1LM3B

A multi-generation analysis of cytochrome b562 redox variants: evolutionary strategies for modulating redox potential revealed using a library approach
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDIRHGYDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A multigeneration analysis of cytochrome b(562) redox variants: evolutionary strategies for modulating redox potential revealed using a library approach.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
molecule keywords SOLUBLE CYTOCHROME B562
total genus 47
structure length 106
sequence length 106
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1lm3B00
2XL6A 3C63A 4ULVA 1YYXA 4CDVA 4NC3A 4U9EA 4D4XA 2YL1A 2YLDA 2YL3A 1A7VA 3NMIA 4JEAA 4CDYA 1M6TA 2XLOA 3ZTZA 5JT4A 3TOLA 2YL0A 4IB4A 5B3IA 5JS5A 4U9DA 4CDAA 2XM4A 3IQ5A 4CJOA 1CPQA 4EIYA 3FOOA 5JVEA 3HNKA 2YLIA 1BBHA 1E86A 2YKZA 4D4NA 4JE9A 4WGZA 1QQ3A 5AGFA 256BA 3HNIA 1MQVA 4L6RA 3NMKA 1E84A 2QLAA 1YZAA 1NBBA 1CPRA 2XLHA 2XLMA 3NMJA 1GQAA 3DE8A 3M15A 1QPUA 3M4CA 3QW1A 1CGOA 2YL7A 3C62A 3DE9A 2CCYA 1CGNA 1EKYA 1LM3B 3ZTMA 1E83A 1JAFA 3TOMA 4CJGA 1YYJA 4JKVA 2J8WA 3HNJA 4WGYA 3ZQVA 1YZCA 3ZWIA 3IQ6A 2YLGA 3L1MA 4JEBA 3QVYA 1APCA 1RCPA 4N4WA 3HNLA 5JP7A 1S05A 2XLWA 2XM0A 3QW0A 3VRCA 3U8PA 2XL8A 3M79A 3QVZA 5JRAA 5JUAA 2J9BA 2BC5A 4IARA 4IAQA 4N6HA 4ER9A 3FOPA 5JSLA 3M4BA 1E85A 2XLEA 5JLIA 2XLDA 4CX9A 4CIPA 2XLVA 3ZQYA
chains in the Genus database with same CATH superfamily
4B6IA 4YT5A 3ABLC 3GM1A 5DVWA 3NRHA 1OXKA 1C03A 1Q0GA 1Q0DA 1VK5A 2NSGA 2P1AA 4ULVA 5CI8A 5FZTA 2EPKX 3V5ZA 3W4YA 1TWGA 4AK9A 1QZXA 5CI9A 3DWWA 5L0IA 3N0TA 4D4XA 1TFKB 1Z63A 2Q9CA 5HV9A 3U9JA 3NDBB 3GEIA 4KI2A 3RFYA 1OKKA 4U5CE 4JEAA 3O10A 2YEVA 3U2LA 1NG1A 4OIRF 3K1IA 4C3BA 3EG9B 2QY9A 2DB4A 2AWYA 2FFHA 1Q0KA 1NSGB 1O5HA 1WATA 4IB4A 1NU7D 4M63A 2W45A 3L8IA 4MTFA 1H9TA 4E18A 4CJOA 4EIYA 4O6YA 3RVYA 5L0JA 2YQYA 4J30B 4MW8A 3ECSA 3HNKA 5E33A 4J7YA 2LQGA 5COGA 4HFKB 4DBRA 3ABKC 2MWQA 4D4NA 4P9TA 5A6AA 3E9VA 2GA0A 4G78A 2CW0F 4WABA 3FAPB 3I5PA 4Z9JA 3JZ0A 5DQTA 2R7QA 3U0CA 4EKWA 3KL4A 1OQCA 1SZIA 2LFFA 3NMKA 4L6RA 4IGGA 4PACA 4BJ6C 1HE9A 1QVXA 1YA9A 3JT1A 3Q6NA 4JTCB 4NTFA 4AL1A 3EGXB 4BJ5C 5L0DA 3I4UA 2XLHA 1CGME 1LPEA 3GODA 1H9GA 3S27A 1U6HA 2KSFA 3W2VA 2VH3A 3GM2A 4MVZA 4I44A 2CNWD 4PJNA 4R32A 2X0CA 1OR2A 3M15A 4DOZA 1KTMA 1BR1A 2P61A 2Q00A 3NG1A 1OR3A 1QSPA 5AC5A 1D0ZA 3AQBA 4X0RA 3G50A 1CGOA 2EIMC 5EK0A 4BEMJ 5A69A 2HMZA 2OU6A 3DZAA 4U5FE 5GPGB 2L9JA 4MTGA 3SZRA 2CCYA 2UUHA 2WVQA 2GDCA 2L81A 5BQHA 4JW1A 4AX2A 2ZXPA 5KYXB 1TQGA 3LLKA 3L34A 3Q7GA 3B0VC 3ITFA 3GM3A 4K1OA 1YARO 4QDLA 3HTKC 1LVKA 2HMQA 3DD7A 4MS2A 4YK5A 1TKNA 2P7VA 3DAGA 4YN0B 5COFA 4CBEA 1BDJB 1D1AA 4K7BA 1B68A 2CGEA 3S29A 3NKDA 1L3PA 1T5OA 1ZHTA 2F22A 4N06A 3PHF2 1YZCA 2EPLX 1Z5ZA 2Y3DA 3EH1A 3GANA 3HKKA 4IWBA 3O39A 3RKOF 1IW7F 4RD9A 3CSKA 3L1MA 1ZHYA 2PX0A 2WVNA 3JRMO 5KYNA 1VMAA 1RCPA 4YT2A 4C3EA 4DBQA 3H65A 2JX0A 3RQGA 1NU9C 1U0BB 4P6IC 3JTLO 4EBBA 3R2PA 5K0IA 5KYXA 2XLWA 2A6HF 1E2XA 1RJ9A 2VB6A 2X51A 3K7DA 4HEAJ 2HSQA 3VRCA 3U8PA 1L7CA 1G4WR 2J9UA 2LSEA 2QE9A 4IARA 3S28A 2HUJA 4AL0A 3FVYA 4PFPA 2XL4A 4N6HA 5L0GA 4DVZA 2R25A 3AJMA 4J7TA 3K1IC 2R03A 4PFOA 4XEVA 5JSLA 1Z6AA 2KYHA 3FAJA 3L0IA 3LLIA 4O6NA 1O3UA 1ORYA 3DMDA 2XLVA 3AGUA 1PV3A 3EGDA 2XL6A 4ZLDA 3C63A 2I15A 1BZ4A 4C3DA 4I1MA 3SNHA 1YYXA 3TJ5A 3EHMA 4NC3A 4XPXA 4U9EA 2A0UA 2YLDA 4MTOA 1OCCC 3NMIA 2HSBA 2KC3A 2J45A 2MHRA 3LESA 3JSEO 3UNGC 3VAYA 3K66A 3KYIA 1FTSA 4CDYA 1BR2A 4JCHA 1IZMA 4Q7CA 1HW2A 3ZDLA 2J9VA 3GORA 1JRAA 2EIJC 3US6A 3ZTZA 3HLZA 1GM5A 3Q7LA 4XEKA 1VYIA 3U3BA 5D92A 5KYWB 1LI5A 3WG7C 4FAPB 2NUTB 3C8GA 3C8ZA 3B71A 1EQ1A 5BQGA 4CIHA 1HMOA 1HY5A 3EGXA 2AU5A 1VYKA 1HE1A 1EA8A 4LERA 4LLEA 4ONSA 2YKZA 3JSZA 4E0HA 5L0FA 2LCHA 4XPWA 5T1DB 2XXAA 2J7PA 1GS9A 4WGZA 2J46A 3I5QA 1FFTC 1MMAA 5L3VA 1I4ZA 2HZ8A 3Q6MA 5AGFA 4JJFA 256BA 3HNIA 3EG9A 4A2NB 4OD4A 5EHHA 2R7VA 4FESA 4KC9A 2ETSA 1LIHA 1Z23A 1GGQA 1SYQA 2NG1A 3EFOB 4MVOA 1KU2A 4O6MA 4RDAA 3T9OA 1J8MF 3VF0A 3W8IA 4QI2A 4G7OF 2Y3HA 2QNLA 1Y6DA 3NMJA 1UFBA 4EUKB 3DKAA 3OWTA 4JZAA 2Z15A 2HFIA 1Z7Qc 5F5HA 1RKEB 3UGOA 3EPVA 4AE4A 2ZPAA 3BRJA 4Q5SF 2J9WA 1H7IA 1LKXA 1SMYF 1WTYA 1NFNA 1YJGA 2QUPA 3C18A 2LFDA 3DM5A 2Y69C 3EHNA 2MYSA 2V26A 2CNWA 4JCZA 2QTVA 3RQFA 4BG0A 1Q0MA 2PX3A 3O55A 1UG7A 1A7EA 3QTHA 2LD6A 2OCCC 2YL7A 4PK4A 4YL3A 4C7OA 3C62A 3DE9A 4ANJA 3R7CA 3MX3A 4LLCA 2PP4A 4G7HF 3ATPA 1WN0A 5A6KA 2HKVA 1LM3B 5T3TA 1VTMP 2Y39A 3ZTMA 1PCXA 2R9RB 1PD0A 1T6QA 1V54C 3AQCA 4KNVA 4DXWA 1JAFA 3TOMA 4RBNA 1FR0A 2KNHA 5CIVA 4YL1A 1YYJA 3SP1A 4E7ZA 2EINC 3T6JA 1AEPA 1NLXA 2J8WA 2R02A 1OCOC 2YVKA 2IXOA 4U5HA 3GEEA 2VASA 4JVSA 4WGYA 5HSWA 1BR4A 2BL2A 2EPOA 3EJNA 3QZCA 2YLGA 4JURI 2CYDA 3OA1A 4XWJA 3RIPA 5A6BA 3ASNC 3QVYA 4MVRA 4Z9HA 3GWLA 2R7SA 1YLMA 2W4BA 2EPNA 1DOVA 3O6XA 4BPMA 5DS6A 4XTKA 1WOLA 2IYLD 3HNLA 4OIOF 2IXPA 2A0BA 2ICWG 3N24A 3TULA 4LDQA 4MNDA 2HJ3A 3EZIA 1S05A 2KW3C 3MLGA 3AGTA 4U5BE 1M2VA 4GYTA 4ZLCA 3A11A 2R7WA 4EBKA 2HV6A 1RMVA 2XRHA 4YJWA 5JRAA 1ZW3A 3K1HA 5T3WA 3V7OA 4BJTA 3ZSUA 5TJ5E 2YRFA 3FOPA 1E85A 2XLEA 3LEOA 3EQLF 3RYLA 5KYUB 1AVOB 1V4AA 2Q9AA 3SXYA 3TJ6A 4U5GA 5JLIA 2GFHA 2YWAA 3ZQYA 3NYMA 4EBJA 2RD9A 1YVIA 2OOCA 5A6BD 3JCUQ 3SEOA 1QKRA 3KMIA 3IHUA 1NFOA 4PJMA 5E3CA 1W2WA 4MVUA 2L6FA 2HJMA 3F47A 2FGYA 3WODF 3AOUA 3TQOA 1LI7A 2OJED 2YL3A 3IQCA 2J0WA 1M2VB 2Q4FA 1A7DA 3F46A 1M57C 1G8XA 3ZVRA 2KJGA 2VCCA 4JJGA 4DRJB 2RSEB 2A68F 2R05A 1I4YA 4DRIB 1OW6A 2XLOA 4XLNF 5JT4A 4EWCA 3TOLA 5DS4A 4MVSA 2YL0A 5B3IA 2ASRA 3W2WA 4U9DA 5JS5A 4CDAA 5B1AC 2Q9BA 2XM4A 2YHSA 3C8GB 3IQ5A 1ZHXA 2NUTA 1CPQA 1NZEA 3FOOA 4FWVA 1OCZC 1O87A 4LDRA 1OW7A 3T6GB 4JC7A 1BBHA 3X2QC 3ZG1A 4A4AA 1VB5A 1ZHZA 1OW8A 4K0DA 2OEXA 2IM8A 2OQMA 1QQ3A 2LK4A 2WZLA 4XEFA 4AE4B 2EIKC 2IOQA 4W8KA 1Y4CA 4CDVA 3LNMB 4GQHA 4KNWA 2R7UA 2BE5F 3LAYA 3DM9B 4IRUA 3SXKA 2DI3A 2QLAA 3LUTB 1LS4A 1HW1A 1YZAA 1VLTA 4NCQA 1RKCA 3NYJA 3DJNB 4JIOA 3U3FA 4LACB 2XS1A 2WZGA 2XLMA 2NSFA 4GEHA 1ORSC 1YDIA 1OCRC 1OKKD 1T6UA 5E3AA 1GQAA 2VCBA 3MFNA 1QPUA 2A6EF 1YAUO 4YWQA 5DS5A 2KK1A 4E17A 3SXMA 2ZXRA 3QW1A 1JR8A 4DRHB 1Q0FA 1TWCA 2PFDA 4E0IA 3JYHA 3MYFA 1A41A 1D0YA 4J32B 4KBLA 4XPYA 2DYSC 3PCVA 2OJQA 4H54A 1CGNA 3CEXA 1XWJA 3SXZA 2R7XA 1EKYA 3ASOC 1MMGA 2OKUA 2JD3A 4FX5A 4PR9A 2FAPB 3LJBA 1ZHWA 4W8PA 1E83A 1RJ9B 3LNRA 1FAPB 1C02A 1ZYRF 4CJGA 2Q3TA 3PDMP 4Q4ZF 3MBGA 4CS7A 3UR3C 3HJCA 1DOWA 3IEEA 1WGWA 3AG4C 2EILC 2WL8A 3CZ6A 3WHNA 1T01A 3HNJA 4MVQA 4IJJA 3ZQVA 4Z9IA 1OXBA 2VC9A 4WJ0A 3J06A 2EPMX 3RF3A 2G62A 3DJUB 3IQ6A 3ZWIA 4YT4A 3U9MA 4CSAC 1R5ID 4XQ1A 1H6GA 5EGYA 2L6HA 2P0NA 3ABMC 2JPUA 4N4WA 5COMA 3S0XA 2M64A 4CS9C 5JP7A 3DI5A 1M2OA 1ST6A 1J8YF 2A69F 3BEHA 3FXHA 2G3VA 2B0JA 3KH2A 3LS0A 1A0BA 1LE4A 3QW0A 4OD5A 1FMWA 4UDVA 3UGPA 4QI0A 2PBEA 3C7JA 3POVA 5BQIA 1SF8A 2XL8A 2H7VC 1JPJA 5JUAA 2BC5A 1D0XA 1I5NA 1PD1A 1SR2A 1RXQA 3C8GD 1C17M 2P6VA 3M4BA 1Z3IX 2KGOA 2AP3A 1LE2A 2W4MA 4H4KC 5KYUA 3W8HA 5B3SC 2GAQA 4MW3A 3U2MA 1JPNA 3U8VA 4CIPA 3L8JA 2IXMA 2R7TA 2H8AA 4U5EE 2I8BA 4HFFB 4I3MA 2WB7A 3E70C 3M1CB 4DJ9A 3ZC4A 1EI7A 2WZFA 1V55C 3B9QA 1RKEA 3VM6A 2DYRC 5D91A 4CS9A 1MMDA 2IXNA 3G4XA 1D1CA 2OG2A 2E87A 2YL1A 3CAXA 4G0HA 4PJJA 3RH3A 2AWCA 4EHPA 4DVYP 3PMRA 1A7VA 2J0XA 2A1DD 2CDQA 1K05A 1MMNA 3GEHA 3B29A 1K04A 2PF4E 2OEVA 2J7PD 1M6TA 3WAQA 3S9OA 3CQZA 4I1OB 3T4RA 3AG1C 4BJ6A 4PJLA 1VLSA 2WVOA 3KKBA 1R4TA 1TWHA 1ZVZA 4JRZA 5E2QA 2R7RA 3VYWA 5DLJA 3T6BA 3K6BA 5DQZA 3A9CA 3NKEA 2C04A 2GWWA 5JVEA 3FMSA 3AG3C 3NYLA 1T6IA 2YLIA 1E86A 3TD7A 1TFOB 2HV7A 4JTAB 4CSAA 4JE9A 4YT8A 3K33A 1N1CA 3UMHA 5F28E 1MQVA 1YA7O 5KYYB 1E84A 3RW0A 4NQFA 3FHDA 1FMVA 1NBBA 1CPRA 2KQ9A 2R7OA 3GWNA 1LS1A 3OEOA 4O7GA 3EGDB 3H2UA 5A6JA 5L0HA 5F5FA 5L0CA 1G4US 1HMDA 2HS5A 4NTBA 5IY5C 1K40A 1AUEA 3SYNA 4U5DE 3DE8A 3B0UX 2G3KA 1JMWA 2H7OA 1ZZPA 2VCAA 3EZHA 1WWPA 1VOMA 4JTDB 3M4CA 2Y3GA 3S84A 4E7SA 3UMKA 4P9FA 4OIQF 1F1MA 1MNEA 1ORJA 1ZU4A 2ZD9A 3LEVA 1TWAA 3ZIBA 1TR2A 1D1BA 1ZU5A 2LP4A 3EFOA 3MYIA 2NUPB 3AG2C 5KYYA 4BEJA 2Q7RA 4HE8D 1XZQA 2UUIA 3UMIA 5BUOA 2AVKA 5AC4A 4JKVA 1ZW2A 2IBFA 1FFHA 2L6GA 4CS8A 3U5SA 4F4BA 2DGJA 2XXAB 3LS1A 4BJ1A 3V5XA 1M56C 2C03A 4ULWA 3S90A 4XLPF 1WASA 3JRTA 5KYWA 3KYJA 4JEBA 4MQ9F 4CS8C 4C7OB 4O79A 1APCA 5B1BC 4NTAA 3RQEA 3V5YA 2TMVP 2L7AA 2B0HA 2D5RB 4IAOA 3G4ZA 2H7BA 3DXJF 3IQTA 1FNTc 4YL0A 4NY3A 2XSEA 3FDQA 2XM0A 1QLEC 2NUPA 4G7ZF 2Y3BA 2V3CC 4OINF 3EH2A 5L3QA 2YZSA 2ZXWC 3DAFA 1T9KA 1XZPA 3B0PA 3KPHA 3M79A 3N2ZB 3QVZA 4N6CA 1U89A 3TK0A 2J9BA 3X1OA 2NPUA 4IAQA 1MNDA 3IPMO 4MVMA 4ER9A 4BJ5A 1G5ZA 3JYYA 4OIPF 4LDKA 1V74B 2ZXOA 2W9YA 3QMKA 5FCLA 2D4UA 2XLDA 2LIGA 2XS8A 4CX9A 2M4EA 1S7ZA 1JOGA 3RVZA 3H2VA 2O9XA 1KNYA 2PNOA
chains in the Genus database with same CATH topology
2XL6A 3C63A 4ULVA 1YYXA 4CDVA 4NC3A 4U9EA 4D4XA 2YL1A 2YLDA 2YL3A 1A7VA 3NMIA 4JEAA 4CDYA 1M6TA 2XLOA 3ZTZA 5JT4A 3TOLA 2YL0A 4IB4A 5B3IA 5JS5A 4U9DA 4CDAA 2XM4A 3IQ5A 4CJOA 1CPQA 4EIYA 3FOOA 5JVEA 3HNKA 2YLIA 1BBHA 1E86A 2YKZA 4D4NA 4JE9A 4WGZA 1QQ3A 5AGFA 256BA 3HNIA 1MQVA 4L6RA 3NMKA 1E84A 2QLAA 1YZAA 1NBBA 1CPRA 2XLHA 2XLMA 3NMJA 1GQAA 3DE8A 3M15A 1QPUA 3M4CA 3QW1A 1CGOA 2YL7A 3C62A 3DE9A 2CCYA 1CGNA 1EKYA 1LM3B 3ZTMA 1E83A 1JAFA 3TOMA 4CJGA 1YYJA 4JKVA 2J8WA 3HNJA 4WGYA 3ZQVA 1YZCA 3ZWIA 3IQ6A 2YLGA 3L1MA 4JEBA 3QVYA 1APCA 1RCPA 4N4WA 3HNLA 5JP7A 1S05A 2XLWA 2XM0A 3QW0A 3VRCA 3U8PA 2XL8A 3M79A 3QVZA 5JRAA 5JUAA 2J9BA 2BC5A 4IARA 4IAQA 4N6HA 4ER9A 3FOPA 5JSLA 3M4BA 1E85A 2XLEA 5JLIA 2XLDA 4CX9A 4CIPA 2XLVA 3ZQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XL6 A;  3C63 A;  4ULV A;  1YYX A;  4CDV A;  4NC3 A;  4U9E A;  4D4X A;  2YL1 A;  2YLD A;  2YL3 A;  1A7V A;  3NMI A;  4JEA A;  4CDY A;  1M6T A;  2XLO A;  3ZTZ A;  5JT4 A;  3TOL A;  2YL0 A;  4IB4 A;  5B3I A;  5JS5 A;  4U9D A;  4CDA A;  2XM4 A;  3IQ5 A;  4CJO A;  1CPQ A;  4EIY A;  3FOO A;  5JVE A;  3HNK A;  2YLI A;  1BBH A;  1E86 A;  2YKZ A;  4D4N A;  4JE9 A;  4WGZ A;  1QQ3 A;  5AGF A;  256B A;  3HNI A;  1MQV A;  4L6R A;  3NMK A;  1E84 A;  2QLA A;  1YZA A;  1NBB A;  1CPR A;  2XLH A;  2XLM A;  3NMJ A;  1GQA A;  3DE8 A;  3M15 A;  1QPU A;  3M4C A;  3QW1 A;  1CGO A;  2YL7 A;  3C62 A;  3DE9 A;  2CCY A;  1CGN A;  1EKY A;  1LM3 B;  3ZTM A;  1E83 A;  1JAF A;  3TOM A;  4CJG A;  1YYJ A;  4JKV A;  2J8W A;  3HNJ A;  4WGY A;  3ZQV A;  1YZC A;  3ZWI A;  3IQ6 A;  2YLG A;  3L1M A;  4JEB A;  3QVY A;  1APC A;  1RCP A;  4N4W A;  3HNL A;  5JP7 A;  1S05 A;  2XLW A;  2XM0 A;  3QW0 A;  3VRC A;  3U8P A;  2XL8 A;  3M79 A;  3QVZ A;  5JRA A;  5JUA A;  2J9B A;  2BC5 A;  4IAR A;  4IAQ A;  4N6H A;  4ER9 A;  3FOP A;  5JSL A;  3M4B A;  1E85 A;  2XLE A;  5JLI A;  2XLD A;  4CX9 A;  4CIP A;  2XLV A;  3ZQY A; 
#chains in the Genus database with same CATH topology
 4B6I A;  4YT5 A;  3ABL C;  3GM1 A;  5DVW A;  3NRH A;  1OXK A;  1C03 A;  1Q0G A;  1Q0D A;  1VK5 A;  2NSG A;  2P1A A;  4ULV A;  5CI8 A;  5FZT A;  2EPK X;  3V5Z A;  3W4Y A;  1TWG A;  4AK9 A;  1QZX A;  5CI9 A;  3DWW A;  5L0I A;  3N0T A;  4D4X A;  1TFK B;  1Z63 A;  2Q9C A;  5HV9 A;  3U9J A;  3NDB B;  3GEI A;  4KI2 A;  3RFY A;  1OKK A;  4U5C E;  4JEA A;  3O10 A;  2YEV A;  3U2L A;  1NG1 A;  4OIR F;  3K1I A;  4C3B A;  3EG9 B;  2QY9 A;  2DB4 A;  2AWY A;  2FFH A;  1Q0K A;  1NSG B;  1O5H A;  1WAT A;  4IB4 A;  1NU7 D;  4M63 A;  2W45 A;  3L8I A;  4MTF A;  1H9T A;  4E18 A;  4CJO A;  4EIY A;  4O6Y A;  3RVY A;  5L0J A;  2YQY A;  4J30 B;  4MW8 A;  3ECS A;  3HNK A;  5E33 A;  4J7Y A;  2LQG A;  5COG A;  4HFK B;  4DBR A;  3ABK C;  2MWQ A;  4D4N A;  4P9T A;  5A6A A;  3E9V A;  2GA0 A;  4G78 A;  2CW0 F;  4WAB A;  3FAP B;  3I5P A;  4Z9J A;  3JZ0 A;  5DQT A;  2R7Q A;  3U0C A;  4EKW A;  3KL4 A;  1OQC A;  1SZI A;  2LFF A;  3NMK A;  4L6R A;  4IGG A;  4PAC A;  4BJ6 C;  1HE9 A;  1QVX A;  1YA9 A;  3JT1 A;  3Q6N A;  4JTC B;  4NTF A;  4AL1 A;  3EGX B;  4BJ5 C;  5L0D A;  3I4U A;  2XLH A;  1CGM E;  1LPE A;  3GOD A;  1H9G A;  3S27 A;  1U6H A;  2KSF A;  3W2V A;  2VH3 A;  3GM2 A;  4MVZ A;  4I44 A;  2CNW D;  4PJN A;  4R32 A;  2X0C A;  1OR2 A;  3M15 A;  4DOZ A;  1KTM A;  1BR1 A;  2P61 A;  2Q00 A;  3NG1 A;  1OR3 A;  1QSP A;  5AC5 A;  1D0Z A;  3AQB A;  4X0R A;  3G50 A;  1CGO A;  2EIM C;  5EK0 A;  4BEM J;  5A69 A;  2HMZ A;  2OU6 A;  3DZA A;  4U5F E;  5GPG B;  2L9J A;  4MTG A;  3SZR A;  2CCY A;  2UUH A;  2WVQ A;  2GDC A;  2L81 A;  5BQH A;  4JW1 A;  4AX2 A;  2ZXP A;  5KYX B;  1TQG A;  3LLK A;  3L34 A;  3Q7G A;  3B0V C;  3ITF A;  3GM3 A;  4K1O A;  1YAR O;  4QDL A;  3HTK C;  1LVK A;  2HMQ A;  3DD7 A;  4MS2 A;  4YK5 A;  1TKN A;  2P7V A;  3DAG A;  4YN0 B;  5COF A;  4CBE A;  1BDJ B;  1D1A A;  4K7B A;  1B68 A;  2CGE A;  3S29 A;  3NKD A;  1L3P A;  1T5O A;  1ZHT A;  2F22 A;  4N06 A;  3PHF 2;  1YZC A;  2EPL X;  1Z5Z A;  2Y3D A;  3EH1 A;  3GAN A;  3HKK A;  4IWB A;  3O39 A;  3RKO F;  1IW7 F;  4RD9 A;  3CSK A;  3L1M A;  1ZHY A;  2PX0 A;  2WVN A;  3JRM O;  5KYN A;  1VMA A;  1RCP A;  4YT2 A;  4C3E A;  4DBQ A;  3H65 A;  2JX0 A;  3RQG A;  1NU9 C;  1U0B B;  4P6I C;  3JTL O;  4EBB A;  3R2P A;  5K0I A;  5KYX A;  2XLW A;  2A6H F;  1E2X A;  1RJ9 A;  2VB6 A;  2X51 A;  3K7D A;  4HEA J;  2HSQ A;  3VRC A;  3U8P A;  1L7C A;  1G4W R;  2J9U A;  2LSE A;  2QE9 A;  4IAR A;  3S28 A;  2HUJ A;  4AL0 A;  3FVY A;  4PFP A;  2XL4 A;  4N6H A;  5L0G A;  4DVZ A;  2R25 A;  3AJM A;  4J7T A;  3K1I C;  2R03 A;  4PFO A;  4XEV A;  5JSL A;  1Z6A A;  2KYH A;  3FAJ A;  3L0I A;  3LLI A;  4O6N A;  1O3U A;  1ORY A;  3DMD A;  2XLV A;  3AGU A;  1PV3 A;  3EGD A;  2XL6 A;  4ZLD A;  3C63 A;  2I15 A;  1BZ4 A;  4C3D A;  4I1M A;  3SNH A;  1YYX A;  3TJ5 A;  3EHM A;  4NC3 A;  4XPX A;  4U9E A;  2A0U A;  2YLD A;  4MTO A;  1OCC C;  3NMI A;  2HSB A;  2KC3 A;  2J45 A;  2MHR A;  3LES A;  3JSE O;  3UNG C;  3VAY A;  3K66 A;  3KYI A;  1FTS A;  4CDY A;  1BR2 A;  4JCH A;  1IZM A;  4Q7C A;  1HW2 A;  3ZDL A;  2J9V A;  3GOR A;  1JRA A;  2EIJ C;  3US6 A;  3ZTZ A;  3HLZ A;  1GM5 A;  3Q7L A;  4XEK A;  1VYI A;  3U3B A;  5D92 A;  5KYW B;  1LI5 A;  3WG7 C;  4FAP B;  2NUT B;  3C8G A;  3C8Z A;  3B71 A;  1EQ1 A;  5BQG A;  4CIH A;  1HMO A;  1HY5 A;  3EGX A;  2AU5 A;  1VYK A;  1HE1 A;  1EA8 A;  4LER A;  4LLE A;  4ONS A;  2YKZ A;  3JSZ A;  4E0H A;  5L0F A;  2LCH A;  4XPW A;  5T1D B;  2XXA A;  2J7P A;  1GS9 A;  4WGZ A;  2J46 A;  3I5Q A;  1FFT C;  1MMA A;  5L3V A;  1I4Z A;  2HZ8 A;  3Q6M A;  5AGF A;  4JJF A;  256B A;  3HNI A;  3EG9 A;  4A2N B;  4OD4 A;  5EHH A;  2R7V A;  4FES A;  4KC9 A;  2ETS A;  1LIH A;  1Z23 A;  1GGQ A;  1SYQ A;  2NG1 A;  3EFO B;  4MVO A;  1KU2 A;  4O6M A;  4RDA A;  3T9O A;  1J8M F;  3VF0 A;  3W8I A;  4QI2 A;  4G7O F;  2Y3H A;  2QNL A;  1Y6D A;  3NMJ A;  1UFB A;  4EUK B;  3DKA A;  3OWT A;  4JZA A;  2Z15 A;  2HFI A;  1Z7Q c;  5F5H A;  1RKE B;  3UGO A;  3EPV A;  4AE4 A;  2ZPA A;  3BRJ A;  4Q5S F;  2J9W A;  1H7I A;  1LKX A;  1SMY F;  1WTY A;  1NFN A;  1YJG A;  2QUP A;  3C18 A;  2LFD A;  3DM5 A;  2Y69 C;  3EHN A;  2MYS A;  2V26 A;  2CNW A;  4JCZ A;  2QTV A;  3RQF A;  4BG0 A;  1Q0M A;  2PX3 A;  3O55 A;  1UG7 A;  1A7E A;  3QTH A;  2LD6 A;  2OCC C;  2YL7 A;  4PK4 A;  4YL3 A;  4C7O A;  3C62 A;  3DE9 A;  4ANJ A;  3R7C A;  3MX3 A;  4LLC A;  2PP4 A;  4G7H F;  3ATP A;  1WN0 A;  5A6K A;  2HKV A;  1LM3 B;  5T3T A;  1VTM P;  2Y39 A;  3ZTM A;  1PCX A;  2R9R B;  1PD0 A;  1T6Q A;  1V54 C;  3AQC A;  4KNV A;  4DXW A;  1JAF A;  3TOM A;  4RBN A;  1FR0 A;  2KNH A;  5CIV A;  4YL1 A;  1YYJ A;  3SP1 A;  4E7Z A;  2EIN C;  3T6J A;  1AEP A;  1NLX A;  2J8W A;  2R02 A;  1OCO C;  2YVK A;  2IXO A;  4U5H A;  3GEE A;  2VAS A;  4JVS A;  4WGY A;  5HSW A;  1BR4 A;  2BL2 A;  2EPO A;  3EJN A;  3QZC A;  2YLG A;  4JUR I;  2CYD A;  3OA1 A;  4XWJ A;  3RIP A;  5A6B A;  3ASN C;  3QVY A;  4MVR A;  4Z9H A;  3GWL A;  2R7S A;  1YLM A;  2W4B A;  2EPN A;  1DOV A;  3O6X A;  4BPM A;  5DS6 A;  4XTK A;  1WOL A;  2IYL D;  3HNL A;  4OIO F;  2IXP A;  2A0B A;  2ICW G;  3N24 A;  3TUL A;  4LDQ A;  4MND A;  2HJ3 A;  3EZI A;  1S05 A;  2KW3 C;  3MLG A;  3AGT A;  4U5B E;  1M2V A;  4GYT A;  4ZLC A;  3A11 A;  2R7W A;  4EBK A;  2HV6 A;  1RMV A;  2XRH A;  4YJW A;  5JRA A;  1ZW3 A;  3K1H A;  5T3W A;  3V7O A;  4BJT A;  3ZSU A;  5TJ5 E;  2YRF A;  3FOP A;  1E85 A;  2XLE A;  3LEO A;  3EQL F;  3RYL A;  5KYU B;  1AVO B;  1V4A A;  2Q9A A;  3SXY A;  3TJ6 A;  4U5G A;  5JLI A;  2GFH A;  2YWA A;  3ZQY A;  3NYM A;  4EBJ A;  2RD9 A;  1YVI A;  2OOC A;  5A6B D;  3JCU Q;  3SEO A;  1QKR A;  3KMI A;  3IHU A;  1NFO A;  4PJM A;  5E3C A;  1W2W A;  4MVU A;  2L6F A;  2HJM A;  3F47 A;  2FGY A;  3WOD F;  3AOU A;  3TQO A;  1LI7 A;  2OJE D;  2YL3 A;  3IQC A;  2J0W A;  1M2V B;  2Q4F A;  1A7D A;  3F46 A;  1M57 C;  1G8X A;  3ZVR A;  2KJG A;  2VCC A;  4JJG A;  4DRJ B;  2RSE B;  2A68 F;  2R05 A;  1I4Y A;  4DRI B;  1OW6 A;  2XLO A;  4XLN F;  5JT4 A;  4EWC A;  3TOL A;  5DS4 A;  4MVS A;  2YL0 A;  5B3I A;  2ASR A;  3W2W A;  4U9D A;  5JS5 A;  4CDA A;  5B1A C;  2Q9B A;  2XM4 A;  2YHS A;  3C8G B;  3IQ5 A;  1ZHX A;  2NUT A;  1CPQ A;  1NZE A;  3FOO A;  4FWV A;  1OCZ C;  1O87 A;  4LDR A;  1OW7 A;  3T6G B;  4JC7 A;  1BBH A;  3X2Q C;  3ZG1 A;  4A4A A;  1VB5 A;  1ZHZ A;  1OW8 A;  4K0D A;  2OEX A;  2IM8 A;  2OQM A;  1QQ3 A;  2LK4 A;  2WZL A;  4XEF A;  4AE4 B;  2EIK C;  2IOQ A;  4W8K A;  1Y4C A;  4CDV A;  3LNM B;  4GQH A;  4KNW A;  2R7U A;  2BE5 F;  3LAY A;  3DM9 B;  4IRU A;  3SXK A;  2DI3 A;  2QLA A;  3LUT B;  1LS4 A;  1HW1 A;  1YZA A;  1VLT A;  4NCQ A;  1RKC A;  3NYJ A;  3DJN B;  4JIO A;  3U3F A;  4LAC B;  2XS1 A;  2WZG A;  2XLM A;  2NSF A;  4GEH A;  1ORS C;  1YDI A;  1OCR C;  1OKK D;  1T6U A;  5E3A A;  1GQA A;  2VCB A;  3MFN A;  1QPU A;  2A6E F;  1YAU O;  4YWQ A;  5DS5 A;  2KK1 A;  4E17 A;  3SXM A;  2ZXR A;  3QW1 A;  1JR8 A;  4DRH B;  1Q0F A;  1TWC A;  2PFD A;  4E0I A;  3JYH A;  3MYF A;  1A41 A;  1D0Y A;  4J32 B;  4KBL A;  4XPY A;  2DYS C;  3PCV A;  2OJQ A;  4H54 A;  1CGN A;  3CEX A;  1XWJ A;  3SXZ A;  2R7X A;  1EKY A;  3ASO C;  1MMG A;  2OKU A;  2JD3 A;  4FX5 A;  4PR9 A;  2FAP B;  3LJB A;  1ZHW A;  4W8P A;  1E83 A;  1RJ9 B;  3LNR A;  1FAP B;  1C02 A;  1ZYR F;  4CJG A;  2Q3T A;  3PDM P;  4Q4Z F;  3MBG A;  4CS7 A;  3UR3 C;  3HJC A;  1DOW A;  3IEE A;  1WGW A;  3AG4 C;  2EIL C;  2WL8 A;  3CZ6 A;  3WHN A;  1T01 A;  3HNJ A;  4MVQ A;  4IJJ A;  3ZQV A;  4Z9I A;  1OXB A;  2VC9 A;  4WJ0 A;  3J06 A;  2EPM X;  3RF3 A;  2G62 A;  3DJU B;  3IQ6 A;  3ZWI A;  4YT4 A;  3U9M A;  4CSA C;  1R5I D;  4XQ1 A;  1H6G A;  5EGY A;  2L6H A;  2P0N A;  3ABM C;  2JPU A;  4N4W A;  5COM A;  3S0X A;  2M64 A;  4CS9 C;  5JP7 A;  3DI5 A;  1M2O A;  1ST6 A;  1J8Y F;  2A69 F;  3BEH A;  3FXH A;  2G3V A;  2B0J A;  3KH2 A;  3LS0 A;  1A0B A;  1LE4 A;  3QW0 A;  4OD5 A;  1FMW A;  4UDV A;  3UGP A;  4QI0 A;  2PBE A;  3C7J A;  3POV A;  5BQI A;  1SF8 A;  2XL8 A;  2H7V C;  1JPJ A;  5JUA A;  2BC5 A;  1D0X A;  1I5N A;  1PD1 A;  1SR2 A;  1RXQ A;  3C8G D;  1C17 M;  2P6V A;  3M4B A;  1Z3I X;  2KGO A;  2AP3 A;  1LE2 A;  2W4M A;  4H4K C;  5KYU A;  3W8H A;  5B3S C;  2GAQ A;  4MW3 A;  3U2M A;  1JPN A;  3U8V A;  4CIP A;  3L8J A;  2IXM A;  2R7T A;  2H8A A;  4U5E E;  2I8B A;  4HFF B;  4I3M A;  2WB7 A;  3E70 C;  3M1C B;  4DJ9 A;  3ZC4 A;  1EI7 A;  2WZF A;  1V55 C;  3B9Q A;  1RKE A;  3VM6 A;  2DYR C;  5D91 A;  4CS9 A;  1MMD A;  2IXN A;  3G4X A;  1D1C A;  2OG2 A;  2E87 A;  2YL1 A;  3CAX A;  4G0H A;  4PJJ A;  3RH3 A;  2AWC A;  4EHP A;  4DVY P;  3PMR A;  1A7V A;  2J0X A;  2A1D D;  2CDQ A;  1K05 A;  1MMN A;  3GEH A;  3B29 A;  1K04 A;  2PF4 E;  2OEV A;  2J7P D;  1M6T A;  3WAQ A;  3S9O A;  3CQZ A;  4I1O B;  3T4R A;  3AG1 C;  4BJ6 A;  4PJL A;  1VLS A;  2WVO A;  3KKB A;  1R4T A;  1TWH A;  1ZVZ A;  4JRZ A;  5E2Q A;  2R7R A;  3VYW A;  5DLJ A;  3T6B A;  3K6B A;  5DQZ A;  3A9C A;  3NKE A;  2C04 A;  2GWW A;  5JVE A;  3FMS A;  3AG3 C;  3NYL A;  1T6I A;  2YLI A;  1E86 A;  3TD7 A;  1TFO B;  2HV7 A;  4JTA B;  4CSA A;  4JE9 A;  4YT8 A;  3K33 A;  1N1C A;  3UMH A;  5F28 E;  1MQV A;  1YA7 O;  5KYY B;  1E84 A;  3RW0 A;  4NQF A;  3FHD A;  1FMV A;  1NBB A;  1CPR A;  2KQ9 A;  2R7O A;  3GWN A;  1LS1 A;  3OEO A;  4O7G A;  3EGD B;  3H2U A;  5A6J A;  5L0H A;  5F5F A;  5L0C A;  1G4U S;  1HMD A;  2HS5 A;  4NTB A;  5IY5 C;  1K40 A;  1AUE A;  3SYN A;  4U5D E;  3DE8 A;  3B0U X;  2G3K A;  1JMW A;  2H7O A;  1ZZP A;  2VCA A;  3EZH A;  1WWP A;  1VOM A;  4JTD B;  3M4C A;  2Y3G A;  3S84 A;  4E7S A;  3UMK A;  4P9F A;  4OIQ F;  1F1M A;  1MNE A;  1ORJ A;  1ZU4 A;  2ZD9 A;  3LEV A;  1TWA A;  3ZIB A;  1TR2 A;  1D1B A;  1ZU5 A;  2LP4 A;  3EFO A;  3MYI A;  2NUP B;  3AG2 C;  5KYY A;  4BEJ A;  2Q7R A;  4HE8 D;  1XZQ A;  2UUI A;  3UMI A;  5BUO A;  2AVK A;  5AC4 A;  4JKV A;  1ZW2 A;  2IBF A;  1FFH A;  2L6G A;  4CS8 A;  3U5S A;  4F4B A;  2DGJ A;  2XXA B;  3LS1 A;  4BJ1 A;  3V5X A;  1M56 C;  2C03 A;  4ULW A;  3S90 A;  4XLP F;  1WAS A;  3JRT A;  5KYW A;  3KYJ A;  4JEB A;  4MQ9 F;  4CS8 C;  4C7O B;  4O79 A;  1APC A;  5B1B C;  4NTA A;  3RQE A;  3V5Y A;  2TMV P;  2L7A A;  2B0H A;  2D5R B;  4IAO A;  3G4Z A;  2H7B A;  3DXJ F;  3IQT A;  1FNT c;  4YL0 A;  4NY3 A;  2XSE A;  3FDQ A;  2XM0 A;  1QLE C;  2NUP A;  4G7Z F;  2Y3B A;  2V3C C;  4OIN F;  3EH2 A;  5L3Q A;  2YZS A;  2ZXW C;  3DAF A;  1T9K A;  1XZP A;  3B0P A;  3KPH A;  3M79 A;  3N2Z B;  3QVZ A;  4N6C A;  1U89 A;  3TK0 A;  2J9B A;  3X1O A;  2NPU A;  4IAQ A;  1MND A;  3IPM O;  4MVM A;  4ER9 A;  4BJ5 A;  1G5Z A;  3JYY A;  4OIP F;  4LDK A;  1V74 B;  2ZXO A;  2W9Y A;  3QMK A;  5FCL A;  2D4U A;  2XLD A;  2LIG A;  2XS8 A;  4CX9 A;  2M4E A;  1S7Z A;  1JOG A;  3RVZ A;  3H2V A;  2O9X A;  1KNY A;  2PNO A; 
#chains in the Genus database with same CATH homology
 2XL6 A;  3C63 A;  4ULV A;  1YYX A;  4CDV A;  4NC3 A;  4U9E A;  4D4X A;  2YL1 A;  2YLD A;  2YL3 A;  1A7V A;  3NMI A;  4JEA A;  4CDY A;  1M6T A;  2XLO A;  3ZTZ A;  5JT4 A;  3TOL A;  2YL0 A;  4IB4 A;  5B3I A;  5JS5 A;  4U9D A;  4CDA A;  2XM4 A;  3IQ5 A;  4CJO A;  1CPQ A;  4EIY A;  3FOO A;  5JVE A;  3HNK A;  2YLI A;  1BBH A;  1E86 A;  2YKZ A;  4D4N A;  4JE9 A;  4WGZ A;  1QQ3 A;  5AGF A;  256B A;  3HNI A;  1MQV A;  4L6R A;  3NMK A;  1E84 A;  2QLA A;  1YZA A;  1NBB A;  1CPR A;  2XLH A;  2XLM A;  3NMJ A;  1GQA A;  3DE8 A;  3M15 A;  1QPU A;  3M4C A;  3QW1 A;  1CGO A;  2YL7 A;  3C62 A;  3DE9 A;  2CCY A;  1CGN A;  1EKY A;  1LM3 B;  3ZTM A;  1E83 A;  1JAF A;  3TOM A;  4CJG A;  1YYJ A;  4JKV A;  2J8W A;  3HNJ A;  4WGY A;  3ZQV A;  1YZC A;  3ZWI A;  3IQ6 A;  2YLG A;  3L1M A;  4JEB A;  3QVY A;  1APC A;  1RCP A;  4N4W A;  3HNL A;  5JP7 A;  1S05 A;  2XLW A;  2XM0 A;  3QW0 A;  3VRC A;  3U8P A;  2XL8 A;  3M79 A;  3QVZ A;  5JRA A;  5JUA A;  2J9B A;  2BC5 A;  4IAR A;  4IAQ A;  4N6H A;  4ER9 A;  3FOP A;  5JSL A;  3M4B A;  1E85 A;  2XLE A;  5JLI A;  2XLD A;  4CX9 A;  4CIP A;  2XLV A;  3ZQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...