1LM3B

A multi-generation analysis of cytochrome b562 redox variants: evolutionary strategies for modulating redox potential revealed using a library approach
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDIRHGYDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYHQKYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A multigeneration analysis of cytochrome b(562) redox variants: evolutionary strategies for modulating redox potential revealed using a library approach.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Electron transport
molecule keywords SOLUBLE CYTOCHROME B562
total genus 47
structure length 106
sequence length 106
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 1lm3B00
3FOPA 4CJOA 3ZQYA 5B3IA 4U9EA 3NMKA 3QVYA 1QQ3A 2J8WA 3HNJA 2BC5A 4U9DA 4L6RA 4N4WA 3C63A 2YKZA 2J9BA 3M4CA 2XLDA 4JE9A 3ZTZA 2XL8A 3HNKA 2YL7A 2YLIA 2YL0A 4IAQA 3HNIA 3DE9A 4WGZA 4ER9A 3IQ6A 1E86A 3U8PA 2YL1A 2XLOA 4ULVA 1E85A 4N6HA 5JSLA 4CX9A 4CJGA 3L1MA 4JEAA 4CDYA 4JEBA 5JRAA 4CIPA 3IQ5A 4IB4A 3NMIA 3QW0A 1CPRA 4EIYA 3FOOA 3NMJA 5JT4A 3QVZA 1LM3B 3M4BA 1YYXA 1A7VA 4CDVA 1RCPA 3M15A 3TOMA 2XM0A 2XLWA 1APCA 1CGNA 2YLGA 1NBBA 2XLVA 3HNLA 1YYJA 1CPQA 2XLEA 1E84A 2XLHA 2CCYA 2YL3A 5JS5A 5JLIA 1CGOA 1S05A 4WGYA 3TOLA 3ZTMA 1YZCA 3DE8A 3QW1A 4D4XA 4D4NA 1GQAA 2XM4A 1BBHA 2QLAA 3ZQVA 3VRCA 2YLDA 4IARA 1MQVA 256BA 1E83A 1QPUA 4JKVA 5JVEA 2XLMA 3ZWIA 1EKYA 4NC3A 1JAFA 3C62A 5JUAA 1YZAA 3M79A 1M6TA 5AGFA 4CDAA 2XL6A 5JP7A
chains in the Genus database with same CATH superfamily
1Z63A 1JOGA 2QTVA 3IHUA 5A6KA 2UUHA 5B3IA 3RQGA 1HMDA 3LS0A 1SZIA 3MYFA 4YT4A 3IQCA 5L0JA 1Y4CA 4C7OB 1OW6A 2GDCA 1LIHA 1TWHA 2G3KA 1RJ9B 2A1DD 1AEPA 4JZAA 1TWCA 2H8AA 3HNJA 3N0TA 4Z9JA 2KK1A 4YL3A 2BC5A 3CSKA 3US6A 2YVKA 4L6RA 1I5NA 2CW0F 2WVNA 2R7SA 3C63A 4JURI 1K04A 3AOUA 3ABKC 3JZ0A 2L6GA 2H7VC 2XLDA 3M4CA 2R03A 2EPKX 1O3UA 2LCHA 3B29A 3X1OA 4CSAA 2P6VA 1NU9C 2ZD9A 4JCHA 2FFHA 3R2PA 2HZ8A 4PFPA 4K1OA 3RQFA 2YL7A 3AG3C 4Q7CA 2YLIA 1VB5A 3NDBB 3EZHA 4IAQA 4BJ1A 3HNIA 1HE1A 3G50A 1UG7A 2PX3A 3VYWA 4ER9A 4E17A 5B1BC 2Q9BA 2I8BA 3LUTB 4J30B 1T5OA 1MMDA 3Q7LA 3T9OA 5JSLA 4XEVA 3K1IC 4CJGA 2IXOA 3JYYA 2Y3BA 4MVOA 3ABMC 1OQCA 1H6GA 4XWJA 5COGA 3TULA 5JRAA 4YT8A 4OIPF 2J0WA 1MNEA 3DMDA 3IQ5A 4JTAB 3G4XA 4CIPA 2J9WA 5KYXB 3ASOC 3ZDLA 2J0XA 4H4KC 4PJLA 2KYHA 3A9CA 3RVZA 1K40A 5KYYA 2J7PA 2R7QA 3FOOA 2CYDA 2IXNA 3NMJA 2UUIA 3RF3A 2HUJA 3S28A 4AX2A 2A6EF 3IPMO 4PR9A 3FXHA 1O87A 1FTSA 1S7ZA 3GEHA 2NPUA 2W4MA 3LESA 4IJJA 5KYYB 2NSGA 5HSWA 4UDVA 5DLJA 4BPMA 5L0CA 1N1CA 1ZHYA 2FGYA 1ZHWA 2GAQA 3GM1A 5T3WA 4NTAA 3SNHA 3T4RA 3EGDA 4E18A 1TQGA 2PF4E 2X51A 5A6BD 1IZMA 3AJMA 5A6JA 4WJ0A 1Z7Qc 3TD7A 3Q6MA 1A0BA 1APCA 2RSEB 4OINF 3JSZA 3HTKC 2R7UA 3ZVRA 2EINC 1NBBA 2XLVA 3NKDA 2LIGA 3QZCA 2EPOA 3EJNA 4G7OF 2QNLA 1E84A 1ORJA 3U0CA 1BR1A 4PJNA 2EPNA 3J06A 2W45A 4DXWA 3B0VC 3U2LA 3I4UA 4PACA 3F46A 3K7DA 3A11A 4WGYA 2KW3C 1H9GA 2PX0A 1PD0A 1PCXA 3QMKA 3WODF 2TMVP 1YZCA 4KBLA 4ONSA 4CIHA 3QW1A 2YWAA 2R05A 4JVSA 3UNGC 1G4US 4D4NA 2KGOA 4XLPF 4H54A 4RD9A 1YDIA 3V5XA 2W9YA 1L7CA 1ZHXA 2W4BA 3AGUA 3FHDA 3K33A 4JRZA 3VRCA 2OG2A 2YLDA 1FFHA 4PK4A 4A2NB 4QI2A 5BQIA 1QLEC 1DOVA 3LS1A 5L3QA 2Y3HA 1PD1A 2AVKA 4CS9A 4MVQA 3DI5A 3L34A 3ZWIA 2A69F 2VH3A 4YK5A 4I1OB 2D5RB 1KU2A 2XS8A 3MBGA 2V3CC 1L3PA 4IAOA 5F28E 4JTCB 1YZAA 4HFFB 2OJQA 4OD5A 2RD9A 3G4ZA 3M79A 4YN0B 1GM5A 1Z5ZA 4DBQA 3MFNA 4JC7A 3AG4C 4CDAA 3U9MA 5A6AA 3C8GD 1MNDA 2HS5A 4I1MA 1OCCC 1JPNA 5IY5C 4A4AA 4G7HF 2IM8A 1BZ4A 4MW3A 3AQCA 2J8WA 3U8VA 4MS2A 2IYLD 3WG7C 4FAPB 4E7ZA 1V74B 2NUPB 2A0BA 3JRTA 3VM6A 2YKZA 1A7EA 5BQHA 2H7BA 2AWCA 3FAJA 1MMGA 1TFOB 3H2UA 3K1HA 4JE9A 4QI0A 1NU7D 1JR8A 1Q0KA 1J8YF 2L9JA 3AG1C 4PFOA 3DWWA 2XL8A 2R7WA 3KKBA 1ZVZA 5D92A 2HV6A 1KTMA 3HNKA 2BL2A 4JCZA 4MTGA 2IBFA 1LE4A 5E3AA 3S27A 2KNHA 2A0UA 4WGZA 3DE9A 4YL1A 3JTLO 1XZPA 4GQHA 1I4ZA 3AG2C 3U9JA 4ULVA 2R7TA 1YA9A 1LI5A 4FWVA 3DD7A 4ANJA 3O10A 2VB6A 2ZXPA 3JT1A 4U5GA 3EGXB 4FX5A 1OXBA 3NYJA 3C8ZA 1SYQA 5E33A 4CDYA 1M2VB 1LE2A 1MMNA 4IB4A 3S0XA 1UFBA 3QW0A 3SXYA 3EGXA 1QVXA 1CPRA 3B0PA 3TQOA 5L3VA 1D0XA 3SP1A 4DRJB 4U5CE 3LEVA 4EBBA 5KYUB 2OEVA 5KYWB 2A6HF 1XZQA 2YZSA 3T6JA 1M56C 2CNWA 3OWTA 3JRMO 3QVZA 4QDLA 2HV7A 4DOZA 2R7OA 5GPGB 4X0RA 3GEIA 2CNWD 4W8KA 4Q5SF 4G7ZF 1FR0A 4C3EA 4CDVA 4XPXA 5BUOA 3EPVA 4N06A 2XXAA 1OKKA 3GM3A 1ST6A 1KNYA 3MYIA 4HFKB 4JJGA 3C7JA 5EHHA 2JPUA 4IWBA 2XLWA 2NUPA 1OCOC 2VCAA 4HEAJ 1PV3A 1DOWA 1Y6DA 2HMZA 2P7VA 3RH3A 3PMRA 2NG1A 5L0DA 2XLEA 3NRHA 2CCYA 5JLIA 4U5EE 1EI7A 1S05A 4BEMJ 1MMAA 3JYHA 2F22A 3EHMA 3S9OA 5DQTA 4ZLDA 1OXKA 1T9KA 4DRHB 3TJ5A 4DVZA 1ZU4A 1RMVA 4O79A 4RDAA 5F5FA 1D0YA 3EH2A 4MVMA 1I4YA 4DVYP 1NG1A 2C03A 2Q4FA 4YT5A 2L6FA 1HW2A 2XSEA 2HMQA 3SEOA 2EPMX 2VCBA 3GODA 1D1BA 2XS1A 5KYUA 1FAPB 1HY5A 3DJNB 2YEVA 4I3MA 2LSEA 1J8MF 3O39A 3QTHA 1VTMP 3RQEA 2OEXA 1HE9A 3C62A 4NY3A 2PP4A 3DJUB 3OA1A 4LLEA 4OIQF 3NYMA 1LS1A 4BEJA 3EQLF 1RKEB 3C8GA 3N2ZB 1ORSC 4P9TA 2NUTB 1FFTC 2P61A 1Q0DA 2J7PD 1HW1A 5FZTA 2YRFA 2ZPAA 4CJOA 3LEOA 4U9EA 3VF0A 3NMKA 4I44A 4DBRA 1YAUO 2FAPB 1QQ3A 3QVYA 3B0UX 3B9QA 2LFDA 2WZLA 2XXAB 2LD6A 3Q7GA 3U5SA 4CSAC 5COFA 2B0HA 3I5QA 1WASA 4U9DA 2OQMA 2J9VA 5D91A 3GANA 1T6IA 4MVZA 2VCCA 2J9BA 5T3TA 3S84A 1R5ID 1ZHZA 1AUEA 3EZIA 4AE4A 3FMSA 3ZTZA 2WL8A 4ZLCA 2Y3DA 5CI8A 2M4EA 2AU5A 3V5ZA 3KL4A 4C3DA 2NUTA 4XTKA 4XEFA 5TJ5E 5DVWA 3RFYA 4BJ5C 1YLMA 2OJED 2ETSA 2LFFA 4CBEA 2YHSA 1E86A 4XQ1A 2A68F 2YL1A 2XLOA 4U5DE 2R7VA 3W4YA 2GFHA 4N6HA 3NYLA 1LKXA 2I15A 3C8GB 4CX9A 1LPEA 3L1MA 4MTOA 2EPLX 4CS8C 1U6HA 2MYSA 1T6UA 4JEBA 4NTFA 2Y39A 1K05A 3RVYA 4C7OA 4EHPA 2DGJA 1WWPA 3K1IA 3ABLC 4J7TA 4YJWA 3CZ6A 5AC5A 5HV9A 5K0IA 1NFNA 2IXMA 2L6HA 4Z9HA 2PNOA 3KMIA 3FVYA 4NCQA 4EIYA 1M57C 4LDRA 4JW1A 2WVQA 4MQ9F 4EWCA 3WAQA 5JT4A 3DM5A 3M1CB 2GA0A 3U3FA 1BDJB 3M4BA 1ZW3A 1E2XA 1YYXA 3JSEO 4ULWA 3H65A 2MHRA 2O9XA 3IQTA 4BJTA 1FNTc 3UMHA 1VLSA 1ZYRF 2H7OA 1RKEA 1RCPA 1JMWA 1QSPA 4O6YA 1O5HA 3GM2A 3M15A 1Z23A 3SZRA 1U89A 1ORYA 3TOMA 2D4UA 4EBKA 5DS4A 4BJ5A 1YARO 4O7GA 3ZSUA 5KYNA 2XL4A 3LNMB 3RIPA 1CGNA 2GWWA 2P0NA 3AGTA 1OR2A 1SMYF 4MTFA 3SXZA 1TR2A 2HFIA 1WGWA 3HKKA 3LLKA 1YYJA 2L7AA 1CPQA 3EFOA 2R25A 4YT2A 2HJ3A 3PCVA 4P9FA 3EG9B 4XEKA 2Q9CA 2IXPA 2MWQA 2R9RB 3KYIA 2XLHA 2YL3A 2EIKC 3OEOA 3ZG1A 4O6MA 2DI3A 1OW8A 4CS9C 1CGOA 2PFDA 3ZC4A 2CDQA 3GEEA 1OW7A 2KSFA 3RYLA 4G0HA 3TOLA 5CI9A 3U2MA 4BJ6C 3DE8A 3DAGA 3HLZA 3NG1A 4W8PA 4D4XA 5E2QA 1GQAA 2KC3A 4K7BA 2XM4A 3GWLA 2HSQA 2LK4A 4GYTA 3RKOF 1FMWA 2WZGA 4JJFA 2C04A 3KYJA 1G5ZA 5EK0A 3KPHA 4XLNF 1WATA 5DS5A 1QPUA 4JKVA 4KI2A 4WABA 4LLCA 3E9VA 4CS7A 2NSFA 2XLMA 3NKEA 1RKCA 3TJ6A 1H9TA 1GGQA 1TFKB 4AL1A 3E70C 2HJMA 4HE8D 4R32A 5F5HA 3O6XA 2Y3GA 4Q4ZF 1F1MA 5JUAA 4O6NA 4OD4A 3B71A 3I5PA 4PJJA 5L0GA 3X2QC 1AVOB 2Q3TA 3ECSA 1VYKA 3L8JA 1Q0MA 3UGOA 5E3CA 3U3BA 1Z6AA 4IRUA 4KNWA 1M2OA 4K0DA 2E87A 1NZEA 1Q0FA 4MNDA 3FOPA 3K6BA 1ZW2A 1HMOA 3ZQYA 3SXMA 3SYNA 1WOLA 1CGME 4AK9A 3W8HA 4C3BA 3N24A 4EKWA 3IEEA 2QUPA 2Y69C 1TWGA 4LERA 4XPWA 4AE4B 4F4BA 5AC4A 3MLGA 2QE9A 2HKVA 4JTDB 4BJ6A 3EGDB 1V54C 4MVUA 2V26A 2EILC 3W2WA 3Q6NA 5B1AC 2LP4A 4N4WA 3POVA 4E7SA 1QKRA 1IW7F 2DYRC 3FAPB 4MVRA 1ZZPA 3DM9B 3EH1A 4MW8A 2OCCC 2AP3A 3CQZA 3W8IA 3EFOB 5T1DB 1V4AA 4LACB 1C17M 1SR2A 1T6QA 3O55A 4KNVA 3RW0A 5BQGA 1GS9A 2YQYA 1VOMA 2DYSC 2ASRA 2JX0A 2YL0A 2L81A 3LLIA 4OIOF 3HJCA 3IQ6A 4M63A 2OOCA 2ZXWC 3U8PA 1ZU5A 1C03A 1OCRC 4U5BE 2OKUA 2X0CA 1D0ZA 1NSGB 3BRJA 1E85A 3CEXA 3K66A 4EUKB 5DS6A 5L0FA 3JCUQ 4JEAA 1W2WA 4LDQA 5L0HA 2JD3A 1Q0GA 4LDKA 4XPYA 1VK5A 3WHNA 3NMIA 4GEHA 3BEHA 2Q00A 1EA8A 2HSBA 3DXJF 3KH2A 5L0IA 1BR2A 1JRAA 1OCZC 1TKNA 2LQGA 1R4TA 1YJGA 3L0IA 3S29A 4AL0A 3DAFA 3LAYA 1NLXA 1LS4A 4RBNA 4BG0A 2B0JA 2KJGA 5A69A 1QZXA 1LM3B 1FMVA 1ZHTA 3EHNA 2R7RA 3AQBA 3L8IA 3T6BA 1NFOA 1A7VA 2M64A 2WZFA 2XRHA 1JPJA 1A7DA 3H2VA 1VLTA 3GORA 3LJBA 2EIMC 1WTYA 4PJMA 1RJ9A 4JIOA 4U5HA 3T6GB 1G8XA 3R7CA 2R7XA 2XM0A 1VMAA 2VC9A 3GWNA 4B6IA 5B3SC 1XWJA 2ZXOA 4DRIB 2AWYA 4KC9A 2QY9A 2EIJC 5CIVA 2P1AA 3ASNC 2R02A 2YLGA 4U5FE 3ATPA 3VAYA 2ZXRA 3W2VA 3MX3A 4FESA 3PDMP 3HNLA 4E0IA 4NTBA 1C02A 2OU6A 2PBEA 2WB7A 3CAXA 2J46A 1U0BB 1A41A 2DB4A 4MVSA 1TWAA 4NQFA 2KQ9A 3TK0A 3ZIBA 5JS5A 1D1AA 2ICWG 2Z15A 4J7YA 2WVOA 1BR4A 3ITFA 3UGPA 5DQZA 2G62A 4OIRF 1V55C 3UR3C 1G4WR 4DJ9A 4YWQA 3ZTMA 1EQ1A 3EG9A 5KYWA 4CS8A 1D1CA 4IGGA 4Z9IA 2VASA 1YA7O 1YVIA 3V7OA 1RXQA 3DKAA 2IOQA 1BBHA 2Q9AA 3SXKA 3FDQA 2QLAA 4EBJA 5EGYA 3ZQVA 3S90A 2Q7RA 4YL0A 4IARA 1MQVA 3UMKA 256BA 5KYXA 1E83A 2CGEA 1T01A 1OR3A 1M2VA 5COMA 4P6IC 3V5YA 1LI7A 1Z3IX 3UMIA 5JVEA 1EKYA 1B68A 3DZAA 4G78A 4N6CA 1SF8A 3LNRA 1WN0A 1LVKA 3C18A 3F47A 4E0HA 5FCLA 2J45A 2J9UA 4NC3A 1JAFA 1VYIA 2G3VA 1H7IA 1M6TA 5AGFA 5A6BA 1OKKD 2XL6A 4J32B 5JP7A 3PHF2 2BE5F
chains in the Genus database with same CATH topology
3FOPA 4CJOA 3ZQYA 5B3IA 4U9EA 3NMKA 3QVYA 1QQ3A 2J8WA 3HNJA 2BC5A 4U9DA 4L6RA 4N4WA 3C63A 2YKZA 2J9BA 3M4CA 2XLDA 4JE9A 3ZTZA 2XL8A 3HNKA 2YL7A 2YLIA 2YL0A 4IAQA 3HNIA 3DE9A 4WGZA 4ER9A 3IQ6A 1E86A 3U8PA 2YL1A 2XLOA 4ULVA 1E85A 4N6HA 5JSLA 4CX9A 4CJGA 3L1MA 4JEAA 4CDYA 4JEBA 5JRAA 4CIPA 3IQ5A 4IB4A 3NMIA 3QW0A 1CPRA 4EIYA 3FOOA 3NMJA 5JT4A 3QVZA 1LM3B 3M4BA 1YYXA 1A7VA 4CDVA 1RCPA 3M15A 3TOMA 2XM0A 2XLWA 1APCA 1CGNA 2YLGA 1NBBA 2XLVA 3HNLA 1YYJA 1CPQA 2XLEA 1E84A 2XLHA 2CCYA 2YL3A 5JS5A 5JLIA 1CGOA 1S05A 4WGYA 3TOLA 3ZTMA 1YZCA 3DE8A 3QW1A 4D4XA 4D4NA 1GQAA 2XM4A 1BBHA 2QLAA 3ZQVA 3VRCA 2YLDA 4IARA 1MQVA 256BA 1E83A 1QPUA 4JKVA 5JVEA 2XLMA 3ZWIA 1EKYA 4NC3A 1JAFA 3C62A 5JUAA 1YZAA 3M79A 1M6TA 5AGFA 4CDAA 2XL6A 5JP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FOP A;  4CJO A;  3ZQY A;  5B3I A;  4U9E A;  3NMK A;  3QVY A;  1QQ3 A;  2J8W A;  3HNJ A;  2BC5 A;  4U9D A;  4L6R A;  4N4W A;  3C63 A;  2YKZ A;  2J9B A;  3M4C A;  2XLD A;  4JE9 A;  3ZTZ A;  2XL8 A;  3HNK A;  2YL7 A;  2YLI A;  2YL0 A;  4IAQ A;  3HNI A;  3DE9 A;  4WGZ A;  4ER9 A;  3IQ6 A;  1E86 A;  3U8P A;  2YL1 A;  2XLO A;  4ULV A;  1E85 A;  4N6H A;  5JSL A;  4CX9 A;  4CJG A;  3L1M A;  4JEA A;  4CDY A;  4JEB A;  5JRA A;  4CIP A;  3IQ5 A;  4IB4 A;  3NMI A;  3QW0 A;  1CPR A;  4EIY A;  3FOO A;  3NMJ A;  5JT4 A;  3QVZ A;  1LM3 B;  3M4B A;  1YYX A;  1A7V A;  4CDV A;  1RCP A;  3M15 A;  3TOM A;  2XM0 A;  2XLW A;  1APC A;  1CGN A;  2YLG A;  1NBB A;  2XLV A;  3HNL A;  1YYJ A;  1CPQ A;  2XLE A;  1E84 A;  2XLH A;  2CCY A;  2YL3 A;  5JS5 A;  5JLI A;  1CGO A;  1S05 A;  4WGY A;  3TOL A;  3ZTM A;  1YZC A;  3DE8 A;  3QW1 A;  4D4X A;  4D4N A;  1GQA A;  2XM4 A;  1BBH A;  2QLA A;  3ZQV A;  3VRC A;  2YLD A;  4IAR A;  1MQV A;  256B A;  1E83 A;  1QPU A;  4JKV A;  5JVE A;  2XLM A;  3ZWI A;  1EKY A;  4NC3 A;  1JAF A;  3C62 A;  5JUA A;  1YZA A;  3M79 A;  1M6T A;  5AGF A;  4CDA A;  2XL6 A;  5JP7 A; 
#chains in the Genus database with same CATH topology
 1Z63 A;  1JOG A;  2QTV A;  3IHU A;  5A6K A;  2UUH A;  5B3I A;  3RQG A;  1HMD A;  3LS0 A;  1SZI A;  3MYF A;  4YT4 A;  3IQC A;  5L0J A;  1Y4C A;  4C7O B;  1OW6 A;  2GDC A;  1LIH A;  1TWH A;  2G3K A;  1RJ9 B;  2A1D D;  1AEP A;  4JZA A;  1TWC A;  2H8A A;  3HNJ A;  3N0T A;  4Z9J A;  2KK1 A;  4YL3 A;  2BC5 A;  3CSK A;  3US6 A;  2YVK A;  4L6R A;  1I5N A;  2CW0 F;  2WVN A;  2R7S A;  3C63 A;  4JUR I;  1K04 A;  3AOU A;  3ABK C;  3JZ0 A;  2L6G A;  2H7V C;  2XLD A;  3M4C A;  2R03 A;  2EPK X;  1O3U A;  2LCH A;  3B29 A;  3X1O A;  4CSA A;  2P6V A;  1NU9 C;  2ZD9 A;  4JCH A;  2FFH A;  3R2P A;  2HZ8 A;  4PFP A;  4K1O A;  3RQF A;  2YL7 A;  3AG3 C;  4Q7C A;  2YLI A;  1VB5 A;  3NDB B;  3EZH A;  4IAQ A;  4BJ1 A;  3HNI A;  1HE1 A;  3G50 A;  1UG7 A;  2PX3 A;  3VYW A;  4ER9 A;  4E17 A;  5B1B C;  2Q9B A;  2I8B A;  3LUT B;  4J30 B;  1T5O A;  1MMD A;  3Q7L A;  3T9O A;  5JSL A;  4XEV A;  3K1I C;  4CJG A;  2IXO A;  3JYY A;  2Y3B A;  4MVO A;  3ABM C;  1OQC A;  1H6G A;  4XWJ A;  5COG A;  3TUL A;  5JRA A;  4YT8 A;  4OIP F;  2J0W A;  1MNE A;  3DMD A;  3IQ5 A;  4JTA B;  3G4X A;  4CIP A;  2J9W A;  5KYX B;  3ASO C;  3ZDL A;  2J0X A;  4H4K C;  4PJL A;  2KYH A;  3A9C A;  3RVZ A;  1K40 A;  5KYY A;  2J7P A;  2R7Q A;  3FOO A;  2CYD A;  2IXN A;  3NMJ A;  2UUI A;  3RF3 A;  2HUJ A;  3S28 A;  4AX2 A;  2A6E F;  3IPM O;  4PR9 A;  3FXH A;  1O87 A;  1FTS A;  1S7Z A;  3GEH A;  2NPU A;  2W4M A;  3LES A;  4IJJ A;  5KYY B;  2NSG A;  5HSW A;  4UDV A;  5DLJ A;  4BPM A;  5L0C A;  1N1C A;  1ZHY A;  2FGY A;  1ZHW A;  2GAQ A;  3GM1 A;  5T3W A;  4NTA A;  3SNH A;  3T4R A;  3EGD A;  4E18 A;  1TQG A;  2PF4 E;  2X51 A;  5A6B D;  1IZM A;  3AJM A;  5A6J A;  4WJ0 A;  1Z7Q c;  3TD7 A;  3Q6M A;  1A0B A;  1APC A;  2RSE B;  4OIN F;  3JSZ A;  3HTK C;  2R7U A;  3ZVR A;  2EIN C;  1NBB A;  2XLV A;  3NKD A;  2LIG A;  3QZC A;  2EPO A;  3EJN A;  4G7O F;  2QNL A;  1E84 A;  1ORJ A;  3U0C A;  1BR1 A;  4PJN A;  2EPN A;  3J06 A;  2W45 A;  4DXW A;  3B0V C;  3U2L A;  3I4U A;  4PAC A;  3F46 A;  3K7D A;  3A11 A;  4WGY A;  2KW3 C;  1H9G A;  2PX0 A;  1PD0 A;  1PCX A;  3QMK A;  3WOD F;  2TMV P;  1YZC A;  4KBL A;  4ONS A;  4CIH A;  3QW1 A;  2YWA A;  2R05 A;  4JVS A;  3UNG C;  1G4U S;  4D4N A;  2KGO A;  4XLP F;  4H54 A;  4RD9 A;  1YDI A;  3V5X A;  2W9Y A;  1L7C A;  1ZHX A;  2W4B A;  3AGU A;  3FHD A;  3K33 A;  4JRZ A;  3VRC A;  2OG2 A;  2YLD A;  1FFH A;  4PK4 A;  4A2N B;  4QI2 A;  5BQI A;  1QLE C;  1DOV A;  3LS1 A;  5L3Q A;  2Y3H A;  1PD1 A;  2AVK A;  4CS9 A;  4MVQ A;  3DI5 A;  3L34 A;  3ZWI A;  2A69 F;  2VH3 A;  4YK5 A;  4I1O B;  2D5R B;  1KU2 A;  2XS8 A;  3MBG A;  2V3C C;  1L3P A;  4IAO A;  5F28 E;  4JTC B;  1YZA A;  4HFF B;  2OJQ A;  4OD5 A;  2RD9 A;  3G4Z A;  3M79 A;  4YN0 B;  1GM5 A;  1Z5Z A;  4DBQ A;  3MFN A;  4JC7 A;  3AG4 C;  4CDA A;  3U9M A;  5A6A A;  3C8G D;  1MND A;  2HS5 A;  4I1M A;  1OCC C;  1JPN A;  5IY5 C;  4A4A A;  4G7H F;  2IM8 A;  1BZ4 A;  4MW3 A;  3AQC A;  2J8W A;  3U8V A;  4MS2 A;  2IYL D;  3WG7 C;  4FAP B;  4E7Z A;  1V74 B;  2NUP B;  2A0B A;  3JRT A;  3VM6 A;  2YKZ A;  1A7E A;  5BQH A;  2H7B A;  2AWC A;  3FAJ A;  1MMG A;  1TFO B;  3H2U A;  3K1H A;  4JE9 A;  4QI0 A;  1NU7 D;  1JR8 A;  1Q0K A;  1J8Y F;  2L9J A;  3AG1 C;  4PFO A;  3DWW A;  2XL8 A;  2R7W A;  3KKB A;  1ZVZ A;  5D92 A;  2HV6 A;  1KTM A;  3HNK A;  2BL2 A;  4JCZ A;  4MTG A;  2IBF A;  1LE4 A;  5E3A A;  3S27 A;  2KNH A;  2A0U A;  4WGZ A;  3DE9 A;  4YL1 A;  3JTL O;  1XZP A;  4GQH A;  1I4Z A;  3AG2 C;  3U9J A;  4ULV A;  2R7T A;  1YA9 A;  1LI5 A;  4FWV A;  3DD7 A;  4ANJ A;  3O10 A;  2VB6 A;  2ZXP A;  3JT1 A;  4U5G A;  3EGX B;  4FX5 A;  1OXB A;  3NYJ A;  3C8Z A;  1SYQ A;  5E33 A;  4CDY A;  1M2V B;  1LE2 A;  1MMN A;  4IB4 A;  3S0X A;  1UFB A;  3QW0 A;  3SXY A;  3EGX A;  1QVX A;  1CPR A;  3B0P A;  3TQO A;  5L3V A;  1D0X A;  3SP1 A;  4DRJ B;  4U5C E;  3LEV A;  4EBB A;  5KYU B;  2OEV A;  5KYW B;  2A6H F;  1XZQ A;  2YZS A;  3T6J A;  1M56 C;  2CNW A;  3OWT A;  3JRM O;  3QVZ A;  4QDL A;  2HV7 A;  4DOZ A;  2R7O A;  5GPG B;  4X0R A;  3GEI A;  2CNW D;  4W8K A;  4Q5S F;  4G7Z F;  1FR0 A;  4C3E A;  4CDV A;  4XPX A;  5BUO A;  3EPV A;  4N06 A;  2XXA A;  1OKK A;  3GM3 A;  1ST6 A;  1KNY A;  3MYI A;  4HFK B;  4JJG A;  3C7J A;  5EHH A;  2JPU A;  4IWB A;  2XLW A;  2NUP A;  1OCO C;  2VCA A;  4HEA J;  1PV3 A;  1DOW A;  1Y6D A;  2HMZ A;  2P7V A;  3RH3 A;  3PMR A;  2NG1 A;  5L0D A;  2XLE A;  3NRH A;  2CCY A;  5JLI A;  4U5E E;  1EI7 A;  1S05 A;  4BEM J;  1MMA A;  3JYH A;  2F22 A;  3EHM A;  3S9O A;  5DQT A;  4ZLD A;  1OXK A;  1T9K A;  4DRH B;  3TJ5 A;  4DVZ A;  1ZU4 A;  1RMV A;  4O79 A;  4RDA A;  5F5F A;  1D0Y A;  3EH2 A;  4MVM A;  1I4Y A;  4DVY P;  1NG1 A;  2C03 A;  2Q4F A;  4YT5 A;  2L6F A;  1HW2 A;  2XSE A;  2HMQ A;  3SEO A;  2EPM X;  2VCB A;  3GOD A;  1D1B A;  2XS1 A;  5KYU A;  1FAP B;  1HY5 A;  3DJN B;  2YEV A;  4I3M A;  2LSE A;  1J8M F;  3O39 A;  3QTH A;  1VTM P;  3RQE A;  2OEX A;  1HE9 A;  3C62 A;  4NY3 A;  2PP4 A;  3DJU B;  3OA1 A;  4LLE A;  4OIQ F;  3NYM A;  1LS1 A;  4BEJ A;  3EQL F;  1RKE B;  3C8G A;  3N2Z B;  1ORS C;  4P9T A;  2NUT B;  1FFT C;  2P61 A;  1Q0D A;  2J7P D;  1HW1 A;  5FZT A;  2YRF A;  2ZPA A;  4CJO A;  3LEO A;  4U9E A;  3VF0 A;  3NMK A;  4I44 A;  4DBR A;  1YAU O;  2FAP B;  1QQ3 A;  3QVY A;  3B0U X;  3B9Q A;  2LFD A;  2WZL A;  2XXA B;  2LD6 A;  3Q7G A;  3U5S A;  4CSA C;  5COF A;  2B0H A;  3I5Q A;  1WAS A;  4U9D A;  2OQM A;  2J9V A;  5D91 A;  3GAN A;  1T6I A;  4MVZ A;  2VCC A;  2J9B A;  5T3T A;  3S84 A;  1R5I D;  1ZHZ A;  1AUE A;  3EZI A;  4AE4 A;  3FMS A;  3ZTZ A;  2WL8 A;  4ZLC A;  2Y3D A;  5CI8 A;  2M4E A;  2AU5 A;  3V5Z A;  3KL4 A;  4C3D A;  2NUT A;  4XTK A;  4XEF A;  5TJ5 E;  5DVW A;  3RFY A;  4BJ5 C;  1YLM A;  2OJE D;  2ETS A;  2LFF A;  4CBE A;  2YHS A;  1E86 A;  4XQ1 A;  2A68 F;  2YL1 A;  2XLO A;  4U5D E;  2R7V A;  3W4Y A;  2GFH A;  4N6H A;  3NYL A;  1LKX A;  2I15 A;  3C8G B;  4CX9 A;  1LPE A;  3L1M A;  4MTO A;  2EPL X;  4CS8 C;  1U6H A;  2MYS A;  1T6U A;  4JEB A;  4NTF A;  2Y39 A;  1K05 A;  3RVY A;  4C7O A;  4EHP A;  2DGJ A;  1WWP A;  3K1I A;  3ABL C;  4J7T A;  4YJW A;  3CZ6 A;  5AC5 A;  5HV9 A;  5K0I A;  1NFN A;  2IXM A;  2L6H A;  4Z9H A;  2PNO A;  3KMI A;  3FVY A;  4NCQ A;  4EIY A;  1M57 C;  4LDR A;  4JW1 A;  2WVQ A;  4MQ9 F;  4EWC A;  3WAQ A;  5JT4 A;  3DM5 A;  3M1C B;  2GA0 A;  3U3F A;  1BDJ B;  3M4B A;  1ZW3 A;  1E2X A;  1YYX A;  3JSE O;  4ULW A;  3H65 A;  2MHR A;  2O9X A;  3IQT A;  4BJT A;  1FNT c;  3UMH A;  1VLS A;  1ZYR F;  2H7O A;  1RKE A;  1RCP A;  1JMW A;  1QSP A;  4O6Y A;  1O5H A;  3GM2 A;  3M15 A;  1Z23 A;  3SZR A;  1U89 A;  1ORY A;  3TOM A;  2D4U A;  4EBK A;  5DS4 A;  4BJ5 A;  1YAR O;  4O7G A;  3ZSU A;  5KYN A;  2XL4 A;  3LNM B;  3RIP A;  1CGN A;  2GWW A;  2P0N A;  3AGT A;  1OR2 A;  1SMY F;  4MTF A;  3SXZ A;  1TR2 A;  2HFI A;  1WGW A;  3HKK A;  3LLK A;  1YYJ A;  2L7A A;  1CPQ A;  3EFO A;  2R25 A;  4YT2 A;  2HJ3 A;  3PCV A;  4P9F A;  3EG9 B;  4XEK A;  2Q9C A;  2IXP A;  2MWQ A;  2R9R B;  3KYI A;  2XLH A;  2YL3 A;  2EIK C;  3OEO A;  3ZG1 A;  4O6M A;  2DI3 A;  1OW8 A;  4CS9 C;  1CGO A;  2PFD A;  3ZC4 A;  2CDQ A;  3GEE A;  1OW7 A;  2KSF A;  3RYL A;  4G0H A;  3TOL A;  5CI9 A;  3U2M A;  4BJ6 C;  3DE8 A;  3DAG A;  3HLZ A;  3NG1 A;  4W8P A;  4D4X A;  5E2Q A;  1GQA A;  2KC3 A;  4K7B A;  2XM4 A;  3GWL A;  2HSQ A;  2LK4 A;  4GYT A;  3RKO F;  1FMW A;  2WZG A;  4JJF A;  2C04 A;  3KYJ A;  1G5Z A;  5EK0 A;  3KPH A;  4XLN F;  1WAT A;  5DS5 A;  1QPU A;  4JKV A;  4KI2 A;  4WAB A;  4LLC A;  3E9V A;  4CS7 A;  2NSF A;  2XLM A;  3NKE A;  1RKC A;  3TJ6 A;  1H9T A;  1GGQ A;  1TFK B;  4AL1 A;  3E70 C;  2HJM A;  4HE8 D;  4R32 A;  5F5H A;  3O6X A;  2Y3G A;  4Q4Z F;  1F1M A;  5JUA A;  4O6N A;  4OD4 A;  3B71 A;  3I5P A;  4PJJ A;  5L0G A;  3X2Q C;  1AVO B;  2Q3T A;  3ECS A;  1VYK A;  3L8J A;  1Q0M A;  3UGO A;  5E3C A;  3U3B A;  1Z6A A;  4IRU A;  4KNW A;  1M2O A;  4K0D A;  2E87 A;  1NZE A;  1Q0F A;  4MND A;  3FOP A;  3K6B A;  1ZW2 A;  1HMO A;  3ZQY A;  3SXM A;  3SYN A;  1WOL A;  1CGM E;  4AK9 A;  3W8H A;  4C3B A;  3N24 A;  4EKW A;  3IEE A;  2QUP A;  2Y69 C;  1TWG A;  4LER A;  4XPW A;  4AE4 B;  4F4B A;  5AC4 A;  3MLG A;  2QE9 A;  2HKV A;  4JTD B;  4BJ6 A;  3EGD B;  1V54 C;  4MVU A;  2V26 A;  2EIL C;  3W2W A;  3Q6N A;  5B1A C;  2LP4 A;  4N4W A;  3POV A;  4E7S A;  1QKR A;  1IW7 F;  2DYR C;  3FAP B;  4MVR A;  1ZZP A;  3DM9 B;  3EH1 A;  4MW8 A;  2OCC C;  2AP3 A;  3CQZ A;  3W8I A;  3EFO B;  5T1D B;  1V4A A;  4LAC B;  1C17 M;  1SR2 A;  1T6Q A;  3O55 A;  4KNV A;  3RW0 A;  5BQG A;  1GS9 A;  2YQY A;  1VOM A;  2DYS C;  2ASR A;  2JX0 A;  2YL0 A;  2L81 A;  3LLI A;  4OIO F;  3HJC A;  3IQ6 A;  4M63 A;  2OOC A;  2ZXW C;  3U8P A;  1ZU5 A;  1C03 A;  1OCR C;  4U5B E;  2OKU A;  2X0C A;  1D0Z A;  1NSG B;  3BRJ A;  1E85 A;  3CEX A;  3K66 A;  4EUK B;  5DS6 A;  5L0F A;  3JCU Q;  4JEA A;  1W2W A;  4LDQ A;  5L0H A;  2JD3 A;  1Q0G A;  4LDK A;  4XPY A;  1VK5 A;  3WHN A;  3NMI A;  4GEH A;  3BEH A;  2Q00 A;  1EA8 A;  2HSB A;  3DXJ F;  3KH2 A;  5L0I A;  1BR2 A;  1JRA A;  1OCZ C;  1TKN A;  2LQG A;  1R4T A;  1YJG A;  3L0I A;  3S29 A;  4AL0 A;  3DAF A;  3LAY A;  1NLX A;  1LS4 A;  4RBN A;  4BG0 A;  2B0J A;  2KJG A;  5A69 A;  1QZX A;  1LM3 B;  1FMV A;  1ZHT A;  3EHN A;  2R7R A;  3AQB A;  3L8I A;  3T6B A;  1NFO A;  1A7V A;  2M64 A;  2WZF A;  2XRH A;  1JPJ A;  1A7D A;  3H2V A;  1VLT A;  3GOR A;  3LJB A;  2EIM C;  1WTY A;  4PJM A;  1RJ9 A;  4JIO A;  4U5H A;  3T6G B;  1G8X A;  3R7C A;  2R7X A;  2XM0 A;  1VMA A;  2VC9 A;  3GWN A;  4B6I A;  5B3S C;  1XWJ A;  2ZXO A;  4DRI B;  2AWY A;  4KC9 A;  2QY9 A;  2EIJ C;  5CIV A;  2P1A A;  3ASN C;  2R02 A;  2YLG A;  4U5F E;  3ATP A;  3VAY A;  2ZXR A;  3W2V A;  3MX3 A;  4FES A;  3PDM P;  3HNL A;  4E0I A;  4NTB A;  1C02 A;  2OU6 A;  2PBE A;  2WB7 A;  3CAX A;  2J46 A;  1U0B B;  1A41 A;  2DB4 A;  4MVS A;  1TWA A;  4NQF A;  2KQ9 A;  3TK0 A;  3ZIB A;  5JS5 A;  1D1A A;  2ICW G;  2Z15 A;  4J7Y A;  2WVO A;  1BR4 A;  3ITF A;  3UGP A;  5DQZ A;  2G62 A;  4OIR F;  1V55 C;  3UR3 C;  1G4W R;  4DJ9 A;  4YWQ A;  3ZTM A;  1EQ1 A;  3EG9 A;  5KYW A;  4CS8 A;  1D1C A;  4IGG A;  4Z9I A;  2VAS A;  1YA7 O;  1YVI A;  3V7O A;  1RXQ A;  3DKA A;  2IOQ A;  1BBH A;  2Q9A A;  3SXK A;  3FDQ A;  2QLA A;  4EBJ A;  5EGY A;  3ZQV A;  3S90 A;  2Q7R A;  4YL0 A;  4IAR A;  1MQV A;  3UMK A;  256B A;  5KYX A;  1E83 A;  2CGE A;  1T01 A;  1OR3 A;  1M2V A;  5COM A;  4P6I C;  3V5Y A;  1LI7 A;  1Z3I X;  3UMI A;  5JVE A;  1EKY A;  1B68 A;  3DZA A;  4G78 A;  4N6C A;  1SF8 A;  3LNR A;  1WN0 A;  1LVK A;  3C18 A;  3F47 A;  4E0H A;  5FCL A;  2J45 A;  2J9U A;  4NC3 A;  1JAF A;  1VYI A;  2G3V A;  1H7I A;  1M6T A;  5AGF A;  5A6B A;  1OKK D;  2XL6 A;  4J32 B;  5JP7 A;  3PHF 2;  2BE5 F; 
#chains in the Genus database with same CATH homology
 3FOP A;  4CJO A;  3ZQY A;  5B3I A;  4U9E A;  3NMK A;  3QVY A;  1QQ3 A;  2J8W A;  3HNJ A;  2BC5 A;  4U9D A;  4L6R A;  4N4W A;  3C63 A;  2YKZ A;  2J9B A;  3M4C A;  2XLD A;  4JE9 A;  3ZTZ A;  2XL8 A;  3HNK A;  2YL7 A;  2YLI A;  2YL0 A;  4IAQ A;  3HNI A;  3DE9 A;  4WGZ A;  4ER9 A;  3IQ6 A;  1E86 A;  3U8P A;  2YL1 A;  2XLO A;  4ULV A;  1E85 A;  4N6H A;  5JSL A;  4CX9 A;  4CJG A;  3L1M A;  4JEA A;  4CDY A;  4JEB A;  5JRA A;  4CIP A;  3IQ5 A;  4IB4 A;  3NMI A;  3QW0 A;  1CPR A;  4EIY A;  3FOO A;  3NMJ A;  5JT4 A;  3QVZ A;  1LM3 B;  3M4B A;  1YYX A;  1A7V A;  4CDV A;  1RCP A;  3M15 A;  3TOM A;  2XM0 A;  2XLW A;  1APC A;  1CGN A;  2YLG A;  1NBB A;  2XLV A;  3HNL A;  1YYJ A;  1CPQ A;  2XLE A;  1E84 A;  2XLH A;  2CCY A;  2YL3 A;  5JS5 A;  5JLI A;  1CGO A;  1S05 A;  4WGY A;  3TOL A;  3ZTM A;  1YZC A;  3DE8 A;  3QW1 A;  4D4X A;  4D4N A;  1GQA A;  2XM4 A;  1BBH A;  2QLA A;  3ZQV A;  3VRC A;  2YLD A;  4IAR A;  1MQV A;  256B A;  1E83 A;  1QPU A;  4JKV A;  5JVE A;  2XLM A;  3ZWI A;  1EKY A;  4NC3 A;  1JAF A;  3C62 A;  5JUA A;  1YZA A;  3M79 A;  1M6T A;  5AGF A;  4CDA A;  2XL6 A;  5JP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...