1LM3B

A multi-generation analysis of cytochrome b562 redox variants: evolutionary strategies for modulating redox potential revealed using a library approach
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
106
structure length
106
Chain Sequence
b'ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDIRHGYDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SOLUBLE CYTOCHROME B562
molecule tags Electron transport
source organism Escherichia coli
publication title A multigeneration analysis of cytochrome b(562) redox variants: evolutionary strategies for modulating redox potential revealed using a library approach.
pubmed doi rcsb
total genus 47
structure length 106
sequence length 106
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1lm3B00
3DE8A 4U9EA 1M6TA 5JUAA 2XM0A 1YZCA 3C63A 4IAQA 3TOMA 5JT4A 3M15A 1YZAA 4D4XA 2YL0A 4U9DA 4IB4A 4D4NA 4IARA 1RCPA 4ER9A 2XLEA 4JEBA 2YKZA 1CGOA 3ZTZA 1A7VA 3ZQVA 5B3IA 3ZWIA 1E85A 1MQVA 4WGZA 1E84A 2J9BA 4CIPA 2XLHA 3HNLA 3M4BA 1QQ3A 1E86A 4JE9A 2YLDA 3C62A 4JKVA 4N4WA 3HNJA 5JS5A 2XL8A 4CJGA 1CPQA 5JP7A 2XLMA 1BBHA 3QVYA 4ULVA 3FOPA 1CPRA 2QLAA 3M4CA 3ZQYA 3HNIA 5JVEA 1NBBA 2YL1A 5JRAA 1E83A 4CDAA 3NMJA 4CX9A 2YLIA 3NMKA 1YYXA 1S05A 4CDVA 2J8WA 4EIYA 3FOOA 2YLGA 3ZTMA 3NMIA 3L1MA 1APCA 4CDYA 4WGYA 2XLVA 2XLWA 1JAFA 1GQAA 4NC3A 3QVZA 4CJOA 3IQ5A 3QW0A 4N6HA 1QPUA 4L6RA 1YYJA 3TOLA 3DE9A 3VRCA 3QW1A 3M79A 3U8PA 256BA 1EKYA 5JSLA 4JEAA 2XLOA 1LM3B 2BC5A 2YL3A 2YL7A 5JLIA 2XLDA 2XL6A 3IQ6A 3HNKA 2CCYA 2XM4A 5AGFA 1CGNA
chains in the Genus database with same CATH superfamily
3DE8A 5T3WA 3SZRA 2A69F 3C63A 3G50A 1BZ4A 1EI7A 4IAQA 2R9RB 4CS9C 3WHNA 3EQLF 3GORA 1A0BA 1ZYRF 2LSEA 2YQYA 4J7YA 2XXAB 3OWTA 3U0CA 2OEVA 2PNOA 3QTHA 1RCPA 1IW7F 4PK4A 4B6IA 1AEPA 4CS8A 1VTMP 2J7PD 4JEBA 5L0JA 3R7CA 2JX0A 4XPXA 2X51A 2YKZA 2Q9CA 2ZXRA 2C03A 3GODA 1R5ID 2WZLA 3TJ5A 4M63A 3EGXB 3ZQVA 5AC5A 5B3IA 5B3SC 1LI5A 2FGYA 1OCRC 1Q0GA 2X0CA 4LDKA 4MW8A 3U9MA 3GWNA 2ZXWC 4XPYA 4CIPA 3C7JA 3HNLA 3M4BA 2R7OA 1FTSA 4DJ9A 3UMHA 3U5SA 2LP4A 2R7UA 1QKRA 1QSPA 3T6BA 1SZIA 1R4TA 3I5QA 4YL0A 4YWQA 2J7PA 1E86A 5L0CA 4G7HF 1WGWA 1BR1A 4O7GA 3GM2A 3TULA 1LPEA 4JKVA 4PJJA 3HJCA 3HNJA 2XL8A 1B68A 1LS4A 2DB4A 2H7OA 4MVOA 4YK5A 1VYKA 3V5XA 1L3PA 4BJTA 2VB6A 2CDQA 2R7RA 1ZZPA 1OKKA 4FESA 3T9OA 3MX3A 2XS1A 1E2XA 2PBEA 4A2NB 4PFPA 3FOPA 1D0ZA 5DQTA 3M4CA 4MTOA 2HSQA 4LDQA 1LVKA 2HMZA 1HE9A 4IGGA 4Z9HA 4XLPF 4Q4ZF 4BJ5A 4P9FA 2VH3A 2W9YA 4MVRA 3RIPA 1Z7Qc 1Y4CA 5JRAA 2NG1A 1V74B 4MVUA 3DAGA 3FVYA 4ZLCA 4JC7A 2CW0F 1TFOB 3N0TA 1UG7A 1YAUO 3LLKA 3W2VA 1WWPA 4PFOA 3GEHA 2WVOA 3U3FA 1KTMA 2H7BA 5BQGA 3F46A 3QZCA 5E3CA 2KJGA 5A6BD 3E70C 4EIYA 4JIOA 4OINF 1MNDA 1WTYA 2H8AA 2J46A 2ZXPA 3DKAA 5E33A 3V5ZA 5KYUA 4UDVA 2VCAA 3SXZA 1FFHA 3S90A 3HKKA 5FCLA 1I4ZA 1OW7A 3EHMA 1SR2A 3AOUA 5T3TA 2IXMA 1J8YF 5KYWA 4WJ0A 1I5NA 2OKUA 1JAFA 3U8VA 3H2UA 2QE9A 3U9JA 4JCZA 3QMKA 1RJ9B 5K0IA 1YA7O 2OEXA 4RBNA 2CNWA 3I4UA 4C3BA 3QVZA 4DVZA 3IQ5A 5A6JA 4JJGA 3C18A 3JSZA 4JTAB 3A11A 2Z15A 3DJNB 2J45A 2P61A 4N6HA 5L0HA 2P1AA 1ZU4A 3DE9A 1OW8A 3HLZA 4E0HA 2A68F 3M79A 5L0FA 4P6IC 3DXJF 3GEEA 4OIPF 1TWGA 2J0WA 2I8BA 5JSLA 4ULWA 3L8IA 4EBKA 2L6HA 2P6VA 4JTDB 2OJQA 1ZW2A 3DZAA 4K0DA 2AP3A 1A7DA 2YL7A 3DWWA 1TWAA 1ZW3A 1MMNA 2L6GA 4QDLA 1S7ZA 1G4US 2LIGA 1PV3A 2G3VA 2XLDA 1T6IA 3C8ZA 4PACA 3VAYA 1VK5A 5COFA 3S28A 3CEXA 4AK9A 1RXQA 3HNKA 3R2PA 4BJ5C 3PHF2 2FAPB 1Q0MA 3GANA 1CGNA 3IEEA 5COMA 2YZSA 2Q7RA 4U9EA 2MHRA 2HJ3A 1OR3A 1YZCA 3TOMA 5JT4A 4J7TA 1NLXA 1EA8A 1YZAA 3OA1A 4I44A 4JVSA 4D4XA 2A6HF 5TJ5E 1XZQA 4U9DA 3Q7GA 1NZEA 4EBBA 2A6EF 3IQTA 4W8KA 4MW3A 4ER9A 1Q0KA 2B0HA 2XLEA 3PCVA 3SXKA 4DBRA 2QUPA 4K1OA 4LERA 2HZ8A 3S29A 3WAQA 4EWCA 1FFTC 3G4XA 1A7VA 1LE4A 4Q5SF 3K1IA 2KW3C 2YWAA 3DM5A 4E7ZA 4WGZA 3ABMC 2J0XA 2J9BA 2PFDA 3H65A 4WABA 1ORYA 2XLHA 5GPGB 3SXYA 4A4AA 2DI3A 3AGTA 4NTBA 1LE2A 3RQGA 5HSWA 1C17M 1QQ3A 4Q7CA 3PDMP 1TFKB 2KSFA 1FNTc 3FAPB 1CGME 2QNLA 3AG4C 3K33A 4YJWA 5B1AC 3JRMO 5CI8A 3ATPA 3RQEA 4CS9A 2Y3DA 1F1MA 2XLMA 1OQCA 3EJNA 1JMWA 5IY5C 2L7AA 1Y6DA 1SF8A 3FXHA 1PD0A 3IQCA 5E2QA 2R25A 4CS7A 4E7SA 4HEAJ 3SP1A 1ZHTA 4J30B 1HW2A 2HS5A 3HNIA 3LESA 3ZVRA 3JZ0A 5JVEA 2PX3A 1HMOA 4N06A 5F28E 4MVMA 3G4ZA 4DOZA 1E83A 4CSAC 2R05A 2GA0A 4AL0A 1M2VA 3Q7LA 2YVKA 4FWVA 3KKBA 4IAOA 2WVNA 1MMGA 4JCHA 4C3EA 4OD5A 3W2WA 3KYIA 1C02A 4Z9IA 1S05A 3L0IA 4MNDA 1GM5A 1OXBA 3EZIA 2L9JA 2KQ9A 1G8XA 4JURI 3X2QC 1FR0A 4EBJA 3MFNA 5D92A 1NG1A 3O39A 3T6GB 3T6JA 1WN0A 4YT8A 2R02A 3ZTMA 3NRHA 2WZGA 3LJBA 4HE8D 3L1MA 2VCBA 4PJNA 4CDYA 3WODF 2GFHA 3CAXA 2R03A 4XTKA 1I4YA 1T5OA 2MYSA 2Y3BA 3K1IC 3OEOA 3US6A 3WG7C 4G78A 4AX2A 2R7TA 1Z6AA 3L34A 4U5EE 2EPMX 3LLIA 5AC4A 1Z63A 2R7WA 3V5YA 1DOVA 3HTKC 2ASRA 2VASA 2EPLX 3JRTA 2LFFA 4L6RA 3O55A 3S84A 5KYYB 4DRHB 4W8PA 2EPNA 2H7VC 3U8PA 2IXNA 1ZHYA 2IBFA 2L6FA 1SYQA 4YL3A 1Z3IX 4C3DA 1JPJA 2AU5A 2OOCA 1VB5A 4IRUA 2KC3A 3TK0A 2C04A 2OCCC 1XWJA 3K1HA 5L0IA 1NU9C 3UNGC 1LM3B 2BC5A 1O87A 3C8GA 5JLIA 3JYHA 3VF0A 3BEHA 2OQMA 2I15A 3W8HA 1PCXA 2PF4E 4U5HA 2KGOA 3U3BA 1KU2A 1TQGA 2R7SA 4MVSA 1HMDA 2JD3A 3IQ6A 3O6XA 2G3KA 2GAQA 4U5FE 4R32A 1K04A 1RKCA 5DLJA 2G62A 2CCYA 4DXWA 2XM4A 2ZD9A 3VM6A 4YT2A 1JR8A 1T01A 1M6TA 3GM1A 2L81A 5KYXB 3DMDA 4JRZA 2YL0A 2DGJA 4JTCB 4ONSA 4D4NA 4IARA 3FDQA 1VOMA 3ASOC 4IJJA 2Y3GA 2HV6A 3ABLC 4XEKA 3J06A 1CGOA 4BEMJ 4E18A 1AUEA 3MLGA 4E0IA 2XXAA 1YLMA 3EZHA 2JPUA 5KYXA 3AGUA 1E85A 3DD7A 1EQ1A 2J9WA 3B29A 1NSGB 1MQVA 1QLEC 3Q6NA 1A41A 1E84A 1YJGA 1U89A 3IPMO 1U0BB 1FMWA 2A0UA 2EPKX 4YT4A 1ST6A 2OU6A 1K05A 1LIHA 4NTFA 2AVKA 2YLDA 4I1OB 3O10A 3CQZA 3FMSA 2IM8A 4N4WA 4O6MA 1C03A 4MVZA 2Y3HA 5JS5A 3EFOA 4H54A 1ORJA 3NDBB 4CBEA 4JZAA 3TQOA 2EILC 5JP7A 4XQ1A 1D0XA 1FAPB 1L7CA 1Q0DA 2FFHA 3BRJA 4XWJA 3RW0A 2D4UA 1V4AA 3LNRA 1T9KA 5BQHA 2IYLD 3KPHA 3B0PA 4AE4B 4YT5A 4OIQF 4O6NA 5A6KA 3QVYA 1IZMA 3K66A 4PR9A 4ULVA 2O9XA 1CPRA 2QLAA 5A6BA 3AQBA 3B9QA 5F5FA 2V26A 3MYFA 2MWQA 4BPMA 5KYYA 3JSEO 1YDIA 2WVQA 3ZIBA 4CIHA 1PD1A 5DQZA 3B0VC 4PJLA 2EINC 4U5BE 4CDAA 2DYSC 1D1AA 1QZXA 2UUIA 3IHUA 3NMJA 2GWWA 2NUTB 4I1MA 4KC9A 4XEVA 3GM3A 3ZG1A 3ZSUA 4CX9A 3RKOF 2YLIA 2IXPA 2ZXOA 2A0BA 3NMKA 5KYNA 3SYNA 2ETSA 2XL4A 3S9OA 2TMVP 4KBLA 2OG2A 4OIOF 1JOGA 2VC9A 2NPUA 2J8WA 3RQFA 1AVOB 3N2ZB 1H7IA 1D0YA 4JW1A 4NTAA 2VCCA 1N1CA 2ICWG 3AG1C 2YLGA 3F47A 1M56C 2KK1A 3V7OA 3JTLO 4KI2A 2IXOA 1RMVA 2HFIA 2EIKC 4FAPB 3NMIA 1WATA 3ASNC 1APCA 4BJ1A 2R7XA 2HKVA 3NYMA 1V54C 1GQAA 3NKEA 4LLCA 3VYWA 3RH3A 3UMKA 3LEOA 5EK0A 3TJ6A 2M64A 3EGXA 4KNVA 4JJFA 5FZTA 3RYLA 1DOWA 4KNWA 1VMAA 5COGA 1HE1A 3SEOA 3EH1A 2KNHA 2A1DD 3QW0A 1M2VB 2CYDA 3B0UX 2B0JA 3W8IA 1YYJA 5L0GA 4XEFA 2LFDA 3FAJA 1G4WR 1OR2A 3DJUB 3VRCA 3QW1A 2XSEA 4N6CA 3EFOB 1OCCC 4QI0A 3JYYA 1G5ZA 4LDRA 4YN0B 4EKWA 4Z9JA 1WOLA 4JEAA 4LLEA 1T6QA 3RF3A 5A69A 3K6BA 4BJ6C 4E17A 2QY9A 4O6YA 1JPNA 1LS1A 3KMIA 4IWBA 2M4EA 2YL3A 1T6UA 4MTGA 4DRIB 5DS4A 4DRJB 4RDAA 3JT1A 4QI2A 1YA9A 2CNWD 3L8JA 3U2MA 3ZQYA 3H2VA 4HFFB 5BQIA 5AGFA 1J8MF 2PX0A 3AJMA 1VYIA 1BDJB 5JUAA 4GEHA 1MMAA 1V55C 2XM0A 3NYLA 2E87A 3TD7A 1H9TA 5L3QA 2V3CC 3ITFA 3M15A 5A6AA 1FMVA 4EUKB 2NUPA 1ZHXA 4H4KC 2PP4A 1NFNA 5D91A 4XLNF 2AWYA 1OXKA 4IB4A 3E9VA 5BUOA 5KYWB 4YL1A 1RKEB 3EG9B 3ZC4A 1RKEA 1D1CA 3EH2A 2NUTA 3EHNA 1NFOA 3DM9B 4P9TA 2Q00A 3ZTZA 3C8GD 5F5HA 4MS2A 4G7ZF 2YHSA 3LUTB 3ZWIA 2NSFA 4ZLDA 4ANJA 1OKKD 4DBQA 5L3VA 4BG0A 2J9UA 2EIJC 1H9GA 3SXMA 3ZDLA 3NG1A 3AG3C 3KH2A 4NCQA 1A7EA 1MNEA 2D5RB 3LNMB 4I3MA 3C62A 4JE9A 1XZPA 2W4BA 4AE4A 5EHHA 3I5PA 1O5HA 2KYHA 3LEVA 4MQ9F 4U5GA 3RFYA 3T4RA 5EGYA 2LCHA 3POVA 1OCZC 4CJGA 2HSBA 3AQCA 1CPQA 2P7VA 4U5CE 2QTVA 3KL4A 4U5DE 1BR4A 1U6HA 2NUPB 1TKNA 4MVQA 3B71A 2P0NA 1Z23A 1BBHA 2CGEA 1Q0FA 2HJMA 3EG9A 1VLTA 3CSKA 3LS0A 2LQGA 3FHDA 1M57C 1NU7D 2WZFA 1NBBA 4NY3A 3ECSA 3U2LA 1HY5A 4GQHA 2Y69C 2YL1A 2LK4A 3GWLA 2R7QA 3LS1A 4C7OA 3S0XA 4C7OB 3EPVA 4CSAA 2WL8A 3S27A 3CZ6A 1YYXA 1RJ9A 5DVWA 3UR3C 3NKDA 3PMRA 1OCOC 2Q9BA 2Q4FA 4CDVA 3EGDB 3LAYA 3AG2C 2W4MA 3EGDA 1TWCA 1TWHA 2WB7A 2Y39A 3FOOA 4GYTA 4J32B 1M2OA 4K7BA 1VLSA 4NQFA 1BR2A 1ZU5A 1UFBA 5HV9A 2YEVA 4XPWA 4LACB 5CIVA 4AL1A 3JCUQ 4BJ6A 3M1CB 5CI9A 4MTFA 3N24A 2BL2A 2IOQA 4O79A 2GDCA 4WGYA 2XLVA 2UUHA 2OJED 3K7DA 2XLWA 1YVIA 5KYUB 4NC3A 3UGPA 2J9VA 1MMDA 2Q9AA 3RVZA 5DS5A 1H6GA 3GEIA 1KNYA 2DYRC 4CJOA 2XS8A 2AWCA 2BE5F 3W4YA 3DAFA 4BEJA 1JRAA 2EPOA 2HUJA 2XRHA 4G0HA 1QPUA 2Q3TA 4HFKB 3TOLA 2HV7A 2LD6A 1QVXA 5B1BC 1D1BA 1TR2A 3MBGA 4OIRF 256BA 3C8GB 1EKYA 1GGQA 1K40A 1WASA 2W45A 4FX5A 5DS6A 1LI7A 2EIMC 1ZHWA 3DI5A 3RVYA 3UGOA 1OW6A 3KYJA 1O3UA 3Q6MA 1ORSC 1GS9A 2XLOA 2RD9A 4DVYP 5L0DA 3MYIA 4EHPA 3NYJA 3UMIA 2F22A 2NSGA 1W2WA 2ZPAA 3A9CA 3ABKC 2HMQA 4X0RA 4OD4A 4CS8C 4PJMA 2RSEB 4F4BA 1SMYF 1Z5ZA 2XL6A 5E3AA 3SNHA 4G7OF 1LKXA 2R7VA 1ZHZA 3X1OA 1HW1A 5T1DB 4RD9A 1YARO 1ZVZA 2YRFA
chains in the Genus database with same CATH topology
3DE8A 4U9EA 1M6TA 5JUAA 2XM0A 1YZCA 3C63A 4IAQA 3TOMA 5JT4A 3M15A 1YZAA 4D4XA 2YL0A 4U9DA 4IB4A 4D4NA 4IARA 1RCPA 4ER9A 2XLEA 4JEBA 2YKZA 1CGOA 3ZTZA 1A7VA 3ZQVA 5B3IA 3ZWIA 1E85A 1MQVA 4WGZA 1E84A 2J9BA 4CIPA 2XLHA 3HNLA 3M4BA 1QQ3A 1E86A 4JE9A 2YLDA 3C62A 4JKVA 4N4WA 3HNJA 5JS5A 2XL8A 4CJGA 1CPQA 5JP7A 2XLMA 1BBHA 3QVYA 4ULVA 3FOPA 1CPRA 2QLAA 3M4CA 3ZQYA 3HNIA 5JVEA 1NBBA 2YL1A 5JRAA 1E83A 4CDAA 3NMJA 4CX9A 2YLIA 3NMKA 1YYXA 1S05A 4CDVA 2J8WA 4EIYA 3FOOA 2YLGA 3ZTMA 3NMIA 3L1MA 1APCA 4CDYA 4WGYA 2XLVA 2XLWA 1JAFA 1GQAA 4NC3A 3QVZA 4CJOA 3IQ5A 3QW0A 4N6HA 1QPUA 4L6RA 1YYJA 3TOLA 3DE9A 3VRCA 3QW1A 3M79A 3U8PA 256BA 1EKYA 5JSLA 4JEAA 2XLOA 1LM3B 2BC5A 2YL3A 2YL7A 5JLIA 2XLDA 2XL6A 3IQ6A 3HNKA 2CCYA 2XM4A 5AGFA 1CGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DE8 A;  4U9E A;  1M6T A;  5JUA A;  2XM0 A;  1YZC A;  3C63 A;  4IAQ A;  3TOM A;  5JT4 A;  3M15 A;  1YZA A;  4D4X A;  2YL0 A;  4U9D A;  4IB4 A;  4D4N A;  4IAR A;  1RCP A;  4ER9 A;  2XLE A;  4JEB A;  2YKZ A;  1CGO A;  3ZTZ A;  1A7V A;  3ZQV A;  5B3I A;  3ZWI A;  1E85 A;  1MQV A;  4WGZ A;  1E84 A;  2J9B A;  4CIP A;  2XLH A;  3HNL A;  3M4B A;  1QQ3 A;  1E86 A;  4JE9 A;  2YLD A;  3C62 A;  4JKV A;  4N4W A;  3HNJ A;  5JS5 A;  2XL8 A;  4CJG A;  1CPQ A;  5JP7 A;  2XLM A;  1BBH A;  3QVY A;  4ULV A;  3FOP A;  1CPR A;  2QLA A;  3M4C A;  3ZQY A;  3HNI A;  5JVE A;  1NBB A;  2YL1 A;  5JRA A;  1E83 A;  4CDA A;  3NMJ A;  4CX9 A;  2YLI A;  3NMK A;  1YYX A;  1S05 A;  4CDV A;  2J8W A;  4EIY A;  3FOO A;  2YLG A;  3ZTM A;  3NMI A;  3L1M A;  1APC A;  4CDY A;  4WGY A;  2XLV A;  2XLW A;  1JAF A;  1GQA A;  4NC3 A;  3QVZ A;  4CJO A;  3IQ5 A;  3QW0 A;  4N6H A;  1QPU A;  4L6R A;  1YYJ A;  3TOL A;  3DE9 A;  3VRC A;  3QW1 A;  3M79 A;  3U8P A;  256B A;  1EKY A;  5JSL A;  4JEA A;  2XLO A;  1LM3 B;  2BC5 A;  2YL3 A;  2YL7 A;  5JLI A;  2XLD A;  2XL6 A;  3IQ6 A;  3HNK A;  2CCY A;  2XM4 A;  5AGF A;  1CGN A; 
#chains in the Genus database with same CATH topology
 3DE8 A;  5T3W A;  3SZR A;  2A69 F;  3C63 A;  3G50 A;  1BZ4 A;  1EI7 A;  4IAQ A;  2R9R B;  4CS9 C;  3WHN A;  3EQL F;  3GOR A;  1A0B A;  1ZYR F;  2LSE A;  2YQY A;  4J7Y A;  2XXA B;  3OWT A;  3U0C A;  2OEV A;  2PNO A;  3QTH A;  1RCP A;  1IW7 F;  4PK4 A;  4B6I A;  1AEP A;  4CS8 A;  1VTM P;  2J7P D;  4JEB A;  5L0J A;  3R7C A;  2JX0 A;  4XPX A;  2X51 A;  2YKZ A;  2Q9C A;  2ZXR A;  2C03 A;  3GOD A;  1R5I D;  2WZL A;  3TJ5 A;  4M63 A;  3EGX B;  3ZQV A;  5AC5 A;  5B3I A;  5B3S C;  1LI5 A;  2FGY A;  1OCR C;  1Q0G A;  2X0C A;  4LDK A;  4MW8 A;  3U9M A;  3GWN A;  2ZXW C;  4XPY A;  4CIP A;  3C7J A;  3HNL A;  3M4B A;  2R7O A;  1FTS A;  4DJ9 A;  3UMH A;  3U5S A;  2LP4 A;  2R7U A;  1QKR A;  1QSP A;  3T6B A;  1SZI A;  1R4T A;  3I5Q A;  4YL0 A;  4YWQ A;  2J7P A;  1E86 A;  5L0C A;  4G7H F;  1WGW A;  1BR1 A;  4O7G A;  3GM2 A;  3TUL A;  1LPE A;  4JKV A;  4PJJ A;  3HJC A;  3HNJ A;  2XL8 A;  1B68 A;  1LS4 A;  2DB4 A;  2H7O A;  4MVO A;  4YK5 A;  1VYK A;  3V5X A;  1L3P A;  4BJT A;  2VB6 A;  2CDQ A;  2R7R A;  1ZZP A;  1OKK A;  4FES A;  3T9O A;  3MX3 A;  2XS1 A;  1E2X A;  2PBE A;  4A2N B;  4PFP A;  3FOP A;  1D0Z A;  5DQT A;  3M4C A;  4MTO A;  2HSQ A;  4LDQ A;  1LVK A;  2HMZ A;  1HE9 A;  4IGG A;  4Z9H A;  4XLP F;  4Q4Z F;  4BJ5 A;  4P9F A;  2VH3 A;  2W9Y A;  4MVR A;  3RIP A;  1Z7Q c;  1Y4C A;  5JRA A;  2NG1 A;  1V74 B;  4MVU A;  3DAG A;  3FVY A;  4ZLC A;  4JC7 A;  2CW0 F;  1TFO B;  3N0T A;  1UG7 A;  1YAU O;  3LLK A;  3W2V A;  1WWP A;  4PFO A;  3GEH A;  2WVO A;  3U3F A;  1KTM A;  2H7B A;  5BQG A;  3F46 A;  3QZC A;  5E3C A;  2KJG A;  5A6B D;  3E70 C;  4EIY A;  4JIO A;  4OIN F;  1MND A;  1WTY A;  2H8A A;  2J46 A;  2ZXP A;  3DKA A;  5E33 A;  3V5Z A;  5KYU A;  4UDV A;  2VCA A;  3SXZ A;  1FFH A;  3S90 A;  3HKK A;  5FCL A;  1I4Z A;  1OW7 A;  3EHM A;  1SR2 A;  3AOU A;  5T3T A;  2IXM A;  1J8Y F;  5KYW A;  4WJ0 A;  1I5N A;  2OKU A;  1JAF A;  3U8V A;  3H2U A;  2QE9 A;  3U9J A;  4JCZ A;  3QMK A;  1RJ9 B;  5K0I A;  1YA7 O;  2OEX A;  4RBN A;  2CNW A;  3I4U A;  4C3B A;  3QVZ A;  4DVZ A;  3IQ5 A;  5A6J A;  4JJG A;  3C18 A;  3JSZ A;  4JTA B;  3A11 A;  2Z15 A;  3DJN B;  2J45 A;  2P61 A;  4N6H A;  5L0H A;  2P1A A;  1ZU4 A;  3DE9 A;  1OW8 A;  3HLZ A;  4E0H A;  2A68 F;  3M79 A;  5L0F A;  4P6I C;  3DXJ F;  3GEE A;  4OIP F;  1TWG A;  2J0W A;  2I8B A;  5JSL A;  4ULW A;  3L8I A;  4EBK A;  2L6H A;  2P6V A;  4JTD B;  2OJQ A;  1ZW2 A;  3DZA A;  4K0D A;  2AP3 A;  1A7D A;  2YL7 A;  3DWW A;  1TWA A;  1ZW3 A;  1MMN A;  2L6G A;  4QDL A;  1S7Z A;  1G4U S;  2LIG A;  1PV3 A;  2G3V A;  2XLD A;  1T6I A;  3C8Z A;  4PAC A;  3VAY A;  1VK5 A;  5COF A;  3S28 A;  3CEX A;  4AK9 A;  1RXQ A;  3HNK A;  3R2P A;  4BJ5 C;  3PHF 2;  2FAP B;  1Q0M A;  3GAN A;  1CGN A;  3IEE A;  5COM A;  2YZS A;  2Q7R A;  4U9E A;  2MHR A;  2HJ3 A;  1OR3 A;  1YZC A;  3TOM A;  5JT4 A;  4J7T A;  1NLX A;  1EA8 A;  1YZA A;  3OA1 A;  4I44 A;  4JVS A;  4D4X A;  2A6H F;  5TJ5 E;  1XZQ A;  4U9D A;  3Q7G A;  1NZE A;  4EBB A;  2A6E F;  3IQT A;  4W8K A;  4MW3 A;  4ER9 A;  1Q0K A;  2B0H A;  2XLE A;  3PCV A;  3SXK A;  4DBR A;  2QUP A;  4K1O A;  4LER A;  2HZ8 A;  3S29 A;  3WAQ A;  4EWC A;  1FFT C;  3G4X A;  1A7V A;  1LE4 A;  4Q5S F;  3K1I A;  2KW3 C;  2YWA A;  3DM5 A;  4E7Z A;  4WGZ A;  3ABM C;  2J0X A;  2J9B A;  2PFD A;  3H65 A;  4WAB A;  1ORY A;  2XLH A;  5GPG B;  3SXY A;  4A4A A;  2DI3 A;  3AGT A;  4NTB A;  1LE2 A;  3RQG A;  5HSW A;  1C17 M;  1QQ3 A;  4Q7C A;  3PDM P;  1TFK B;  2KSF A;  1FNT c;  3FAP B;  1CGM E;  2QNL A;  3AG4 C;  3K33 A;  4YJW A;  5B1A C;  3JRM O;  5CI8 A;  3ATP A;  3RQE A;  4CS9 A;  2Y3D A;  1F1M A;  2XLM A;  1OQC A;  3EJN A;  1JMW A;  5IY5 C;  2L7A A;  1Y6D A;  1SF8 A;  3FXH A;  1PD0 A;  3IQC A;  5E2Q A;  2R25 A;  4CS7 A;  4E7S A;  4HEA J;  3SP1 A;  1ZHT A;  4J30 B;  1HW2 A;  2HS5 A;  3HNI A;  3LES A;  3ZVR A;  3JZ0 A;  5JVE A;  2PX3 A;  1HMO A;  4N06 A;  5F28 E;  4MVM A;  3G4Z A;  4DOZ A;  1E83 A;  4CSA C;  2R05 A;  2GA0 A;  4AL0 A;  1M2V A;  3Q7L A;  2YVK A;  4FWV A;  3KKB A;  4IAO A;  2WVN A;  1MMG A;  4JCH A;  4C3E A;  4OD5 A;  3W2W A;  3KYI A;  1C02 A;  4Z9I A;  1S05 A;  3L0I A;  4MND A;  1GM5 A;  1OXB A;  3EZI A;  2L9J A;  2KQ9 A;  1G8X A;  4JUR I;  3X2Q C;  1FR0 A;  4EBJ A;  3MFN A;  5D92 A;  1NG1 A;  3O39 A;  3T6G B;  3T6J A;  1WN0 A;  4YT8 A;  2R02 A;  3ZTM A;  3NRH A;  2WZG A;  3LJB A;  4HE8 D;  3L1M A;  2VCB A;  4PJN A;  4CDY A;  3WOD F;  2GFH A;  3CAX A;  2R03 A;  4XTK A;  1I4Y A;  1T5O A;  2MYS A;  2Y3B A;  3K1I C;  3OEO A;  3US6 A;  3WG7 C;  4G78 A;  4AX2 A;  2R7T A;  1Z6A A;  3L34 A;  4U5E E;  2EPM X;  3LLI A;  5AC4 A;  1Z63 A;  2R7W A;  3V5Y A;  1DOV A;  3HTK C;  2ASR A;  2VAS A;  2EPL X;  3JRT A;  2LFF A;  4L6R A;  3O55 A;  3S84 A;  5KYY B;  4DRH B;  4W8P A;  2EPN A;  2H7V C;  3U8P A;  2IXN A;  1ZHY A;  2IBF A;  2L6F A;  1SYQ A;  4YL3 A;  1Z3I X;  4C3D A;  1JPJ A;  2AU5 A;  2OOC A;  1VB5 A;  4IRU A;  2KC3 A;  3TK0 A;  2C04 A;  2OCC C;  1XWJ A;  3K1H A;  5L0I A;  1NU9 C;  3UNG C;  1LM3 B;  2BC5 A;  1O87 A;  3C8G A;  5JLI A;  3JYH A;  3VF0 A;  3BEH A;  2OQM A;  2I15 A;  3W8H A;  1PCX A;  2PF4 E;  4U5H A;  2KGO A;  3U3B A;  1KU2 A;  1TQG A;  2R7S A;  4MVS A;  1HMD A;  2JD3 A;  3IQ6 A;  3O6X A;  2G3K A;  2GAQ A;  4U5F E;  4R32 A;  1K04 A;  1RKC A;  5DLJ A;  2G62 A;  2CCY A;  4DXW A;  2XM4 A;  2ZD9 A;  3VM6 A;  4YT2 A;  1JR8 A;  1T01 A;  1M6T A;  3GM1 A;  2L81 A;  5KYX B;  3DMD A;  4JRZ A;  2YL0 A;  2DGJ A;  4JTC B;  4ONS A;  4D4N A;  4IAR A;  3FDQ A;  1VOM A;  3ASO C;  4IJJ A;  2Y3G A;  2HV6 A;  3ABL C;  4XEK A;  3J06 A;  1CGO A;  4BEM J;  4E18 A;  1AUE A;  3MLG A;  4E0I A;  2XXA A;  1YLM A;  3EZH A;  2JPU A;  5KYX A;  3AGU A;  1E85 A;  3DD7 A;  1EQ1 A;  2J9W A;  3B29 A;  1NSG B;  1MQV A;  1QLE C;  3Q6N A;  1A41 A;  1E84 A;  1YJG A;  1U89 A;  3IPM O;  1U0B B;  1FMW A;  2A0U A;  2EPK X;  4YT4 A;  1ST6 A;  2OU6 A;  1K05 A;  1LIH A;  4NTF A;  2AVK A;  2YLD A;  4I1O B;  3O10 A;  3CQZ A;  3FMS A;  2IM8 A;  4N4W A;  4O6M A;  1C03 A;  4MVZ A;  2Y3H A;  5JS5 A;  3EFO A;  4H54 A;  1ORJ A;  3NDB B;  4CBE A;  4JZA A;  3TQO A;  2EIL C;  5JP7 A;  4XQ1 A;  1D0X A;  1FAP B;  1L7C A;  1Q0D A;  2FFH A;  3BRJ A;  4XWJ A;  3RW0 A;  2D4U A;  1V4A A;  3LNR A;  1T9K A;  5BQH A;  2IYL D;  3KPH A;  3B0P A;  4AE4 B;  4YT5 A;  4OIQ F;  4O6N A;  5A6K A;  3QVY A;  1IZM A;  3K66 A;  4PR9 A;  4ULV A;  2O9X A;  1CPR A;  2QLA A;  5A6B A;  3AQB A;  3B9Q A;  5F5F A;  2V26 A;  3MYF A;  2MWQ A;  4BPM A;  5KYY A;  3JSE O;  1YDI A;  2WVQ A;  3ZIB A;  4CIH A;  1PD1 A;  5DQZ A;  3B0V C;  4PJL A;  2EIN C;  4U5B E;  4CDA A;  2DYS C;  1D1A A;  1QZX A;  2UUI A;  3IHU A;  3NMJ A;  2GWW A;  2NUT B;  4I1M A;  4KC9 A;  4XEV A;  3GM3 A;  3ZG1 A;  3ZSU A;  4CX9 A;  3RKO F;  2YLI A;  2IXP A;  2ZXO A;  2A0B A;  3NMK A;  5KYN A;  3SYN A;  2ETS A;  2XL4 A;  3S9O A;  2TMV P;  4KBL A;  2OG2 A;  4OIO F;  1JOG A;  2VC9 A;  2NPU A;  2J8W A;  3RQF A;  1AVO B;  3N2Z B;  1H7I A;  1D0Y A;  4JW1 A;  4NTA A;  2VCC A;  1N1C A;  2ICW G;  3AG1 C;  2YLG A;  3F47 A;  1M56 C;  2KK1 A;  3V7O A;  3JTL O;  4KI2 A;  2IXO A;  1RMV A;  2HFI A;  2EIK C;  4FAP B;  3NMI A;  1WAT A;  3ASN C;  1APC A;  4BJ1 A;  2R7X A;  2HKV A;  3NYM A;  1V54 C;  1GQA A;  3NKE A;  4LLC A;  3VYW A;  3RH3 A;  3UMK A;  3LEO A;  5EK0 A;  3TJ6 A;  2M64 A;  3EGX A;  4KNV A;  4JJF A;  5FZT A;  3RYL A;  1DOW A;  4KNW A;  1VMA A;  5COG A;  1HE1 A;  3SEO A;  3EH1 A;  2KNH A;  2A1D D;  3QW0 A;  1M2V B;  2CYD A;  3B0U X;  2B0J A;  3W8I A;  1YYJ A;  5L0G A;  4XEF A;  2LFD A;  3FAJ A;  1G4W R;  1OR2 A;  3DJU B;  3VRC A;  3QW1 A;  2XSE A;  4N6C A;  3EFO B;  1OCC C;  4QI0 A;  3JYY A;  1G5Z A;  4LDR A;  4YN0 B;  4EKW A;  4Z9J A;  1WOL A;  4JEA A;  4LLE A;  1T6Q A;  3RF3 A;  5A69 A;  3K6B A;  4BJ6 C;  4E17 A;  2QY9 A;  4O6Y A;  1JPN A;  1LS1 A;  3KMI A;  4IWB A;  2M4E A;  2YL3 A;  1T6U A;  4MTG A;  4DRI B;  5DS4 A;  4DRJ B;  4RDA A;  3JT1 A;  4QI2 A;  1YA9 A;  2CNW D;  3L8J A;  3U2M A;  3ZQY A;  3H2V A;  4HFF B;  5BQI A;  5AGF A;  1J8M F;  2PX0 A;  3AJM A;  1VYI A;  1BDJ B;  5JUA A;  4GEH A;  1MMA A;  1V55 C;  2XM0 A;  3NYL A;  2E87 A;  3TD7 A;  1H9T A;  5L3Q A;  2V3C C;  3ITF A;  3M15 A;  5A6A A;  1FMV A;  4EUK B;  2NUP A;  1ZHX A;  4H4K C;  2PP4 A;  1NFN A;  5D91 A;  4XLN F;  2AWY A;  1OXK A;  4IB4 A;  3E9V A;  5BUO A;  5KYW B;  4YL1 A;  1RKE B;  3EG9 B;  3ZC4 A;  1RKE A;  1D1C A;  3EH2 A;  2NUT A;  3EHN A;  1NFO A;  3DM9 B;  4P9T A;  2Q00 A;  3ZTZ A;  3C8G D;  5F5H A;  4MS2 A;  4G7Z F;  2YHS A;  3LUT B;  3ZWI A;  2NSF A;  4ZLD A;  4ANJ A;  1OKK D;  4DBQ A;  5L3V A;  4BG0 A;  2J9U A;  2EIJ C;  1H9G A;  3SXM A;  3ZDL A;  3NG1 A;  3AG3 C;  3KH2 A;  4NCQ A;  1A7E A;  1MNE A;  2D5R B;  3LNM B;  4I3M A;  3C62 A;  4JE9 A;  1XZP A;  2W4B A;  4AE4 A;  5EHH A;  3I5P A;  1O5H A;  2KYH A;  3LEV A;  4MQ9 F;  4U5G A;  3RFY A;  3T4R A;  5EGY A;  2LCH A;  3POV A;  1OCZ C;  4CJG A;  2HSB A;  3AQC A;  1CPQ A;  2P7V A;  4U5C E;  2QTV A;  3KL4 A;  4U5D E;  1BR4 A;  1U6H A;  2NUP B;  1TKN A;  4MVQ A;  3B71 A;  2P0N A;  1Z23 A;  1BBH A;  2CGE A;  1Q0F A;  2HJM A;  3EG9 A;  1VLT A;  3CSK A;  3LS0 A;  2LQG A;  3FHD A;  1M57 C;  1NU7 D;  2WZF A;  1NBB A;  4NY3 A;  3ECS A;  3U2L A;  1HY5 A;  4GQH A;  2Y69 C;  2YL1 A;  2LK4 A;  3GWL A;  2R7Q A;  3LS1 A;  4C7O A;  3S0X A;  4C7O B;  3EPV A;  4CSA A;  2WL8 A;  3S27 A;  3CZ6 A;  1YYX A;  1RJ9 A;  5DVW A;  3UR3 C;  3NKD A;  3PMR A;  1OCO C;  2Q9B A;  2Q4F A;  4CDV A;  3EGD B;  3LAY A;  3AG2 C;  2W4M A;  3EGD A;  1TWC A;  1TWH A;  2WB7 A;  2Y39 A;  3FOO A;  4GYT A;  4J32 B;  1M2O A;  4K7B A;  1VLS A;  4NQF A;  1BR2 A;  1ZU5 A;  1UFB A;  5HV9 A;  2YEV A;  4XPW A;  4LAC B;  5CIV A;  4AL1 A;  3JCU Q;  4BJ6 A;  3M1C B;  5CI9 A;  4MTF A;  3N24 A;  2BL2 A;  2IOQ A;  4O79 A;  2GDC A;  4WGY A;  2XLV A;  2UUH A;  2OJE D;  3K7D A;  2XLW A;  1YVI A;  5KYU B;  4NC3 A;  3UGP A;  2J9V A;  1MMD A;  2Q9A A;  3RVZ A;  5DS5 A;  1H6G A;  3GEI A;  1KNY A;  2DYR C;  4CJO A;  2XS8 A;  2AWC A;  2BE5 F;  3W4Y A;  3DAF A;  4BEJ A;  1JRA A;  2EPO A;  2HUJ A;  2XRH A;  4G0H A;  1QPU A;  2Q3T A;  4HFK B;  3TOL A;  2HV7 A;  2LD6 A;  1QVX A;  5B1B C;  1D1B A;  1TR2 A;  3MBG A;  4OIR F;  256B A;  3C8G B;  1EKY A;  1GGQ A;  1K40 A;  1WAS A;  2W45 A;  4FX5 A;  5DS6 A;  1LI7 A;  2EIM C;  1ZHW A;  3DI5 A;  3RVY A;  3UGO A;  1OW6 A;  3KYJ A;  1O3U A;  3Q6M A;  1ORS C;  1GS9 A;  2XLO A;  2RD9 A;  4DVY P;  5L0D A;  3MYI A;  4EHP A;  3NYJ A;  3UMI A;  2F22 A;  2NSG A;  1W2W A;  2ZPA A;  3A9C A;  3ABK C;  2HMQ A;  4X0R A;  4OD4 A;  4CS8 C;  4PJM A;  2RSE B;  4F4B A;  1SMY F;  1Z5Z A;  2XL6 A;  5E3A A;  3SNH A;  4G7O F;  1LKX A;  2R7V A;  1ZHZ A;  3X1O A;  1HW1 A;  5T1D B;  4RD9 A;  1YAR O;  1ZVZ A;  2YRF A; 
#chains in the Genus database with same CATH homology
 3DE8 A;  4U9E A;  1M6T A;  5JUA A;  2XM0 A;  1YZC A;  3C63 A;  4IAQ A;  3TOM A;  5JT4 A;  3M15 A;  1YZA A;  4D4X A;  2YL0 A;  4U9D A;  4IB4 A;  4D4N A;  4IAR A;  1RCP A;  4ER9 A;  2XLE A;  4JEB A;  2YKZ A;  1CGO A;  3ZTZ A;  1A7V A;  3ZQV A;  5B3I A;  3ZWI A;  1E85 A;  1MQV A;  4WGZ A;  1E84 A;  2J9B A;  4CIP A;  2XLH A;  3HNL A;  3M4B A;  1QQ3 A;  1E86 A;  4JE9 A;  2YLD A;  3C62 A;  4JKV A;  4N4W A;  3HNJ A;  5JS5 A;  2XL8 A;  4CJG A;  1CPQ A;  5JP7 A;  2XLM A;  1BBH A;  3QVY A;  4ULV A;  3FOP A;  1CPR A;  2QLA A;  3M4C A;  3ZQY A;  3HNI A;  5JVE A;  1NBB A;  2YL1 A;  5JRA A;  1E83 A;  4CDA A;  3NMJ A;  4CX9 A;  2YLI A;  3NMK A;  1YYX A;  1S05 A;  4CDV A;  2J8W A;  4EIY A;  3FOO A;  2YLG A;  3ZTM A;  3NMI A;  3L1M A;  1APC A;  4CDY A;  4WGY A;  2XLV A;  2XLW A;  1JAF A;  1GQA A;  4NC3 A;  3QVZ A;  4CJO A;  3IQ5 A;  3QW0 A;  4N6H A;  1QPU A;  4L6R A;  1YYJ A;  3TOL A;  3DE9 A;  3VRC A;  3QW1 A;  3M79 A;  3U8P A;  256B A;  1EKY A;  5JSL A;  4JEA A;  2XLO A;  1LM3 B;  2BC5 A;  2YL3 A;  2YL7 A;  5JLI A;  2XLD A;  2XL6 A;  3IQ6 A;  3HNK A;  2CCY A;  2XM4 A;  5AGF A;  1CGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...