TZBA 2V5VA 3KM0A 4EA6A 2WICA 3Q3CA 3R77A 3OKFA 1EUDB 4LISA 1MOZA 3OETA 4ND4A 1MC1A 4JK3A 2X8AA 1KYXA 1N3IA 1NUAA 2PM8A 1B23P 4C0HA 1KO4A 2OQ2A 2QGFA 2XUFA 4RZUA 1WMDA 2GQ0A 3M3PA 3HGTA 4TGLA 3EPLA 4HI0E 5EWLA 2I9KA 2IS6A 4EP1A 2FMUA 3SF8B 4GQBA 4E2YA 1FSPA 2Y76A 4PZEA 1U7ZA 2XB9A 5CM8B 4FKBA 4RX1A 4A2PA 1DBSA 4XGQA 4Z9FA 2JZOA 5D84A 3EODA 1S01A 4DCGA 3N0WA 1Y9JA 1XEXB 3RS7A 4CUJA 1KZ1A 1Y6ZA 2D54A 3FHCB 4M0DA 3B89A 1OZGA 4FT4A 4QRDA 3URKA 3VX3A 1KRWA 1CVIA 1C7FA 2M98A 2D3TA 4F84A 1E4VA 3P4UA 3IILA 3D31A 3AF0A 4WN9A 4IDFA 4FNAA 3C5VA 4TKVB 2XBMA 1R8JA 2VPPA 3DWIA 5FADA 1H8HD 2H1WA 5DCUA 3U7QB 1E2NA 1W0CA 3GFSA 1CUXA 1W76A 2XUKA 5KVCA 1RFLA 2CMHA 3E3NA 2BBSA 3I2HA 4UARA 4A6XA 2TECE 2VSXA 3VTAA 2GARA 1T15A 4J1SA 5J58A 3EULA 4IIBA 2O2DA 5I01A 1AE1A 3DYVA 3GUHA 1Z4OA 3Q7SA 1BKDR 4WXHA 4RK6A 4LOLA 3T12A 1JPVA 2O1SA 3VDXA 2CL7X 4G2TA 3SQNA 2Y99A 4TMFA 3QX8A 2Q3FA 3OPNA 1I3LA 4G1FA 6Q21A 2J0EA 1I1OA 1IHPA 4RIFA 4A4DA 1PWHA 1H69A 1QK4A 3SE0A 3TJZA 3UJBA 4IZOA 5JVDF 1ZCBA 1ZGZA 5KTKA 4FTWA 1UJ2A 2V7VA 4WSOA 3ZU3A 4CETA 5EFZA 5IULC 4UNPA 1RWWA 3V33A 1MAAA 2OBNA 4W1PA 1P33A 2Q8NA 2WAOA 4DIEA 4LXYA 1XCLA 1PFKA 4CG0A 1DEXA 5DF1A 2PJZA 2MR6A 1VJTA 1C0IA 4R2LA 3O2JA 2K4MA 4LDRA 3AFIA 3JCZA 4B3BA 3GGGA 1GGJA 2XVAA 3N8KA 2W22A 3O1JC 4YAKA 4LF6B 2VF5X 1X0VA 2BRUC 4AQ7A 2D2IA 4HDMA 5MGNA 1BVUA 3OFSA 3TXAA 3RUCA 3V8RA 2DHCA 3GT0A 3DULA 1OUMA 4OA8A 3IB6A 4XWYA 2R00A 4LZLA 3I0MA 2II6A 4RVFA 2A3RA 4DEYA 4ZRNA 5A4IS 3HSKA 4PC3A 2D59A 1XTRA 1Y8QB 1WHTB 5EMLA 4JASB 5DXJA 4CF7A 2YNMD 3IUQA 4DZRA 3C6QA 2QBYA 3L8EA 4PZDA 1SC4A 2C7OA 2QUKA 2V96A 3U1TA 1YRQA 4UZFA 1U0TA 1O5IA 2YJ3A 4BUZA 5DWVA 4X20A 2OV4A 3PHHA 4M36A 4ESHA 3WIBA 1T6YA 4OYRA 5BP7A 1AKTA 3C6MA 2WIKA 3EPPA 3LNCA 5CEEA 4HQLA 2YJTD 4IIJF 1RM5A 1SQSA 2HA7A 1J06A 2ZVQX 2P9TA 1HY3A 2QRUA 5ELMA 4YXWA 4EG4A 2H31A 3O4GA 5CURA 1NXVA 1QZ3A 4HG2A 3Q8KA 1XZPA 1IXYA 1GGMA 4RDHA 1ZM7A 2ZZKA 4RLSA 2CLKB 3BJEA 2QRVB 1E2GA 1I4LD 2WKRA 3GLRA 1JQBA 4M1OA 4Y1RB 4QU9A 1EI9A 2PFGA 2Q9UA 1KMHB 3C3XA 3I2GA 5TGTA 1XRLA 2G6BA 1J7KA 1MO2A 3FJYA 2ZYSA 4QUJA 3W2FA 3SHVA 4EJMA 2J7PA 4OJYA 1LTKA 1H23A 4WESA 4D9CA 2FPIB 3T41A 1RR6A 1U2GA 1JQKA 3GHYA 2I1QA 3PWSA 3QI7A 5LDGA 4F91B 5JCPA 5B12A 2PUBA 1GT6A 2YWJA 5MF6A 3KR0A 4CL3A 1T3GA 3AR6A 3WICA 4XIFA 5HGXA 3P20A 6REQB 2HF9A 4XGIA 3WLRA 4LYYA 3SE7A 1PNRA 3D64A 4UU0A 4B6EA 3UMCA 1Q21A 2Q2QA 1P1JA 1I6LA 2QVZX 3R3VA 4IV5A 2WVJA 5D3MB 4N7BA 2WY2D 4EFLA 4TZTA 4E0BA 5BRJA 2F7SA 3VMMA 5IXYA 2VDKB 3TL3A 4TZ6A 2PUJA 5DBIA 4ETMA 3O8CA 1L4MA 4DR1B 2C83A 4YJ3F 1P0PA 2WE7A 1HE1C 5FAKA 1J0BA 1V5WA 2FWAA 2PU5A 4FJ0A 5A5FA 1L4KA 1WXFA 2MR5A 3GJ0A 1LX7A 4XSGA 3HXOA 4OU5A 1HDZA 1U5AA 4WNCA 2JKZA 1GNPA 4WBXC 5JQGF 4LE1A 3TXXA 4P4NA 3JYPA 3H6KA 4RVGA 4CPDA 2MTBA 2EX4A 3H19A 5KC8A 1P6QA 2QZSA 1KEWA 2VPYA 4EL5A 1IBKB 2RIPA 1D2RA 4J9UE 5E4FA 2FCRA 3TZ6A 2L2QA 4G8CA 3KYDA 2XLBA 3ZV4A 4IH4A 4LVNA 2JF0A 1TTHA 2IDMA 4J16C 4BCCA 1PQWA 3TYXA 5AM4A 2OZVA 1S1CA 3SFVA 4FBGA 3MJVA 4F6RB 1AHIA 4DCUA 1W2GA 2W6NA 4J7UA 4E33A 1B3BA 1L5ZA 1YFZA 2WABA 4JIMA 2P1DA 2Q9BA 4PE5B 1GUAA 3ZY4A 1N57A 5ADVA 1JPJA 4BJ6A 4ZQBA 2WBLC 3QVVA 4IIUA 1E3EA 3UANA 1UDRA 2H4JA 4HWRA 1IOLA 4M2LA 4COKA 3WBFA 5E6SA 1SBZA 2RFLA 2O2ZA 1KPIA 2ZLBA 2ERCA 5LOVA 3KQHA 5AK0A 4XUGB 3RSLA 4PYRA 3Q8MA 1M0EA 1OWPA 1EQ2A 5LZ4A 2OVFA 1I2CA 3DEYX 2IK8A 1ZXBA 2EHDA 2ROQA 3I83A 3W3AA 1KBQA 2AFHE 4LOKA 1VLZA 1OLXA 3AM3A 4KIFA 1MQAA 1ZUWA 4C7JA 2FPRA 1P62B 2IEBA 3LA8A 3AONB 3OP1A 4ENUA 2V8BA 3TIXB 5KNDH 2Q5FA 5LPNA 5K2MA 1I7SB 3G1TA 4KVAA 4WK6A 3LUHA 1E92A 4JYCA 4KK3A 3SZUA 1P5FA 3H13A 4Y3UA 3KUKA 1M8JA 2V7UA 3DAYA 4MINA 4RQUA 4V0MA 4N8EA 1KEKA 4KN5A 3TQQA 4C3OB 3QXCA 1MEEA 1NOKA 4RD1A 5D1HA 4AJIA 4H0FA 3AP2A 1TMKA 4Y0NA 3CUWA 1TCAA 3ED1A 2H57A 4C43A 5JCZA 1R15A 5AHXA 3K0AA 4R9SA 3EPKA 3NANA 5EPEA 3SJ7A 3A6ZA 3E81A 3KZMA 1AQUA 4M9ZA 4Q05A 3ZHUA 2X5JO 3N0XA 5CAEA 1TLTA 3LOUA 2GLXA 4LS3A 1CPYA 4Q82A 2PLNA 3VNQA 2B4TO 3IAEA 3V1YA 1QJCA 2ZJ8A 1EGHA 3PFCA 1CVRA 1LCIA 3U4IA 2H1IA 1UMCB 1EMDA 1WMEA 4NV0A 2Y2UA 3FOAA 3IMGA 3VR6D 5K0ZA 2C2WA 2QD5A 4AURA 1E2QA 3BICA 3NV9A 4K88A 4AJKA 5AM5A 3DNPA 1HI9A 3WO1A 1YNOA 3UB4A 3ZXIA 2WHXA 3L0IB 4I1VA 1QRSA 4OSEA 1RMYA 4W5QA 2CY0A 1TO2E 2QXUA 3HR4A 1QGZA 4DRZA 5AD1A 1KQGA 3LUPA 3LSTA 5B58T 1FMJA 2BJHA 3M70A 4FOSA 3SOPA 3ZI4A 4ZKEA 1QONA 1DJNA 2Z98A 2NSYA 4K6GA 1T4DA 3T9DA 1V2HE 4N39A 1M2EA 1C9NA 2ZBDA 1ZOPA 2NXEA 2VDJA 1TM4E 3BJRA 1I7LA 3DLCA 4AWBA 1L5OA 3MG9A 1LSSA 2FQYA 3ZBUA 3ZGLA 4M3NA 5A0FA 1B8UA 1XNQB 2PVSA 1S89A 1PEDA 1P9LA 3IDOA 4ERXA 3AW9A 2WTXA 2PN1A 4HNRA 3ON5A 3Q6NA 3QW4B 4IYJA 4I1YA 3ZWOA 3B3GA 4U00A 4Z8XA 1NU6A 3DAOA 3NHAA 2GJAA 3N8NA 5CDGA 4MMYB 3BXGA 2ORWA 3S2IA 5KJFA 4EW3A 4TL6A 1YASA 2MHCA 3OIUA 3PPYA 3FGOA 2Q2OA 4MRMA 1G9SA 3FTQA 1LLCA 2HK7A 4UUBA 3G5MA 2RJOA 3STVA 1A2BA 3G2LA 4HAIA 2GYWA 1DRVA 2E9SA 2HU5A 2HRZA 2FZEA 3AB8A 2BAGA 4L73A 2P9GA 4IMJB 3MAGA 3L6BA 2PA0A 1XLTA 5AK4A 1C9MA 4U7JA 1PCXA 2ZB7A 2VHTA 4C4RA 1UJCA 1DBVO 2BEWB 2BFCB 1H5NA 3RIYA 5JT1A 5LFAA 3FE2A 4HRVA 3U7RA 1T5TA 5KVQA 1P0IA 3RVRA 2RGCA 1JKMA 4U2DA 4UTOA 3DZJA 3K6KA 3MUEA 2PA3A 3PNBA 1D1TA 2VKTA 1DC5A 3AHCA 3TCKA 4C4OA 4RC9A 1KQ3A 1U6JA 4HEJA 1P1FA 4YLYA 5KO2A 1NMXA 1U3UA 3MWYW 2Z4RA 2PBFA 1DBPA 4KE6A 4YMSA 3OOWA 3ADKA 3T3MB 3NHJA 1MO6A 5BORA 3IEUA 2D0DA 2AF3C 1M1XB 3DAHA 4EPTA 1DXYA 1DMSA 1L7BA 2QZ4A 2QTHA 3E9YA 2GEVA 3H6GA 1EPUA 3Q6IA 3WGGA 2FMIA 1FS4A 1U0NA 3TBHA 1Q3TA 4F93B 3RODA 5LXTB 5L3QA 1VCMA 3ZKAA 1AGRA 1WB4A 4EG3A 1GNVA 2WHQA 4JBGA 4HDQB 4TOIA 4I1PA 3R5FA 2AFIA 1U9IA 2UZ1B 4U2GA 4DADA 4JI5B 2IPMA 2OORC 5JI3E 4F9FA 4I1SA 3WYFA 2YWCA 2CT8A 2GEFA 1WSAA 3U1BA 5G0TA 4FYKA 4GH5A 4MKXA 2YV2A 2LDXA 3TD6A 3VNRA 5I51A 1JH9A 4OATA 5K0SA 3D4OA 1FDVA 4YMGA 2I6XA 4RIEA 1OWLA 1AXEA 1R9MA 2FEMA 2W2MA 3HMKA 4KXMA 5CFZA 3L2OB 1WS6A 2VSNA 2C8VA 4RANA 2P6UA 4MJXA 4Z7NB 1BYIA 1R2QA 1TM5E 4ZQGA 1R5OA 3HVHA 1GR0A 3PHJA 5E38A 4OQMA 3W5VA 1NQXA 2ZRIA 5JAIA 3PJRA 4EUKA 1C8KA 4TLDA 5AMXA 4IZ6A 1GPH1 2JCBA 3B1WA 1WZEA 3MELA 3OTIA 3HVRA 4DPLA 4B3GA 2CHEA 4QJBA 1IXKA 2EX0A 3D5QA 3LVQE 3PQFA 5BW4A 2C3OA 5JU6A 1AH2A 3QJGA 4NLLA 4MVJF 1AA9A 5F3DA 1D6MA 3AUKA 3MHTA 1I80A 2ACWA 3ZE6A 2UZ4A 2Z5VA 3HO6A 3UQYS 4ENWA 1B00A 1XX6A 3L1UA 1NVWQ 3TOZA 5KYUB 4GL2A 2EYQA 3VSBA 1KJNA 3QMPA 4MRRA 5JZMA 3K8QA 3GW8A 1BEZA 4UW9A 2Q7OE 2IYFA 4D8YA 5FWNA 2GK6A 5D7BA 4TTAA 2GEDA 2ZSUA 3S55A 4BLTA 5C8YA 2C7RA 4FEYA 3DWGA 5AM1A 4MUHA 1ZGGA 5JD3A 1SWVA 3PV0A 4L95C 5FFFA 5LMZA 1XU7A 3KCQA 3NATA 3ZLTA 3CT4A 1LBEA 1XLWA 1XVTA 4R2HA 3P4XA 1RHMA 3O8DA 4KAJA 5FA5A 5F5XA 3AINA 4FYPA 3DZBA 3IFSA 1E1NA 4I1OA 3JQ7B 3VOBA 1I6WA 3LGSA 2CUKA 2R62A 1V7QA 4TV8A 3FYCA 3W5HA 1KWKA 4RZ2A 2F9MA 4M83A 5ER6A 1E0KA 1JXOA 1K27A 1NYTA 1PUJA 2FW0A 3EK2A 3L0OA 4J16A 3T3DA 1SZCA 2DKFA 1Y9DA 2WWRA 5EXXA 4O8ZA 3V55A 3DVSX 1WHTA 4IS3A 5FTWA 1KI6A 2XCLA 4IV8A 4LJ7A 3V34A 4EHIA 1YGPA 3R40A 2WFZA 3BEDA 4RNCA 5LQMA 4P34A 1YBFA 1ZN7A 4X6YA 2Z43A 3UJCA 2ZROA 4FPXA 4DIOA 3QEBZ 1ZMRA 2F1JA 3DBVO 5D00A 2JH9A 3R23A 1D2GA 4C04A 2HA2A 4QUIA 3R8FA 2FG7C 3SX0A 3LE8A 4TL8A 1FP6A 2P2CA 4DVGA 1RKBA 3RRXA 3FKQA 1AK1A 1XJWA 2HV9A 1TT5A 4HO1X 1YZGA 4ZJPA 4M87A 4PHHA 3D02A 1FSSA 4JU8A 4EH1A 2IJGX 4KPUB 4OIMA 1KBZA 4OJMX 5TS2A 5LKRA 2PKQO 3OZAA 1MX3A 4FGWA 4G56A 3MOIA 4RZIA 5IJ9B 4DMGA 2RARA 4DT1B 1YRBA 5FRDA 5AJTA 1DKUA 1D8AA 3IIMA 4J9VA 3LQQA 1UFOA 1ZL0A 3N7UA 3O4VA 1RJWA 1P4GA 1QUFA 2QAGC 3HI6A 3PRKE 5BN3A 2I80A 2I2FA 3DZFA 3M6AA 2DFTA 2V3WA 3K1ZA 5LYJA 2WJ6A 1DEAA 2BSXA 2ZJ7A 3AEXA 3GD7A 4I9UA 4U63A 3AFOA 3MCUA 3W5CA 3V80A 3E7XA 4TTJA 2YKGA 1U02A 2BI4A 2DEUA 2PZBA 4UM5A 2AHOA 2HK8A 2I8AA 5HFJA 3B20A 2HGSA 3IURA 2P9FA 1KF0A 4J3JA 2X14A 2PX0A 3AJ8A 2GJ8A 4CN9A 2WAAA 2IPOA 5F9FA 4LE2A 5B6JA 1WZNA 1S7CA 2Y92A 2C92A 3EXFB 3TQFA 4BWYA 4U7WA 5AJVB 3BT7A 4IUYA 1IQPA 2UXCB 1FFCA 1NT4A 1T9DA 4BN4A 1E9BA 2CWDA 4X60A 3ET5A 4GECA 1WXIA 1RYMA 1Z6YA 2XWQA 3ASYA 1BU8A 1HUQA 2AYXA 2QR5A 3JWHA 3PCXA 2QTNA 4PVDA 5SY6A 1V37A 5IF3A 3DGFC 4BNWA 3C3WA 3K9BA 1PBNA 1QIFA 1LK5A 3I8OA 3QX7A 4MUFA 1NKSA 2ETXA 3RYHB 3U19A 4MWOA 1BH6A 1GG5A 1V2GA 3A2NA 4HB2A 4QFMA 4WCFB 2B1GA 3WP0A 4F12A 1XZHA 3P52A 1KYWA 5D85A 1L4YA 4NBNA 1MF7A 3MEQA 3FD8A 2AXEA 3GLKA 4TX1A 2RD2A 4TLMB 3D8RA 1VL1A 3KUUA 2Q28A 1X1DA 4F04A 5CA1F 2H59A 3CE6A 2H7YA 2UUOA 3L0PA 3ZJTA 3OUUA 4H59A 4ND6A 2O1EA 1X92A 3GFRA 4IR7A 4M9SA 1BHQ1 2W83A 1Q1GA 1W8DA 4DMCA 1XRJA 2CNLA 5CDUA 5TT1A 4ZVMA 1J0EA 5ITZA 2AX4A 1K98A 1OBCA 3K9FC 1T0JB 4MCIA 2PX3A 3I2KA 2FTKE 1RMQA 2REBA 3CH6A 2YW9A 4OLJA 4P3NA 5BQXA 1JPNA 3BHIA 2K2QB 2I22A 2AG6A 1VG9B 1F2UB 4R3WA 4X1OA 3V8EA 4EHHA 1FVFA 1ZJ6A 4Y2TA 3EWNA 3KSZO 4QPJC 3TWOA 1PKXA 2WUVA 1QDEA 2YTZA 2A0YA 4TVKA 1N34B 2DY0A 5MGBA 1WNTA 5IG2A 4ZCLA 3QWIA 4JI2B 1VOTA 1YVRA 4Q3BA 1OXTA 2F1OA 4J6EA 3TD2A 2FZKA 3UMJA 2C7VA 2ZETA 2GF0A 3WLOA 4RTLA 3ZY6A 1BIFA 2V59A 3O84A 4FGKA 5KI6A 5EHXA 1HX7A 1UDXA 4FYJA 5I8PA 4GYKA 3ZIAD 4C7VA 1VL8A 3WJ1A 5JXIA 4DLLA 1LF5A 2IY7A 3FNIA 2B2XA 3PHLA 1R5BA 3DZCA 3O8NA 3Q1KA 5SZKB 4EB6B 5KSPA 1Q57A 4KXXA 4R7GA 5ALVA 1JDUA 2XX3A 3ZE7A 5BYBA 5KNLA 4JQOA 1EFUA 3UK7A 1M1YE 2BRUA 4UTVA 3AOEC 1MH9A 1T29A 2P9EA 2PRSA 3SC2A 5C80A 1JMKC 1GNSA 3RS4A 2RDMA 1UZLA 2AJ8A 1SAYA 4JJZA 3QEOA 1BS9A 4KPGA 4RQBA 3CJQA 3U13A 3O0DA 3OZIA 3QPVA 4GPBA 2WSIA 3MA0A 2QR2A 5LDHA 1CRQA 1E2HA 2GPSA 1NPTO 3KQLA 1AG9A 1FUIA 4FFWA 2WFAA 3GD5A 1J8MF 4Q7EA 1NZFA 2P30A 3GUUA 4H7DA 3DPUA 4YJ3B 5TJ9A 1FTGA 4JJ7A 5EMKA 1DO0A 1QH8A 2AZMA 1M2VA 1TPZA 3DP7A 1BJTA 4J4HA 2OG1A 3GFFA 4E3WA 3FPCA 1K75A 2GRAA 1QGUA 4H0CA 4JAVC 1DIAA 1K5DA 1LNZA 3EFOA 4EFDA 4I9HA 1LKZA 4FIZA 2R7KA 4K9SA 2A9OA 2E3JA 3FN4A 5KTPA 1K8YB 4PLPA 3ZW7A 1X87A 4M0UA 4ARCA 1R0LA 2G5CA 2HSWA 2FNAA 2R6R1 4GX2A 3M6FA 5JLAA 3NEJA 2ZDGA 3KPYA 3TO5A 1H0KA 3EVZA 3HFJA 1ABBA 5THXA 2WTBA 5TQVA 2QXYA 3HJNA 3K8ZA 4AQDA 4D5EA 5TGZA 1KJWA 1VRCA 5H4HA 4KYVA 1A72A 1ZZEA 4ZDIA 3LCUA 1L5RA 4YREA 1W4AA 1BX0A 1J4AA 2NVOA 2WYUA 3KG2A 3KZKA 1G38A 4D9HA 2W2QA 2V1UA 4J4TA 4BP1A 3D8SA 1FVXA 4KDRA 3GJXC 2BTQB 3F8SA 4MYSA 3BN3A 4JNCA 1AZTA 2C5FA 4KRYA 3SZGA 2QLBA 5DI9A 4YRMA 2WDZA 4FE3A 3B1FA 1SVWA 1H2YA 3RT9A 2G71A 3M1IA 3E7DA 1OC2A 2G0AA 2CJFA 2HQ1A 4ZALA 4AY6A 2WMNB 1PR9A 5C1IA 4YDHB 1E9RA 1EP2B 1N2GA 1N4AA 1CJKC 2N0SA 4QA9A 2AMJA 4ZVVA 4AN1A 3CSSA 2NVUB 4JJGA 3H5VA 1MJGA 3MUFA 1W85A 3FTEA 1ENPA 1KZ7B 2QLNA 1RNLA 4Y2QA 1EWTA 3QUAA 4AKSA 5L8VA 3Q9LA 1FIUA 3CUYA 1PLLA 4E2ZA 2W58A 4N5DA 4CXMA 3AVTA 1BMDA 4Y2GA 3VI3B 5HTOA 4CG3A 1DBRA 1D8TA 4WJZA 2W2KA 3OC6A 1DDGA 3OZRA 3IYLW 4RD2A 4G67A 4IDBA 4Z1OA 4R1QA 5KOJA 4R84A 3SJCA 4CIDA 2OOSA 1BHO1 1J24A 1LDMA 3TI9A 5CDFE 3CUSA 3VVCA 3C7DB 1T4MA 1VKHA 4JSTA 4V3CA 1Y6RA 3WLIA 4D98A 2YC4C 3FTDA 3GFVA 1JECA 4NDNE 1P81A 3GMTA 2XMQA 2Z1DA 3RSHA 3THRA 5FBVB 1K68A 1TCBA 1V1RA 2OZPA 4NBTA 3UWSA 1SU4A 1JSXA 1Q0QA 3CB4A 2VXBA 2POQX 3A6JA 4R1OA 1E79A 1RHJA 1Y1RA 3QYPA 3QFRA 1HG1A 3TQHA 4OSOA 4HAXA 4RTMA 2P0YA 2OXTA 1S9HA 5JWOA 1HA3A 4Q4HB 3A8TA 5BSUA 3A9SA 1HZZA 4U9UA 3WADA 2IYEA 3GBSA 1JFTA 4BNVA 1A96A 1BFDA 1C2TA 3DMFA 4P4TA 2NPIA 3AY0A 3RTEA 3WZ2A 2WJ3A 2DUMA 3L7CA 2FPLA 4E08A 2B82A 2WJPA 3ZWPA 4KIWA 7GPBA 4NXNB 1FFAA 1XTPA 3PQ4A 1R88A 2FZWA 4NEHB 4W9NA 2B5VA 4AZ0A 3A1NA 4NKRA 4H6VA 4TL7A 4YDQA 1L7AA 4ZXPA 4B7XA 4C5AA 4F11A 5L3SB 3L4JA 2BZSA 2JEOA 3K0CC 2FJ0A 5F7OA 3PENA 2X40A 4D56A 5KU1A 4GYJA 3NIBA 4J0JA 4QGAA 2AD5A 1TIPA 4LF7B 1WZUA 1RQLA 1GXSA 1KI1A 1XK6A 2WSSD 3CUEF 4JODA 3GRFA 4J2OA 4UUOA 1U63A 1KYZA 3DL2A 2HSJA 3B2EA 2Q5JA 3TINA 1GL3A 3S5UA 2JCGA 4O8CA 4AULA 3M83A 1WTAA 1BEEA 5E8JA 3WL4A 1H05A 3ONDA 2NV6A 3GP8A 5BXQC 2P41A 3MK31 1V45E 4FDMA 4F45A 3LI2A 4CV1A 1LW6E 5LNK1 2ZI6A 3SJAA 2QQGA 4G4GA 1V3VA 4HGYA 4Q9NA 3TW4A 2EWMA 2IEIA 4C4XA 2PZEA 4XVHA 3G2OA 3ITNA 4LBWA 2Q8PA 4MCAA 1AOXA 4QYTA 2ZB3A 4J07A 4CHGA 1BFUA 4WFKA 3CHYA 5C4GB 3ZNQA 1H2BA 3AXTA 5F51A 2VAWA 1TF2A 3EZ2A 3U48A 2SCUB 4AY2A 2EWWA 2XJ4A 1O5TA 3I1YA 4D9NA 5CA1B 3GFBA 3JD0A 3PZRA 1E3MA 4BO3A 1CJCA 3HKBA 2MSKA 1A69A 3ANTA 1M67A 4IDDA 4R8LA 3WL7A 4O2BF 5C46F 4B0OA 3QRWA 2JH8A 3ESDA 4PSUA 2B83A 1NR5A 3IKLA 4ZOEA 1LLDA 3I01M 4B1FA 1QFXA 2VYQA 5ANRB 3PDIA 3COJA 1ZIYA 3EF3A 3W1EA 5DM2A 2GF2A 2HZBA 3HUTA 4EGJA 1FUYB 2FR8A 2CK3A 1GPKA 1NV8A 3AIMA 1B7GO 2AOUA 1LS6A 3AUTA 3L0YA 1YKSA 4A0FA 4E09A 4NR0A 3NBYC 1TPYA 4HBZA 1I13A 3LT0A 4BYMA 4X54A 1GPNA 4AYXA 4N6NA 3N8DA 4OXXA 1VIYA 4OMFG 1MG0A 3EUAA 1YIOA 3GA5A 4NDAA 1EGVB 3G59A 1L3BA 2EZ8A 4TSKA 4BO6A 2GZ2A 2X23A 3AY6A 5HE8A 4BQFA 5IF9A 1BD3A 2WJYA 4CF3A 3J81k 5DHRA 1EFLA 2A0WA 2ZUFA 1EK1A 1MV5A 1N2IA 4UFOA 1S7GA 2CYCA 3BWEA 3IP9A 3WIOA 5LVAA 1IZ0A 5KYTA 4ZO9A 1EDOA 3P9YA 5DK6A 4M0MA 1V9LA 4Z53A 1IQRA 3EGXA 3ESRA 4BLWA 2FZLA 2B35A 4NHOA 3FRJA 4W82A 1DWPA 2UYQA 2WSYB 1ZX1A 2LTAA 3GEHA 4LSGA 3EY4A 3HCCA 3TTXA 2BP7A 2HBYA 4NPCA 1ZD4A 5GOZA 2JLBA 1OJ7A 2ZWVA 2QQEA 3H5IA 4EKDA 5B1EA 1R0RE 1MPTA 5EXSA 1QTRA 2VOEA 4EI7A 2JLCA 3U60B 2RHOA 5TMPA 1WUJS 1D2MA 2Z3VA 5D86A 4CM8A 1YZHA 2J3MA 4ZT6A 4B3TB 4AIRA 5BR4A 1BGXT 2EF0A 3RIMA 3IE1A 3CNQS 2RH5A 3PGLA 4G5RA 2J3EA 2JEZA 3DFIA 3EMKA 3QLVA 1K3UB 2VA9A 4KWIA 1WU8A 1ZCAA 2Z1MA 1M1NB 3NOVA 1KMCA 2O7QA 3TTTA 5FTLA 1QCYA 1Q6ZA 2BFFA 3WX0A 4BKMA 1JQLB 2ZRGA 3LUJA 3SSMA 1EM6A 1THGA 1EA7A 3WG9A 1C8LA 4YT4A 3R7FA 1M2NA 4EVSA 1ANKA 1TAUA 2AN4A 4TWRA 2PS1A 4L02A 1V71A 2VJQA 3L6EA 3L7AA 1O97D 2PTHA 3QE2A 1PL7A 3K0FB 1T2DA 3L5KA 3M1AA 1V16B 1G20E 1T13A 2I54A 4LIPD 2PMDA 3DLIA 1TZBA 3P0JA 1EB9A 3M6VA 3ZYCA 2XCTB 4AM8A 2FAXA 1THTA 1NFFA 5DEIA 3G5LA 4TYYA 4HB3A 1JU9A 2JLQA 3N2IA 3OD5A 3O1LA 4KJZA 5GADl 1N3BA 4E6EA 1JPUA 3S2GA 4MR7A 1Z2PX 1TYBE 3LDHA 5KYYA 3PIIA 1OZFA 1WE2A 2GOYA 3DMTA 1U0JA 3K1TA 2YHUA 1Q22A 2EG9A 3PJEA 3QMWA 2I8CA 5CP8A 3ZOZA 3KHUA 1CUZA 1U8CB 1D0IA 1PN3A 2GRUA 3NBXX 3ABIA 1BX1A 3N2ZB 4IH9A 4ZDWA 3W79A 2TMKA 4HLQB 1MZPA 3H97A 3ZGYA 4D43A 2W6JA 5I7UA 5JYDA 1GM5A 1II9A 1TK9A 4R51A 4LY3A 1ZD2P 3ORQA 4EEZA 2C84A 4UPVA 1JG3A 3N6XA 4YJ2F 5ALZA 3UO8B 3O74A 5JZSA 4HDRA 2M6SA 3GGDA 4FXPA 5KNCH 1NE7A 2Z4TA 3JU3A 3AHGA 3BDAA 1IHUA 4FQ8A 4RS4A 1W73A 3JQ9A 2CLSA 2IZ6A 1XHFA 1DQYA 1G5FA 2OGZA 2PZLA 2XYQA 5AJWA 4GSKA 4KMOA 3UMYA 5ALPA 1U1GA 1HNNA 4ND5A 5DLDA 3UHAA 3SQWA 3EXG2 2UVQA 4OOEA 5I9IA 1T5OA 4PN7A 4DMFA 1PGOA 4LJ9A 4EKEA 4I81A 3VKWA 4I4NA 1YR8A 3VX4A 4KFRA 5SYMA 5ALXA 4YXFA 1G7TA 5CXUA 2WWWA 3K0BA 3C6ZA 1TNDA 4QREA 3Q85A 2ODPA 5CYPA 1K6EA 1XLVA 4YTEA